(data stored in ACNUC1104 zone)

EMBL: FN806773

ID   FN806773; SV 1; circular; genomic DNA; STD; PRO; 2616384 BP.
XX
AC   FN806773;
XX
PR   Project:PRJEA46291;
XX
DT   26-MAY-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1, complete
DE   genome
XX
KW   complete genome.
XX
OS   Propionibacterium freudenreichii subsp. shermanii CIRM-BIA1
OC   Bacteria; Actinobacteria; Propionibacteriales; Propionibacteriaceae;
OC   Propionibacterium.
XX
RN   [1]
RP   1-2616384
RA   Loux V.;
RT   ;
RL   Submitted (06-APR-2010) to the INSDC.
RL   Loux V., I.N.R.A, Unite MIG, Domaine de Vilvert, 78352 Jouy en Josas Cedex,
RL   FRANCE.
XX
RN   [2]
RX   DOI; 10.1371/journal.pone.0011748.
RX   PUBMED; 20668525.
RA   Falentin H., Deutsch S.M., Jan G., Loux V., Thierry A., Parayre S.,
RA   Maillard M.B., Dherbecourt J., Cousin F.J., Jardin J., Siguier P.,
RA   Couloux A., Barbe V., Vacherie B., Wincker P., Gibrat J.F., Gaillardin C.,
RA   Lortal S.;
RT   "The complete genome of Propionibacterium freudenreichii CIRM-BIA1, a hardy
RT   actinobacterium with food and probiotic applications";
RL   PLoS One 5(7):e11748-e11748(2010).
XX
DR   MD5; c92bd1f2f51783eaf5ad284899134493.
DR   BioSample; SAMEA2272304.
DR   EnsemblGenomes-Gn; EBG00000006232.
DR   EnsemblGenomes-Gn; EBG00000006234.
DR   EnsemblGenomes-Gn; EBG00000006235.
DR   EnsemblGenomes-Gn; EBG00000006237.
DR   EnsemblGenomes-Gn; EBG00000006238.
DR   EnsemblGenomes-Gn; EBG00000006239.
DR   EnsemblGenomes-Gn; EBG00001165074.
DR   EnsemblGenomes-Gn; EBG00001165075.
DR   EnsemblGenomes-Gn; EBG00001165076.
DR   EnsemblGenomes-Gn; EBG00001165077.
DR   EnsemblGenomes-Gn; EBG00001165078.
DR   EnsemblGenomes-Gn; EBG00001165079.
DR   EnsemblGenomes-Gn; EBG00001165080.
DR   EnsemblGenomes-Gn; EBG00001165081.
DR   EnsemblGenomes-Gn; EBG00001165082.
DR   EnsemblGenomes-Gn; EBG00001165083.
DR   EnsemblGenomes-Gn; EBG00001165084.
DR   EnsemblGenomes-Gn; EBG00001165085.
DR   EnsemblGenomes-Gn; EBG00001165086.
DR   EnsemblGenomes-Gn; EBG00001165087.
DR   EnsemblGenomes-Gn; EBG00001165088.
DR   EnsemblGenomes-Gn; EBG00001165089.
DR   EnsemblGenomes-Gn; EBG00001165090.
DR   EnsemblGenomes-Gn; EBG00001165091.
DR   EnsemblGenomes-Gn; EBG00001165092.
DR   EnsemblGenomes-Gn; EBG00001165093.
DR   EnsemblGenomes-Gn; EBG00001165094.
DR   EnsemblGenomes-Gn; EBG00001165095.
DR   EnsemblGenomes-Gn; EBG00001165096.
DR   EnsemblGenomes-Gn; EBG00001165097.
DR   EnsemblGenomes-Gn; EBG00001165098.
DR   EnsemblGenomes-Gn; EBG00001165099.
DR   EnsemblGenomes-Gn; EBG00001165100.
DR   EnsemblGenomes-Gn; EBG00001165101.
DR   EnsemblGenomes-Gn; EBG00001165102.
DR   EnsemblGenomes-Gn; EBG00001165103.
DR   EnsemblGenomes-Gn; EBG00001165104.
DR   EnsemblGenomes-Gn; EBG00001165105.
DR   EnsemblGenomes-Gn; EBG00001165106.
DR   EnsemblGenomes-Gn; EBG00001165107.
DR   EnsemblGenomes-Gn; EBG00001165108.
DR   EnsemblGenomes-Gn; EBG00001165109.
DR   EnsemblGenomes-Gn; EBG00001165110.
DR   EnsemblGenomes-Gn; EBG00001165111.
DR   EnsemblGenomes-Gn; EBG00001165112.
DR   EnsemblGenomes-Gn; EBG00001165113.
DR   EnsemblGenomes-Gn; EBG00001165114.
DR   EnsemblGenomes-Gn; EBG00001165115.
DR   EnsemblGenomes-Gn; EBG00001165116.
DR   EnsemblGenomes-Gn; EBG00001165117.
DR   EnsemblGenomes-Gn; EBG00001165118.
DR   EnsemblGenomes-Gn; EBG00001165119.
DR   EnsemblGenomes-Gn; EBG00001165120.
DR   EnsemblGenomes-Gn; EBG00001165121.
DR   EnsemblGenomes-Gn; EBG00001165122.
DR   EnsemblGenomes-Gn; EBG00001165123.
DR   EnsemblGenomes-Gn; EBG00001165124.
DR   EnsemblGenomes-Gn; EBG00001165125.
DR   EnsemblGenomes-Gn; EBG00001165126.
DR   EnsemblGenomes-Gn; EBG00001165127.
DR   EnsemblGenomes-Gn; EBG00001165128.
DR   EnsemblGenomes-Gn; EBG00001165129.
DR   EnsemblGenomes-Gn; PFREUD_00230.
DR   EnsemblGenomes-Gn; PFREUD_00270.
DR   EnsemblGenomes-Gn; PFREUD_00950.
DR   EnsemblGenomes-Gn; PFREUD_01160.
DR   EnsemblGenomes-Gn; PFREUD_01230.
DR   EnsemblGenomes-Gn; PFREUD_01240.
DR   EnsemblGenomes-Gn; PFREUD_01480.
DR   EnsemblGenomes-Gn; PFREUD_01520.
DR   EnsemblGenomes-Gn; PFREUD_01530.
DR   EnsemblGenomes-Gn; PFREUD_01990.
DR   EnsemblGenomes-Gn; PFREUD_02000.
DR   EnsemblGenomes-Gn; PFREUD_02380.
DR   EnsemblGenomes-Gn; PFREUD_03050.
DR   EnsemblGenomes-Gn; PFREUD_03740.
DR   EnsemblGenomes-Gn; PFREUD_04220.
DR   EnsemblGenomes-Gn; PFREUD_04820.
DR   EnsemblGenomes-Gn; PFREUD_04830.
DR   EnsemblGenomes-Gn; PFREUD_04840.
DR   EnsemblGenomes-Gn; PFREUD_04870.
DR   EnsemblGenomes-Gn; PFREUD_04900.
DR   EnsemblGenomes-Gn; PFREUD_05400.
DR   EnsemblGenomes-Gn; PFREUD_05430.
DR   EnsemblGenomes-Gn; PFREUD_05440.
DR   EnsemblGenomes-Gn; PFREUD_05500.
DR   EnsemblGenomes-Gn; PFREUD_06570.
DR   EnsemblGenomes-Gn; PFREUD_06580.
DR   EnsemblGenomes-Gn; PFREUD_06650.
DR   EnsemblGenomes-Gn; PFREUD_07190.
DR   EnsemblGenomes-Gn; PFREUD_07780.
DR   EnsemblGenomes-Gn; PFREUD_07820.
DR   EnsemblGenomes-Gn; PFREUD_07880.
DR   EnsemblGenomes-Gn; PFREUD_07910.
DR   EnsemblGenomes-Gn; PFREUD_08190.
DR   EnsemblGenomes-Gn; PFREUD_08200.
DR   EnsemblGenomes-Gn; PFREUD_08580.
DR   EnsemblGenomes-Gn; PFREUD_09560.
DR   EnsemblGenomes-Gn; PFREUD_10020.
DR   EnsemblGenomes-Gn; PFREUD_10090.
DR   EnsemblGenomes-Gn; PFREUD_10110.
DR   EnsemblGenomes-Gn; PFREUD_10310.
DR   EnsemblGenomes-Gn; PFREUD_10790.
DR   EnsemblGenomes-Gn; PFREUD_10800.
DR   EnsemblGenomes-Gn; PFREUD_11060.
DR   EnsemblGenomes-Gn; PFREUD_11110.
DR   EnsemblGenomes-Gn; PFREUD_11120.
DR   EnsemblGenomes-Gn; PFREUD_11230.
DR   EnsemblGenomes-Gn; PFREUD_11240.
DR   EnsemblGenomes-Gn; PFREUD_12050.
DR   EnsemblGenomes-Gn; PFREUD_12150.
DR   EnsemblGenomes-Gn; PFREUD_12450.
DR   EnsemblGenomes-Gn; PFREUD_12470.
DR   EnsemblGenomes-Gn; PFREUD_12480.
DR   EnsemblGenomes-Gn; PFREUD_12490.
DR   EnsemblGenomes-Gn; PFREUD_12650.
DR   EnsemblGenomes-Gn; PFREUD_12660.
DR   EnsemblGenomes-Gn; PFREUD_12870.
DR   EnsemblGenomes-Gn; PFREUD_12880.
DR   EnsemblGenomes-Gn; PFREUD_13300.
DR   EnsemblGenomes-Gn; PFREUD_13310.
DR   EnsemblGenomes-Gn; PFREUD_14160.
DR   EnsemblGenomes-Gn; PFREUD_15160.
DR   EnsemblGenomes-Gn; PFREUD_15380.
DR   EnsemblGenomes-Gn; PFREUD_16620.
DR   EnsemblGenomes-Gn; PFREUD_16650.
DR   EnsemblGenomes-Gn; PFREUD_16660.
DR   EnsemblGenomes-Gn; PFREUD_17280.
DR   EnsemblGenomes-Gn; PFREUD_17430.
DR   EnsemblGenomes-Gn; PFREUD_17950.
DR   EnsemblGenomes-Gn; PFREUD_17970.
DR   EnsemblGenomes-Gn; PFREUD_18080.
DR   EnsemblGenomes-Gn; PFREUD_18500.
DR   EnsemblGenomes-Gn; PFREUD_19330.
DR   EnsemblGenomes-Gn; PFREUD_19340.
DR   EnsemblGenomes-Gn; PFREUD_19380.
DR   EnsemblGenomes-Gn; PFREUD_19700.
DR   EnsemblGenomes-Gn; PFREUD_19770.
DR   EnsemblGenomes-Gn; PFREUD_19780.
DR   EnsemblGenomes-Gn; PFREUD_20490.
DR   EnsemblGenomes-Gn; PFREUD_21030.
DR   EnsemblGenomes-Gn; PFREUD_21710.
DR   EnsemblGenomes-Gn; PFREUD_21720.
DR   EnsemblGenomes-Gn; PFREUD_21750.
DR   EnsemblGenomes-Gn; PFREUD_22520.
DR   EnsemblGenomes-Gn; PFREUD_22530.
DR   EnsemblGenomes-Gn; PFREUD_22540.
DR   EnsemblGenomes-Gn; PFREUD_22610.
DR   EnsemblGenomes-Gn; PFREUD_22620.
DR   EnsemblGenomes-Gn; PFREUD_22640.
DR   EnsemblGenomes-Gn; PFREUD_22820.
DR   EnsemblGenomes-Gn; PFREUD_23110.
DR   EnsemblGenomes-Gn; PFREUD_23120.
DR   EnsemblGenomes-Gn; PFREUD_23370.
DR   EnsemblGenomes-Gn; PFREUD_23540.
DR   EnsemblGenomes-Gn; PFREUD_23560.
DR   EnsemblGenomes-Gn; PFREUD_23570.
DR   EnsemblGenomes-Gn; PFREUD_23660.
DR   EnsemblGenomes-Gn; PFREUD_24180.
DR   EnsemblGenomes-Gn; PFREUD_24300.
DR   EnsemblGenomes-Gn; PFREUD_24310.
DR   EnsemblGenomes-Gn; PFREUD_24370.
DR   EnsemblGenomes-Gn; PFREUD_24380.
DR   EnsemblGenomes-Gn; PFREUD_24390.
DR   EnsemblGenomes-Gn; PFREUD_24540.
DR   EnsemblGenomes-Gn; PFREUD_24550.
DR   EnsemblGenomes-Gn; PFREUD_24570.
DR   EnsemblGenomes-Gn; PFREUD_24690.
DR   EnsemblGenomes-Gn; PFREUD_24700.
DR   EnsemblGenomes-Gn; PFREUD_24810.
DR   EnsemblGenomes-Gn; PFREUD_25010.
DR   EnsemblGenomes-Tr; EBG00000006232-1.
DR   EnsemblGenomes-Tr; EBG00000006234-1.
DR   EnsemblGenomes-Tr; EBG00000006235-1.
DR   EnsemblGenomes-Tr; EBG00000006237-1.
DR   EnsemblGenomes-Tr; EBG00000006238-1.
DR   EnsemblGenomes-Tr; EBG00000006239-1.
DR   EnsemblGenomes-Tr; EBT00001732032.
DR   EnsemblGenomes-Tr; EBT00001732033.
DR   EnsemblGenomes-Tr; EBT00001732034.
DR   EnsemblGenomes-Tr; EBT00001732035.
DR   EnsemblGenomes-Tr; EBT00001732036.
DR   EnsemblGenomes-Tr; EBT00001732037.
DR   EnsemblGenomes-Tr; EBT00001732038.
DR   EnsemblGenomes-Tr; EBT00001732039.
DR   EnsemblGenomes-Tr; EBT00001732040.
DR   EnsemblGenomes-Tr; EBT00001732041.
DR   EnsemblGenomes-Tr; EBT00001732042.
DR   EnsemblGenomes-Tr; EBT00001732043.
DR   EnsemblGenomes-Tr; EBT00001732044.
DR   EnsemblGenomes-Tr; EBT00001732045.
DR   EnsemblGenomes-Tr; EBT00001732046.
DR   EnsemblGenomes-Tr; EBT00001732047.
DR   EnsemblGenomes-Tr; EBT00001732048.
DR   EnsemblGenomes-Tr; EBT00001732049.
DR   EnsemblGenomes-Tr; EBT00001732050.
DR   EnsemblGenomes-Tr; EBT00001732051.
DR   EnsemblGenomes-Tr; EBT00001732052.
DR   EnsemblGenomes-Tr; EBT00001732053.
DR   EnsemblGenomes-Tr; EBT00001732054.
DR   EnsemblGenomes-Tr; EBT00001732055.
DR   EnsemblGenomes-Tr; EBT00001732056.
DR   EnsemblGenomes-Tr; EBT00001732057.
DR   EnsemblGenomes-Tr; EBT00001732058.
DR   EnsemblGenomes-Tr; EBT00001732059.
DR   EnsemblGenomes-Tr; EBT00001732060.
DR   EnsemblGenomes-Tr; EBT00001732061.
DR   EnsemblGenomes-Tr; EBT00001732062.
DR   EnsemblGenomes-Tr; EBT00001732063.
DR   EnsemblGenomes-Tr; EBT00001732064.
DR   EnsemblGenomes-Tr; EBT00001732065.
DR   EnsemblGenomes-Tr; EBT00001732066.
DR   EnsemblGenomes-Tr; EBT00001732067.
DR   EnsemblGenomes-Tr; EBT00001732068.
DR   EnsemblGenomes-Tr; EBT00001732069.
DR   EnsemblGenomes-Tr; EBT00001732070.
DR   EnsemblGenomes-Tr; EBT00001732071.
DR   EnsemblGenomes-Tr; EBT00001732072.
DR   EnsemblGenomes-Tr; EBT00001732073.
DR   EnsemblGenomes-Tr; EBT00001732074.
DR   EnsemblGenomes-Tr; EBT00001732075.
DR   EnsemblGenomes-Tr; EBT00001732076.
DR   EnsemblGenomes-Tr; EBT00001732077.
DR   EnsemblGenomes-Tr; EBT00001732078.
DR   EnsemblGenomes-Tr; EBT00001732079.
DR   EnsemblGenomes-Tr; EBT00001732080.
DR   EnsemblGenomes-Tr; EBT00001732081.
DR   EnsemblGenomes-Tr; EBT00001732082.
DR   EnsemblGenomes-Tr; EBT00001732083.
DR   EnsemblGenomes-Tr; EBT00001732084.
DR   EnsemblGenomes-Tr; EBT00001732085.
DR   EnsemblGenomes-Tr; EBT00001732086.
DR   EnsemblGenomes-Tr; EBT00001732087.
DR   EnsemblGenomes-Tr; PFREUD_00230-1.
DR   EnsemblGenomes-Tr; PFREUD_00270.
DR   EnsemblGenomes-Tr; PFREUD_00950.
DR   EnsemblGenomes-Tr; PFREUD_01160.
DR   EnsemblGenomes-Tr; PFREUD_01230.
DR   EnsemblGenomes-Tr; PFREUD_01240.
DR   EnsemblGenomes-Tr; PFREUD_01480-1.
DR   EnsemblGenomes-Tr; PFREUD_01520-1.
DR   EnsemblGenomes-Tr; PFREUD_01530-1.
DR   EnsemblGenomes-Tr; PFREUD_01990.
DR   EnsemblGenomes-Tr; PFREUD_02000.
DR   EnsemblGenomes-Tr; PFREUD_02380.
DR   EnsemblGenomes-Tr; PFREUD_03050-1.
DR   EnsemblGenomes-Tr; PFREUD_03740-1.
DR   EnsemblGenomes-Tr; PFREUD_04220-1.
DR   EnsemblGenomes-Tr; PFREUD_04820-1.
DR   EnsemblGenomes-Tr; PFREUD_04830-1.
DR   EnsemblGenomes-Tr; PFREUD_04840-1.
DR   EnsemblGenomes-Tr; PFREUD_04870.
DR   EnsemblGenomes-Tr; PFREUD_04900-1.
DR   EnsemblGenomes-Tr; PFREUD_05400-1.
DR   EnsemblGenomes-Tr; PFREUD_05430-1.
DR   EnsemblGenomes-Tr; PFREUD_05440-1.
DR   EnsemblGenomes-Tr; PFREUD_05500-1.
DR   EnsemblGenomes-Tr; PFREUD_06570.
DR   EnsemblGenomes-Tr; PFREUD_06580.
DR   EnsemblGenomes-Tr; PFREUD_06650.
DR   EnsemblGenomes-Tr; PFREUD_07190.
DR   EnsemblGenomes-Tr; PFREUD_07780-1.
DR   EnsemblGenomes-Tr; PFREUD_07820-1.
DR   EnsemblGenomes-Tr; PFREUD_07880-1.
DR   EnsemblGenomes-Tr; PFREUD_07910-1.
DR   EnsemblGenomes-Tr; PFREUD_08190-1.
DR   EnsemblGenomes-Tr; PFREUD_08200-1.
DR   EnsemblGenomes-Tr; PFREUD_08580-1.
DR   EnsemblGenomes-Tr; PFREUD_09560-1.
DR   EnsemblGenomes-Tr; PFREUD_10020-1.
DR   EnsemblGenomes-Tr; PFREUD_10090.
DR   EnsemblGenomes-Tr; PFREUD_10110.
DR   EnsemblGenomes-Tr; PFREUD_10310-1.
DR   EnsemblGenomes-Tr; PFREUD_10790.
DR   EnsemblGenomes-Tr; PFREUD_10800.
DR   EnsemblGenomes-Tr; PFREUD_11060-1.
DR   EnsemblGenomes-Tr; PFREUD_11110.
DR   EnsemblGenomes-Tr; PFREUD_11120.
DR   EnsemblGenomes-Tr; PFREUD_11230.
DR   EnsemblGenomes-Tr; PFREUD_11240.
DR   EnsemblGenomes-Tr; PFREUD_12050-1.
DR   EnsemblGenomes-Tr; PFREUD_12150-1.
DR   EnsemblGenomes-Tr; PFREUD_12450-1.
DR   EnsemblGenomes-Tr; PFREUD_12470-1.
DR   EnsemblGenomes-Tr; PFREUD_12480-1.
DR   EnsemblGenomes-Tr; PFREUD_12490-1.
DR   EnsemblGenomes-Tr; PFREUD_12650.
DR   EnsemblGenomes-Tr; PFREUD_12660.
DR   EnsemblGenomes-Tr; PFREUD_12870.
DR   EnsemblGenomes-Tr; PFREUD_12880.
DR   EnsemblGenomes-Tr; PFREUD_13300-1.
DR   EnsemblGenomes-Tr; PFREUD_13310-1.
DR   EnsemblGenomes-Tr; PFREUD_14160-1.
DR   EnsemblGenomes-Tr; PFREUD_15160.
DR   EnsemblGenomes-Tr; PFREUD_15380-1.
DR   EnsemblGenomes-Tr; PFREUD_16620.
DR   EnsemblGenomes-Tr; PFREUD_16650.
DR   EnsemblGenomes-Tr; PFREUD_16660.
DR   EnsemblGenomes-Tr; PFREUD_17280-1.
DR   EnsemblGenomes-Tr; PFREUD_17430-1.
DR   EnsemblGenomes-Tr; PFREUD_17950.
DR   EnsemblGenomes-Tr; PFREUD_17970-1.
DR   EnsemblGenomes-Tr; PFREUD_18080-1.
DR   EnsemblGenomes-Tr; PFREUD_18500-1.
DR   EnsemblGenomes-Tr; PFREUD_19330.
DR   EnsemblGenomes-Tr; PFREUD_19340.
DR   EnsemblGenomes-Tr; PFREUD_19380-1.
DR   EnsemblGenomes-Tr; PFREUD_19700-1.
DR   EnsemblGenomes-Tr; PFREUD_19770.
DR   EnsemblGenomes-Tr; PFREUD_19780.
DR   EnsemblGenomes-Tr; PFREUD_20490-1.
DR   EnsemblGenomes-Tr; PFREUD_21030.
DR   EnsemblGenomes-Tr; PFREUD_21710.
DR   EnsemblGenomes-Tr; PFREUD_21720.
DR   EnsemblGenomes-Tr; PFREUD_21750.
DR   EnsemblGenomes-Tr; PFREUD_22520.
DR   EnsemblGenomes-Tr; PFREUD_22530.
DR   EnsemblGenomes-Tr; PFREUD_22540.
DR   EnsemblGenomes-Tr; PFREUD_22610.
DR   EnsemblGenomes-Tr; PFREUD_22620.
DR   EnsemblGenomes-Tr; PFREUD_22640.
DR   EnsemblGenomes-Tr; PFREUD_22820.
DR   EnsemblGenomes-Tr; PFREUD_23110.
DR   EnsemblGenomes-Tr; PFREUD_23120.
DR   EnsemblGenomes-Tr; PFREUD_23370.
DR   EnsemblGenomes-Tr; PFREUD_23540.
DR   EnsemblGenomes-Tr; PFREUD_23560.
DR   EnsemblGenomes-Tr; PFREUD_23570.
DR   EnsemblGenomes-Tr; PFREUD_23660-1.
DR   EnsemblGenomes-Tr; PFREUD_24180.
DR   EnsemblGenomes-Tr; PFREUD_24300.
DR   EnsemblGenomes-Tr; PFREUD_24310.
DR   EnsemblGenomes-Tr; PFREUD_24370.
DR   EnsemblGenomes-Tr; PFREUD_24380.
DR   EnsemblGenomes-Tr; PFREUD_24390.
DR   EnsemblGenomes-Tr; PFREUD_24540.
DR   EnsemblGenomes-Tr; PFREUD_24550.
DR   EnsemblGenomes-Tr; PFREUD_24570.
DR   EnsemblGenomes-Tr; PFREUD_24690.
DR   EnsemblGenomes-Tr; PFREUD_24700.
DR   EnsemblGenomes-Tr; PFREUD_24810.
DR   EnsemblGenomes-Tr; PFREUD_25010.
DR   EuropePMC; PMC2909200; 20668525.
DR   EuropePMC; PMC3534718; 23083487.
DR   EuropePMC; PMC3772855; 24058439.
DR   EuropePMC; PMC4437456; 25886522.
DR   EuropePMC; PMC4916054; 27358740.
DR   EuropePMC; PMC5340759; 28337185.
DR   EuropePMC; PMC6107788; 30174657.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FN806773.
DR   SILVA-SSU; FN806773.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2616384
FT                   /organism="Propionibacterium freudenreichii subsp.
FT                   shermanii CIRM-BIA1"
FT                   /sub_species="shermanii"
FT                   /strain="CIRM-B1AI"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:754252"
FT   CDS_pept        241..1707
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="PFREUD_00010"
FT                   /product="Chromosomal replication initiator protein"
FT                   /function="3.1 DNA replication"
FT                   /note="DnaA, ATPase involved in DNA replication initiation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55501"
FT                   /db_xref="GOA:D7GHC9"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHC9"
FT                   /inference="similar to AA sequence:Uniprot:DNAA_PROAC"
FT                   /protein_id="CBL55501.1"
FT                   /translation="MTRATDSAQGAPDLPDAWKHVLSDFGGRDKAYLRGAKALTVHEST
FT                   VMIAVPNDYTRENIESKLRDTIESRLSDVYHREMRLAITVEPSLELDLRPPERDEEAER
FT                   EVEPVQFIPRQDAPAPSLRAVETPQPASAESADDTAIADGRLNPRYTFDNFVIGSSNRF
FT                   AHAAAVAVAEAPGKAYNPLMIYGESGLGKTHLLHALGHYVRNYYSNVRVKYVSTEEMTN
FT                   EFINAVGENRTAEFRRKYRDDVDVLLIDDIQFLEGKTQTQEEFFYTFNALHNAQRQIVL
FT                   TSDRPPKALEQLESRLRSRFEWGLITDIQPPDPETRIAILQRKAAADNLSVPPGVLEFI
FT                   ASKIQTNIRELEGALIRVTAFASLNREEVSLAVAEQVLRDLIPDGAEADVTAPTIIHET
FT                   ANYFGVSVDDLIGPSRNQTLVMARQIAMYLCRELTDLSLPKIGQEFGGKDHTTVMHADR
FT                   KIRKLMSERRSVYNQVTELTNRIKQNSARR"
FT   CDS_pept        complement(1682..3151)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00020"
FT                   /product="Multidrug resistance transporter, MFS superfamily
FT                   protein"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55502"
FT                   /db_xref="GOA:D7GHD0"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD0"
FT                   /protein_id="CBL55502.1"
FT                   /translation="MTTILRQSPGAPEAPESDARRPSGRAGHGLAMVIIAAALPTLMTA
FT                   LDDLVMTFALPVIQKAMNASVTQLQWFVNAYTIVFAALLLPAAALGDRFGRRRVFLIGI
FT                   TVFTGASAWAAVSGSSAMLIAARAVEGAGAAAIVTLSLALLADMVPPAKRPMAIGIWGG
FT                   VNGIGTAAGPIVGGAVIQGLHWSAIFWINVPVGVVAIVLALVSLRGAAAARGSQERRGI
FT                   DLLGMALGIASIFMLVWTIVEAPDHGWTSARTLLGLAVALACVVCFLMRERRARSAFLP
FT                   VVMFRDRVFSAANAATFLFAGAVFGAIFLLSQFLEVSMGYSALGAGWRAAPWTLMPMVM
FT                   APIVGLIVQRIGVRLVLMIGLGLEAVALLWMALVLSPGVTYGAVIAPMFVGDVGMGLSF
FT                   APLSTAALQGRQGPEYAVASGVNSTLRQVGVTLGVAVCTAIFTSAGSYRPGQPFVDGLL
FT                   PALWMCVGVLVVGVGVCGLISPATSGARNSA"
FT   CDS_pept        3393..4010
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00030"
FT                   /product="transcriptional regulator"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55503"
FT                   /db_xref="GOA:D7GHD1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD1"
FT                   /protein_id="CBL55503.1"
FT                   /translation="MRISELAHAAKVPLPTVKYYQREGLLPPGRAVNARESQYGEEHLS
FT                   RLRVVRVLVTGLGLTIAQVRHVLDVLDGPQRDPYQAMGEATKNLPLTAPASQTSTPDDD
FT                   VAMVRALGFTHIIDPQLAGQLGNALRWAAESGVSVTPELLGAYLDATRQIARADFEVIP
FT                   RTNSRESVSFAVVGTVVMEPVLLALRRLAHEELAQEMEDDEG"
FT   CDS_pept        complement(4007..5188)
FT                   /transl_table=11
FT                   /gene="SqdX"
FT                   /locus_tag="PFREUD_00040"
FT                   /product="Glycosyltransferase, group 1"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="2.4.1.21"
FT                   /note="1,4-alpha-D-Glucan <=> 1,4-alpha-D-Glucan"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55504"
FT                   /db_xref="GOA:D7GHD2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD2"
FT                   /inference="similar to AA sequence:Uniprot:A0YWU2_9CYAN"
FT                   /protein_id="CBL55504.1"
FT                   /translation="MRVAMFTEVFLPKVDGVVTRLTHTLEQLGEMGHEVLVFAPGNPPA
FT                   SHAGQPVSRVRSFSLRPIYPEIKVGLPTPSIADKMVHFRPDVVHAVNPVALAAFGVEVA
FT                   VHRRLPLLASYHTDLADYLGKLGVGWARRPMVGWTRFLHNRAQVNLCTSPTMVRRARRR
FT                   GVRHVELWPKAVDVQTFRPGRASAAMRARLTDGHPDARLLIYVGRLSREKDLADLVEPM
FT                   RVLGAQGYRLAMVGSGPARAELKRAFVGTPTVFTGYLAGSELAAAYASADAFVFPSTTE
FT                   TLGLVALESMASGVPVIAAAAGGLPDVIHDGTDGFLVTPHDGAGFADRARRLLGDDDAA
FT                   RRLRTLMAVAARAEAERHDWAAATRSLVERYREAIERHGIERARGGRSRRGPG"
FT   CDS_pept        complement(5202..6449)
FT                   /transl_table=11
FT                   /gene="sqdB"
FT                   /locus_tag="PFREUD_00050"
FT                   /product="UDP-sulfoquinovose synthase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.13.1.1"
FT                   /note="UDP-glucose + HSO3- <=> UDP-6-sulfoquinovose + H2O"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55505"
FT                   /db_xref="GOA:D7GHD3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD3"
FT                   /protein_id="CBL55505.1"
FT                   /translation="MKIVVLGGDGFCGWPASLHLSALGNEVTIVDNFSRRRIDEELGAG
FT                   SLTPIRSNAERRAAWAEATGRHLDLVELDVATDYERLLDLLVTLRPDAIVHFAEQRSAP
FT                   YSMKSSRHKRYTVNNNVNATDNVLCAIVESGLDIHLVHLGTMGVYGYGTAGMKIPEGYL
FT                   DVAVNGEAGEMHREILYPTSPGSIYHMTKVLDQDLFAYYAKNDALRITDLHQGIIWGTS
FT                   TPETQLDERLVNRFDYDGDYGTVLNRFLVQAAVGYPLTVHGTGGQTRAFIHIQDMTRCI
FT                   ELALANPPERGVRVKIFNQMTETHRVRDLAAMVARLTGAVVENVPDPRNEADENELHVT
FT                   AEAFLDLGLHPTTLSQGLLGEINQTAAKYRDRVDFAHIPARSLWTKDRQPGIPAAYRED
FT                   SPGGLPTDPVTAIDAG"
FT   CDS_pept        6930..7865
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00060"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55506"
FT                   /db_xref="GOA:D7GHD4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD4"
FT                   /protein_id="CBL55506.1"
FT                   /translation="MPPQDSPRARRAAADDPGVSDGVPEATSAALHADEQPPLGEVPVP
FT                   RDDNSEIAAYTRDLTKVYGSGDAEVVALDHVDVDFVKARFTAVMGPSGSGKSTLMHCVA
FT                   GLDAPTSGEVVIGDTNIATLKDSRLTELRRDRIGFVFQSFNLIPTLTALENIELPMAIA
FT                   GRKPDPEWLDHVIDIVGLRSRLKHKPSQLSGGQQQRVACARALVGKPDIIFADEPTGNL
FT                   DSAASAEILGFLASSVTDLGQTIVMVTHDPTAAAYANRALFLADGRIVADMDDPDRDKV
FT                   LARMVELSSPVDASAPGASTQAAGPSTVQG"
FT   CDS_pept        7804..10425
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00070"
FT                   /product="ABC transporter"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55507"
FT                   /db_xref="GOA:D7GHD5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD5"
FT                   /inference="similar to AA sequence:Uniprot:A1SNS2_9ACTO"
FT                   /protein_id="CBL55507.1"
FT                   /translation="MTRPHPVRRRRLPVLRQFRADMWKASWKSLMGHKVRLLLSALSVV
FT                   LGIAFLSGALTFTGMLSNTFAAITQGTIADVSVGVKGTQSIDSVVTPDYTKNHLTNADI
FT                   DRIRGVAGVESASGQITQMNTVYLLGTNNKVVGMAGPPSIASNFTTEPAMNHKPGIEVR
FT                   SGQAPTTDDEVAVDPSSLERSGYHLGDTVKLLANGQTITKKLVGTAAWGSGGSAGAAYV
FT                   FFDDVTASQLLMGGAPGYMQAAVTVKAGSDVDAVTKAVAAAVPDGFEAVPGHQVADQLK
FT                   TALDQAMDFVNIFLGVFAAISLVVACFLIVNTFSMLVAQRSRELALYRALGASRGQVAW
FT                   SVIFEALLTGLVGGVIGVGLGAFLAYGIGEAVTAAGMDMVSSVPMPSWQNALLSVVIAV
FT                   VVTVVAAWFPSRRASRVPPIAAMTGEVTSGEGGLGRRTLVGTIMLVVGIAGIWSGVTLK
FT                   VSKNMWLLGGGAFLVLIAVTLMSPVIGRPLIWVMGRAYRLLFGETGKLAELNAIRLPRR
FT                   TAATASALMIGITLVSTLSILGASASTSTEHSVRDSLRGDFVISSLNYGPLPASLFDEV
FT                   KSTQGVASVHRARTAATTINGARARVIGYPTSDFNKIQAQSMVTGTMGDALGEVIVSQA
FT                   YADEQKLQVGSTLESVDAATMAPLKLTVTGIFTTPKGGGFGSINANLATVAALGNRDRD
FT                   SQLSVDAAPGASHQSVQDALDSATSDNPLIVVQNQQEYAKAQSAQIDQMLTTVYALLGL
FT                   AVVIAVLGIVNTLALSVVERTREIGLLRAVGMKRGQLRLMITLESVIIAVLGAVLGLVM
FT                   GLGFGVALQHVLVDQGLSILSIPWGRLGIFLAVSVVVGVLAAVVPARRATKLNMLDAIS
FT                   SE"
FT   CDS_pept        12301..13461
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="PFREUD_00080"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55508"
FT                   /db_xref="GOA:D7GHD6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD6"
FT                   /protein_id="CBL55508.1"
FT                   /translation="MKITVERDVMAEAVAWVARSLPNRPSVPILAGLLMRATGSQLVLS
FT                   SFDYETSARITIDAQVDEEGEALVSGRLLSEIARSLPNRPARFTANSNHVELVCGSARF
FT                   TLQMLPVEDYPQLPEMPAESGTVPSDEFTRSVAQVVVAAGRDELLPVFTGVRIEINDDR
FT                   LSLLATDRYRMALKELTWNPATTQAESAALVPARVLSESARSMGGGEAVALALSNGIEG
FT                   EGLIGLSGEGAGGRRELTTRLLDGEFPKVRHLMDIKPNVTVRVKTEEVLESVKRVSLVA
FT                   ERNTSVRMVIEDDRIALDAATGDQAQATEAIEAQVNNVAGGEMAVSAVGFNPRYLTDAL
FT                   SALDTPYVQFSFTAPGKPCLVQGLPDVDGEPEADYKHVIMLMRLPG"
FT   CDS_pept        13535..14836
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="PFREUD_00090"
FT                   /product="DNA replication and repair protein recF"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /note="RecF is a recombinational DNA repair ATPase that
FT                   maintains replication in the presence of DNA damage"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55509"
FT                   /db_xref="GOA:D7GHD7"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD7"
FT                   /inference="similar to AA sequence:Uniprot:RECF_PROAC"
FT                   /protein_id="CBL55509.1"
FT                   /translation="MFVDHLELKDFRSYEAAKLDIGPGVSVFVGPNGHGKTNLVEAVEY
FT                   LSTLSSHRVSADAPLIRAGTSQAIVRALVVAGRDDPRKLLLELEINAGRANHARINRAP
FT                   VRRMRDFIGALRTVVFSPEDLAMVKGDPTDRRAFLDALVITRWPRLAGVKSDYDRVLRQ
FT                   RNTLLKTLARRSSRVDGGDVATLDVWNERLAQFGAELLAARLATLSDLMPYARASYAAI
FT                   APVNNRVDARYKSSLSGLSELLGYATDGAPGELPEAPDTDDEVRTPAPGPDQLAVLMMD
FT                   AMAARRGDELARGVTLVGPHRDDVTLTIGTLPAKGYASHGESWSLALALRLGSLDMLRA
FT                   DDVEPVLVLDDVFAELDVTRRDRLADAVAKAEQVLVTAAVGSDVPGQLNGQRFDVDLRG
FT                   SAHAGHEESATGPRVSIVSPALSTGSVHRSVDND"
FT   CDS_pept        14748..15611
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00100"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55510"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD8"
FT                   /protein_id="CBL55510.1"
FT                   /translation="MRRAPPGRVFRSCPQPCPQALSTGLWTMTERERHPGEAPMPWGDG
FT                   LPPWQRDQEAPPEPPDPTPPDPILPDSTEPVSTGPDPAEDDPASSGSSNGERWDPSGGD
FT                   PSAGGPDEGALPDDHDPEGFEVATSVAHQLSGMLPPARLGPRKKGRKRRRRARLFDEER
FT                   SGAGPDVRDPQAVGSAMEKLVNERGWRTQLGLRLIVGRWAELVGPTNAAHSRPESYRDR
FT                   VLVVRAESSTWASALRLLAPQLVAELNRRLGDGSVIRVDVRGPAAPSWRHGRRTVNGRG
FT                   PRDTYG"
FT   CDS_pept        15864..17531
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00110"
FT                   /product="membrane protein (s-layer)"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55511"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHD9"
FT                   /protein_id="CBL55511.1"
FT                   /translation="MKTRVRSRKPAAGLAGIALFASGLSLMSTVASRADSGLPSGVHEG
FT                   VCIPKDGAGSFNIIINNDDQMSRTKYTDSYDNIYRCITPPAAQAAGLTYSSPMKSFLHA
FT                   AGFTTTDVSDKSILAQDDQWKGYTNGADGTPLTNSYGAPLNSMIAAYDRDGSVTTQIDG
FT                   NPSKYGQDLPIPGYWDTQVGTASSGNWWIPNNGPTGTGGVVAGSYLWNQRVAAGTLGQQ
FT                   DDGTPFEEIQKGNPALKRDWNTIHWNTIQFNFNPSNTPAFTFIDYLGFRDLNNLPPIDV
FT                   TQRDINANVTLKLSTMYEGYPGTSFPARPESDFAAGKLKTVQRTHENDPDVIPADDVSE
FT                   PSTPGVSTPSPQPSSPQPSSPATGGDGGGTTVPPAGDCFVDVHAGDQFADDICWAKSQG
FT                   ITTGWPDGTYRPVTPINRDALIAYIYRLAGSPAFTPSGQTFSDVAPSNQFYKEIEWAAS
FT                   TGITTGWPDGTFRPTTPVARDAMAAFLYRRAGSPAFVAPGVPAFTDVGAGNMFYQQIEW
FT                   MKSTGVSTGWVDGTYRPLDATNRDAMAAFLHRYSNIGK"
FT   CDS_pept        17774..18334
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00120"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55512"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE0"
FT                   /protein_id="CBL55512.1"
FT                   /translation="MASEGEWARWRGDMRSSARGVENSAANIEQSSARAAAASDRTAEN
FT                   SARTARASEDTARSARSAATASWVSAGFAAVSAIQNARAARAAEEQTAITQSMAAQEQT
FT                   HQFAMWRQTEEGKQYVAWRNQAIPLAQLLRDRQTQWQLAWAQAIGNAQDSVSAQELEHM
FT                   KPHTVQVRSGRLKRLFTNEGVAG"
FT   CDS_pept        18375..18449
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00130"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55513"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF53"
FT                   /protein_id="CBL55513.1"
FT                   /translation="MEVLTLAICRKTSTCHTLLSLHLA"
FT   CDS_pept        18416..19723
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24230"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55514"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GG08"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55514.1"
FT                   /translation="MSHPTFTTPCLTTFCGLDELGLEAVGQRLDPDRAVIECRVVEPDR
FT                   WCRECGCEGAPRDTVIRRLAHEPFGHRPTTLLIRVRRYKCCGCGRVWRQDTTAAAPVRA
FT                   KISRGGLAWGLAGLVLDHLSVTRVAAGLGVSWSAANDAILAEGRRRLIDDPARFEGVTT
FT                   IGVDEHVWRHTRHGDTYVTVIIDLTPVRDKTGPARLLDMVAGRSKAVFKTWLAARPKPW
FT                   REGIEVVAMDGFTGFKTAAAEELPDAAPVMDPFHVIRLAGDALENCRRRVQHDVFGRRG
FT                   MKGDPLYQARRTLLTGAGLLTDKQQARLDALFAEDRHVEVEATWGIYQDMITAYRDKDR
FT                   GLGRFFLAHTIDKISASVPEQLVEIRKLARTLTQRASDVLGYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLSHYIARSLLEAGGFRPALHPRS"
FT   CDS_pept        19746..20222
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00140"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55515"
FT                   /db_xref="GOA:D7GHE3"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE3"
FT                   /protein_id="CBL55515.1"
FT                   /translation="MILFILGGFGLITTLAGASMTRVTVLGVAGPLLLALLMLAVAVYL
FT                   TVNGKRRRQEEQTGITWMNTELRSIVAAEAAQRVARFGFDPLAVPQGYTGFAWGATFDP
FT                   SAYADQLMWMIINGPVNFPEPDELPALVMPDVLAPNPAFRPEVNAALADFQQQS"
FT   CDS_pept        20643..22685
FT                   /transl_table=11
FT                   /gene="gyrB2"
FT                   /locus_tag="PFREUD_00150"
FT                   /product="DNA gyrase subunit B"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="5.99.1.3"
FT                   /note="DNA gyrase negatively supercoils closed circular
FT                   double-stranded DNA in an ATP-dependent manner and also
FT                   catalyzes the interconversion of other topological isomers
FT                   of double-stranded DNA rings, including catenanes and
FT                   knotted rings. ATP-dependent breakage, passage and
FT                   rejoining of double-stranded DNA. Belongs to the type II
FT                   topoisomerase family"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55516"
FT                   /db_xref="GOA:D7GHE4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE4"
FT                   /protein_id="CBL55516.1"
FT                   /translation="MSEQLNESAVTEKTEDEKRMDALTLTDTEDDSVDGEYGADEIQVL
FT                   EGLEAVRKRPGMYIGSTGERGLHHLVREIVDNSVDEALAGYADSIEVTLLNGGGCRVVD
FT                   NGRGIPVAEHPAEHISTLTLVLTVLHAGGKFGGGGYKVSGGLHGVGSSVVNALSSRFDA
FT                   DVYRDGYHWHQSFTLGDPVAPVERLEETERTGTTITFYPSADIFETTDFSYETLATGFR
FT                   EIAFLNKGLRIAITDERTDHVDEDGKQLHDVFKFDNGLVDYVTFLNGNRETMTPVIDVE
FT                   AHAPEVGMGVEVAMQWNTSYVTSLHTFANTINTREGGTHEEGFRAALTTTINKWGENWG
FT                   LIKKREDRVSNDDIREGLTAIVSVKLVNPQFEGQTKTRLGNTEARGFVQRAVNERLGDW
FT                   MEQNPGDGKLIVRKAQAAASARIAARKARDMARNRKGLLGSGGLPGKLADCSSNNPEEC
FT                   EIFIVEGDSAGGSAKGGRNPRIQAILPLRGKILNVEKARIDRALQSETIEAIISALGTG
FT                   VHEEFDINKLRYHKIVLMADADVDGAHIRTLLLTLLFRFMPELIDGGYVYLAQPPLFRL
FT                   RWTNAPHELAYNDGERDSLRDKGLEAGKKLPSVNPIQRYKGLGEMDAQDLWTTTMDPDN
FT                   RILLQVNLDDAARADQTFSILMGEDVEERRRFIQRNAKDVRFLDV"
FT   CDS_pept        22732..25467
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="PFREUD_00160"
FT                   /product="DNA gyrase subunit A"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55517"
FT                   /db_xref="GOA:D7GHE5"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE5"
FT                   /protein_id="CBL55517.1"
FT                   /translation="MSETPQGPGDNAETPTNNQRARKGSGVDAIAGPAKGRVDPVDLTS
FT                   EIQNSFLDYAMSVIVERALPDVRDGLKPVHRRVIYTMYDGGYRPDRGWNKCSRVVGDVM
FT                   GKYHPHGDSAIYDTLVRLAQPWAMRYPLVSGQGNFGSPGNDGAAAMRYTECRMAPLAME
FT                   MVRDIDQGTVDFQPNYDNRDTEPTVLPARFPNLLVNGSTGIAVGMATNIPPHNLREVNE
FT                   AVQWFLEHPEASDEELLEASMARVKGPDFPNGALIVGRKGIEDAYRTGRGSVTMRAVIN
FT                   IEEDRKGRTELVVTELPYMCNPDNLAQKIADLVNSGRLTGISDIRDDSSARTGQRLAIM
FT                   LKRDAQPRVVMNNLYKHTQLQDTFGCNMLALVDNVPRTLRLDQFIRYWVLHQIEVIVRR
FT                   TEHQLQQAEKEAHIYRGLVKALDMLDEVIALIRRSPTTEQASAGLQKLLDIDDVQAAAI
FT                   LNMQLRRLAALERQKIIDKMKELDTLIADLKDILANRERQRSIVSNELGEIVGKYGDER
FT                   RTQIIAAEGDFSDEDFIPDDDMVVTITRGGYAKRTRTDQYRPQRRGGKGVRGATLRADD
FT                   EVQHLFATTNHQWILFFTDHGRVYRIKTWQLPEGGRDAKGGHVAGLLSFLPDEKIAQVL
FT                   ALRSYEDAEYLVLATKQGLVKKTALSAYDSPRQAGLIAVNFRADDDELIGAELVDASDD
FT                   VLLISRLGQAIRFRADDEQMRPMGRTTSGVTGMRFREGDELLSMSVVPAERGEASDEHA
FT                   DEEDEPLYVFTVTNGGFAKRTPVGDYRVQNRGGLGIKAMRMDDERGHLVGGLVVTDSDE
FT                   VIAIKASGQVTRSSVAEVNPTGRDTMGVKFVGVRGKDEVIAIALNPEKPEEEGEGDETE
FT                   PEATDEMGNAVPATDVIEADASEDGTAAADDDEDARASDE"
FT   CDS_pept        25689..26573
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00170"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55518"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE6"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6T1_PROAC"
FT                   /protein_id="CBL55518.1"
FT                   /translation="MSPSSSNSHDLEPTVSDQSLSVARRLMRGQGRASMLAYRMDPAQS
FT                   VQSMAHGVDAKGRFLVSWIGNACCPVPESAEVNPVRTGGQPEPVPVRLEILRQSPDPMT
FT                   RIAAASLHLLGSLYVLSDDERIDLLAERALPTMVGDVAGMRGAHVGVLVSDRVLLHDCY
FT                   GVTPLSFDALVGESADAAPVFPTMADDLEAFECVACLAEPTLRHVCDSVMCGLLRGRVH
FT                   STKAVVNPCPAVADKVFCVDVDQTGILFMRVLNGRATSVVADFSRNVHSLEGLDAEVSA
FT                   LVESSTLVDDYRV"
FT   CDS_pept        complement(26704..26979)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00180"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55519"
FT                   /db_xref="InterPro:IPR011437"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE7"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6T0_PROAC"
FT                   /protein_id="CBL55519.1"
FT                   /translation="METAIKSCSTSACAFNHNGCTAFAVTIGGSDAKPTCRTFIELDAR
FT                   GGLSSANGKVGACQRLECTHNKDLMCTASSIEVGGSQADCLAYQAK"
FT   CDS_pept        27220..28017
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00190"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55520"
FT                   /db_xref="InterPro:IPR002737"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE8"
FT                   /protein_id="CBL55520.1"
FT                   /translation="MVTRPTAVAGSFYPGQRGRLTRELDTLFEQADRPPAQVSPARVKA
FT                   IVVPHAGYVYSGTTAATGYELLRGRPINRVVVLGPTHRVGIRGMALAGADAFDTPLGSV
FT                   PVDPDLTAIAEAVPLVVTRPDVHAREHSLEVQLPFIRTVLPQASVLPVAVGDALPDEVA
FT                   ALLDAVWGESDTAIVISSDLSHYHSYDDARKLDAGTIDKVLALDDTVAPNRACGCFSLN
FT                   GLLLASGEHHLTPTLLSARNSGDTAGDKGRVVGYASFAFQADQ"
FT   CDS_pept        28082..28654
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00200"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55521"
FT                   /db_xref="InterPro:IPR002733"
FT                   /db_xref="InterPro:IPR023473"
FT                   /db_xref="InterPro:IPR027485"
FT                   /db_xref="InterPro:IPR027623"
FT                   /db_xref="InterPro:IPR036071"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHE9"
FT                   /protein_id="CBL55521.1"
FT                   /translation="MNDIPAGARETLIDMARGAIERQFGMTVHHREQATGELAKWLARP
FT                   GASFVTLTLDGRLRGCIGTLEAYRPLGQDVRDNAVLAAFHDRRFTPLRVAEYPGLHVEV
FT                   SVLSAPEPMEVTSEADAIRQLRPGVDGVVLTEGSHRATYLPQVWDQLPDPHEFLSTLRE
FT                   KAGLAPDRWGPDTRLARYAVTAFEDTR"
FT   CDS_pept        28651..29739
FT                   /transl_table=11
FT                   /gene="pflA"
FT                   /locus_tag="PFREUD_00210"
FT                   /product="PflA, Pyruvate-formate lyase-activating enzyme"
FT                   /function="3.8 Protein modification"
FT                   /EC_number="1.97.1.4"
FT                   /note="S-Adenosyl-L-methionine + Dihydroflavodoxin +
FT                   [Formate C-acetyltransferase]-glycine <=> 5
FT                   prime-Deoxyadenosine + L-Methionine + Flavodoxin
FT                   semiquinone + [Formate C-acetyltransferase]-glycin-2-yl
FT                   radical"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55522"
FT                   /db_xref="GOA:D7GHF0"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR027596"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF0"
FT                   /protein_id="CBL55522.1"
FT                   /translation="MTTSPTRRDPAGTDRAVHDTDGLPGRTARWWHALPDGRLRCELCP
FT                   RECTLRDGQRGFCFVRARHGDEIRLDTYGHCSGLAVDPIEKKPLNHVLPGSRVLSFGTA
FT                   GCDLACRFCQNWEISTARSMTAVGVPAMPRDIAHDASARGCSAVAFTYNDPVVFAEYAM
FT                   DTARAVNEQQMLSIAVTAGYINPEPRDEFFACMDAANIDLKGFTEGFYRRITGGRLDVV
FT                   LDTIDAVVHNGRTWVELTTLLIPGMNDSDEELRAMCGWIVRQLGPDVPLHFTAFHPSNR
FT                   MRDVPPTTATSVERARQIALDAGIHFVYTGNVHDPAGQTTWCPQCGTALIERDGYRVGP
FT                   VRLDDLGRCRSCGYALPGIFRR"
FT   CDS_pept        29896..30414
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00220"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55523"
FT                   /db_xref="GOA:D7GHF1"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF1"
FT                   /protein_id="CBL55523.1"
FT                   /translation="MADNSDATTAKADGGSRRFARPGSRRRSGRKPALSFATLKEKAGA
FT                   GRPEGPTRKAQLRISRVDPWSVMKTSFLFSVVGGIALIIAVWVLWGIISLSGGLNAMQQ
FT                   GITAMVGADSGGGSNLANYVTMWRVLGFTVLVSVVSIVLVTAITTLFSFVYNVAANVIG
FT                   GLEVTLAED"
FT   tRNA            30488..30564
FT                   /locus_tag="PFREUD_00230"
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:30522..30524,aa:Ile)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        30652..31098
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00240"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55524"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF2"
FT                   /protein_id="CBL55524.1"
FT                   /translation="MSQRAAPHAVTPCPEVTYDRIQKAVKRAMRSAPVEHEGVLALQTE
FT                   RAILTFQLIAEAELLRVAALIGLRLRADDSAAAAIEAINRLNSQSVDGTIYLYPSDDPG
FT                   TRSVGIDSFIPVDQGLTDAQLNRSVALALSSIGDLIGALPGPSD"
FT   CDS_pept        31113..31571
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00250"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55525"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF3"
FT                   /protein_id="CBL55525.1"
FT                   /translation="MFFTRKTVATPAMTPDRLAEALDGLPEVFVLDDAGNYHYRDDVGI
FT                   AVQLGYNDDSTLLEAHFTGVPVVQELMPRALDMVNQWNLAARPVRAYLGRVSEELPFQA
FT                   PHLRAILTTGVGVTDGQLVSWLRRCDEGIGAFNDHLRQFFSQVGTPGN"
FT   CDS_pept        complement(31608..32018)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00260"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55526"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF4"
FT                   /protein_id="CBL55526.1"
FT                   /translation="MDRGAGVPLSQRVANTRAAEAREAAERAAAQAEDELGDRAGRQSP
FT                   PTQSRPAQSPPPQPPPGPYRAPGSPQSMSAPDANRIPTVVVVLIDGAKPGLIARWRHTP
FT                   QGWEGLVAQAGGVDDFYAEWLPATRLRPANVT"
FT   CDS_pept        32291..33073
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lacI"
FT                   /locus_tag="PFREUD_00270"
FT                   /product="Transcriptional regulator, LacI family protein"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="PSEUDO:CBL55527.1"
FT                   /inference="similar to AA sequence:Uniprot:Q0S5Y9_RHOSR"
FT   CDS_pept        33208..33366
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00280"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF6"
FT                   /protein_id="CBL55528.1"
FT                   /translation="MQDPRRLAEAAIDLVAARINGPQGSGDNPTSEELVVLPTELRVRK
FT                   TTAPPKR"
FT   CDS_pept        33744..34934
FT                   /transl_table=11
FT                   /gene="iol"
FT                   /locus_tag="PFREUD_00290"
FT                   /product="myo-inositol 2-dehydrogenase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="1.1.1.18"
FT                   /note="myo-Inositol + NAD+ <=>
FT                   2,4,6/3,5-Pentahydroxycyclohexanone + NADH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55529"
FT                   /db_xref="GOA:D7GHF7"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF7"
FT                   /protein_id="CBL55529.1"
FT                   /translation="MSEKTLGVGVISLGWMGRLHTRGYKTLAEKFPELDARIRLVSVCD
FT                   PVEANQAFATEHLGFARAVAGYQELLDDPEVDVVSICSPNYLHREIALATVAAGKPFWI
FT                   EKPMGTSAAQSREIAEAAAAAGLVTSVGFNYRHTPAIEKAREVIRSGRLGRITNVRCWL
FT                   IADYASSPLGPLTWRYDPDKAGSGVVGDLMSHGADLVQYLCGRISSVSALTDTFITERP
FT                   IPTKVGVGHSGWEVSDELGPVGNEDYVAMIARLDSGAVGTFESSRVSVGPRAEYIIEVY
FT                   GTDGSLRWNFEHLNDLEVCLGADNEFQGYTRVMAGPTFPNFSRFQPGAGTSMGFDDLKA
FT                   IEAAQFIESVLTGKQLAPSAADGWAAAEVDQATVASARDGQWHDVAPVTGPTTYDA"
FT   CDS_pept        34951..36603
FT                   /transl_table=11
FT                   /gene="iolT2"
FT                   /locus_tag="PFREUD_00300"
FT                   /product="iolT2 (myo-inositol transporter iolT2)"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55530"
FT                   /db_xref="GOA:D7GHF8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF8"
FT                   /protein_id="CBL55530.1"
FT                   /translation="MSTNNQLDIRLDMPRAELDAAVAKVPAGGKHRSIGLIALVATLGS
FT                   FLFGYDTGVISGALPYMYMPFGAHGLEITASEEGWIGGTLLVGAAVGALIGGRLSDRYG
FT                   RRHNILLLAFIFAIGAIGTALAPNIWVMYPMRFVLGFAVGGASATVPVYLSETAPKRIR
FT                   GRIVAIDQVMIVTGQLLAFTFNALIDNAVGGPQLDVAGNTQGHLQTGTQTWDNVLALQT
FT                   SQGGPFDPAAWHSFVNALLVDGGNGMAGRVMLMLCTIPAIALWIGMRFMPESPRWYAAN
FT                   RRYYESIGALKQVRDPHRDGDPADEFDEMLVSHRREEGQKKGTFGDIWRTPWLRKLFLV
FT                   GVFLAICNQTTGVNTVMYYAPKVLQYAGMGTSASITAQTANGIMSVIGCSVALWLIGRF
FT                   RRRQILITCLFSVFVTLRVIALLFEVTIAPAITEGGRPPSWAPMVILAMMGLFMLVVQA
FT                   GNGPVVWTMLGEMFPSKVRGIANGTAVFCMWMVNALITATFPTMMEGLGGGITYGIYAV
FT                   INLVFAFILIKIMPETSNKSLEEIEVYAEARYS"
FT   CDS_pept        complement(36839..37498)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00310"
FT                   /product="Two-component system response regulator"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55531"
FT                   /db_xref="GOA:D7GHF9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHF9"
FT                   /protein_id="CBL55531.1"
FT                   /translation="MMSGPAVRVVLAEDSTLLREGLVRLLDEAGFEVAGAYGDAEQLLA
FT                   DVGRARPDVAMLDVRLPPDFTDEGIRAALRLRRDHPGVAILILSQYLESLYAEELFASG
FT                   QGGLGYLLKERVTSLDSLTDAIRRVHAGGTALDPQVVSGLLRSKHDPLAALTAREAQSL
FT                   ELMAQGYSNTEIARQMHIGVGTLEKHIAAVFAKLGLADTGTEHRRVRAVLAWLRAQ"
FT   CDS_pept        complement(37495..38997)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00320"
FT                   /product="Two-component system sensor kinase"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55532"
FT                   /db_xref="GOA:D7GHG0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR025828"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG0"
FT                   /protein_id="CBL55532.1"
FT                   /translation="MTSISGSPASLRTANGDPTVTRSDAPTEPPSLMLGGVWSWRHVPG
FT                   RLGYLLGGLPWAVVTFSVLISLLSAGIPLLILTPLGMACLWALVICARAVGAGERARLR
FT                   WAGTTPIEAPAPAPSGSPTLWRRAWQAILDVDAWRAVAHNVVNFIVSMVSFSLVAVWLA
FT                   VIAQGVSTWLDTHWIRLSADINTLGDLLLPASMRSAMGVHIADTALAVIALVTLPVLTF
FT                   ALVWMHRLLGGALLSANKSRELTRRISELNRRVGKLADAHSASADAEGEALRRLERNVH
FT                   DGPQQQLLRMQMGLDTAKRHLADDPQRAAAMLDELRDRSQDTLEELRDLSRGLVHPLLV
FT                   ERGLGAALESLAERATLPVRVTNHLPEQLDRPQGIEQTSAQGLLLATSELLANVAKHAQ
FT                   ASSAEIMVDALPAGSPQATNPGAQGPCPTLTDPARTDQPPAVQVRVRDNGVGGAVVVPG
FT                   HGLDGVARRMQGLGGSFTLASPAGGPTTITLRIPLTDWSNRP"
FT   CDS_pept        complement(39199..40533)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00330"
FT                   /product="transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55533"
FT                   /db_xref="GOA:D7GHG1"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG1"
FT                   /protein_id="CBL55533.1"
FT                   /translation="MTTIPAAAPPAPRQSAFRTLLGTGVGNALEWYDWNIYASFAIYMS
FT                   RELFSSKDPTSAFLETMGIFAVAFVARPFGGAFFGWLADRIGRKHALAIAVIFASGGSL
FT                   LIAVCPTYHQVGAWSSLILLLARLIQGLAHGGELPSAQTYLSEMAPPNRRGLWASAIYV
FT                   TGSFGLTLGLLFGVVLRDTLGSDAMNQYGWRIPFAAGAVLGVFAFWIRERMEETEAFED
FT                   EKKAGELKKSLVREVLKHKKIALQVIGMTCGLTVAYYIWSVSTASVAQKNLGYSTNDAF
FT                   GASIIGNLVFMVSLPLWGMFSDRFGRKTNMLIAMIGCAVLYVPLNNMVRGGNEFWRLVV
FT                   AICVMLVLLGAYLAIAPAAYAEMFPTEVRATAFGVPYAIAIALFGGTAPYIMSAWAATP
FT                   NRFVIYVIVLLLISAATILTLPETKGIDLSYHPKFNPRPDDVATS"
FT   CDS_pept        complement(40552..41763)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00340"
FT                   /product="Amidohydrolase (Peptidase M20D) (Putative
FT                   metal-dependent amidase/aminoacylase/carboxypeptidase)"
FT                   /function="3.10 Protein degradation"
FT                   /EC_number="3.5.1.-"
FT                   /note="carboxypeptidase activity"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55534"
FT                   /db_xref="GOA:D7GHG2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG2"
FT                   /inference="similar to AA sequence:Uniprot:A0K1I1"
FT                   /protein_id="CBL55534.1"
FT                   /translation="MPLGPDPYLVSIQDELVALRHELHQIPEVGLDLPQTQQRVLKALE
FT                   GLPLEITLGKKLSSITAVLRGKAPSNGPRRTVLLRGDMDALPVVEQTGLAWASTNGAMH
FT                   ACGHDCHMTGLVGAARALSHKVDELPGDVVFMFQPGEESDRGAELMIAEGVLDAAGKRV
FT                   DAAYGLHVWSGLDKAGIFYCRPGTIMASSDMADFEFVGKGGHGSAPHLAVDPVPAMAEV
FT                   ITALQVMIARHFNIWDPVVITCGHVEAGVARNIIPETATIEATMRAFSKQAQQQLFDMV
FT                   PRVVTDVAASHGVTANVKLTNLYPATINHDEGAALVAKTATDLFGADHFVEMANPMGAA
FT                   EDFSLVLEQVPGAFAILPATPPDKDPAQVHGNHSPFALYDDSVLLDAAALLSELATRTL
FT                   ADAN"
FT   CDS_pept        42453..44192
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00350"
FT                   /product="ABC transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55535"
FT                   /db_xref="GOA:D7GHG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG3"
FT                   /protein_id="CBL55535.1"
FT                   /translation="MAPDQDATLIDLATLRSSGAVLRAMVRRDPLKFSLGALGAALVSV
FT                   ANVSIPLAMGRAVQVGLVDHRFSGFALWLGVVALAYLLRAGATTLRLHSNMSASMLQHD
FT                   MRVQALARTVDPTGLGSARRLPGDLLTVMITDARTTSRALVALTGVPGQLVTLIGALVA
FT                   LLLIDWRLSVAVLVLTPLLVLMSLKGLAPIQERTRAERRAEAAAAGIAADLTEGLRVVQ
FT                   GLGASARASSRFRTASQTGLAATLRTRTARGIYNAVVSGAVGIFTALLTLLGAVLALNG
FT                   QITIGALVTVVGLGQTLAPPLRSLGVDTASTLASARASADRVRELVATPPAQQFGTADE
FT                   PPAGPVHLELRGVTTPTITVPLNLAVPPGRQLGMVGPEPVIDELAALVARERRPATGQL
FT                   LVDARPAAEWSDDGYRARVLAAPREPELFDGTLRENLTLAPDGPLQAEADKALDAAIWA
FT                   SASGDTVAGLPAGVDEMIGEGGQELSGGQRQRIALARALLHADDLLMLVEPTTSVDPIT
FT                   DREIAERMREFRAGRTTMVACSSANELAQADEVVFFGEDGAIIARGPHESLLALDAYRE
FT                   VLS"
FT   CDS_pept        44192..46159
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00360"
FT                   /product="ABC-transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55536"
FT                   /db_xref="GOA:D7GHG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG4"
FT                   /protein_id="CBL55536.1"
FT                   /translation="MRAHGPVWLPRGPANRWLPLASGRQIAAQVRSHSHGLWRWLVLAV
FT                   VAMTISALTSLALPVATGMVVDQVRTHGPLSGLIAPGVMVVTAVIIGAVASGAGQALTP
FT                   SYFAAVLARLREDMLARALDLDQQLIEQAGSADLVARVGDDVATVRDSVNAGLPRMVNT
FT                   SILLVVAASGLAAMSPLFLLPLAAGAVVFTASVRWFLKRAPAIYRNERQASARQSQDIL
FT                   STLHGLDAVRAFGLAGLRTGIVARSSWQAVRWELRGRFLSNALVVRLVIGEAVVIIGQL
FT                   LVSYPLVTGGHVSVGQASAAGLLLLSLMGPLRFLLMFIDDLQAAYASLQRIVGVLGVDA
FT                   HHAPQGDDSFAAPTDGAGAGQPGAGSPAGARSGVGPSDTGPVESRPVGVGPMDTGAMEA
FT                   GPIEAARIEAGRIEAGPMETGRIEIRHLGFAYRPDQPVLSDINLTIAPGEHVAVIGESG
FT                   AGKSTLAKLIAGTLSSSSGEVAVGARPGTRGPAVVLVSQDIHTFSGSLADDVTMGAPAS
FT                   TVDDQLAALARDALDRVGADWATDLSMVVGRLGTALSPAQAQQVALARVLVADPAIVIL
FT                   DEATAEAGSAGARMLDRAADEAIAGRTALVIAHRLSQAAYADRIVVMAHGRIAEVGTPD
FT                   ELLVRDGEFTRLWKAWQAQR"
FT   CDS_pept        46374..47489
FT                   /transl_table=11
FT                   /gene="ald"
FT                   /locus_tag="PFREUD_00370"
FT                   /product="Alanine dehydrogenase"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="1.4.1.1"
FT                   /note="L-alanine + H2O + NAD+ = pyruvate + NH3 + NADH"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55537"
FT                   /db_xref="GOA:D7GHG5"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008141"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG5"
FT                   /protein_id="CBL55537.1"
FT                   /translation="MRIGVPTEIKNNEFRVAITPAGVHSLASHGHEVLVQKGAGEGSSI
FT                   TDDEFAKAGATITDTAEQVWDDAEMIIKVKEPIASEYGLMREGQLLFTYLHLAADRPLT
FT                   EELLRRKVTSIAYETVELADGSLPLLAPMSEVAGRLSAQVGAYNLMQPYGGRGVLLGGA
FT                   TGVKKGRAVVLGGGTAGFCSARVLDGMGADVTIFDVDAARMEYIEDITKGDIHTEYSTP
FT                   FAVEEACVLADLVVGSVLVPGARTPKLVSHELVTKMKKGSVLVDIAIDQGGCFEDSHPT
FT                   THADPTFKVEGSIFYCVANMPGAVPFTSTYALTNATLRYAQLLADKGWEEAIRLRHDLA
FT                   LGLSTYDGQLFTDGVGEALGIDVEPLSTVLG"
FT   CDS_pept        47857..49395
FT                   /transl_table=11
FT                   /gene="cycA2"
FT                   /locus_tag="PFREUD_00380"
FT                   /product="D-serine/D-alanine/glycine transporter"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55538"
FT                   /db_xref="GOA:D7GHG6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG6"
FT                   /protein_id="CBL55538.1"
FT                   /translation="MALDWTGIPPEVDLPDGEPELSRGLKNRHLQLIAIGGAIGTGLFL
FT                   GAGRTIHLAGPSIVLVYVIIGFFLFFVMRAMGELLLSNLAYKSFADFATDLIGPWAGFY
FT                   IGWTYWMCWVVIGIADTTAICGYLALWFPDLPKWIPALCVVLLLTGLNMVAVRVFGELE
FT                   FWFAMIKIVTIIALILVGAYLAFTAFQPPMAGAPAASFAHMWDRGGFFPTGFAGFMAGF
FT                   QIAIFSFQGIEMAGTAAAETADPEHNLPKAINSIPARVLIFYVLALIVIMSVQPWDLID
FT                   PNNSPFVEMFSFIGVLIAFHVINFVVLTSAASSANSGVFSTSRIMYGLAREKNAPKRFA
FT                   KLSGRHIPRNALFLTALCISPSIILVMLSDSVMDAFSLVAGISSVLYLSVWGLIVACYI
FT                   AYLRKHPERHAESIFPMPLARIMPRATLVFFVAILVVLGFAEDSRIALFFAPVWILFMA
FT                   LMYRFLRSTRAEAEPIDFDAERDRARELVEQHVTETGGKGASERLKKTGRRTLD"
FT   CDS_pept        complement(49612..50748)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00390"
FT                   /product="ErfK/YbiS/YcfS/YnhG precursor"
FT                   /function="1.1 Cell wall"
FT                   /note="Several members of this family contain peptidoglycan
FT                   binding domains. So these proteins may use peptidoglycan or
FT                   a precursor as a substrate.."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55539"
FT                   /db_xref="GOA:D7GHG7"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="InterPro:IPR041280"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG7"
FT                   /protein_id="CBL55539.1"
FT                   /translation="MGAGAVGLAACSKARPGSTGASASSKGPATPTLSLTAPHGLDAVL
FT                   PQDALTVAVNDGTLKSIVVADSNGNAYSGQLNGSTWTCDRAFWPAANYNVTVEATDAKD
FT                   GPHTLTASFTTAKVETIVYSPVYVQQGLGVGMPVYIQFNSPITDKAIRADIERHATVTT
FT                   APVQEGSWGWVENRILMWRPKNYWLAGSTAKVSLAFAGLVVGDGLYLADDTNYSISFGE
FT                   AHVLRCNNSSQYMGVYQNDNPVKNLPVSTGTAAHPTLSGTKVIMEKLTSMIMDSSTYGV
FT                   PATSAEGYKLKVDSCQRVTWSGEFIHAAPWSVAQQGNTPSSHGCVNVSPTEAAWLMSFT
FT                   QVGDPVEFTGGGPSFQPGDGVGCWVYDWDSWQQRSALV"
FT   CDS_pept        51199..51486
FT                   /transl_table=11
FT                   /gene="acyP"
FT                   /locus_tag="PFREUD_00400"
FT                   /product="Putative acylphosphatase"
FT                   /function="2.1.2 Main glycolytic pathways"
FT                   /EC_number="3.6.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55540"
FT                   /db_xref="GOA:D7GHG8"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG8"
FT                   /protein_id="CBL55540.1"
FT                   /translation="MSRAVENLRAVRLVASGRVQGVGFRWQARQQARALGIDGWVKNRG
FT                   DGRVEMVAQGERTAVGRFIAWARSGPGYGYVEHLEVTDEPVRGMTGFDVR"
FT   CDS_pept        complement(51519..52202)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00410"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55541"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHG9"
FT                   /protein_id="CBL55541.1"
FT                   /translation="MSQSVEPASSGDRFVTLRAPMRNEQEIKRSRFIACLYPVSSSQQA
FT                   REHIAELRKEFYDARHRPSAFVLGAGHTEARTSDDGEPAGTAGAPMLQALVAHQTAPGR
FT                   RDLSDVLAVVVRYFGGIKLGAGGLTRAYGGAVSEALTRASFVVRQRMQLVDVHLPLAEA
FT                   GAIEAALRNSSLHVVATRWTSTEGIVQVAHVPGEDELTREAVAALTGGLARLIDAGSEW
FT                   TTRAL"
FT   CDS_pept        52333..52842
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00420"
FT                   /product="Nitroreductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.-.-.-"
FT                   /note="A subfamily of the nitroreductase family containing
FT                   uncharacterized proteins that are similar to
FT                   nitroreductase. Nitroreductase catalyzes the reduction of
FT                   nitroaromatic compounds such as nitrotoluenes, nitrofurans
FT                   and nitroimidazoles. This process requires NAD(P)H as
FT                   electron donor in an obligatory two-electron transfer and
FT                   uses FMN as cofactor."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55542"
FT                   /db_xref="GOA:D7GHH0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH0"
FT                   /inference="similar to AA sequence:Uniprot:Q0L4J3_9ACTO"
FT                   /protein_id="CBL55542.1"
FT                   /translation="MADITPLLADRWSPHAFDKTHVISEDQVQLLLEAARWAPSAMNRQ
FT                   PWSFVVGVRDDDVFARLRPAIEGFSDWALDASAIILGAYQNAGSEPDYALYDLGQSMAH
FT                   LTVQAEALGLHVRQFATFDRPMAGRAFNIAAPWEPIIMAAVGLPAPGQKPEGRARKPLS
FT                   ELTAWQ"
FT   CDS_pept        53037..54728
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00430"
FT                   /product="Hypothetical transmembrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55543"
FT                   /db_xref="GOA:D7GHH1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH1"
FT                   /inference="similar to AA sequence:Uniprot:A0PP50"
FT                   /protein_id="CBL55543.1"
FT                   /translation="MSGGTAVGSQEFPPVGTFPQEDELPPSGTTRRTRDASSADLVANG
FT                   SATTDPSPAPRHRIRRRLIPLDGHGDIRLGVLAALLCMIGSWYVSTWLDESATAHIISY
FT                   PPAQMNGLFTWTDLVYAPYYYLMHYWTALVGINPFTLRLPSVLAVGVGTAAMAATGRVL
FT                   VARRGQLLYAACFALLPRVMAMGIEARPYAFAAMFVACAVWLVVLIGRRPTAWRVIGLT
FT                   AAMALAVYAQMYAVLPVVGLTLVGLLTIRTRHRWLVAAAAVAAGTLCLPFGVAAVGQLR
FT                   QVGWIADLSHDWFDHALVESWAASRTNVNVTATDLVPHVIAVTMAVLAALLVVLALVSR
FT                   FSGTAAERAGRRPGVARMLWAMVPIVLTVVVLWTYSLLATDVLLARYFTAAAPFYAVVL
FT                   AEATMALRWRWARVVPVLLLVGALALAGFQRRPYAKVTWEDYSLLATVMRTEAQPGDGL
FT                   LTERNPQPNENYQVALACDPDAFTHVINLAQPNKPPLDGPFRRDPPRIRLVTYPQLPER
FT                   IWLAVPFGQWSEYGQQLEHLGYQPTLTERGPQGDPGGHAITLWQRR"
FT   CDS_pept        complement(54766..55494)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00440"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55544"
FT                   /db_xref="GOA:D7GHH2"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH2"
FT                   /protein_id="CBL55544.1"
FT                   /translation="MWNAVLVLTCLSAGLLVGTAVQARLRAPGQTAAPRGRRVDPLTAA
FT                   AAGLLVAGTLGQALIGQEIYDRYLITLVPLLCGPLLGSLAARPAATSAASPGASATPRA
FT                   VPPRSSSPSRASVPTTSRWAGAVGLVVVAALSWSVTASTLARDGAQWRAAERLVARGVS
FT                   ATDIDAGFEWLGWHSSRPMVTGSGVVGAHGYTSSFADTRACYTVSQSPLPDMAMVETVH
FT                   YPRFAVAGSSTLWVQRSADC"
FT   CDS_pept        complement(55317..56333)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00450"
FT                   /product="Hypothetical membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55545"
FT                   /db_xref="GOA:D7GHH3"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH3"
FT                   /protein_id="CBL55545.1"
FT                   /translation="MSQPGHEVELADDAHHSPRPRSTTGSLRRELVAIGLVAALVALIG
FT                   LTPLLTNSHFYWYDDSAGGAYGQWFELGRQISHGHWPLLNPSAWMAGNYTVEQFGLLNP
FT                   VVIVIGLITQLVSNAAVMATGVKLFFMMVGGAGVYALARQFGARRCLSVMAGVAAPLGG
FT                   FTLFLDATSWVTNLEVWAYFPWVLWGLWRFIVQKKSYWPAFAAGYLTITVAYVQGTVMV
FT                   VFAFVAFLIWCAIRRTASRALRTVLAGLPMGLLTLALYLPAAPMPAPNTAVRRSLRRRC
FT                   GTRCWCSPACRRACSSARRCRRACAPPGRRLRHEVGASTRSPRQRQACWWRARSGRR"
FT   CDS_pept        complement(56330..58423)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00460"
FT                   /product="Hypothetical transmembrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55546"
FT                   /db_xref="GOA:D7GHH4"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH4"
FT                   /inference="similar to AA sequence:Uniprot:A0JYE8"
FT                   /protein_id="CBL55546.1"
FT                   /translation="MSWLGFCALVAASVVLLMLPGGIVNRCAKLPRKVSLALAPGVSTA
FT                   IIAASAIVANKVGLGWNLLPPALLTVVCALGCLVVRWLAHRLVDARTGHAPHADGTPGP
FT                   RRVAASVPASASASSGSAASPGSPEVTGSATRGAPRPPATGWWLGAGALGMVLTAWHII
FT                   TILGRPDNFSQSFDNVFHLSAIRWILDNSNGSSLAITMTTGDNPAAFYPLAWHDVATLA
FT                   LKMVHSTDVVAANNAMVVAVPAVVWVLGCFYLLHVLGCVNAPALVAAGLMVGAFPAFPY
FT                   LPASWGVLYPNMFGIALIPATIALAYQALGLGEHRTPLRSALPVGLLAMFGMAIAHPNT
FT                   IALFCVVLIPMLATWLTRILRARDADQPRWQRRGAIGLTALAALVIIAIWAKIRPPEDA
FT                   AVWNAIIGPRRALWQALTMTPSTATITVLPISVLVVVGAVVVIVTRRQIWLLAAHGLLI
FT                   FLWMAVSCFPSGWLRNALVGIWYNDPSRLAAALPLTALPLAVIGCSAMARWLVGWLTAR
FT                   RQLTAPTTPIVATVTLLLAVVLVPATLLAPTLRTTLRDAADSYRITWNGNVVDTDEYAL
FT                   LKRLPELVPADETVATVPYNGSSMAYALENVKTTTTHILYTPSRDVYTINQNLRFAEFN
FT                   PEVCHALSDLNVHYALDFGWYEVNRSNYAQYAPGFARLYEAPGFVPVANNGHAVLYRIE
FT                   ACR"
FT   CDS_pept        complement(58479..59348)
FT                   /transl_table=11
FT                   /gene="rmlA (rfbA)"
FT                   /locus_tag="PFREUD_00470"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="2.7.7.24"
FT                   /note="dTTP + D-Glucose 1-phosphate <=> Pyrophosphate +
FT                   dTDP-glucose"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55547"
FT                   /db_xref="GOA:D7GHH5"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH5"
FT                   /inference="similar to AA sequence:Uniprot:A0JYE7"
FT                   /protein_id="CBL55547.1"
FT                   /translation="MKGIILAGGTGSRLHPITMGTSKQLVPVYDKPMVYYPLSTLMFAG
FT                   IRDVLVITTPEDADSFHRLLGDGSGFGINLSYAVQDAPKGLAQAFTIGADFIGGDKVAL
FT                   VLGDNIFYGPGLGTRLARNTDVEGAAIFGYWVADPQAYGVVEVNALGMAVSIEEKPSEP
FT                   RSHLAVPGLYFYDNDVVGFARNLAPSPRGELEITDINRIYMAANRLHVEVLPRGTAWLD
FT                   TGTFDSLNDASDFVRTIQARQGLQVGCPEEIAWRQGWLSDDDLLARARLLAKSGYGDYL
FT                   AQLVAIGH"
FT   CDS_pept        59488..60258
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00480"
FT                   /product="Glycosyl transferase, family 2
FT                   (Dolichyl-phosphate mannose synthase)"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="2.4.1.-"
FT                   /note="transferase activity, transferring glycosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55548"
FT                   /db_xref="GOA:D7GHH6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH6"
FT                   /inference="similar to AA sequence:Uniprot:A0JYE0"
FT                   /protein_id="CBL55548.1"
FT                   /translation="MSRDRRVGMTRTLIIMPAWNEDEVIGDTIRELRSVLPDIDLLVVN
FT                   DGSTDATVSVAEAAGALVLNLPYNMGVGGAMRAGYKYARRFDYDQAIQVDADGQHDPRD
FT                   VRTVLEGLKQANISIGARFAGRGEYTVRGPRAWAMRFLAGIVSRLAHYKLTDITSGFRA
FT                   ADRLAIEQYCRHFPVEYLGDTIDSLVVAIRSGLTVCQVPVEMRPRQAGTPSHNPLKAAL
FT                   YLSRAVVSLFIAMTRRPVKHDPSLRAAHGEEAAL"
FT   CDS_pept        60255..60680
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00490"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55549"
FT                   /db_xref="GOA:D7GHH7"
FT                   /db_xref="InterPro:IPR019277"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH7"
FT                   /inference="similar to AA sequence:Uniprot:A0JYE1"
FT                   /protein_id="CBL55549.1"
FT                   /translation="MKSTIFFVILTVIMLFVVGNLLRSRRIRERYAVLWVLVGLFMLVL
FT                   VAFPVLLDRLAHLVGITVPSNLLFILAIAMLLGITLQLTLEVSRAEDRSRVLAENVAIL
FT                   NLEMREAGLTHLPTHGAPGDEMSDTTDDGPEGPDASR"
FT   CDS_pept        60819..61700
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00500"
FT                   /product="Glycosyl transferase, family 2"
FT                   /function="1.1 Cell wall"
FT                   /note="transferase activity, transferring glycosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55550"
FT                   /db_xref="GOA:D7GHH8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH8"
FT                   /inference="similar to AA sequence:Uniprot:A0JYE2"
FT                   /protein_id="CBL55550.1"
FT                   /translation="MTVDVLFPFYGDVELMKQAVHSVLRQSYGDFRLIVIDDGYPDASI
FT                   PGWFAALGDDRVSYERNATNLGANGNYRKALTRVTNELVVVMGADDVMLPNYLQWLVDR
FT                   AGEHPEVQIFQPGVVVIDEHGSGVNGLVDAVKSVYRPRGSGLRVLTGEALAVSLLRGDW
FT                   LYFPSVGWRAETITSIGFREGYDVVQDLALALDVAMHGGSLLVDSQLAFMYRRHSSSDS
FT                   SVRALSGTRFDEERRFFENMAAEMAERGWNHAARVARLHLSSRFHAATLLPGALRHGNR
FT                   EGLRNLGRHLVK"
FT   CDS_pept        complement(61769..63013)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00510"
FT                   /product="Polysaccharide biosynthesis protein precursor"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55551"
FT                   /db_xref="GOA:D7GHH9"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHH9"
FT                   /protein_id="CBL55551.1"
FT                   /translation="MNRENAGAVHEVARRLAGFTGWPLLALITPLVVSPLMARIAGDGW
FT                   SSVVTAMSVGSFGMAAVTWGWSLVGPPRVAQANEADRWSIYRESIHTRLLLSVIVLPLA
FT                   GVLTALLSVPELRLSAALLAVAFSAVGLLPQWYCIGIGRPTLLGLFDTLPRVVTTLIAL
FT                   PIVLWTRDIIAYPLLLMAGIAFSVWLFPRRVFPQRPSPPRSLRSTWHDITSMASAAGTN
FT                   LIGVAYSYAPVPIATALLAATASSHFASADQLFRYSLYAITSLGNALQGWSLEVEGVAG
FT                   RRRHLWAMALNTTLGVVGGLALIFAGPWATSILFGPAVAAEPGTSLWYGVAFFFLSTST
FT                   PLLRNLLLPNGRARTVLAATAASAVVGLTAMVVAGWKASAAGIAAGMAGSECLILLVTA
FT                   WPAMRLLDRRYPAVS"
FT   CDS_pept        63182..64915
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00520"
FT                   /product="Rhamnosyltransferase , Glycosyl transferase
FT                   family 2"
FT                   /function="1.1 Cell wall"
FT                   /note="transferring glycosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55552"
FT                   /db_xref="GOA:D7GHI0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI0"
FT                   /protein_id="CBL55552.1"
FT                   /translation="MEPSTPQRPRLSVAMATYNGAQFINEQIRSILPQLGDHDELVIVD
FT                   DASSDNTVELVGAFADSRIVLARNEVNRGYVRTFERALALARGEVILLSDQDDEWFPGR
FT                   VEAMLSEMGDRLLVVSNWEPRGGAPGFFERIRLRARDSRHHLRNVVGIIVGYRLHWGCA
FT                   MAVRRELLDIALPFPSWMDESHDQYLALAANMARSVRYMEADTVWHRLHDRNLTPQKPR
FT                   ALAKILRARVRLLGELAVLGSRLADRRGNQLTAPERDPHLSDVPGGPEHGAQRRVAIVL
FT                   SAFNPPDDLPARVRDWTRWFGPVVVVDDGSPNAGPSVWARLEEAGATVLHNPRNMGIAH
FT                   ALNVGITHARHTSHPDWVLTMDQDSAMDRDYLRHAFEALDATGEPRRIGMIAAATQNGV
FT                   ALKTMAGPRGITEVLDPMQSGTLMRADMFDDIGYLREDYFIDSVDSEFNARARNHGYVL
FT                   LAAPQCDLTHSLGAGRPMVIFGWRAHIGAKKLTVIYHAPFRVYYITRNNIYTATKYMWR
FT                   QPVWVARRMYMELQSHVVRFAFGPNRRLLFIAMAHGVGDALLHRTGPIPDSLASRLRPP
FT                   R"
FT   CDS_pept        complement(64998..66530)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00530"
FT                   /product="Hypothetical transmembrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /note="possible EPS polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55553"
FT                   /db_xref="GOA:D7GHI1"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI1"
FT                   /inference="similar to AA sequence:Uniprot:Q73TB3_MYCPA"
FT                   /protein_id="CBL55553.1"
FT                   /translation="MPRNEASPTRIGVVQRLVPQSVRGDAVLGLVVVLLTLVGAWRVSP
FT                   WLDEVATAHVVSYSSRDMASMWQGIPTLPSGSDMVHAAYYEVVHWWVDLVGITPFTLRL
FT                   PSVIAAGVGTMAMAGVGRRLVGRRGQLAYAAAYGLLPRTLLMAIEARPYAMSSMFAALA
FT                   LLLVVVYRRRPSWLRWVGLVLAIAAAMLVHLYAALPMAGLVAAAWFFTKGRRRWMLAAA
FT                   GIVSAALVAPFGVATSRQLGQIGWLASEKYSLIETALVQSWAASRTPPVPEISDRVPDA
FT                   IAAAMAVVAAILLIAVVVESRGRHLRRLAFALVPVATGVGILWIASLVWTNVLQGRYLT
FT                   PVAPFFAMALAELAIHAQRRWVRSLVILLMVGSLTLFGFQQRTYAKASTTDYNLMSRVM
FT                   RQSARAGDGFLIDPIQDWVFSYRGAVSVDPGAFAALIDLAQPTKPPLDFAWAHDPPELN
FT                   LAAQEWLPPRIWLASWNTKPATYGPQLAELGYHSVYAQSGVPDGHTVTLWEK"
FT   CDS_pept        complement(66685..68169)
FT                   /transl_table=11
FT                   /gene="rmlC (cps)"
FT                   /locus_tag="PFREUD_00540"
FT                   /product="dTDP-4-dehydrorhamnose reductase /
FT                   dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /function="1 Cell envelope and cellular processes"
FT                   /EC_number="5.1.3.13"
FT                   /EC_number="1.1.1.133"
FT                   /note="dTDP-4-dehydro-6-deoxy-alpha-D-glucose <=>
FT                   dTDP-4-dehydro-6-deoxy-L-mannose / The enzyme occurs in a
FT                   complex with EC 1.1.1.133 dTDP-4-dehydrorhamnose reductase/
FT                   dTDP-6-deoxy-L-mannose + NADP+ <=>
FT                   dTDP-4-dehydro-6-deoxy-L-mannose + NADPH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55554"
FT                   /db_xref="GOA:D7GHI2"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI2"
FT                   /inference="similar to AA sequence:Uniprot:A0JYD7_ARTS2"
FT                   /protein_id="CBL55554.1"
FT                   /translation="MRRRGTDTMALDHEKQLAATTTPIPGFLVFDLTVHGDNRGWFKEN
FT                   WQRAKMTALGLPDFGPVQNNISFNDEVGVTRGIHAEPWDKFISVATGRVFGAWVDLREG
FT                   PSFGTVFTCEIDPGVAVYVPWGVGNAYQTLEPNTAYTYLVNAHWSPEAKYTFLNLADET
FT                   VAIDWPIALDDAILSDKDRAHPRLDAVTPFPPAMPRVLVTGAHGQLGRALMAQLPDAGF
FT                   LPVGVDLDKLNIADRASVDAYDWSTVDVIVNAAAWTDVDGAETAQGRPRAWAANATGPA
FT                   NLARVATEHGLTLVHISSEYTFDGTRAPHREDEMPSPLGVYGQSKAGGDAAVAATPRHY
FT                   LVRTSWVVGEGKNFVRTMVDLAGRGIAPKVVDDQVGRLTFTTDLAAGIIHLLRHGAAWG
FT                   TYNLSNEGTPLSWAAVAKRVFALSGHDPQDVSPISTAEYFAGKDAAPRPADSTLDLTRI
FT                   EATGFRPPSMEERLDAYVAQLRRDGSGQQPTVNRPD"
FT   CDS_pept        complement(68150..69148)
FT                   /transl_table=11
FT                   /gene="rmlB (rfbB)"
FT                   /locus_tag="PFREUD_00550"
FT                   /product="DTDP-glucose 4,6-dehydratase"
FT                   /function="2.1.4 Substrate-specific entries to carbohydrate
FT                   metabolic pathway"
FT                   /EC_number="4.2.1.46"
FT                   /note="dTDP-glucose <=>
FT                   dTDP-4-dehydro-6-deoxy-alpha-D-glucose + H2O / dTDP-glucose
FT                   <=> 4,6-Dideoxy-4-oxo-dTDP-D-glucose + H2O"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55555"
FT                   /db_xref="GOA:D7GHI3"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI3"
FT                   /inference="similar to AA sequence:Uniprot:A0JYD8"
FT                   /protein_id="CBL55555.1"
FT                   /translation="MARLLVTGGAGFIGSNFVHHVLDHTDDTVVVLDKLTYAGNMGSLE
FT                   GLPADRYSFVKGDVCDRELVDKLVADADAVVHFAAESHNDNSLLDPAPFVQTNLVGTFS
FT                   LLEAVRAHDVRYHHISTDEVYGDLALDDPAKFEPETAYNPSSPYSSTKAGSDLLVRAWV
FT                   RSFGVRATISNCSNNYGPRQHVEKLIPRQITNIIDGVRPRLYGDGLNVRDWIHVDDHNA
FT                   AVLTILDKGRYGETYLIGADGELNNKTVIEKILVAMGQPADAYDHVTDRPGHDRRYAID
FT                   STRLRTELGWQPHYRDFDAGLAHTIDWYRANESWWRPQKAAVEAKYAAQGH"
FT   CDS_pept        complement(69279..73313)
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="PFREUD_00560"
FT                   /product="large surface protein A"
FT                   /function="1.1 Cell wall"
FT                   /note="extracted as s-layer proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55556"
FT                   /db_xref="GOA:D7GHI4"
FT                   /db_xref="InterPro:IPR002901"
FT                   /db_xref="InterPro:IPR013207"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI4"
FT                   /protein_id="CBL55556.1"
FT                   /translation="MLAGPSKKSIPYTRTAGFILAAIPAVGLSLALAPSHASADTVSET
FT                   PASPAATSASTSASSGTTSSSSSATPVLATSETSTTPKTITVSGAIGDLYTAMDGADGE
FT                   LGLATASETPLTGGGVWQQFQHGRIYWSQATGAHAIKGGIGDTYVALGDAALTKLGLPT
FT                   YDEVKLPDGWYQQFQNAGIYWTNDGGKVVTSDVAAKYAALGKTTSATATASSAPSATAS
FT                   TSTATTATSANSAADATTKTSSNSSAANTASAKSTAQPTTAATSASTPATPTPANSSSS
FT                   SSASPATPSAAAPSTTQSPTAQAPTTQAPTSAIADAVAPSAQIATSGAIGDLYNQLGGA
FT                   NGVLGAATSSETALSGGGAWQQFANGRIYWSQATGAHAIKGGIGDVYFAMGDSALTDIG
FT                   LPTGDERDLGNGMWVQQFQNGRIFWSGATGGHATNGDIAAAYAALGDSAYSYLGLPTAD
FT                   PVSVRSGVMQSFQSGRIFWSPTTGAHIVHGGINDTYTSLGSSAFADLGLPTSDEAAVAN
FT                   GWAQQFEKGSIFWSYATAGVVVHGNIGAIYASLGTDGPASLGLPSGQVTTLADGSQYQQ
FT                   FQRGLIYWSQASGARIVHNGIGDTFAAMASAPSAMGMPTGDEVDLGNGAWMQQFQNGRI
FT                   YWSGATGGHAIKGGIGDTFAAMGDSAYGLLGLPTGDETVLSNGWFQHFQNGSIFWSYPT
FT                   AGILIKGGIGDTFAALGESALSTLGAPVSGELSLGNGAWMQQFQNGRIYWSGATGGHAI
FT                   KGGIGDTFAAMGDSAYGLLGLPTGDEVSLPAGWYQQFQGGRIYWFGPTGGHMVRGGIGD
FT                   SYVNQGASTGLLGLPTSSEISADGGSYQVFQGGRIYWKDGLGSGTVRGAMLDAYLSMNA
FT                   SSGLLAFPRGGEVAIAGGALQDFEGGRLYWHPNSYAYLVRGAIGATYDAWGGSSGALGF
FT                   ATSNENPTADGTIQSFQNGTIAWKNSGGTVVNVVKGGIGDTFTAMGNSAYGLLGLPTSN
FT                   EITLPNGWYQQFQGGRIYWSGPTGGHMVRGGIGDSYINQGASTGLLGLPTSSEISADGG
FT                   SYQVFQGGRIYWKDGLGNATVRGAMLDEYLKLGASSGLLQFPRAGEAAINGGVSQDFEG
FT                   GRIYWRPNNYAYAVRGAVGATYFAWGASDGALGFPTSDEAPTDDGTIQTFQNGTIAWKN
FT                   SGGTVVNVVNTGGSKPAAGDEAGYIRWVAGFAQEEQRRYRVPAAVSIAQSIIESGWGQS
FT                   SLTAVDNNYFGIKCPAYGSPFVSGCTSYSTSEWVNGGYVTIQAGFRSYNSPGDSFLDHG
FT                   FFLSLGDPSNSANRYYPAFLTTNDRDFVRAIAAAGYATDPTYANKIISIMDRYNLYQYD
FT                   V"
FT   CDS_pept        73606..74793
FT                   /transl_table=11
FT                   /gene="glf , rfb"
FT                   /locus_tag="PFREUD_00570"
FT                   /product="UDP-galactopyranose mutase"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="5.4.99.9"
FT                   /note="Molecular function: UDP-galactopyranose mutase
FT                   activity, Biological process: lipopolysaccharide
FT                   biosynthetic process. UDP-D-galactopyranose =
FT                   UDP-D-galacto-1,4-furanose."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55557"
FT                   /db_xref="GOA:D7GHI5"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI5"
FT                   /protein_id="CBL55557.1"
FT                   /translation="MQADLVVVGAGLFGLTIAERAANELGLKVVVLDRRDHIGGNAYSE
FT                   KDEATGIEVHRYGAHLFHTSNEKVWEYVNQFTGFTGYVHHVYTNHQGEVFPMPINLGTI
FT                   NQFLRSALSPAQARDWVREQAGELAGTNPTNLNDKGIQLIGRPLYEAFIKYYTGKQWQT
FT                   DPKDLPASIISRLPVRYTYDNRYFNDTHEGLPVHGYTAWFERMITNPNIEVRLNTDFFD
FT                   DSQEYSKSKVIGSIPVIYTGPVDRYFDYADGNLGWRTIDLKEEILDIEDFQGCSVMNYP
FT                   DADVDFTRIIEFRHFHPERDYTKDATVIMREYSRFAGRDDEPYYPVNTAEDRETLLKYR
FT                   ERVKHESQILFGGRLGSYKYLDMHMAIGSALSMYENKVRPHFANGEALVSGGVDE"
FT   CDS_pept        74790..76802
FT                   /transl_table=11
FT                   /gene="gtfA"
FT                   /locus_tag="PFREUD_00580"
FT                   /product="Glycosyltransferase, family 2"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="2.-.-.-"
FT                   /note="transfer of sugar"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55558"
FT                   /db_xref="GOA:D7GHI6"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR040492"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI6"
FT                   /protein_id="CBL55558.1"
FT                   /translation="MSVSTAKQPMVSDFSDTPVSSVESNGYRVATRVIFPSDADLDVMP
FT                   LYIDLDEDESESHIHPEDVRGRDSIAVRPGVRMSLGSYFNAFPASYWRRWSVVRTVRLV
FT                   VNTSGQGTVVVYKSNARGNRQRVQSVQVSGEHNQQVFDLPLETFGDGGFYWFDLVAGDN
FT                   EMVLESAQWWVPTASQPHGTATFATTTLNKPDYVVKNLRAMAGDVSLRDVVDEILIIDQ
FT                   GTKKVAEYAGFDEVKAELGDQLVVIDQANLGGSGGFSRGMYEGATRGKSDYVILLDDDI
FT                   SLETESIIRLVTFADMCKKPTLVGGHMFDLFNRTVLHTYGEVVEPYYWQPALPHPDQSL
FT                   GHDFVHGGGKPDDGGLRSTEWLHQRTDVDYNGWWMDLIPVSVIKEIGLSLPVFIKWDDA
FT                   EYGLRAKEAGYNTVSLPGAAVWHISWVDKDDLVGWQAYFHDRNRYISALLHSPFPRGGD
FT                   IVSNSQKLDLKHLVSMQYYTVMGRLQAQRDLLAGPGTLPGLLATKLPAIRAAAKDFSDS
FT                   TLKKEYEDFPDIHAPKPKRPRKRSVESSRFLKMAEGAKAVLRQFRRPRPGHLDNPQTEI
FT                   AFKDNKWWNTAQWDSALVTNAEGTGIAWYKREPAEMRRMLAESAANQARILHEWPRLRD
FT                   EYKEALPQLTSFEQWEELFGIEHRPLGEPPAGEEH"
FT   CDS_pept        76771..77691
FT                   /transl_table=11
FT                   /gene="tagG1"
FT                   /locus_tag="PFREUD_00590"
FT                   /product="ABC-type polysaccharide export systems, permease
FT                   component"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55559"
FT                   /db_xref="GOA:D7GHI7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI7"
FT                   /protein_id="CBL55559.1"
FT                   /translation="MASRLRARNIEPVSSSDLASLPLHAPGHSNGLLDVPKWHFLLNLL
FT                   VKKELRVRYRGSVLGMLWSYVKPAVQLLVYYMAMGRFLRLSASMTNYVIYLFAGMVMIN
FT                   FFNEVMGNTTRSIVNNAPLVGKIYLPRELFPVSSLWVAFVHFVPQLAVLLLGALVVGWR
FT                   PTMLNVMAGLLSIAMVAIFALGLGLAFAAWNVMFRDAENLVDLIAMVALWVSPVFYNWS
FT                   MVQSVVPGWLWNIYQCNPLAMSVELSHYAFWVPTRGVTATRSMAELMPPHWVMWSGLAL
FT                   LISLIILVLGQMVFRANEGKFAQEL"
FT   CDS_pept        77691..78461
FT                   /transl_table=11
FT                   /gene="tagG2"
FT                   /locus_tag="PFREUD_00600"
FT                   /product="ABC-type polysaccharide export systems"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55560"
FT                   /db_xref="GOA:D7GHI8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI8"
FT                   /protein_id="CBL55560.1"
FT                   /translation="MSDPVESTVMVDPNLVVARLRDVDKRFTLHHTHSIKEYLVWTMKG
FT                   RKGELSESFLALDDVNLDIHQGESVALLGFNGSGKSTSLKLLSGVMMPDKGEVAIRGRI
FT                   AGLIEVGAGFHPDLTGRENVYLNGAILGMSESEIDEKFQRIVDFSEIEKFIDTEVKFYS
FT                   SGMFLRLAFAVAAHSEPDIFLIDEILTVGDEPFQRKCIAKIKELKAGGQTLVVVSHDLD
FT                   MVRGICDRGVVLAQGRVTFDGDVDDAVEFLRSTE"
FT   CDS_pept        complement(78574..80982)
FT                   /transl_table=11
FT                   /gene="gtfB"
FT                   /locus_tag="PFREUD_00610"
FT                   /product="Glycosyltransferase"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55561"
FT                   /db_xref="GOA:D7GHI9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHI9"
FT                   /protein_id="CBL55561.1"
FT                   /translation="MRVALLCNVDQAVYRVGDEAIGIASAAQLRQRGHEVVMISRQEKY
FT                   GPGGQPHAESIPALTFPWPLDERDRYLAEIRKVLSGNHVALPAKDKLFKIMNQLRGVDA
FT                   LVIGGGGSLNSNFGWLVYERLATALVASFLDIPVVLSGQSLGPFLLLSDRAALKELLEL
FT                   CQLVGVRDADSYRLATQLCPEHPAIFQTLDDAVLLDADWDHPKANRISVTLGDNAEPFT
FT                   EHDYVSIMAALIDGLAQRTDAEVEFVPHMADPDRPRSDVRIHKLVAAQMSHQATLLPIE
FT                   QAVDATTRLAASRWALTTRFHPVVFGLLSGTPVLPITLGRYARSRVDGALANWGRSNAS
FT                   VPLAALWDPATGALRADVADAVLDALVAGADAERSAALAVRAERLDAAGRWWDQVVAVL
FT                   DEASDTADDSDRADASNPAEAPRDATHDAATPDSAAPLGGPAALDQVDRFTGDVAAAIA
FT                   PFRYAPAAGADRTVALIMRTQNRPGFLDRAVQDVLEQAWADWQLVVVNDAGDTDQVASV
FT                   LDRYRSELGDRLTVVNNPVSHGMEAASNVGLANSHSEFVNIHDDDDSWQPRFLLETLTH
FT                   LRAHPDEEAVATRTTIVMERQVGPDWVTYERFPSWPDLHAMRLLDFVKLNRIVPICLVY
FT                   RRAVHDRVGLYAEDYPVIGDYVFHLRLLQAGEVGFIDHALANWHHRPLQPAEGTAGNSM
FT                   YTNSSDHTEYDLLLRNKALKEWTDKNGLGLPLFISKELERETDHLEQKIQEVVDALGTQ
FT                   QQLIADLQVQLRATDHAVRAGGGFNFAKRQYQVARGYLSRAAGRITGRL"
FT   CDS_pept        complement(81158..82015)
FT                   /transl_table=11
FT                   /gene="gtfC"
FT                   /locus_tag="PFREUD_00620"
FT                   /product="Glycosyltransferase, family 2"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="2.-.-.-"
FT                   /note="transferase activity transferring glycosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55562"
FT                   /db_xref="GOA:D7GHJ0"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ0"
FT                   /protein_id="CBL55562.1"
FT                   /translation="MTAFSVLLPVYAGDEPEFFARALASISTDQILRPNEIVIVRDGPV
FT                   PPELEEVIAHASDGSAVGDIPVTLVRINRNRGLAAALELGLEACRYEIVARADADDISV
FT                   PHRFSRQLPVIAGDAPGEPDGYDLVGSAIQEFNDDEHHPGMVRRLPQDGDEIRRVAHFR
FT                   DPFNHPTVVYRKSAVARAGGYQHLSKMEDYWLFARMLQCGARVTNLPDPLVLYRVGSGA
FT                   YKRRGGVEMLGSELALQRAFVRSGFVSHLVGARNVAVRGLYRLVPTGLRQRAYRTMMRL
FT                   VGRR"
FT   CDS_pept        complement(82012..82974)
FT                   /transl_table=11
FT                   /gene="gtfD"
FT                   /locus_tag="PFREUD_00630"
FT                   /product="Glycosyl transferase, family 2"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="2.4.-.-"
FT                   /note="transferase activity transferring glycosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55563"
FT                   /db_xref="GOA:D7GHJ1"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ1"
FT                   /protein_id="CBL55563.1"
FT                   /translation="MKPTPGNPPRIVAVVVAWNRRELLTQCLDGLAGQTRPADAVIVVD
FT                   NASTDGSGDIARDHPVVTEVITMPTNTGGAGGFTTGIAAAMARQRADGIWIMDDDTVPT
FT                   STALQALLDTARLYPRELAVLASRADWSDGREHPMNTPRNRLDASPREKADAARLGCRP
FT                   IRSASFVSILINAEAVRECGLPMADYFLWNDDFEYTARLLRHHEGLYVPASRVRHLTRA
FT                   FGDSGADPGPRFYQEVRNKVWLFTRSRALTRWEKLIYGASTLRRWAHTLRTSGNRRVLS
FT                   RGLRTGLRDGLRAGPRANGRVLAGTPAESDIEALAKEPA"
FT   CDS_pept        complement(83198..83584)
FT                   /transl_table=11
FT                   /gene="trxA2"
FT                   /locus_tag="PFREUD_00640"
FT                   /product="thioredoxin"
FT                   /function="3.8 Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55564"
FT                   /db_xref="GOA:D7GHJ2"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ2"
FT                   /protein_id="CBL55564.1"
FT                   /translation="MAVVLAFGGYRKLTDGRAREAALDEPTLGPTELGTPLGSTATFVQ
FT                   FSSKVCAPCVATGRLLSGLTAQRDDVNHVEIDGEERLDLVREFGINRTPTVFLLDPDGA
FT                   IRYRFVGPSRKAEFVDALAELQAA"
FT   CDS_pept        complement(83619..84062)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00650"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /note="signal peptid detected according to SignalP. 3 TM
FT                   domains according to TMHMM"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55565"
FT                   /db_xref="GOA:D7GHJ3"
FT                   /db_xref="InterPro:IPR025508"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ3"
FT                   /inference="similar to AA sequence:Uniprot:Q3W826_9ACTO"
FT                   /protein_id="CBL55565.1"
FT                   /translation="MRGPRFGAAITSVLLIAALVLGPWPGVIVLAIQTLAFAAGAVLGV
FT                   SRQPYGLFFRSVVRPRIAPASEFEDAAAPRFAQGVGLAFAIAGLAGVVFSLPVLFYVAV
FT                   AFALVAAGLNALFGFCLGCEMYLLGKRLFGSSRPSTGNATQTG"
FT   CDS_pept        84556..84666
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00660"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55566"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ4"
FT                   /protein_id="CBL55566.1"
FT                   /translation="MPGVNADDSAADGQLAQQQQECEEYAELRTAARAST"
FT   CDS_pept        complement(85247..86044)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00670"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="2.3.1.51"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55567"
FT                   /db_xref="GOA:D7GHJ5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ5"
FT                   /protein_id="CBL55567.1"
FT                   /translation="MDLARNPKLYKSTTASIARNMVRMALIRPAVDAAIKVHVHGLEHL
FT                   DGLESPFIVTPNHSGHFDGPLVMLTMPKRLTKNLATGAAADYFFNHWYKAFGTQLLMNA
FT                   FPVDRGSMHGHRGLASALLESGISLLIFPEGTRSRTGGMGRFKPGTAALAISHNVPIVP
FT                   VALVGAWAAWPPSRARWVPGRPDVHVVYGSPMRADPGEIAHAFSERVRRKIIEMHDTTA
FT                   RAYSMPTQAEMMHLAAIEGAKKDIEAEQQKKKHSRDKKHRDDE"
FT   CDS_pept        complement(86044..86850)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00680"
FT                   /product="dehydrogenase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55568"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ6"
FT                   /protein_id="CBL55568.1"
FT                   /translation="MPTALVTGGSSGIGYAFATELARRGYDLVLVARDPQRLGSAARAV
FT                   RNKFGVQVHELSADLSDHDDIARVEQVLADRPIDLLVNDAGFAAHDDLLDDDWSGQVRA
FT                   LDLMCLAVLVLSGAAAREMVKRGSGEIINISSMNSLIPADNYAAIKAWVNSYTEGLAAR
FT                   LDGTGVRANVTITAWVKTEFHAAAGLDRPRIPDWVWVPVKSVVRLALADVRRGKVRSVP
FT                   TLRWRFAAWVLQHGPLALPRRVSHWVQSEHDNNRIGGPDEPRPEDV"
FT   CDS_pept        complement(86953..88143)
FT                   /transl_table=11
FT                   /gene="ackA"
FT                   /locus_tag="PFREUD_00690"
FT                   /product="Acetate kinase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="2.7.2.1"
FT                   /note="ATP + Propanoate <=> ADP + Propanoyl phosphate / ATP
FT                   + Acetate <=> ADP + Acetyl phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55569"
FT                   /db_xref="GOA:D7GHJ7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ7"
FT                   /inference="similar to AA sequence:Uniprot:A1A187"
FT                   /protein_id="CBL55569.1"
FT                   /translation="MAKPILVLNCGSSSIKYQLIDPDEETVLAKGLVERIGDAGNGIVT
FT                   HETDGQEWTITPQLHNHTVALQAVFKMFDDHGPGLKNVTAVAHRAVHGGDRFAAPVVID
FT                   DEVIATMQELVPLAPLHNPAVIEGIRAAQSLLGNVPHVAIFDTAFFTQLPEEAYTYAIN
FT                   RDLAKRNAIRKYGFHGTSHQYVSQQVPAVVGTDLGELNQIVCHLGNGASISAIKGGKPI
FT                   DTSMGLTPLAGLVMGTRSGDIDPGVFAYAARSEGWSTERIDSELNKNSGMLGLTGDTDM
FT                   RDVEAAFEKGDEAAVTGMNVYIHRLVFYIGGYAALLGRLDTLTFTAGVGENSSFVRKMV
FT                   CDRLVGLGVVLDEAKNEARDKAPHLISAPESKVKVLVVRTNEELAMAKQTEHLLAS"
FT   CDS_pept        complement(88304..89836)
FT                   /transl_table=11
FT                   /gene="pta"
FT                   /locus_tag="PFREUD_00700"
FT                   /product="Phosphate acetyltransferase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="2.3.1.8"
FT                   /note="Acetyl-CoA + Orthophosphate <=> CoA + Acetyl
FT                   phosphate / Propanoyl-CoA + Orthophosphate <=> Propanoyl
FT                   phosphate + CoA"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55570"
FT                   /db_xref="GOA:D7GHJ8"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR004614"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ8"
FT                   /inference="similar to AA sequence:Uniprot:A0YRZ9_9CYAN"
FT                   /protein_id="CBL55570.1"
FT                   /translation="MTTSVFVASPDGRVDLNSAAQTIAEALGRQESSTTIFTPLAHAAG
FT                   DAVGTTFTDFTNDEDAARAALLERCAAIDGAVVAVGTDYTGPTAPTELALNASLAADLA
FT                   LPVILVVDASQGPEFAAAYACTTTAAFAKDHATVAGVVFTNGTAPTLNGLPTAALDGNL
FT                   EPLLANAAATTVTTRTQAHFNFELMSRAKSEIKTIVMPESEDLRILEAASITLARGTAN
FT                   IVLLGERDEVIANAKAHGFDVSGATIISMNDPALIESYAAKFAELRAKKGVTLDQARET
FT                   MKDGAYFGTMMVYMGQADGLVSGANHTTANTIRPALQFIKTKPGTKTVSGAFLMSLADR
FT                   VLLFADCAVTIDPTPEQLADIAIASNETAQMFGIDPRIALLSYSTGTSGKGPEVDAVRE
FT                   GYELATQRAPQTKLAGPIQFDAAIDPVVGKKKMPENPVAGDATVFVFPNLNSGNIGYKV
FT                   AQRTAGAVAIGPLLQGLRRPVNDLSRGATVDDIVNTIIMTAIQAQGETGPLA"
FT   CDS_pept        complement(90014..93412)
FT                   /transl_table=11
FT                   /gene="hepA"
FT                   /locus_tag="PFREUD_00710"
FT                   /product="Helicase (SNF2-related protein)"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55571"
FT                   /db_xref="GOA:D7GHJ9"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHJ9"
FT                   /inference="similar to AA sequence:Uniprot:A0K1K3"
FT                   /protein_id="CBL55571.1"
FT                   /translation="MNARSRTPDITRQWLRGLSEGILRAHYGQDLIDQASALSEGARVV
FT                   TNLVADGGRIKADVADSSSGQTHEFHPEIQLIGYPVRIATWSDRCDCGNPNPCVHATAL
FT                   MLTAKADATEVVATQAPVQHGHEKAAWETALSPALPRFDSDGERELALQFEQVEGVAGF
FT                   GADSRWRISALRAGPDGEWQRAHMSWHDINHPGITLAARADQLNALRGLERLATQGGRR
FT                   AGDILLERMPPELWRVLRRAANTGVTFLHKLGDNAWAPVTVDDHPATLGLDIVAAPHSA
FT                   SASRPAGTSKPSGKNADDTTDTKDPSDFELRTILREGDTVEPFRSGWLLLGNPPHGLLR
FT                   TEPRGALRLTPLADNVDASLRPLLEDSTALKLPAEDLPRFLGLYAPFLRDRMDLVSTDG
FT                   SVEPDQQPTAGCWVRADFSTAGELTLDIGIYLSSDGQVAELTPDEAKRVRLDRDTMALY
FT                   SELRDMAGGPGHSVLTGRDMLDFVSNYLDTLQADERVRVDIVGKRPSFKELTGTADVRL
FT                   TVTDRDAEGHEEDADADASDDVSSAAEESQERPATDWFDLDIDVRIGDEPVPARELLAA
FT                   LVAGQDYLILDSGSWLALDRRELDPLRALVQEASTMVEPGAGTVGISRWQLGLWEELAT
FT                   SGIATIESARWRRRVQALLDVGTAPTPPVPAGVHAELRPYQVEGYGWLSALWDAGLGGI
FT                   LADDMGLGKTLQTLCLVERLHEDSRPRNPSLVIAPTSVMGAWTGEAKKFVPGLNVVMID
FT                   ETSRKSGVPLAEAIKDADLVVTSYTLTRLDAKQFQALDWSMLVLDEAQFIKNREAKTYA
FT                   VIRELRAHLRLAITGTPLENSLMDLWSLLSITAPGVFPDPKAFTERYVKPVETGTGPGR
FT                   VDELKRRIRPLMLRRTKHEVAAELPPKQEFILPVTLGREHRRIYDRQLQAERMNTLGLL
FT                   GDARHHRIEILAALTRLRQLSLAPGLVDEKMLNIGSAKIDTLVEHLRALAGENHRALVF
FT                   SQFTSFLHLVRDRLTTEGIEWEYLDGRTRHRDERVQRFKDGNATAFLISLKAGGFGLTL
FT                   TEADYVYVLDPWWNPAAENQAIDRTHRIGQDKQVMVYRMVSTNTIEEKVVALQQRKRDL
FT                   FDQVVGDQALASGAISVDDIRALLA"
FT   CDS_pept        94210..94494
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24240"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55572"
FT                   /db_xref="GOA:D7GF23"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF23"
FT                   /inference="similar to AA sequence:Uniprot:Q1BDS3_MYCSS"
FT                   /protein_id="CBL55572.1"
FT                   /translation="MSNSRKRHTPEQVVRKLGQADRMLADGSDIAAVCRELGISEQTYY
FT                   RWRNQYGGLKADDAKRLRELEKQNATLKRLLAEAELEKAALKELAEGNF"
FT   CDS_pept        94557..95360
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24250"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55573"
FT                   /db_xref="GOA:D7GF22"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF22"
FT                   /inference="similar to AA sequence:Uniprot:Q26XT5_MYCFV"
FT                   /protein_id="CBL55573.1"
FT                   /translation="MACRLAGLSRSAYRRPLKGDTVADPDRALRDWLRAWAKKHPRYGY
FT                   RRAYHDARGEGWAVNHKKIQRLWRAEGLRVPQRRRRKRVGSSTVDAPAAVAPNLVWAVD
FT                   FQFDADERGCPIKICSIVDEHTRECIGGLVERSITADRLTAHLEELVAVRGAPGVLRSD
FT                   NGPEFISDAMADWAGTRTGLFYIPPGSPWHNGYVESFNSRLRDECLNINSFYSLLHAQV
FT                   VIGDWKTEYNHQRRHSSLGYLPPAEYARQCTHQIETDDSQSDRTE"
FT   CDS_pept        95357..96445
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00720"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55574"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHK2"
FT                   /protein_id="CBL55574.1"
FT                   /translation="MKGAAHSVARLMDVILDDLDEDQGGIGWWRGHVGWQVSAELGEYL
FT                   LSACGGVSEAVIKASLAIQEYRESSCARDHALTHAWRDIAKRGGSRDELIGAQQALGDA
FT                   GQRREDRLDAWLEQTIVSLGQALDRVAAVIVIVAGIKCDVIRTDWGELQKVAVKALKNG
FT                   RGQGLRQGVLADVGTSGRERQNALLSDVLKPEDHGPEDWLSWLIAQRNTMVHRAPRMSL
FT                   IQMVGTRARPTGVINPLPSQPDWVGTRAMIDAGKAGTMSSMFLVSTPQTVLEGLRGSMC
FT                   TFLDQLLKETLGLWGARRSDPRLIVQPGDSWQPVPKSGTLSFPGYGEPASMVTKEIAVH
FT                   PSMGRRLRAARLMDDQVHLWEA"
FT   CDS_pept        complement(96463..97488)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00730"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55575"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHK3"
FT                   /protein_id="CBL55575.1"
FT                   /translation="MDTTDCDPRRGGSHLGERFLASQRGLEMTRDQYAYPNRRNNNLLP
FT                   RDWYSVEEWEGCAWAFRNDDHTEYSDAFLLVKRDQALVNFDLSMSYFGCLDAGEFEDAL
FT                   EQVLSKGRTFKPIMSLPDWEGAAGCYIMVFDHYKQFYVGTTGNIRQRIKQHWSARKLFD
FT                   RILFGTPYDSVFPVDELRPLDTTRLYAARSRNPFSMEERVEKAADRRFCLNRMAGGEPT
FT                   PLMVALTILDPRSRPLVPGVAPMTSEEYQRALTGVHDVVASAVALPPADAGEALASMDM
FT                   GIRAVTLSSGELGFWSRRDEVGRAVVRGDLDTVRYSAFLEALGEHVVWPKADMQRNSVE
FT                   G"
FT   CDS_pept        97697..97771
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00740"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55576"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF53"
FT                   /protein_id="CBL55576.1"
FT                   /translation="MEVLTLAICRKTSTCHTLLSLHLA"
FT   CDS_pept        97738..99045
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24260"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55577"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GG08"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55577.1"
FT                   /translation="MSHPTFTTPCLTTFCGLDELGLEAVGQRLDPDRAVIECRVVEPDR
FT                   WCRECGCEGAPRDTVIRRLAHEPFGHRPTTLLIRVRRYKCCGCGRVWRQDTTAAAPVRA
FT                   KISRGGLAWGLAGLVLDHLSVTRVAAGLGVSWSAANDAILAEGRRRLIDDPARFEGVTT
FT                   IGVDEHVWRHTRHGDTYVTVIIDLTPVRDKTGPARLLDMVAGRSKAVFKTWLAARPKPW
FT                   REGIEVVAMDGFTGFKTAAAEELPDAAPVMDPFHVIRLAGDALENCRRRVQHDVFGRRG
FT                   MKGDPLYQARRTLLTGAGLLTDKQQARLDALFAEDRHVEVEATWGIYQDMITAYRDKDR
FT                   GLGRFFLAHTIDKISASVPEQLVEIRKLARTLTQRASDVLGYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLSHYIARSLLEAGGFRPALHPRS"
FT   CDS_pept        99104..100267
FT                   /transl_table=11
FT                   /gene="aslB"
FT                   /locus_tag="PFREUD_00750"
FT                   /product="Arylsulfatase regulator"
FT                   /function="2.7 Metabolism of sulfur"
FT                   /EC_number="3.1.6.1"
FT                   /note="phenol sulfate + H(2)O = a phenol + sulfate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55578"
FT                   /db_xref="GOA:D7GHK6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHK6"
FT                   /protein_id="CBL55578.1"
FT                   /translation="MTPEVVRAVLQDAIDASPDTAIQFCWQGGEPTLRGLDFYREAFAV
FT                   ARRIVPPGRHFAWSMQTNGVLIDERWAEFLARHDVLVGLSIDGPRDVHDRWRVDRGGRG
FT                   TWAKVMRAARLLHEHGVRFNTFTTVHPANQHRGAEVYRFLRDEVRSDFHQYIPIVVPDP
FT                   ARPGHVVRGLSVDPGAWGEFQVDVFSQWLHRDVGQVFVMNVEWALAAWCGDEPASCMFR
FT                   EHCGDAVVVEHDGSVYSCDHFVDPAHRLGRVGDDSLAAMVADPRQRTFGDAKADLPARC
FT                   RECPVLFACHGECPKNRLMGEAQLTGEDRLTGEDRLTRGPRSEGADPMAGPADGPKVNY
FT                   LCRGYRHFFTAIDAPMRYLAACVLSGRDPARVMPWARQYRILVSPGT"
FT   CDS_pept        100696..102252
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="PFREUD_00760"
FT                   /product="Xylulokinase protein, Carbohydrate kinase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="2.7.1.17"
FT                   /note="ATP + D-Xylulose <=> ADP + D-Xylulose 5-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55579"
FT                   /db_xref="GOA:D7GHK7"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHK7"
FT                   /inference="similar to AA sequence:Uniprot:Q2DBD7_ACICY"
FT                   /protein_id="CBL55579.1"
FT                   /translation="MSERQRTQQGPLVVAIDSSTTSTKAIVVDTNGTVWATARRPIPLL
FT                   TPAMDHYEHDPALWWRTSHETIGEVLGGLSQADRDRVAAIGITHQRESFAPFSADGTPL
FT                   ANGILWLDGRAAEQIERHGSAHVHELSGKPAGVTPAIYKMAWVTQHHPEWFARADKVTD
FT                   VLGAIVFNLTGRWASSTAAADSLGLFDIQRRDWSDELLQIAGVRRDQMPELVAPASPIA
FT                   DIRPELAAEWGLARPIPVIAGLGDGQAAGIGAAAVDPGVGYLNMGTAVNAGVESGSYIY
FT                   NPAFRTHVSGIPGNYVLEVLQSSGSYLAGWVRDTFGDPDHPGDPDVERDNAAAAAIAPG
FT                   ADGLVTLPYWNAVQSPYWDALARGAVVGWRGTHTRAHLYRSVLESICFEMRRNLDELAD
FT                   GTGTPITQLRIMGGGARSGVWRQIMADVTGVPLTVCLEEEISALGAAVLAMAAINAHAE
FT                   PLADGSPDVASSARAMASFGETVHPDMELHERYRRIAAVHARLYPALRETFQELAALSQ
FT                   D"
FT   CDS_pept        102305..103357
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="PFREUD_00770"
FT                   /product="Glycerol-3-phosphate dehydrogenase [NAD(P)+]
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="1.1.1.94"
FT                   /note="sn-Glycerol 3-phosphate + NAD+ <=> Glycerone
FT                   phosphate + NADH + H+ / sn-Glycerol 3-phosphate + NADP+ <=>
FT                   Glycerone phosphate + NADPH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55580"
FT                   /db_xref="GOA:D7GHK8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHK8"
FT                   /inference="similar to AA sequence:Uniprot:GPDA_ARCFU"
FT                   /protein_id="CBL55580.1"
FT                   /translation="MPTITVLGAGAMGSALCRPLADAGWDVRLWGTWLDDHLLDAVEAG
FT                   KPHPRTNVPLAPGVATFRSAQLEQALDGTQVVVMSVASVGVPRVAELALPGIAKADALW
FT                   MTSKGFSEADDGRIGLLPEAIRSIAAAKGVALPPLVAIAGPVKANECAQALPTATIFGC
FT                   RDREVSRSYAAQAATANYAIAHTDDETGVEVCAPMKNVYAIALGVADGLEEKTGVPHHN
FT                   LKAAAFAQAIAEMSLLGAQLGADPATAYGLPGVGDLEVTGLSGRNKVYGVRLGRGEQPQ
FT                   EALAEMDRLEQTVEGVPATALAVRFVEQIGGGLAERMPLLAAVNRLLNDAGVDPMTEVA
FT                   RAVLPVKPTL"
FT   CDS_pept        103431..104207
FT                   /transl_table=11
FT                   /gene="deoR1"
FT                   /locus_tag="PFREUD_00780"
FT                   /product="Transcriptional regulator of sugar metabolism"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55581"
FT                   /db_xref="GOA:D7GHK9"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHK9"
FT                   /inference="similar to AA sequence:Uniprot:Q578X9_BRUAB"
FT                   /protein_id="CBL55581.1"
FT                   /translation="MEQQPATSRDVRIHDVLQVVTREGTIAVKELADELGVSSMTVYRD
FT                   VAALETSGLIQRSHGRVTAAPFSMAEASSLMRMGTELDAKQRIADAALPLLAPGSTIAM
FT                   DDSTTCRHLFPGLGELAPLTVVTNARFIADAVRDSAELELITLGGSYLRWADAYAGPMT
FT                   EAMIDQVSPDVCIMSTTAVTGGVCSHPDEAMAAVKGRLMRAARQRILLVDRTKFSRNAL
FT                   HRFLPLSEVDVVITEKSLDPAHLATLRDQVERVITV"
FT   CDS_pept        104640..105638
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="PFREUD_00790"
FT                   /product="AlkA, 3-methyladenine DNA
FT                   glycosylase/8-oxoguanine DNA glycosylase"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55582"
FT                   /db_xref="GOA:D7GHL0"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL0"
FT                   /protein_id="CBL55582.1"
FT                   /translation="MAGARSGAAGSPAQRTVVGAAGRLDMALGRLAKGPADPTHRRVGA
FT                   QHWWRATRTPDGPALLELFDYHADVVTRAWGEGADWALDQVPRLLGEQDDPSGFAALAA
FT                   DCDLLRRAHHDHPQWRIGATDNLTEALAPAVIEQKVTGPEAFGGLRSLLAKYATPAPGP
FT                   AATPDGPAHGMVVPPTAEQWAHIPSFEFTRAGVDGRRAAALVRAMRRVPSLERALGRAT
FT                   DGAERSRLLQTQPGIGPWTAAKVLQWAYGDPDAWSIGDYHAPALISLALTGQKGDDAFA
FT                   DEVLAPYAGHRYRVELLVTPLVAHAARRGARRTLPSHVPGVGVNRRRSWRR"
FT   CDS_pept        105638..106897
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00800"
FT                   /product="Major facilitator superfamily protein MFS_1"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55583"
FT                   /db_xref="GOA:D7GHL1"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL1"
FT                   /protein_id="CBL55583.1"
FT                   /translation="MASGMESPETEHKASDKPAHKAGRVPTRLRLARLGVLLIFFVNGA
FT                   TFASLVPRYPEIIERLHVSNTLWGLALGIGPIGGIALGWLAAPLMRRYRSRNVAALAQI
FT                   ASSGALVILALAGSIEWVFVAMFAMSAFDAVTDTSMNYHGLRVQRLYRRSIFNSFHGWW
FT                   CIGAVVGGFLGSAAAGAAMAVPTQTYVTVGVLLCCVVASWAMMLPGEDREQVAGTEVAT
FT                   GRAWLRPRTLAVLVGLGLLGALAGGIELGGSAWSPLYMTDQFAATPFVAGLGFVALMVF
FT                   ETLGRLTGDVIVDRLGLVRTVIWGAVACLAGMALALAAPTPVTALIGFGASGWGIATMI
FT                   PNAMNAADGLPSVPAGVGLTITTWVMRVGFVLFPIVIGALGDAVSLRLALLVIPLSAVL
FT                   IMALSPLLRPRPAPQATATG"
FT   CDS_pept        complement(106926..108353)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00810"
FT                   /product="Sensor protein, ATPase-like:Histidine kinase"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /EC_number="2.7.13.3"
FT                   /note="ATP + protein L-histidine = ADP + protein
FT                   N-phospho-L-histidine."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55584"
FT                   /db_xref="GOA:D7GHL2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL2"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5Z3_PROAC"
FT                   /protein_id="CBL55584.1"
FT                   /translation="MIRPLRRAVLGRNGEPRTLQQRFAAMTAAVVALAVAVVGMIAYVS
FT                   TSRSLYGQVDDELVSVAGYMVTPIASDVTGMGGLNSSSLQAANVNIVLVKSDRSIVRVQ
FT                   GEKVSIQPDAPEVAVARMKFGKSTRTVSLGPDGQRYRLVAVPMEAKDNSSYALVLARPL
FT                   EPLVDTLDQLRAILLWLVIGFTIIAAAVGYTIGRRVMQPLRQLSDAVAHVTETDELVPI
FT                   GSTRADELGDLSRAFDTMMHSLASSRNRQKYLIADASHELRTPLTSMRTNVELLVADEK
FT                   SGMLPEGARAEILGDVAAQLGEFTSLVGDLVQLSRDDVVLPSPEPLDFAEVVESAIVRA
FT                   KRRGSSLNFDVSLEPFYVVGEPDTLERAVTNLLDNAVKFSPRGGTVHVHLAGDTLTVSD
FT                   EGPGIAQDDLPHIFDRFYRSNKARNTPGTGLGLSIVAHTVKAHGGWVHADNAPGGGAMF
FT                   TVRLPAAPPEVVAQMDH"
FT   CDS_pept        complement(108350..109045)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00820"
FT                   /product="two-component response regulator"
FT                   /function="1.3 Sensors (signal transduction)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55585"
FT                   /db_xref="GOA:D7GHL3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL3"
FT                   /protein_id="CBL55585.1"
FT                   /translation="MAMQILVVDDDQAVRDSLARSLHYSGYEVETAEDGLEALAKLSTN
FT                   LHPDAVVMDVMMPRLDGLETTKMLRANGNDVPILVLTARDAVGDRVDGLDAGADDYMVK
FT                   PFSLEELLARLRALTRRSRPESQQANEVLSFADMTLDPQTREVTRGGRRISLTRTEFAL
FT                   LQTFMEHPGKVLDRSWLLNEVWGFDFPATANSLEVYIGYLRRKTEQEGEPRLIHTVRGV
FT                   GYVLRETAP"
FT   CDS_pept        complement(109052..109966)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00830"
FT                   /product="Peptidase_E_like"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /note="In bacteria peptidase E is believed to play a role
FT                   in degrading peptides generated by intracellular protein
FT                   breakdown or imported into the cell as nutrient sources.
FT                   Peptidase E uniquely hydrolyses only Asp-X dipeptides
FT                   (where X is any amino acid), and one tripeptide
FT                   Asp-Gly-Gly."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55586"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL4"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5Z5_PROAC"
FT                   /protein_id="CBL55586.1"
FT                   /translation="MTLFLVGGGPSQATGPIYDSFVEQARGRGPRIALAILGAPEQAGA
FT                   SVGMYADPIRQRWPEAQIEPIWLIDEDEGTVEWPTDPEQLGGLVVAGGWAPGYLDALTP
FT                   LRDEIVRIVRGGVPYMGFSAGAQIVAKHAIVGGWQSHGRAVGPEIAGDGSTEIVVRDGL
FT                   GLIGSAVDVHIDSQHLLERAISALLDHDISSAIAIDEDTALVVDVASGRSDVVGSGAVH
FT                   WLNNEGHEVRVRRTQGPQAQPVVEDDTESTSDAGSTGDTASPEDTASPEDTGSSEDTAS
FT                   TGADASADTASPGTESEPPTNEK"
FT   CDS_pept        complement(110022..110486)
FT                   /transl_table=11
FT                   /gene="ptpA"
FT                   /locus_tag="PFREUD_00840"
FT                   /product="Low molecular weight protein-tyrosine-phosphatase
FT                   (protein-tyrosine-phosphatase)"
FT                   /function="3.8 Protein modification"
FT                   /EC_number="3.1.3.48"
FT                   /note="Protein tyrosine phosphate + H2O <=> Protein
FT                   tyrosine + Orthophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55587"
FT                   /db_xref="GOA:D7GHL5"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL5"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5Z6_PROAC"
FT                   /protein_id="CBL55587.1"
FT                   /translation="MSAFDLLFVCLGNICRSTMAEQVARAQAADRALGLRIDSAGVSDW
FT                   ERGNPLDPRAAKCLSAHGYPVGDHRAHLVTDAELGSGLIIGMERSHLDDLASMGAPGDR
FT                   LALITDFVPGDHADGLPDPWYGDMSDFEFTLKVIEAAMPAILDDAASLRR"
FT   CDS_pept        complement(110483..110863)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00850"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55588"
FT                   /db_xref="GOA:D7GHL6"
FT                   /db_xref="InterPro:IPR007165"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL6"
FT                   /protein_id="CBL55588.1"
FT                   /translation="MLWRTVVNAAAMGVATWLLPGISFIGNDTTGQRALTLAIVAIVIG
FT                   LLNAFVKPVLTLVSSCFVVITLGLFLWVINAAVLMFASWLCGAMGVGWHVAGWGSAFVG
FT                   ALIVSVVAMLLGGNRDNYGGRN"
FT   CDS_pept        111002..112006
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="PFREUD_00860"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.1.3.3"
FT                   /note="Carbamoyl phosphate + L-Ornithine <=> Orthophosphate
FT                   + L-Citrulline"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55589"
FT                   /db_xref="GOA:D7GHL7"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL7"
FT                   /inference="similar to AA sequence:Uniprot:Q47NE4_THEFY"
FT                   /protein_id="CBL55589.1"
FT                   /translation="MAVDLSGRNFLKEADFTPEQWAEFLRLAAELKAAKKSGTERPTMV
FT                   GKNIALIFEKTSTRTRCSFEVGAHDQGAHVTYLDPSGSQLGHKESVEDTARVLGRMFDG
FT                   IEYRGFGQSRVQTLADYAGVPVWNGLTDEWHPTQMLADQLTMTERSTKPLREVSVAYVG
FT                   DARFNEGNSHLVSGALSGMDMRIIAPKELQNSAEVIATANEIAATTGARLTVTDDPNAV
FT                   EGVDFVSTDVWVSMGEPKEAWAERIDLLRPYQVNSALLARTGNPKVEVLHCLPAYHNLG
FT                   TAIGREIYELTGMDALEITDDVFEANADVIFDEAENRMHTIKAVMVATLGERG"
FT   CDS_pept        112010..112609
FT                   /transl_table=11
FT                   /gene="mug"
FT                   /locus_tag="PFREUD_00870"
FT                   /product="G/U mismatch-specific DNA glycosylase"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /EC_number="3.2.2.-"
FT                   /note="Excises ethenocytosine and uracil, which can arise
FT                   by alkylation or deamination of cytosine, respectively,
FT                   from the corresponding mispairs with guanine in ds-DNA. It
FT                   is capable of hydrolyzing the carbon-nitrogen bond between
FT                   the sugar-phosphate backbone of the DNA and the mispaired
FT                   base. Required for DNA damage lesion repair in
FT                   stationary-phase cells"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55590"
FT                   /db_xref="GOA:D7GHL8"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL8"
FT                   /inference="similar to AA sequence:Uniprot:Q0S465_RHOSR"
FT                   /protein_id="CBL55590.1"
FT                   /translation="MAKGFTRAELQAFRHQTVPDLLPEPLRLLFVGINPSLWSAGVGVH
FT                   FAHPGNRFYPALAAAGITSHVIDASHGYPPEGLSELERGGVGISNLAREATTKADELDN
FT                   QQFVDGLARIREMVRRYHPKVVAFLGIGAYRVATGDRHAKVGEQALRLDWGDGTGSSAH
FT                   VFALPNPSGLNAHETVESLGRDYREAAEAAGVPLFH"
FT   CDS_pept        112893..113681
FT                   /transl_table=11
FT                   /gene="noxB"
FT                   /locus_tag="PFREUD_00880"
FT                   /product="oxidoreductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55591"
FT                   /db_xref="GOA:D7GHL9"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHL9"
FT                   /protein_id="CBL55591.1"
FT                   /translation="MSSNHASADILATRQATLADPLTLPSGAVIKNRILKGAMNEALGD
FT                   RGAHPTEPLVNLYRHWASGGTGLLLTGNVMVDPRQLGEPGNVAVEDETDMDMLRQWAQA
FT                   GTENGAALWMQINHPGKQSPRTINQHPVAPSAIGFGGKYERFFSMPRELSRGEIEAIVG
FT                   RFARTAVIARDAGFTGVEIHGAHGYLVNQFLSPLDNHRTDEYGGSLENRLFTDEGVAVV
FT                   RPGAARRCRGEGRGLPMMGVLTQPVRKTSTCLTLPSRALT"
FT   CDS_pept        113648..115003
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24270"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55592"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM0"
FT                   /protein_id="CBL55592.1"
FT                   /translation="MPDATFTRPDLTTFTRLDGLGLEVTGQLLEPDRSVLACRVVEPDD
FT                   WCRRCGCQGVPRDTVSRELAHEPFGWRPTTLVLTVRRYRCKECSHVWRQDTTAAAPPRA
FT                   KISRAGLRWGLVGIVVGHLSMARVAEGLGVAWNTANDAVLAEGRRLLIEDPTRLDGVKV
FT                   VGVDEHVWRHTRRGDKYVTVIIDLTPVRDGTGPSRLLDVVEGRSKKAFKDWLAERDQAW
FT                   RDGIEVVAMDGFAGFKTATTEELPDAVTVMDPFHVIRLAGDALDECRRRVQQELHGHRG
FT                   RKGDPLYTARRTLHTGADLLTDRQHERLDKLFAGDRHVHVECTWGIYQRMISAYRHPDR
FT                   AAGRVEMSSVIDALADSVPEALVELRKLGRTLTRSACDVLAYFDRPRTSNGPTEAVNGR
FT                   LEHLRGLALGFRNLTNYIARALLEAGGFRPHLHPHLGRARSRFACRRGWCSR"
FT   CDS_pept        114858..115205
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00890"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55593"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM1"
FT                   /protein_id="CBL55593.1"
FT                   /translation="MAWPSASATSPTTSPAHSSKPADSDHTYTLIWEEPDHDSLVVGAG
FT                   VAVESGPELVVLDGPALAGEPVGHGLGDASGVVAAELVGVSGVFGDRLGSFDRVSLGEV
FT                   EDGHGEESRAA"
FT   CDS_pept        complement(115228..116322)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00900"
FT                   /product="TRNA processing ribonuclease BN"
FT                   /function="3.6 RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55594"
FT                   /db_xref="GOA:D7GHM2"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM2"
FT                   /protein_id="CBL55594.1"
FT                   /translation="MTSTAPSTPRNAPDPEASGKPDSPDDLHKRSWKYVLRKTIREFSS
FT                   DQCTDIAASLTYYAVLSLFPCLIAIFSLLGVVGQGKAASDAVLGIIEQVAPGDTVDTIR
FT                   GPIEQIAESPGAGFALITGILLAIWSASGYVGAFSRAMNRIYEIEEGRPFWKLKPAQLL
FT                   VTVITIVLLVIAAIILVVSGDVTKAIGDALGIGDVPQTIWSIAKWPLLIFIAVLVVAIL
FT                   YYATPNAKQPKFRWISMGALLAIIVLALATAAFGFYVGNFSNYDRTYGSLAGVIIFLLW
FT                   LWIANLALLFGAEFDAELERGRQLQAGIAAEEDIQLPSRDTRKSDKAAEKERQDIEKGR
FT                   EIRQNADPDDTAKDATTPGPAREH"
FT   CDS_pept        complement(116385..116948)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00910"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55595"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM3"
FT                   /protein_id="CBL55595.1"
FT                   /translation="MSDSPDEIRADIERTRHDLGRDVDALADEVSPSKIVDRQVDKVRG
FT                   AFTSVRERVMGAADDAGSSLTDAGSHAGDLKDRAVAKAEGNPLAVGLIAFGAGLLAASL
FT                   IPASSKEKDLAATVKEQAQPLVDEVTDAAKEIGEHLKEPLQASVESVKSSAQDSVATVK
FT                   DEAQGAASDVKDQAQHARDNISDS"
FT   CDS_pept        complement(116945..117106)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00920"
FT                   /product="Hypothetical secreted protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55596"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM4"
FT                   /protein_id="CBL55596.1"
FT                   /translation="MMPGVVVAVLWALIALILFLVGRSQIKQVKGVPQTVDTLKEIPET
FT                   LKRNEENR"
FT   CDS_pept        117132..118241
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00930"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55597"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM5"
FT                   /protein_id="CBL55597.1"
FT                   /translation="MTSYRSAVESVTSSVARLMDVILDDLDEDQGGIGWWRGHVGWQVS
FT                   AELGEYLLSACGGVSEAVIKASLAIQEYRESSCARDHALTQAWRDIAKRGGSRDELIGA
FT                   QQALGDAGQRREDRLDAWLEQTIVSLGQALDRVAAVIVIVAGIKCDVIRTDWGELQKVA
FT                   VKALKNGRGQGLRQGVLADVGTSGRERQNALLSDVLKPEDHGPEDWLSWLIAQRNTMVH
FT                   RAPRMSLIQMVGTRARPTGVINPLPSQPDWVGTRAMIDAGKAGTMSSMFLVSTPQTVLE
FT                   GLRGSMCTFLDQLLKETLGLWGARRSDPRLIVQPGDSWQPVPKSGTLSFPGYGEPASMV
FT                   TKEIAVHPSMGRRLRAARLMDDQVHLWEA"
FT   CDS_pept        complement(118259..118624)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00940"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55598"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM6"
FT                   /protein_id="CBL55598.1"
FT                   /translation="MSTIMVALTILDPRSRPLVPGVAPMTSEEYQRALTGVHDVVASAV
FT                   ALPPADAGEALASMDMGIRAVTLSSGELGFWSRRDEVGRAVVRGDLDTVRYSAFLEALG
FT                   EHVVWPKADMQRNSVEG"
FT   CDS_pept        complement(118509..118931)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="PFREUD_00950"
FT                   /product="gluconokinase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="2.7.1.12"
FT                   /note="ATP + D-Gluconic acid <=> ADP +
FT                   6-Phospho-D-gluconate"
FT                   /db_xref="PSEUDO:CBL55599.1"
FT                   /inference="similar to AA sequence:Uniprot:Q8FLM8_COREF"
FT   CDS_pept        complement(119045..119770)
FT                   /transl_table=11
FT                   /gene="hflC1"
FT                   /locus_tag="PFREUD_00960"
FT                   /product="Stomatin/prohibitin homolog"
FT                   /function="3.8 Protein modification"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55600"
FT                   /db_xref="GOA:D7GHM8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM8"
FT                   /inference="similar to AA sequence:Uniprot:Q73V33_MYCPA"
FT                   /protein_id="CBL55600.1"
FT                   /translation="MLIVLLVSLRVIPEYQRGIAFRFGHLRPTLEPGIHFVFPLVDSLQ
FT                   RVDLRVITLTIPPQEVITKDNVPARVNAVVLFKVLEPKDAILKVENYAIATSQISQTTL
FT                   RSLLGRVDLDTLLAHRDDLNIDLQGVIDARTKPWGIEVSTVEIKDVEIPEAMQRAMARE
FT                   AEAERERRAKVISARGELEASDELRQAAETLSQSPASLQLRYLQTLLELGADQNSTVVF
FT                   PLPLDIIGPLLNKMGNALK"
FT   CDS_pept        complement(119944..120813)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_00970"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /note="no peptide signal, 3 TM domains according to TMHMM"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55601"
FT                   /db_xref="GOA:D7GHM9"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHM9"
FT                   /inference="similar to AA sequence:Uniprot:Q1BBQ5_MYCSS"
FT                   /protein_id="CBL55601.1"
FT                   /translation="MDAPLWGVDFVVWMFCAYALILVGVGYGLDLLAKRTSQQSSAKRN
FT                   FGFHYHENQDAWLCSEDQWLFPTAFDRDNRVMHYRASSIVCNTCQVKNTCTTSMMGREI
FT                   TREVDPWPYSESGRFHRGIALAVAVSGLVLIAGVAILGHTAADIAVEVATAVAVVAASV
FT                   PLARHLMRSPANFVEPTHVKVVDADEIDAAVLADRFAQKWGNVSDERKRAAALERERVL
FT                   ADAAPATGWRGRGTRDTPLHISSALAMKERLKRESRGAEVIHDGSAPIPGGPRPRDIGA
FT                   GREETPDS"
FT   CDS_pept        complement(120818..123085)
FT                   /transl_table=11
FT                   /gene="norB"
FT                   /locus_tag="PFREUD_00980"
FT                   /product="Nitric-oxide reductase subunit B (nitric-oxide
FT                   reductase)"
FT                   /function="2.8 Metabolism of nitrogen/nitrate and nitrite"
FT                   /EC_number="1.7.99.7"
FT                   /note="Reduced acceptor + 2 Nitric oxide <=> Nitrous oxide
FT                   + Acceptor + H2O / Nitric oxide + NADH + H+ <=> Nitrous
FT                   oxide + NAD+ + H2O"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55602"
FT                   /db_xref="GOA:D7GHN0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHN0"
FT                   /inference="similar to AA sequence:Uniprot:Q1BBQ4_MYCSS"
FT                   /protein_id="CBL55602.1"
FT                   /translation="MRTYTDSMPQPDRIVNEQGQEIISSEQISHGQALYQSRGLQEYGS
FT                   VMGHGAYLGPDFTAEYLRLTTDAAVEKYTADGVQDPRQAVEDEWRTNRYDENTGTLVWT
FT                   DQQIAGYHQMVDYYTDFLGSPTTEHGMFPNALEPGEEIEDTTAFFGWTAWASSTNRPGH
FT                   DYSYSNNWPSEPNVGNGPTANLMIWSVLSLIVLLGGIGILFAVYGRWSARIGWHGEEAP
FT                   VLDFRQPDEVHLTPSQKVSGLFFVVIMVLFFAQAMVGALTEHYRVELTGFFGIDIAQIL
FT                   PYTVSRTWHVQLSLLWTAAGFLAAGIFLAPLITRKEPKKQGFLTGVLLVAVAIVVFGSL
FT                   ATEWLSQKGILPEGSLFSQQWEYLDLPRLFQIALTVGMFLWMFIVIRTLRSKLNSTKKT
FT                   SLPWLFMFSGLAIPMFYAVGMLAGSETHFSVAEFWRFWVVHLWVEDFLELFTTVMVAYV
FT                   FVLLGVVRQKMAISIIMLDVILYSLGGVVGTMHHLYFSGTSAETMAFGAVFSAAEVIPL
FT                   TFLTVEAWGFMQLGSRQYTNRTKPFPHRWAVMFLISVGFWNFLGAGIFGFLINLPIVSY
FT                   YEIGTALTANHAHGSMMGVYGMLALAFAVFVLRYIIPEKEWPEKGVKWAFWATNIGLVW
FT                   MVFISLLPLGVAQLYQSVGKGYYDARAIGHITDPGNTLLDWLRMPGDVIFLSGIVPLLW
FT                   LAWKALKSYFSKDSKPVVYELMDPPLYEALTDERIAEMAAANKADAVPDQVSPYRSDRR
FT                   EE"
FT   CDS_pept        complement(122947..123879)
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="PFREUD_00990"
FT                   /product="Leucyl/phenylalanyl-tRNA-protein transferase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="2.3.2.6"
FT                   /note="L-Leucyl-tRNA + Protein <=> tRNA + L-Leucyl-protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55603"
FT                   /db_xref="GOA:D7GHN1"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHN1"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5N8_PROAC"
FT                   /protein_id="CBL55603.1"
FT                   /translation="MLAHVFGLEADWPGQDLVGFTDTIDTELTLAAYASGLFPMPLHES
FT                   DFHGMGWWSPVRRAILPLGALRVSHSLRQALNHYRTSVDTAFEQVLAGCADPKRPDGWI
FT                   DQDVVAVYTQLFERGVAHSVETWDDEGRLVGGLYGVGMRGLFAGESMFHDPEHGRDASK
FT                   VALVRLVDTLRARPDGVALSADVWVFPRPPPYVPAARTRLIPSTLTVWQRKQSCQARTS
FT                   RPLSRSQKPNRGPKPYRPTHPRAGCRPSLSSCCWVSASWQRLRCAPTPTRCPSPIASSM
FT                   SRARRSSPASRSATVRRSTRAAACRNTAR"
FT   CDS_pept        123102..123161
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01000"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55604"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHN2"
FT                   /protein_id="CBL55604.1"
FT                   /translation="MPKPSNMTKATACTQPLDA"
FT   CDS_pept        complement(123962..124159)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01010"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55605"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHN3"
FT                   /protein_id="CBL55605.1"
FT                   /translation="MAVKRGTTYCTFGTQVQTALAADATRTSLTLTNSQTRRSVAVTCA
FT                   KGTTITTCTGDDGSVVWLRG"
FT   CDS_pept        124247..124552
FT                   /transl_table=11
FT                   /gene="tnpC"
FT                   /locus_tag="PFREUD_24280"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55606"
FT                   /db_xref="GOA:D7GF57"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF57"
FT                   /protein_id="CBL55606.1"
FT                   /translation="MSTGNEKTRRQRRKFTAQYRHEAARMVIDSGRTIAEVAQELGLGP
FT                   QLLGRWVKAEKETMTPSTLSPDEREELKRLRKENADLRMDNEFLGKAAAFFAAKHQ"
FT   CDS_pept        124549..125457
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24290"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55607"
FT                   /db_xref="GOA:D7GF56"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF56"
FT                   /protein_id="CBL55607.1"
FT                   /translation="MSEKYTLMQAEKARYPIARMARLLKVSTSGYYAWVAAQQRDGDHL
FT                   LPSLRARRRLDEAVRRIWVDSRSTYGYLRVCAQLRREGVVVDRKTVAASMRRQGLAGIS
FT                   PRRFRPVTTIPGTRTHSIPDRVKRHWDTGQVDRVWVTDITYLRTRAGWVYLCAIKDACY
FT                   RKVIATAMSTTMTTDLVEEALRRARILRPNAPRKVIIHSDRGTQFTSEQMYECCRELHL
FT                   DQSMGRTGVCWDNAMIESQWSVLKAEFYDRYEWDTPQQAIQGVEEWIYDFYNTKRLNSA
FT                   IGYQTPVEFEAQHAAALTRAA"
FT   CDS_pept        complement(125381..125719)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24300"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55608.1"
FT   CDS_pept        125520..125546
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01020"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55609"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHN7"
FT                   /protein_id="CBL55609.1"
FT                   /translation="MTSFGGWR"
FT   CDS_pept        complement(125742..126104)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24310"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55610.1"
FT   CDS_pept        complement(126139..127026)
FT                   /transl_table=11
FT                   /gene="tnpB"
FT                   /locus_tag="PFREUD_24320"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55611"
FT                   /db_xref="GOA:D7GE48"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GE48"
FT                   /inference="similar to AA sequence:Uniprot:A0QCS7"
FT                   /protein_id="CBL55611.1"
FT                   /translation="MDGRRLGVELICRLLQVAPSSYYAAKTRAPSARALRDEELIPQLV
FT                   EIWEANYRVYGVRKLWKAARRGGIMIGRDQTARLMRVAGIEGARRSKRVKTTRPDPASS
FT                   RHPDLVKREFTATAPNRLWVTDLTFVPTWAGVAYVCFIIDAFSRMIVGWRVASHMRTEM
FT                   VLDAIEMARWSRGAHHEDLRCHSDAGCQFTSIRYGERLAEIGATPSIGTVGDSYDNALA
FT                   ETVNGYYKAELVRGPTRSGPWKTVEDLELATLGWVHWHNTQRLHGYLGDVPPAEFENAF
FT                   YAVPNDSNLLIGIK"
FT   CDS_pept        complement(127059..127403)
FT                   /transl_table=11
FT                   /gene="TnpD"
FT                   /locus_tag="PFREUD_24330"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55612"
FT                   /db_xref="GOA:D7GE49"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7GE49"
FT                   /inference="similar to AA sequence:Uniprot:Q1BDJ0_MYCSS"
FT                   /protein_id="CBL55612.1"
FT                   /translation="MPKELANGKPTTRRYSVEEKAAAVRMVRTLRAELGVTQGTVQRVA
FT                   TQLGYGVESVRMWVKQADVDDGVVPGVSSAEEQRVKELEQENRELRRANEVLKRAASFF
FT                   GAELDRHYRK"
FT   CDS_pept        complement(127442..128350)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24340"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55613"
FT                   /db_xref="GOA:D7GF56"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF56"
FT                   /protein_id="CBL55613.1"
FT                   /translation="MSEKYTLMQAEKARYPIARMARLLKVSTSGYYAWVAAQQRDGDHL
FT                   LPSLRARRRLDEAVRRIWVDSRSTYGYLRVCAQLRREGVVVDRKTVAASMRRQGLAGIS
FT                   PRRFRPVTTIPGTRTHSIPDRVKRHWDTGQVDRVWVTDITYLRTRAGWVYLCAIKDACY
FT                   RKVIATAMSTTMTTDLVEEALRRARILRPNAPRKVIIHSDRGTQFTSEQMYECCRELHL
FT                   DQSMGRTGVCWDNAMIESQWSVLKAEFYDRYEWDTPQQAIQGVEEWIYDFYNTKRLNSA
FT                   IGYQTPVEFEAQHAAALTRAA"
FT   CDS_pept        complement(128347..128652)
FT                   /transl_table=11
FT                   /gene="tnpC"
FT                   /locus_tag="PFREUD_24350"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55614"
FT                   /db_xref="GOA:D7GGH2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GGH2"
FT                   /protein_id="CBL55614.1"
FT                   /translation="MSTGNEKTRRQRRKFTAQYRHEAARMVIDSGRTIAEVAQELGLGP
FT                   QLLGRWVKVEKETMTPSTLSPDEREELKRLRKENADLRMDNEFLGKAAAFFAAKHQ"
FT   CDS_pept        complement(129036..129842)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01030"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55615"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHP3"
FT                   /protein_id="CBL55615.1"
FT                   /translation="MVANQMHTLRVRVRGLSRGYIRGVLSALAVVPADWSGVRGLVLGG
FT                   LHIDIARGSAHIECTAGRDVPDEPTARLVRQWSSTTMDELDGAFTPEGFSTAWGARYAG
FT                   LDAGYERLLVGSARWMIDARQERALHKSYILDVLDVFDVVPVPAQEFSTTFESLLRAAH
FT                   LRHEEDGGPDGSAVGPRMVLLGRAGTVALDHFECSELDGRYAPDQLRERAGSRAEGYRK
FT                   RWQTILAYASDAAAGEGIADAPAGRITFDDVSDEQARRRLQGRLGR"
FT   CDS_pept        complement(130020..131555)
FT                   /transl_table=11
FT                   /gene="gntK"
FT                   /locus_tag="PFREUD_01040"
FT                   /product="Gluconate kinase (Gluconokinase)"
FT                   /function="2.1.2 Main glycolytic pathways"
FT                   /EC_number="2.7.1.12"
FT                   /note="ATP + D-Gluconic acid <=> ADP +
FT                   6-Phospho-D-gluconate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55616"
FT                   /db_xref="GOA:D7GHP4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHP4"
FT                   /inference="similar to AA sequence:Uniprot:Q8NLD4_CORGL"
FT                   /protein_id="CBL55616.1"
FT                   /translation="MTETMMPGNQTTEIPEARPVPFARAIGPFVLAMDIGSTSTRAALY
FT                   DAMARPVLEQNAVAEHHFVEGADGTSEIDADQMADEVAETITGALAGLEPGTVSAVAMD
FT                   TFAASLICVDAQGRAISPCMTYADSRSAPQLAELRKVLDLDEAQQAVGVRLHTSYHPPR
FT                   LLWIKQNHPDFWARTARFVSLGEYVFTKLAGVDACATSTMAWAGMLNRHSGQLDDDLLS
FT                   VTDTRADQYAQIVDPDQPQTPDPGLIDDRWPALSGAKWFPTIPDGYASNIGVGAVGAET
FT                   VALSAATSGAMRVIVPGTPEKLPSGLWAYRVSRHESIVGGALNDVGRVMTWLTTTFAPV
FT                   DATERDTALRAAPRPDTPLVLPFLTGERATGWSGNARAVFCGVTAASGPWDMWRGTVEG
FT                   VAISYRRIFEQLRSIDVNIERILASGGVTHHFPATLDVITNALGYPVHVVNMERMTMRG
FT                   TAMMALGVINPEGKFATAPQHSVNNPDPSQAPYYDDLRKRFEEVYDEVIAGKE"
FT   CDS_pept        complement(131814..132677)
FT                   /transl_table=11
FT                   /gene="mutM1"
FT                   /locus_tag="PFREUD_01050"
FT                   /product="Formamidopyrimidine-DNA glycosylase (Fapy-DNA
FT                   glycosylase) (DNA-(apurinic or apyrimidinic site) lyase
FT                   mutM) (AP lyase mutM)"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /EC_number="3.2.2.23"
FT                   /EC_number="4.2.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55617"
FT                   /db_xref="GOA:D7GHP5"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHP5"
FT                   /inference="similar to AA sequence:Uniprot:Q9RCW5_STRCO"
FT                   /protein_id="CBL55617.1"
FT                   /translation="MPELPQVEALADFLRTDLVGSVIERLEVGAISALKTFDPPPDALV
FT                   GRTVTAINRFGKHLDVDAGGLHLVFHLARAGWLVWREKVPSTVIKPGKSRIALRVRLQG
FT                   GAGFDLTEAGTQRKLAVWIVRDPQQVPSIASLGPDPMAPGFTPAVFRQILAGAGRAQLK
FT                   GILRDQHVIAGIGNAYSDEILHDAKLSPFKPAANLTDDEVERLYAAIRDGLAAATERAR
FT                   GLAARDIKADKRAQLRIHGHAGDPCPVCGTPIASVNFADSSLQYCPVCQTGGKKLADRR
FT                   MSKLLK"
FT   CDS_pept        complement(132670..133395)
FT                   /transl_table=11
FT                   /gene="aatB"
FT                   /locus_tag="PFREUD_01060"
FT                   /product="Leucyl/phenylalanyl-tRNA-protein transferase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="2.3.2.6"
FT                   /note="L-Leucyl-tRNA + Protein <=> tRNA + L-Leucyl-protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55618"
FT                   /db_xref="GOA:D7GHP6"
FT                   /db_xref="InterPro:IPR004616"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR042203"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHP6"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5N8_PROAC"
FT                   /protein_id="CBL55618.1"
FT                   /translation="MLAHVFGPEASWPSQDLVGFTEQIDAGLTMAAYASGLFPMPLHES
FT                   EFHGMGWWSPMQRGIIPLPSLRVSHSLRQALRRYRTTIDTSFDEVLAGCADPTRPGSWI
FT                   DDDVKAIYTGLFERGVVHSVETWDDDDRLVGGLYGVGLRGLFAGESMFHDREHGRDASK
FT                   VALVRLVDTLSARPDGKALLDTQWLTPHLASLGGVEIPRHRYLELLDDALDAPETAWPA
FT                   PGVFTRGRALPPAQGGSHA"
FT   CDS_pept        complement(133942..136128)
FT                   /transl_table=11
FT                   /gene="pkaA"
FT                   /locus_tag="PFREUD_01070"
FT                   /product="Serine/threonine protein kinase"
FT                   /function="3.8 Protein modification"
FT                   /EC_number="2.7.11.1"
FT                   /note="ATP + Protein <=> ADP + Phosphoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55619"
FT                   /db_xref="GOA:D7GHP7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHP7"
FT                   /protein_id="CBL55619.1"
FT                   /translation="MTQDNSGSAEKPFRLGTNYQVETPLGHGVVGTTWRGTGAGGAELA
FT                   FTVLNKRFASNPQVVRHLLAQRPVLATVRGDHVVPVVDMVADSDVVAVVSPYIKGTDLR
FT                   SRLDDEGTLPPAEACRIISETAQGLATLHATGLTHRDVKPSNILLDDTQQPASAKVTDY
FT                   AVGGIVEEWAGGGHSAVLASTPAYLSPEVIAGDPVTVQSDMYALGVVLYESLCGVTPFA
FT                   PLQPEGTMQAILTLDPGRPRGVDDALWEVLSMLLNRDPRQRGSADALSWRLSELQNALA
FT                   DAPKLPKLDVSPSPTPLPQVMAFPGAAPTTAPQIVGQVPAPNQPGPNQLGPNQPGPNQV
FT                   GGGQPGAQGAGFQGPAAGVLAAGAVIGAAAAAVPTQQAAAQPTQAASGPSDAGQVAGGQ
FT                   TAAGQAGPAQGQGGQGQPVQGQPGQDQSGQGAQGQPLQGQPAQGQPGQQPSPQSGAAGQ
FT                   APGQPAADQPAPYQGAAPQPVPHQVAASQPGGAPQGAPAQQPTAAFAAQQAPTQELPAQ
FT                   AAAQMGGAQTPPPVPPAPQRAHPEPEPQRGRPLRRRPKFIVGLVLVIVIGLAAAAAIAV
FT                   AVTRLNSSSSSSSASQSSVTPTPSETPTPTPTPTPTPTPTPEVWPPDANAVICTSGGTM
FT                   AVKRGTTYCTFGSTVQQALAAGTLTAPSAAPGAAAATPATGATPATGTTPAAGGATVSL
FT                   RNTQTGTSVAVSCTSGATITTCSGNDGSVVWVRK"
FT   CDS_pept        complement(136443..137051)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01080"
FT                   /product="secreted transglycosydase"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55620"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHP8"
FT                   /protein_id="CBL55620.1"
FT                   /translation="MSKTLSRIASVASVAALAGSITVIAGQNASADSVNWDAVAACESG
FT                   GNWGTNTGNGYQGGLQFSSSTWNAYGGGQYASSANQASRDQQIAVAEKVLAGQGIGAWP
FT                   VCGANAGSAGSYTSTNTGGTAASTSNAASSTTRSTARTESTYTPARAASTGGNYTVQSG
FT                   DTLNTIAAAHGTTWQALYAANKSNITDANLIYAGETLNV"
FT   CDS_pept        complement(137263..138567)
FT                   /transl_table=11
FT                   /gene="gltA2"
FT                   /locus_tag="PFREUD_01090"
FT                   /product="Citrate synthase"
FT                   /function="2.1.3 TCA cycle"
FT                   /EC_number="2.3.3.1"
FT                   /note="Citrate + CoA <=> Acetyl-CoA + H2O + Oxaloacetate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55621"
FT                   /db_xref="GOA:D7GHP9"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR019810"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHP9"
FT                   /inference="similar to AA sequence:Uniprot:Q6A7U2_PROAC"
FT                   /protein_id="CBL55621.1"
FT                   /translation="MGETAKLEIDGEVYELPVVQGSTGEKAIDISKLRNTTGLITLDEG
FT                   YANTGSCRSAITHIDGEKGELSYRGIPIETLAEHSTFIETAWLVIFGRLPTELEREHFS
FT                   ELLSQNAALHTQMRAHFAAFPEQAHPMAILSAMINAISTHDRPKIAPDDDATLERYAAN
FT                   LMSKVRTIAAGSYKTSIGEPLIYPRRDLLYTQNFLHMMFSLPYQEYEASPQAVHALNLF
FT                   WLLHADHEQNCSTSTVRMVASGEANLYASCSAGVVALWGGRHGGANVATVQMLQRIRNE
FT                   GLSPKQFLAQVKDKESNIRLSGFGHRIYKSYDPRARLLEKAATDLLDATDSKDPLLPLA
FT                   QELAAEALSDDYFAERSLYPNVDFYSGVILRAVGIPLNMFTVMFAIGRMPGWIANWREI
FT                   NNDPNGRIYRPRQVYTGPPYVQWREYADRISQPGE"
FT   CDS_pept        139026..139829
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01100"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55622"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHQ0"
FT                   /inference="similar to AA sequence:Uniprot:Q6A617_PROAC"
FT                   /protein_id="CBL55622.1"
FT                   /translation="MPTRKRSNTGSTVGAIGATVVAMAPTIAPGPSANLLRRLADYAID
FT                   GVGPLPGARIAAGHALEHKTGDVEAALDSLVRNHVAMAGAQGFVSNLGGVVTAIAAIPA
FT                   NLAAVAVVQTRMVATIAHLRGYDLSDLRVREAIWMTLLGRHDVDDLVAAGKLPSTPLGV
FT                   ATAPVLDSALEQRIAEQVLATLVGRSGGKQTLAMMSKRIPLVGGGVGMATDGWFTWTVA
FT                   SYARDVFAPRRLPELPGPEQVVDEEQPAPQPESDVRDAEWSEEDD"
FT   CDS_pept        complement(139940..140809)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01110"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55623"
FT                   /db_xref="GOA:D7GHQ1"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="InterPro:IPR025962"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHQ1"
FT                   /protein_id="CBL55623.1"
FT                   /translation="MVLLAIVNLAAAVLLIAMGVLGQRHALPRNGWAGIRTATTMTNDD
FT                   TWDAAHVAAAPAFVIGGLVQLLLAATALVLAGNDDLNGAGVAIVFTVVWLVTLTAAVAM
FT                   AAVVGVRASKAVLVRQQQQLVAVGAHGHSASASDEVLGAEPPGEWISRDPARTVAAIVM
FT                   ALVPAALMMVLRSSVFADLPAKVPQHWGLSGPPDAWVSSNTAFWLGFVAACVLGVAAIS
FT                   VLLVARTARARRGYYSLFTIMAFIASGGWLASALYGIGIAIGGWQSGLIIAAAAVLGLV
FT                   ARYIVPDA"
FT   CDS_pept        complement(140988..142493)
FT                   /transl_table=11
FT                   /gene="vpr"
FT                   /locus_tag="PFREUD_01120"
FT                   /product="Peptidase Subtilases"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="3.4.21.-"
FT                   /note="Subtilases are a family of serine proteases."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55624"
FT                   /db_xref="GOA:D7GHQ2"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHQ2"
FT                   /protein_id="CBL55624.1"
FT                   /translation="MGLSSSAIARADDGLWYLDQFGVRDAHAQGLDGSGVTISVIDSPL
FT                   VSDYPALSDANISYDTVPQSTRAPGGRSEGYDACYQNGQKIVASFKSGQAMDPDAPGDP
FT                   IFITHGTEMTSRIVGNGKGYGSDPGFEGIAPRAAVKFFANSGGIGSGDVADNSCEGPDG
FT                   SALGTDLATTGLGIARAVGAGARVVSMSFLTSVDADDYPGFLSALQHGVIMVSARDNSQ
FT                   EPGLPDMVGDPSRLTGLPGLVTVNSIGPSGPLAPSSDTTDGSVAILSPGNEVLIAPAMD
FT                   TRVLDVANGGTSSAVANLSGMLTLALQKWPDATGNQIMQSLVANTRDSDGTATLDEGHE
FT                   RGFGVVDLTKLLAVDPTGYPDVNPILDQEVTRAAEHGETADMYDAQCAADSAQTTEYQF
FT                   GDVTMKVPCQAGQFKQELVRQQDAWAAVQQCRADGGADCMRLSATNTAPAVSKQAGAVQ
FT                   APAAPVRTSTHAGVWVAAATGALAVVAVATGGVILHRRRRSSH"
FT   CDS_pept        complement(142614..143762)
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="PFREUD_01130"
FT                   /product="Alanine racemase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="5.1.1.1"
FT                   /note="L-Alanine <=> D-Alanine"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55625"
FT                   /db_xref="GOA:D7GHQ3"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHQ3"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5H2_PROAC"
FT                   /protein_id="CBL55625.1"
FT                   /translation="MLYTTHLEIDLDALRHNARAIKQLVGDRKVLVAVKADGYGHGAVP
FT                   IARLFQREHLADWLGVATVSEAMALREGGVTLPILKLSHAFPEELPTAIDADIALTVVD
FT                   EQSADEAAEAAKVVGKPVNVHLALDTGMRRIGAEPEHAVALARHIDEDALNLQGIFTHM
FT                   PVSDTTQGYDFTVEELARFAKAVDDVQADRATRGLPAVPLVHAAASAGVLGHDLSGLTM
FT                   VRPGIAIYGAYPDAQTPRTAALRPVVTMRSKVSFIKRIRAGETVSYGRTWTAPTDRWIA
FT                   TVPVGYADGFNRLNSNRGRMLINGRSFPVAGRVCMDQTMLDLGEADDHGVHRGDDVIII
FT                   GASGDEYISTDELAELAGTISYEVTAVIPPRVSRQYFDSAAE"
FT   CDS_pept        complement(143935..145488)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01140"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55626"
FT                   /db_xref="GOA:D7GHQ4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHQ4"
FT                   /protein_id="CBL55626.1"
FT                   /translation="MTSASSTHSRERHILLGVTGSIAAFKAAQLASDWVKQGHQVRVLM
FT                   TAAAAQFVSPLTFQSLTHQSVRIAMFDDSGASQTATDDGMHVGITHIDDAKWADVFVIA
FT                   PASADVIARIAAGMANDHLTATLLAATCPVVLAPAMNTRMYDNPVTQRNMTTCRQLGMS
FT                   FVEPSSGLLACEDVGKGRLAELSDIEWAVDEALEGMSAPRFDADVAGPGRSGAARAEAP
FT                   RPTSDVESAGATPSDAGSSDAGPIDAAVIDAAMADAEPSTTLVVPDSVTSDVVVPDAGA
FT                   MPPLRAGGPAGGAEGLLSGVRVLITAGPTREPIDPVRFLSNHSSGRMGYALASAAHDLG
FT                   AAVTLVSGPVSLPEPAGVTMVQVQTAAEMFDAVTARFEQADLVVMAAAVADFAVAAQAD
FT                   QKIKKRGRRALTLQLEATPDILAWCGEHRHPGQVLCGFAMETTELVAHATEKLARKGAD
FT                   MIVANSLTTPGAGFGTDTNVVTILTATDGEPHRDDLPMMTKRELAGQILARMAALRVSA
FT                   "
FT   CDS_pept        complement(145532..145876)
FT                   /transl_table=11
FT                   /gene="arsR1"
FT                   /locus_tag="PFREUD_01150"
FT                   /product="Transcriptional regulator, ArsR family protein"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55627"
FT                   /db_xref="GOA:D7GHQ5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHQ5"
FT                   /inference="similar to AA sequence:Uniprot:Q2BDF5_9BACI"
FT                   /protein_id="CBL55627.1"
FT                   /translation="MTASHDDCALESLLILNQCIPLFETLKDPERQSILVRLIEHGPLT
FT                   VNEVAESSSLSRPAVSHHLKILERNGLVSMTKEGTRRICRAETQTGLSLLKRLVSALEA
FT                   DLAEVPGVAH"
FT   CDS_pept        complement(145879..146526)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="noxB"
FT                   /locus_tag="PFREUD_01160"
FT                   /product="FMN oxidoreductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="PSEUDO:CBL55628.1"
FT                   /inference="similar to AA sequence:Uniprot:Q72ZZ9_BACC1"
FT   CDS_pept        146609..146683
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01170"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55629"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF53"
FT                   /protein_id="CBL55629.1"
FT                   /translation="MEVLTLAICRKTSTCHTLLSLHLA"
FT   CDS_pept        146650..147957
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24360"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55630"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GG08"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55630.1"
FT                   /translation="MSHPTFTTPCLTTFCGLDELGLEAVGQRLDPDRAVIECRVVEPDR
FT                   WCRECGCEGAPRDTVIRRLAHEPFGHRPTTLLIRVRRYKCCGCGRVWRQDTTAAAPVRA
FT                   KISRGGLAWGLAGLVLDHLSVTRVAAGLGVSWSAANDAILAEGRRRLIDDPARFEGVTT
FT                   IGVDEHVWRHTRHGDTYVTVIIDLTPVRDKTGPARLLDMVAGRSKAVFKTWLAARPKPW
FT                   REGIEVVAMDGFTGFKTAAAEELPDAAPVMDPFHVIRLAGDALENCRRRVQHDVFGRRG
FT                   MKGDPLYQARRTLLTGAGLLTDKQQARLDALFAEDRHVEVEATWGIYQDMITAYRDKDR
FT                   GLGRFFLAHTIDKISASVPEQLVEIRKLARTLTQRASDVLGYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLSHYIARSLLEAGGFRPALHPRS"
FT   CDS_pept        147994..148302
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24370"
FT                   /product="Putative transposase subunit"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55631.1"
FT   CDS_pept        148238..148552
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24380"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55632.1"
FT   CDS_pept        complement(148571..149509)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01180"
FT                   /product="Restriction endonuclease PvuRts1 I"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55633"
FT                   /db_xref="GOA:D7GHR1"
FT                   /db_xref="InterPro:IPR040674"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHR1"
FT                   /protein_id="CBL55633.1"
FT                   /translation="MEKLEYLARTLSRTSRKDYENYVVNAVWNRLDDSEVQPVSQKLVA
FT                   IDPRSRYFIDLYFPQLNMGIECNEPYHATRSEQDAGRTITIFDVLHQVQPNSGYQQLDI
FT                   DVFVRGHTGNVQWAPLEAVDNAIDDVVGKLRARIETLRQSGGFSPWVIEPDDPFAYFQN
FT                   RDEISMADDIGFANIATVCNSILGSSYSLESRGPRKSCFVPSSLRSIYGSEYLVWFPKK
FT                   AVAGHAVSRGWNNMLSDDGLSLDEYNEDWNAIDSATGQKRVVFIQAVDPVTRVRAYRFA
FT                   GVFLRDGVSEIGGVPRKHYRRISDKFTVVHG"
FT   CDS_pept        complement(149691..149897)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01190"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55634"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHR2"
FT                   /protein_id="CBL55634.1"
FT                   /translation="MEAGEVSDGISERAVAGMSAGSVEHGRGLLRTGESERFPFKKAPT
FT                   LLTSTDTPLSPPHDTQASLTKPR"
FT   CDS_pept        complement(149916..150023)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01200"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55635"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHR3"
FT                   /protein_id="CBL55635.1"
FT                   /translation="MEETLLATIRHSLDPTGGAEHSPRVGLDVQTQARR"
FT   CDS_pept        150110..150601
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24390"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55636.1"
FT   CDS_pept        150653..150997
FT                   /transl_table=11
FT                   /gene="TnpD"
FT                   /locus_tag="PFREUD_24400"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55637"
FT                   /db_xref="GOA:D7GE49"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7GE49"
FT                   /inference="similar to AA sequence:Uniprot:Q1BDJ0_MYCSS"
FT                   /protein_id="CBL55637.1"
FT                   /translation="MPKELANGKPTTRRYSVEEKAAAVRMVRTLRAELGVTQGTVQRVA
FT                   TQLGYGVESVRMWVKQADVDDGVVPGVSSAEEQRVKELEQENRELRRANEVLKRAASFF
FT                   GAELDRHYRK"
FT   CDS_pept        151030..151917
FT                   /transl_table=11
FT                   /gene="tnpB"
FT                   /locus_tag="PFREUD_24410"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55638"
FT                   /db_xref="GOA:D7GE48"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GE48"
FT                   /inference="similar to AA sequence:Uniprot:A0QCS7"
FT                   /protein_id="CBL55638.1"
FT                   /translation="MDGRRLGVELICRLLQVAPSSYYAAKTRAPSARALRDEELIPQLV
FT                   EIWEANYRVYGVRKLWKAARRGGIMIGRDQTARLMRVAGIEGARRSKRVKTTRPDPASS
FT                   RHPDLVKREFTATAPNRLWVTDLTFVPTWAGVAYVCFIIDAFSRMIVGWRVASHMRTEM
FT                   VLDAIEMARWSRGAHHEDLRCHSDAGCQFTSIRYGERLAEIGATPSIGTVGDSYDNALA
FT                   ETVNGYYKAELVRGPTRSGPWKTVEDLELATLGWVHWHNTQRLHGYLGDVPPAEFENAF
FT                   YAVPNDSNLLIGIK"
FT   CDS_pept        152007..152960
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01210"
FT                   /product="Appr-1-p processing, ADP-ribose-1-monophosphate)
FT                   processing activity"
FT                   /function="4.6 Miscellaneous"
FT                   /note="may play roles in distinct ADP-ribose pathways, such
FT                   as the ADP-ribosylation of proteins, an important
FT                   post-translational modification which occurs in DNA repair,
FT                   transcription, chromatin biology, and long-term memory
FT                   formation, among other processes."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55639"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHR7"
FT                   /protein_id="CBL55639.1"
FT                   /translation="MTAISAVVGDITTQDVDAIVNPTNTEMRPGGGVDRAIHDAAGPGL
FT                   LEEVRSRFPTGLAVGDAGWTHGGRLAARYVIHTVGPLQPTSKKSEQLLASCYRRCLQIA
FT                   DELGIQTIAFPVIGVWSYGWPGNKAIPIEARTLMESPSSVSRIMIIASDEVIRDQVLAC
FT                   LINKAWLRLLQGVRVLHERGFEGVRVWAGFGPVGGWRIQITDVDYMKKLPDSEIYIARE
FT                   YRSDRVYWNRWGAQVGKTLITNLTTPGEVADLLLGEVPYLAQKKSDPEYVVWYQALVSV
FT                   CEGLEAQPWTSSDWVTPPGWGIGQKVVFPYPPAPKG"
FT   CDS_pept        complement(153075..154643)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01220"
FT                   /product="DNA polymerase"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55640"
FT                   /db_xref="GOA:D7GHR8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHR8"
FT                   /protein_id="CBL55640.1"
FT                   /translation="MSLLRQLARLFGHRQTSEEPATQAGRAGFPPPSRAQGAGFPPPSR
FT                   AQSAGFPPPGAALLAEFPPPNAVPNAATPPPQRPTAARRQAPSDPTTDTSFVPAQRTAA
FT                   PAAGFPPVATAEPVMVPAKPITIPVELVIEPAHPVTAPASQQFGTATPDASGWYMPTYR
FT                   ERDISDWVPEVRRLKRSGELEAALTLATGCMDAMVQAAERNPANVMEHYVIEVVRIQHK
FT                   MARYSDEVNTIESWLGREIPASRDDHRLDLRKRLAKARELVARSEGRDSSAHHAEWKRL
FT                   VALQKASKQQGAPASTPPARQSPRAQVIPERAAASHQPAPSRARASSSRRRPSKFIPAL
FT                   DEFLAQPFVAADFETANRSSGVSACQIALVRVESGRVVDRFNTLLKPPSGFDDFEFTYL
FT                   HGISARDTRTAPSWPDIIPAIRGFAGDATVYAHNAPFDSRVWRQLDEFFHTRSLPDHFF
FT                   CSYLTARRMMPGLDNYRLPTVLERCAPHFVLDHHKADSDAEACALIVAALQSNPELYAR
FT                   LEAHR"
FT   CDS_pept        complement(154717..157755)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="hsdR"
FT                   /locus_tag="PFREUD_01230"
FT                   /product="Type I restriction enzyme"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /EC_number="3.1.21.3"
FT                   /db_xref="PSEUDO:CBL55641.1"
FT   CDS_pept        complement(157752..158243)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="hsdS"
FT                   /locus_tag="PFREUD_01240"
FT                   /product="Type I restriction enzyme EcoR124II specificity
FT                   protein (S protein) (S.EcoR124II)"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /db_xref="PSEUDO:CBL55642.1"
FT   CDS_pept        complement(158339..158617)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01250"
FT                   /product="Methylase_S, type I restriction enzyme"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55643"
FT                   /db_xref="GOA:D7GHS1"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS1"
FT                   /protein_id="CBL55643.1"
FT                   /translation="MILKFQIPLPPLVVQHEIVKILDTFTNLEAELEAELEAELEAELE
FT                   AELEAELEAELEAELEAELEARRAQYEHYRDRLLSFNETPRRSGGSL"
FT   CDS_pept        complement(159010..160578)
FT                   /transl_table=11
FT                   /gene="hsdM1"
FT                   /locus_tag="PFREUD_01260"
FT                   /product="Type I restriction-modification system DNA
FT                   methylase"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55644"
FT                   /db_xref="GOA:D7GHS2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR004546"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS2"
FT                   /protein_id="CBL55644.1"
FT                   /translation="MTESTKESERAELHKTIWRIANDLRGSVDGWDFKSYVLGMLFYRF
FT                   ISENLTAYINKGEHAAGDVDFNYADLPDSDAAMALRETVDEKGFFILPSDLFENVRHDA
FT                   PHNPNLNETLANAFANIENSAAGTSSEGDLKGLFDDLDVNSNRLGNSVMQRNEKLVKLL
FT                   DAVGDLPLGNFGEHTIDLFGDAYEYLMTMYASSAGKSGGEFYTPQEVSELLTRITVVGK
FT                   THVNKVYDPACGSGSLLLKFGQVLGQGGVRKGYFGQEINLSTYNLCRINMFLHGINYSD
FT                   FDIALGDTLTEPKHWDEEPFEAIVSNPPYSIHWAGNDNPTLINDPRFSPAGVLAPKSKA
FT                   DLAFTMHILSWLAVNGTAAIVEFPGVLYRGGAERKIRKYLIDNNFVDTVIQLPPDLFFG
FT                   TTIGTCIIVLKKSKRDNSVLFVDGSAEFVRPGNKNKLDDANRQKILDAFTAREDADYFA
FT                   KLVPASELADNDYNLSVSSYVQPEDTTEKIDITELNARIAKIVARQSELRTQIDAIVAD
FT                   LEDAQ"
FT   CDS_pept        complement(160633..162456)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01270"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55645"
FT                   /db_xref="GOA:D7GHS3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS3"
FT                   /protein_id="CBL55645.1"
FT                   /translation="MITLRGASVHFGARRALDDFSGSFAPGQVTALVGGDGAGKSTLLR
FT                   VLTGRVAATPAQPGAVTPRTQLGYMPADAGVWNNLSVAQNIAFVARVFAMSPEQTSQRS
FT                   QLLLARAGLAQVGDREAGKLSGGMRQKLGFVLATLHSPSVVLLDEPTTGVDPVSRGEIW
FT                   SLIAGAAAEGATVVFATTYLDEAERCDQLFLLDQGRLVTSGTPDEVIASCPGTVWQAPA
FT                   DAGAGADTDDVPRATSWRRGDQLFAWTPSDREAPAGFAASVPDLENTSIALLLAGGATL
FT                   GADSLDDAATAPGHPRASDAPVVLASRVTKTFGDFTALHDVSLAVHPGEIVGLLGGNGA
FT                   GKTTLMRCVLGLEQVASGRVLLFGQVPSIAVRRRLGYVAQGLGLYPTLSATENLRFTAR
FT                   VFGARSGGREFSAARGARAVARLGERALAYAHDLGRGPVGALPLGARRMLAYLCAIEHD
FT                   PELLILDEPTSGMDPLSRARLWRELREVADRGVGILVSTHYMAEAAQCDRLEMLTAGHV
FT                   SASGSVADITAGRRSLVVHAPQWQRAFALLRDADLPVALDRRMLRVPGASRDEIARVLD
FT                   GLDGGYSVTEAASTLEETMMLAERGGDAGGK"
FT   CDS_pept        complement(162453..163652)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01280"
FT                   /product="ABC transporter, permease protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55646"
FT                   /db_xref="GOA:D7GHS4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS4"
FT                   /protein_id="CBL55646.1"
FT                   /translation="MRALVVKEFQELVRDRRTLAMLLLLPLLLLVIFGYAANFSVSKVS
FT                   VTVIGRDAPTLAADLAQYPVAGQSLDISTDADATDPEQLLRERRADVVVQATDTAAAPS
FT                   PAAPATAAPISERMHVYADGSRLFSAQAAQRAFTTLVAQDTQQHLAQIQAAAAAGAPAG
FT                   SSAQGSAAVGSAAQAASNPGSVVTVLFNPDLKTSWVMVPGLIGLILTFIGTVITSIGLV
FT                   RQRETGTLEQLAVMPLRSSSIILGKIIPYFLLALFDLVLITAVGVWLFGVPFRGSLLLF
FT                   AAAAVIFLFVVLGFGVLISTASQTTGQAIQLAIMTVLPQVLLSGLIFPLDSMAAGVRWI
FT                   GYCLPLTWFNQIAQGVMLRDAPAGSLLWPFVILAAMAVVFFGIATLRMRFSLTHGGARA
FT                   "
FT   CDS_pept        complement(163854..164843)
FT                   /transl_table=11
FT                   /gene="panE1"
FT                   /locus_tag="PFREUD_01290"
FT                   /product="2-dehydropantoate 2-reductase (KPA reductase)
FT                   (Ketopantoate reductase)"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="1.1.1.169"
FT                   /note="(R)-Pantoate + NADP+ <=> 2-Dehydropantoate + NADPH +
FT                   H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55647"
FT                   /db_xref="GOA:D7GHS5"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS5"
FT                   /inference="similar to AA sequence:Uniprot:Q88UF9_LACPL"
FT                   /protein_id="CBL55647.1"
FT                   /translation="MKYAVIGAGAMGYRYGVLLQENAGVDVDFVDTWEPNLAKVAEQGG
FT                   VYVSRDHEGRHLVPINLYSPEDYKGNPDVWIIFVKQMQLEGVLERCAHLFNDKQVVFSA
FT                   MNGYGHFEKIQKYFSDDRIYGGTAMIATVLNGPGDVDFIGKSGAGEMHMCAYTEKVTDI
FT                   EKKIAEDFKAANLNPIITENFMGTCMAKVIFNSVVNTLCTMYEITMGQFIEFDGAMAMA
FT                   KQLIDEAYDVCDRAGIRLIESRQDELKSIDYVCRVGNPLHYPSMYQDMSKGRPTEVDYI
FT                   NGYIAKLGRENDYPARTHEFLTRGVHLAELAWHIHKEEAEKAEAEQAA"
FT   CDS_pept        165075..166814
FT                   /transl_table=11
FT                   /gene="PPA1976"
FT                   /locus_tag="PFREUD_01300"
FT                   /product="Para-aminobenzoate synthase"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55648"
FT                   /db_xref="GOA:D7GHS6"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS6"
FT                   /protein_id="CBL55648.1"
FT                   /translation="MTMAHSKHGPRLQLHVRSVRPAPGASPWDVEALFRRLSDGANAAF
FT                   WLDSAQSVGAQSAVAQSAVAQHVGPRPAGTTSDRGRFSLLGTDAGDLSEVLRYCRHDDA
FT                   GHTRLQRGHGAGRVSQTLDGDILDVLAERLAARPIGEVPEGIPFAGGYIGYLGYEAKAL
FT                   VFPDDPTRHSPTPEGYWLRPQATIVIDHATNVAHLLVLTAEGDDDAAGSWFGRLEDVLG
FT                   RAGTTPSSPVPSRAAPTPTAPTATPPRVAGSWRLTRADYEEHVRRAQDFLRAGDSYEVC
FT                   LTDTFEGPYPAGIDALDLYGVLRRINPAPYAAYLRFDTFGDHLEVLSASPEQFLKVRDD
FT                   GLVSSKPIKGTAPRSADPAEDQRLAAELATDPKSRAENLMIADLLRNDLGRVCVTGSIR
FT                   VPALMQVESYATVHQLVTTVQGMLRDDVDLVGLLRATFPGGSMTGAPKQRTLQIIDALE
FT                   PGPRGIYSGALGYLGYGRRAELSIVIRTIVRNHDRLSIGAGGAIVLDSQAPAEFDEKEL
FT                   KAAALLSALRRAGTPAGRPAPYGGSSTHDANSAPGAGHDDTGVHRAARDAHAADHQGGE
FT                   PDD"
FT   CDS_pept        166657..167760
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01310"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55649"
FT                   /db_xref="GOA:D7GHS7"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS7"
FT                   /inference="similar to AA sequence:Uniprot:Q82NW6_STRAW"
FT                   /protein_id="CBL55649.1"
FT                   /translation="MRAPRPDAQRRTVDPAPTTRTVRRARGMMTPASTARHATPMPQTI
FT                   KEASPMTESQPADDASDGPLTPGGAELSGVVRRPFTPRALVWNGEAFVDDVRAIEPALD
FT                   ILAADSWRSSHGAAAHFDLHCLRFEAGVARWALDAGLPIPSAREWASMRRAMIAAILTA
FT                   HHDTHRDAGLETGQDLFPRIGWEMIGGHAGPVFVLRIRACPPMRDDTTLLWTGLTDPRL
FT                   HPTVKGPDIERLGKLRGVAASRGCDDAILADPNRTVLEASTGSLVWWYEGKIVLPAHRE
FT                   RVLPGVTETMVARRAASLGMQVVRANARTDDWGSGQGVWFLNSVQGISPVTRVVIGSRA
FT                   MHLAPFVATAEWRHWWGSQFRPYSPSL"
FT   CDS_pept        complement(168053..168733)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01320"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55650"
FT                   /db_xref="GOA:D7GHS8"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS8"
FT                   /protein_id="CBL55650.1"
FT                   /translation="MSQPMPPDSSGQNDPEGWVRDPTAPGGWAPIRGYQPRPGGHPGQG
FT                   QYGRQGAAPDQGQYPGARPDQGQYQAPPPLQARQSMPPQRPQAPMPQQRPQAPMPQQPQ
FT                   GRPQQPPRYSDEARNDARASLEAFGEMGPQYSDAVIDSFLARVDSQLGAQHQQNAEIEK
FT                   RKAKQEDKRRSGRTAALSISLGIAIPLTAIASDYGLVGMAMAWVGVLLVAFITTGFKWG
FT                   RDDK"
FT   CDS_pept        169344..170330
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="PFREUD_01330"
FT                   /product="Prephenate dehydratase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="4.2.1.51"
FT                   /note="L-Arogenate <=> L-Phenylalanine + H2O + CO2 and
FT                   Prephenate <=> Phenylpyruvate + H2O + CO2"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55651"
FT                   /db_xref="GOA:D7GHS9"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHS9"
FT                   /inference="similar to AA sequence:Uniprot:Q47KD6_THEFY"
FT                   /protein_id="CBL55651.1"
FT                   /translation="MLGYFGPEGTFTHQALLSVSEDEATPFSTVAAALDAVRAEEIDAA
FT                   MVPIENSVEGSVSATIDNLGSLDAPRLQIMQEVLVEVTFDLCARPGTTLDQVHRIITHP
FT                   HAAAQVRDWLSLHLPEAEVIERGSTAAAAQAVSDPDSGFDAAVCAPIAGRLYGLVPLAT
FT                   DIADNDAAVTRFVLVGRPGRPALATGADKTTLVAYMRHDEPGALLSILQQFAVRGVNLC
FT                   RIESRPTKTTLGNYCFNMDAEGHLDDFRVAAALMGLKRVCKDVIFLGSYARADQQLPNV
FT                   PVGAKDSDYRAAGAWLEGLGGNMIINAPGSTSASNSDPDPTRSPSNS"
FT   CDS_pept        complement(170210..171814)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01340"
FT                   /product="Diacylglycerol kinase, catalytic region"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55652"
FT                   /db_xref="GOA:D7GHT0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT0"
FT                   /protein_id="CBL55652.1"
FT                   /translation="MTTRPFSRFTAWATAVFTACFLAWTRLTLRTQVFAGLDASSNVPR
FT                   LVRDSPVAQVASAFAIVAHPAVMCLLLVVIAIWAWRRRLRHLAVTSLVSGALTMLICQA
FT                   IKASVNRARPPSPMADAITYQGSSYPSLHMAMAAATAAVVVGVTTTTRQPRWAVVLWRL
FT                   VGFAFVVAMGFDGWLMNAHHFTDIIAGVLLGAAVVSAVMLFARVRMLPLIAPRHPANAV
FT                   RTRGGLCAVIYNPAKMRDEMVFRRQLVSELAGAHWEIPLWLPTTIAQPGAAQAREAIAR
FT                   GADLVVAAGGDGTVREVSGALAGSGIPMGIVPSGTANLLAKNVGIPIDMEDAISVAVGG
FT                   EPTPLDLVRMVVDAQADKPLYFAVMAGIGFDARLMQRTNESLKKALGAAAYVFSAMPEL
FT                   FTKPHRVEISVDGSKQTRRNAVLTVMGNVPSIGGGVELMPDADPTDGRMEMVVGSPVGL
FT                   SAWARATAQVLTRMGADPTLEQYAGVAMSVEVDEPMPYELDGDLVGSGSLFEAEVDPGA
FT                   LMIMLPPRPSSQAPAAR"
FT   CDS_pept        171962..173236
FT                   /transl_table=11
FT                   /gene="serS1"
FT                   /locus_tag="PFREUD_01350"
FT                   /product="Seryl-tRNA synthetase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.11"
FT                   /note="ATP + L-Serine + tRNA(Ser) <=> AMP + Pyrophosphate +
FT                   L-Seryl-tRNA(Ser)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55653"
FT                   /db_xref="GOA:D7GHT1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT1"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5P0_PROAC"
FT                   /protein_id="CBL55653.1"
FT                   /translation="MIDPKLLRTDPDRVRRSQRARGESVELVDQALAADEARRSSISAF
FT                   EQARAEQKSLGALIAKASGDERNALLSRTKELAAKVRELDASAHEADEHYTEVVKQFGN
FT                   IVFEDVPEGGEDDLFVIDTEGTPRDFAGEGITIRDHLELGEMLDAIDMERGAKVSGSRF
FT                   YYLKGPGAMLEFALIQFALHKALEWGLTPMIPPALVNPAAMEGTGFLGQAADDVYYLER
FT                   DNQYLVGTAEVPLAAYHSDEILDSKELPLRYAGFSPAYRREAGSYGKDTRGIFRVHWFD
FT                   KFEMFTYCRPEDAVAEHERLLAHEKEFISALGIPFEVLDVASGDLGLSAARKYDCYGWV
FT                   PSQDKYREITSTSNCTEFQARRLNIRMRDGKQVTPLATLNGTLCAMTRMIVMILENYQQ
FT                   VDGSVVIPEVLRPYLGGREVFTPKG"
FT   CDS_pept        173357..174037
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01360"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55654"
FT                   /db_xref="GOA:D7GHT2"
FT                   /db_xref="InterPro:IPR008628"
FT                   /db_xref="InterPro:IPR038261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT2"
FT                   /protein_id="CBL55654.1"
FT                   /translation="MEHTVDLAGEYLLLVLDDHKGGFRQDLTTIDYTVAAAELVDLVGM
FT                   GALEFTGTGENRTFVPGEKAPQDPLLAELAELAAGRSYDEAITALSGGVSVGDDKPRSL
FT                   RSLELERLVNAGILRAQHGKLLGLIPRTRYPQADPTVELELRARLSGALVGTTDLDDRS
FT                   RALIALLYAAHALGKAFPDLDQKRIWRRGKEIANESWEDDGLALALAQYATYMATLSAA
FT                   SLGR"
FT   CDS_pept        complement(174082..174180)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01370"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55655"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT3"
FT                   /protein_id="CBL55655.1"
FT                   /translation="MSSTEAVSSLDTRMPATKRSTTSGSPSILSRP"
FT   CDS_pept        complement(174177..177149)
FT                   /transl_table=11
FT                   /gene="ptsG/ptsM"
FT                   /locus_tag="PFREUD_01380"
FT                   /product="PTS system mannose-specific EIIBCA component
FT                   (EIIBCA-Man) (EII-Man/EIII-Man)"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55656"
FT                   /db_xref="GOA:D7GHT4"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT4"
FT                   /protein_id="CBL55656.1"
FT                   /translation="MTSDINAPAEILASIGGADNVENLTHCATRLRFQLHDNSGIDEKQ
FT                   VESIPGVMGAVSQSGNRYQVVIGGAVESVYNDIMALPEMKEGGSATGTQKSGSNADVKS
FT                   AAKEKGPRGRFTWLDSFFDFLGDSFRPILGSLLGASLIITFMALMGTLGVIGNWADPRT
FT                   ELSPTWQFINLCWRCVFYFLPLMVAYNASKKLGADPWIGFAVMAVVMLPGFTSLGQYAT
FT                   HLTFAGSEINVVRLFGGHLPLTIFDYGSQVFPPLLMAAVLGPLYKLLKKIISPNVQLIF
FT                   VPFLSMLIMIPLTAFLIGPLGVYAGAGLANGLKAVNDFSPFIFAILIPMLYPFMVPLGL
FT                   HWPLNAIMLLNIQTLGFDFIQGPMGAWNFACFGATAGVLFLSVRDRDVTMRQTATGALA
FT                   AGLLGGISEPSLYGIHLRFKRIYPRILVGCFLGGLVQGIGGGLTTNAFVFTSLLTIPAF
FT                   SNIPLYAISIAVAFFSSMLLVVFFDYRTADERAEAAKVRATEDADQAAEEARKASAEAH
FT                   KAELRADDAEARADQAEQRAATTTVAAERAAQVATAVAPARTALAPNAVTQIASPVAGY
FT                   VVPLDKVPDPVFAKGTVGLGVGIDPTGDTITSPGDGKIIVAQDTGHAFGIKLDNGIELL
FT                   IHVGIDTVNLGGTGFDVHVARGDRVTTGDVLVRFDRKVIESAGYSMITPVLVTNPRKFA
FT                   SVTQAPATLSSALVAPGDTIITVTAKPPKDGAAAAPGTPPAPAHRSAAQAVAAGDSKAG
FT                   ASASTEAPGSSVGGASVGGSPAPGSTVPGVSAHGVSAHGDAQASPQGTGTADGARRAAT
FT                   TAGAADSSGSAAASGAAPGSALVAGAVTEIGSPVAGRVVALSDVPDPVFSKGIVGLGVG
FT                   IDPTGDTITSPGDGKIIVAQDTGHAFGIKLDNGIELLIHVGIDTVNLGGTGFDVHVARG
FT                   DRVTTGDVLVRFDRKVIESAGYSMITPVLVTNPRKFASVTQAAQGAVTPGEGIITVTAK
FT                   Q"
FT   CDS_pept        177399..178793
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01390"
FT                   /product="exonuclease of the beta-lactamase fold involved
FT                   in RNA processing"
FT                   /function="3.6 RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55657"
FT                   /db_xref="GOA:D7GHT5"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT5"
FT                   /protein_id="CBL55657.1"
FT                   /translation="MSKPVATLTFLGAARTVTGSKFLLDLNERRLMVDAGMFQGAREWR
FT                   RRNWDDFPVDPATITDLLITHAHMDHSGYIPALVKHGFHGRIHCTPQTRELTAIVLRDS
FT                   ANLQVNEARDAARGGYSKHNPPLPLYDEADVERSLPLFHDVAFDRDLDLGGGVHARFTR
FT                   AGHILGSASIRVWLADDPQISVLFSGDLGRDQHPVLRRREEPEGATSVLIESTYGNREH
FT                   PTGDEEDHEALAGLIRRTIARGGSVLIPAFAVDRTEILIKVLGEMQHAGRIPPVPIFIN
FT                   SPMGSAALDVYQGTGAHAELRADIDISALLNLPTLRDVRTKEESVALNRPAQPCIIISA
FT                   SGMATGGRVVHHLRHMLPDPRNAVVFTGYQALGTRGRSLVEGAKQIKMYGRYVPVKAEV
FT                   LLDTAFSVHADAPELLEWLAALSPAPQVVYCVHGEPKSAEHLADTISEELGLMAVVPRY
FT                   GEVVRL"
FT   CDS_pept        178790..179509
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01400"
FT                   /product="Response regulator, two-component system"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55658"
FT                   /db_xref="GOA:D7GHT6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT6"
FT                   /protein_id="CBL55658.1"
FT                   /translation="MSAVQDAPGDAPCILIVEDEHSLATVMAGYFTRNGYRAEVVGDGL
FT                   EAVAAARRLDPSVVILDLGLPSLDGVEVARRIRTFSDCYILMLTARADEVDELIGLSVG
FT                   ADDYLTKPFSPRLLIARVQAMQRRPRSAITPPDEQPLRIGELTIDPAAREVQLGTREIA
FT                   LTRTEFDLLAHLARNPRRAISRDELIEAVWGVGWSGDDQLVDTHIGHLRKKLGDSAANA
FT                   RFIETVRGVGYRMGQGR"
FT   CDS_pept        179674..180795
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01410"
FT                   /product="ATP-binding region, ATPase-like:Histidine kinase,
FT                   Histidine kinase A-like precursor"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /EC_number="2.7.13.3"
FT                   /note="ATP + protein L-histidine = ADP + protein
FT                   N-phospho-L-histidine."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55659"
FT                   /db_xref="GOA:D7GHT7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT7"
FT                   /inference="similar to AA sequence:Uniprot:Q27B70_MYCFV"
FT                   /protein_id="CBL55659.1"
FT                   /translation="MLTRRSIARRFLTGAAVVVGVAVVTIFVVDALVSPAIFHAHLMQA
FT                   DLSNPETVLRHVEEGMRSSNMIALAVAILIAVLAALLVSLYLATRVSASLAPLAAAARQ
FT                   VAAGDYTARVDAGPLGAEFDELTEAVNAMSQRLASVEQSRTRLFSDLAHEMRTPIAVVQ
FT                   AQLEGIEDGVVGVEDSIPVLRAQAERLTRLSSDIGLLSQAQEHALRYEFAPGEVASVVR
FT                   GCVDDMALRYREAGVQLTLDVATHARAQLDTARFAQVITNLLANALNATVSAGRGRTGD
FT                   RGGHVHVGVRRHGNEVAVQVRDDGVGISPEELPHVFDRFARVGPARDRSSGGFGIGLTV
FT                   ARAIMSAHHGRISADSPGPGRGATFTVTVPVLH"
FT   CDS_pept        complement(180857..181504)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01420"
FT                   /product="extracellular protein without function"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55660"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT8"
FT                   /protein_id="CBL55660.1"
FT                   /translation="MSRRFATTLAASALSLVVLAGCSTATAGPSSGTPSGTVTAGAASN
FT                   TSSTAANGSVDVAKAGVEELKGADARTLVDKLEATPLSQRRTDLRASVRADELQLSDTS
FT                   GNKASVKMPADQFYLSFAPYVNKTHDCTYHSLTTCKAELGNKQMHVTITDAAGATVIDQ
FT                   DLTAADNGFIGVWLPRNITGTLTVSYDGKSASQQISTAKADDPTCLTTLHLA"
FT   CDS_pept        181865..182362
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="PFREUD_01430"
FT                   /product="thiol peroxidase"
FT                   /function="3.8 Protein modification"
FT                   /EC_number="1.11.1.-"
FT                   /note="peroxydase. Has antioxidant activity. Could remove
FT                   peroxides or H(2)O(2)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55661"
FT                   /db_xref="GOA:D7GHT9"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHT9"
FT                   /inference="similar to AA sequence:Uniprot:Q5LBP6_BACFN"
FT                   /protein_id="CBL55661.1"
FT                   /translation="MSTTAFQGTPVHTVGELPAVGSQAPDFELVGKDLSTITLKSLRGR
FT                   RVVLNIFPSLDTGVCATSVRTFNKLAAGLDNTTVLAVSKDLPFAAERFCVAEGIENVVP
FT                   ASAFRKHSFSNYGVLMTDGPLAGLLARSVVVIDENGTVVYNQLVPEIGNEPDYDDAVAA
FT                   LK"
FT   CDS_pept        complement(182530..183276)
FT                   /transl_table=11
FT                   /gene="npdA"
FT                   /locus_tag="PFREUD_01440"
FT                   /product="Silent information regulator protein Sir2
FT                   /NAD-dependent deacetylase"
FT                   /function="4.6 Miscellaneous"
FT                   /EC_number="3.5.1.-"
FT                   /note="Modulates the activities of several enzymes which
FT                   are inactive in their acetylated form. NAD+ + an
FT                   acetylprotein = nicotinamide + O-acetyl-ADP-ribose + a
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55662"
FT                   /db_xref="GOA:D7GHU0"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR028628"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU0"
FT                   /protein_id="CBL55662.1"
FT                   /translation="MSADQLSRILAPADHVVFFGGAGVSTESGIPDFRSATGLYKTQSG
FT                   GEFPPEYMLSHSCWADHPEDFYAFYRKNMLHPEAKPNAAHYALARLEKAGRLTAVVTQN
FT                   IDGLHQMAGSQKVFELHGSVLRNHCVDCHRSYPVEAIEQSTGIPRCTVCNGIIKPDVVL
FT                   YEEGLDPDVMDGATRAIMAADVLIVGGTSLNVYPAAGLLEYYRGDKLVLINKSATPADN
FT                   RAQLVIHDSIGKVLGQAVDEVLGDKA"
FT   CDS_pept        183477..185186
FT                   /transl_table=11
FT                   /gene="cpsA1"
FT                   /locus_tag="PFREUD_01450"
FT                   /product="Cell envelope-related function transcriptional
FT                   attenuator common domain"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55663"
FT                   /db_xref="GOA:D7GHU1"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU1"
FT                   /protein_id="CBL55663.1"
FT                   /translation="MSEEPQGGHVDDPSSASRARRAARAADDPGDGANTPRYADSAAKR
FT                   RRGRLRPRWGRIAALAMALVLFVVVAAAGIYIWRANAGIKRSGAIADKTSQSSDLDLLV
FT                   MGLDSRVDVNGNALPSDIYDALHSGDASDGGLNSNVLMYVHVPADGSQASVFAIPRDDY
FT                   VDFPGCPDGVCKGKIKEAYGYAADAKTQELDKQGKTGQDAYQQARDAGRAAEVRTVEQF
FT                   LGVEIDHFIEVTMVAFFQIAQVVQPITVCVNEKTVDTYSGADFKAGEQDINAEQAMAFV
FT                   RQRRDTDNPDLAFTDLDRSRRQQAFIASLLVKLKKTNLLTNPGQLDKLVQVAQQNTVLD
FT                   KNLKISQLTSLATSLEGSKLNFYTLPVESFGTADDGAAINVVDKAKIQGIVRSILHPGQ
FT                   SASPSASASASGSASYSPTYGMGATVSVMNESGVTGAAASLVGQLTGFGFTAGQATNGA
FT                   DILQESSVSYGSAVAGQAKQLAQQLGGLSANADSTLGANAVVVHMGTGFTGWPSASPSA
FT                   ASSAASTGGSSVSPSASSTAIPSAVDANSGGQSGPEPSQLTQISGGGIPCVK"
FT   CDS_pept        complement(185841..187277)
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="PFREUD_01460"
FT                   /product="Argininosuccinate synthase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="6.3.4.5"
FT                   /note="ATP + L-Citrulline + L-Aspartate <=> AMP +
FT                   Pyrophosphate + N-(L-Arginino)succinate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55664"
FT                   /db_xref="GOA:D7GHU2"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU2"
FT                   /protein_id="CBL55664.1"
FT                   /translation="MLDVVSKVLTSLPVGQRVGIAFSGGLDTSCAVAWMREKGAIPCTY
FT                   TADIGQYDEPDIASVPGRAGQYGAELSRLVDCRESLVEEGLSALACGAFHVQSAGRAYF
FT                   NTTPIGRAVTGTLLVRAMNDDNVSIWGDGSTYKGNDIERFYRYGLMANPSLRIYKPWLD
FT                   EDFVSELGGRDEMSVWLQKRNLPYRDSKEKAYSTDANIWGATHEAKTLEHLDVSLETVE
FT                   PIMGVKFWDPSVTIDTEDVTIGFEQGRPVTINGKKFDSAVDLVLEANKVGGRHGLGMSD
FT                   QIENRIIEAKSRGIYEAPGMALLFIAYERLVNAIHNEDTIINYRNEGMRLGRLLYEGRW
FT                   LDPQSLMIRESIQRWVASVVTGEVTLRLRRGEDYTIVNTDGPAFSYHPERLSMERVQDA
FT                   AFGPLDRIGQLTMRNLDISDSRSRLEQYASQGQLTGGEAAKLVGALEPGKASEIADHPE
FT                   HAGTSHATPLDNAAMETGAD"
FT   CDS_pept        complement(187439..188410)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01470"
FT                   /product="NADPH:quinone reductase and related Zn-dependent
FT                   oxidoreductases"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55665"
FT                   /db_xref="GOA:D7GHU3"
FT                   /db_xref="InterPro:IPR002364"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU3"
FT                   /protein_id="CBL55665.1"
FT                   /translation="MHAITVDEPGGVDVMSWAEVPIPDPGPGEVLVRTQAAGVNRGDVL
FT                   QRQGHYPPPAGITDIMGMEALGVIEKLGDGVEGHQVGEQVLALVSGGAYAEFFVVPAGQ
FT                   LLKLPAGIDPLAAAGLVEVAATVVSNFDRVHLSAGETVLIHGGAGGIGTLAIQYAKALG
FT                   AHVIVTAGSAKKLAYCRKLGADEGFDYHDDWEPQVMMATQDRGVDVILDIVGAKYLEAN
FT                   VRCLADDGRLVIIGMQKGTKGTLNIAVLLNKRGTVTATSLRFRSLASKAAICRRVEEAI
FT                   WPLLSSGAIKPGNQTQVPMAHASKAHELLESGDNTGKIILVV"
FT   tRNA            188470..188555
FT                   /locus_tag="PFREUD_01480"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:188504..188506,aa:Ser)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        188660..189097
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01490"
FT                   /product="membrane protein without function"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55666"
FT                   /db_xref="GOA:D7GHU4"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU4"
FT                   /protein_id="CBL55666.1"
FT                   /translation="MSSYILRPRIPRRAFVLGSAATVVGLVLVVIGLVQNWAILAIIVL
FT                   AALLAVGLLTLLMVAYSMVNHRIHIDLDAKGYRVYGPGMDRRGTWAKVTRVAVTPDGSR
FT                   LMIASGPVKRTYISCPKGGDDPAMQALIKEISAHLPEHSRR"
FT   CDS_pept        complement(189479..192067)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01500"
FT                   /product="Cell envelope-related transcriptional attenuator"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55667"
FT                   /db_xref="GOA:D7GHU5"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU5"
FT                   /protein_id="CBL55667.1"
FT                   /translation="MADDDVQRPRRVRRAADDAHSATPPASGTPGTPRRIWARPQPEDP
FT                   PTTPPAAPEAPAAPSTPADPTPTGGSSRRGMGTNEPHVSKWGTRESTPEPTASATPRRS
FT                   WSRRRAESTGDQPPVGSGHPTGEGTGPRHARRSAPIHKPVESDLSHPDAPRSTAAADAT
FT                   TPSPAPAEQAPTRPAPPAAATPRGRQHDAPTPRASAPDKHVASRRTPATTPPAAATPHS
FT                   AAPHSPAPHDPTPPSPTTHAPTPGTPTAPRSERGANLTLGGEPLGEHTAFLHAPDYRHA
FT                   NAAARAAARERARRAAAGTEPAAHDGELFDVEQVGLREPPPPPPEPEPASLRSRFAAFT
FT                   ERSDDTGSHGFGWTMLRTTLGSLIPGAGLIGTRLTMIGTLLFMMTVVFGSGVILAAVVH
FT                   PPALMATVMNSVGLTAIGIMLVAVTIIWMAIVAGTYLVTRPRRMKRWQRIAGAIVVFLM
FT                   AALVGSVSSVGAAYAFESAIVVSDVFGNSKTRSQTRPLGDWANKDRVNILLLGGDSGAD
FT                   RDEDLGLRTDTVMLASINTHTGNTVFIQLPRNLENVPFPAGSDLAKVYPNGRVWDRSSG
FT                   TEDNYMLNAVWNEVPLEHPELFRNTDQPGADATKLAVSGITGLTVDYYAMINIDGIQAL
FT                   VDAMGGVVVNINFPIAKGGHVDGYGDEECGVDGNLSVGPDQKLDGADAMWYARSRCNDP
FT                   DYDYGRMRRQSCLVNAIIRQANPQTMLTRYEAIAAAGKNMMSTDIPESLLDDATNLALQ
FT                   VKDAQVSRVVFSQAIGTAPQVGDINPGNPDYNAIRNRISGAITASDNGTTPSAPASASS
FT                   SPMATGSAGSASSVASAAGSGSTSASAAGAAATPSGTAENMSGACDYHPN"
FT   CDS_pept        189510..189719
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01510"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55668"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU6"
FT                   /protein_id="CBL55668.1"
FT                   /translation="MFSAVPDGVAAAPAALALVDPLPAADATLLADPALPVAIGELDAD
FT                   AGADGVVPLSLAVMAPEMRFRIAL"
FT   tRNA            192316..192408
FT                   /locus_tag="PFREUD_01520"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:192351..192353,aa:Ser)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   tRNA            192593..192668
FT                   /locus_tag="PFREUD_01530"
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:192626..192628,aa:Arg)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        complement(193036..193290)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01540"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55669"
FT                   /db_xref="GOA:D7GHU7"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU7"
FT                   /protein_id="CBL55669.1"
FT                   /translation="MGPLVATRVLQLFIGEPVSGALNALATLVIVLAVVMVVPTRSHRS
FT                   LSGWLTGADMVDSRSVTPTVAGPGAGDTGVGGSGAADPA"
FT   CDS_pept        complement(193244..194332)
FT                   /transl_table=11
FT                   /gene="vanZ"
FT                   /locus_tag="PFREUD_01550"
FT                   /product="VanZ"
FT                   /function="4.2 Detoxification"
FT                   /note="confers low-level resistance to the glycopeptide
FT                   antibiotic teicoplanin (Te)Arthur M, Depardieu F, Molinas
FT                   C, Reynolds P, Courvalin P; , Gene 1995;154:87-92.: The
FT                   vanZ gene of Tn1546 from Enterococcus faecium BM4147
FT                   confers resistance to teicoplanin."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55670"
FT                   /db_xref="GOA:D7GHU8"
FT                   /db_xref="InterPro:IPR006976"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU8"
FT                   /protein_id="CBL55670.1"
FT                   /translation="MLFLPYVVWSFHRFGQLSFRRIIGWAAVCVYFTGLAVYTLVPFPE
FT                   DPQAFCASTHVGYNLHPLEFITDIRTQTAGMGLRSALTSAVVLQVVFNVVLFVPLGVLL
FT                   HRYFRRGAITSTLIGLIMSVCIETTQYTGFFGLLPCAYRVADVDDVITNTAGTLIGALI
FT                   APLLLFWMPASRTLTSTRLVARPVTSMRRWVGMVVDGFLFYLIAASSSIAVLVAGRLLS
FT                   WWPVEAEPEWISPAGDVVALLMVFVIPSLTGRGGSLGQRVVWLTPRWPAAAGSGDGSGG
FT                   AVGADSSGGTVGGDWPDGAAPDGGQMGGGTYRGGSLDSGSLGSGLPSSGLSDGRTLANG
FT                   PLAFAGGRGPAGGHAGAPAVHR"
FT   CDS_pept        194524..195207
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01560"
FT                   /product="Short chain dehydrogenase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.1.1.-"
FT                   /note="Short-chain alcohol dehydrogenase of unknown
FT                   specificity"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55671"
FT                   /db_xref="GOA:D7GHU9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHU9"
FT                   /inference="similar to AA sequence:Uniprot:Q6A722_PROAC"
FT                   /protein_id="CBL55671.1"
FT                   /translation="MAERRAVLITGATRGIGRAIADELADDWHVLVGGRHPDQVRKVVQ
FT                   ALPSAEPFIADLTDAGAMQAAVEQIGHLDAVVHSAGAVVMGPVSELSRQDWRDLYEINV
FT                   VAVADLTAELLPKLREAHGQVVTINSGSGFHTGPGQTCYAATKHALVAFTDGLREEERG
FT                   VVRVTSVHPGRVDTDMQVDIQRQLGAQYQPERYLQPADVARAVELALTMRPGANVDTVS
FT                   VRPAL"
FT   CDS_pept        195204..195923
FT                   /transl_table=11
FT                   /gene="ugpQ1"
FT                   /locus_tag="PFREUD_01570"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="3.1.4.46"
FT                   /note="Glycerophosphodiester + H2O <=> Alcohol +
FT                   sn-Glycerol 3-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55672"
FT                   /db_xref="GOA:D7GHV0"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV0"
FT                   /inference="similar to AA sequence:Uniprot:Q2BF50_9BACI"
FT                   /protein_id="CBL55672.1"
FT                   /translation="MTAVWAHRGASAAAPENTLPAFQAAATLGADGVELDVQRTRDGQL
FT                   VVCHDETIDRTSNGVGNLADYTLSQLKEFDFSAGHPEFTNVAIPTLAEVFDVLGPTGLM
FT                   INIELKNSVVPYEGMEAQVLALVHAAGWDDKVFYSSFNHRSMRRLAERDYPVGLLYDSV
FT                   LWRAAKYAAELGASALHPSGRAVRVNPGVVRAAHKRGLSVNVWTIDKPAQIQALLDLEV
FT                   DAIITNVPDVALGVRDA"
FT   CDS_pept        complement(196022..196840)
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="PFREUD_01580"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="1.1.1.25"
FT                   /note="Shikimate + NADP+ <=> 3-Dehydroshikimate + NADPH +
FT                   H+ and Shikimate + NADP+ <=> 5-Dehydroshikimate + NADPH"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55673"
FT                   /db_xref="GOA:D7GHV1"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV1"
FT                   /inference="similar to AA sequence:Uniprot:Q6A8I5_PROAC"
FT                   /protein_id="CBL55673.1"
FT                   /translation="MTHHAAVIGSPIAHSLSPVLHRAAYQQLGLHDWEYDAIEVTPDTL
FT                   GEFIASRDNSWAGLSVTAPLKEALIEFGRPDQQSSELQSANTLIFGHPNRLFNTDVTGL
FT                   RDAMASYDVIMPGTAVIMGAGATARSAISTLVRLGCRVIRVVARDAGRAHASLDRVAAL
FT                   YGTDLQIVDWSGFDALGADSADVLISTAPVQYTPEEAAQLAAVSQVVFDIVYQNYPTNL
FT                   SRAAIKAGRVSVDGVDLLVHQAIDQVRLMTGEEPLAEPLIEVCRAELAKR"
FT   CDS_pept        196927..197976
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01590"
FT                   /product="3-carboxymuconate cyclase"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="5.5.1.5"
FT                   /note="3-Carboxy-2,5-dihydro-5-oxofuran-2-acetate <=>
FT                   3-Carboxy-cis,cis-muconate Benzoate degradation via
FT                   hydroxylation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55674"
FT                   /db_xref="GOA:D7GHV2"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV2"
FT                   /protein_id="CBL55674.1"
FT                   /translation="MSTQLCYVSGRRDGLITTVRFDDKAETAEVVSRLNLGPKPMPLEL
FT                   NRERRLLRVATGADPLRVSTLKLLPDGSCQVLSEVNCPLSATYLSFTPDDRMAFVVSYH
FT                   ASRLAWAPVWDNHLIDDSAWHVEQVGEQPHCVEPSPDGRHVYVVELGANRVQGFRVSDG
FT                   ELVADEQIGVQFEHGTGPRHLVFDASGEHGYLIEELGGHIVHLTRDPDSGRLTVAERVP
FT                   YSDRADDLRPGVHVPSGSTPSLDDQTLRHWGAELALDPQRHWIVASERRASTLNLQALN
FT                   DDGSFGARLDHVPTEKQPRGMGLIGDHHVIAGAELGDTATIYRVDDQLEPVAEVEGLGG
FT                   PVWFASIGS"
FT   CDS_pept        198081..198923
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="PFREUD_01600"
FT                   /product="2,5-diketo-D-gluconate reductase A"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="1.1.1.274"
FT                   /note="involved in ascorbate production
FT                   2-Dehydro-D-gluconate + NADP+ <=> 2,5-Didehydro-D-gluconate
FT                   + NADPH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55675"
FT                   /db_xref="GOA:D7GHV3"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV3"
FT                   /protein_id="CBL55675.1"
FT                   /translation="MIIPTTPTPTVELSGGTRMPMLGMGTWPLKGEECRAAVASAIEQG
FT                   YRLVDTAEAYGNEEAVGKAVREAGPDRAEIFVTTKFSKQWHSRKGVHEALEHSLERLGL
FT                   DYVDLFLMHWPMPGEGSYVDAYRGMVELKEQGLAKAIGVSNFKVHHLDDLITEGMTPEV
FT                   NQIQLDPSRPRLEVRDFLDNHDIVTEAWSPLGRGADGVLNAPAVLDAAKKHGITPAAAV
FT                   LAWELNQGIVTIPKSANPEHQRTNLEAIGVELSAQEMKAIDALADPNAKIDDSDKTGN"
FT   CDS_pept        complement(199077..201533)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01610"
FT                   /product="ABC transporter permease"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /note="lipid transport ?"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55676"
FT                   /db_xref="GOA:D7GHV4"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV4"
FT                   /protein_id="CBL55676.1"
FT                   /translation="MLRQPRQLISAGIAILLGVAFVAATFVFSASLNAGMTKLVAGMVG
FT                   DAKVVVSPSENTYTPVTQQLTDTVSKVPGITHSKKIVQGSATLRLDGQDNHALISSQPD
FT                   LSSQTTLFEGTLAKGDGQVTISKTAADAYRLKVGDKVTLANYDDRAFDETVVGIVNAGN
FT                   DAVAQPLASWVFAPTEQAMTLASTSGYNMVFLYGNGDAGALRDAVQAAAGVSDAQLTVR
FT                   TGQDEVQAAMKQMTGSTNSIQYVLLGFAAIALFVGIIVIANTFSILVAQRVRQLALLRC
FT                   VGATRNQVFGMVFGEAAVLGLVGSAAGILAGFGLAAALIPLASKGAQIPLEFAISPAAV
FT                   IVPLVVGVLITLAASISPARKATRVAPLAAMRPELAVSKAKRLGVVRAIIGIVLVVGGA
FT                   AMLALGIVRAKPDTGVGGLAIAIAGGLLSFIGVLLVGRGLIPALARLIGAPLAKSSVSG
FT                   DLAVGNTRRNPGRAAATANALLVGVTLITLLTVGASTSQASLDRYLSATYPQDAVVSAA
FT                   KGIDEQALTRIRATDGVQDAALVPSTTTEVSSRDHAAQQRPVMGVDNTAAHLTHFPQRY
FT                   ENLDDNTVRTSDTSVHNGETVTIKGASGTTVQLTAKVSNDYSPSLVVSTTVLSKLDPGA
FT                   AETAWVQYKSGVNVNTVTTDLGKAVGGLGQVSIDSGAQMRAQFGQMIDIVLAVAVGLLA
FT                   VAVAIAVIGVANTLGLSVLERTQEIGLLRALGMTRRQVRSMISWEAVMIAVVAAALGLA
FT                   LGVAYGLIGAKVMLGSITSTPFVAGLPWVRLAAIGVIAVAAGWLASLIPASRANRISPS
FT                   AALATE"
FT   CDS_pept        complement(201533..202411)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01620"
FT                   /product="ATP binding protein of ABC transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55677"
FT                   /db_xref="GOA:D7GHV5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV5"
FT                   /protein_id="CBL55677.1"
FT                   /translation="MTTMTQPTTAAVRTVHLTKIYGQGDTQVTALNDVSVEFIRGQFTA
FT                   IMGPSGSGKSTLMHCAAGLDTPTSGQVFIGQVDATSLSDTNLTLLRRERVGFVFQAFNL
FT                   LPTMTAEQNILLPLKLAHSKPDRQWLDTIVKVLGLQDRLSHRPAELSGGQQQRVAVARA
FT                   LITRPEVIFADEPTGALDSAASNELLDFLSRSVHELGQTIVMVTHDAHAAGFSDRVLRL
FT                   ADGRIVSDEPVNHPIAGQTPVPTTGFTSGAVAGTPNFAPAPGSAPQMGAANPQRPDDAP
FT                   DAGLKRQAGDN"
FT   CDS_pept        complement(202689..203399)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01630"
FT                   /product="two-component response regulator LuxR"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55678"
FT                   /db_xref="GOA:D7GHV6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV6"
FT                   /protein_id="CBL55678.1"
FT                   /translation="MGARETKTMADEPIRLLLADDQEMVRVGFRMVLDSQPDMAVVAEA
FT                   PNGRDAVDAVLHAAPGQAPDVALMDIRMPVLDGVAATQKIVADSDTRVLILTTFDLDEY
FT                   VYSALQAGASGFLLKDAGPTELLAAIRAVASGDSVVAPSATRRLLERFVPTLPIAQSGG
FT                   DTKKRLEALTDREREVLTLVGQGLNNTEIAETLFLGSATVKTHIGHILAKLQLRDRVHM
FT                   VVFAYDAGLVHPRG"
FT   CDS_pept        complement(203365..204687)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01640"
FT                   /product="two component sensor kinase"
FT                   /function="1.3 Sensors (signal transduction)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55679"
FT                   /db_xref="GOA:D7GHV7"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV7"
FT                   /protein_id="CBL55679.1"
FT                   /translation="MPRVKQVSDWFGAHPMFADSVWAGFIAVVSLLGAASISGRWDSAG
FT                   SGPILDILYIVWALSYAVPMIWRRTRPVLACWLLLIPHLVQLMVITQPMPGNITVPMMM
FT                   YAVAVHGSPRAGRIWLGVGVLAAAAAALRWSYRGNGAEQYWTVAVFNAFALSALVVASW
FT                   LLGAFNRERHATVASLRDRAEALERERDRFAELAAEQERSRISREMHDVVAHSLSVIVV
FT                   QTDGIRYALDQPGDPAAQVEQARGALDTIGQTARTALRDTRALVGALRDGESVEMAPQP
FT                   QLDDIPQLVASTANSGLPVELTIDGDPAWHAPLGPAQQAAAYRIVQESLTNVIKHAGPG
FT                   AQAWVRLIHDPAGLTIWVRDDGQGTQTNDGLGHGLIGMRERVASSHGTLTARNRLDGGF
FT                   EVIATLPVGGQSGTVEPAGPRPDTHRWGTDNGRKGDEDNGR"
FT   CDS_pept        complement(204833..205435)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01650"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55680"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV8"
FT                   /protein_id="CBL55680.1"
FT                   /translation="MIALIALVLVVAGTALVVHSLSTSRDAPRDMAGNPVQFEPGNSPA
FT                   PSTIERMQVQDTDSGRLRVPSVGLDVPLGSMLAVDNVINPPSFTQAYWVRNVGVAPADA
FT                   SSGTVFVVSHSVSGGRAPGNYLLNVGKGTSTVNAGDLISVDGHDYIAQSWRAISKKQLP
FT                   AAQDLWDPVPGRLVLITCLEQPDGNSPDNLVVVAQLR"
FT   CDS_pept        205658..206263
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01660"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55681"
FT                   /db_xref="GOA:D7GHV9"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHV9"
FT                   /protein_id="CBL55681.1"
FT                   /translation="MNSSRLEAFSDGVLAIIITIMVLELRTPEGNGFSDLVHETGLGFL
FT                   TYVLSFAYVGIYWTNHHHLFQLVEKVNGPVLWANLNLLFWLSLLPMTTDWMDASDLSRV
FT                   PVLIYGVDLLLAAASYWLLSHTLVRSQPSESLLNQALGDDRKGFWSPILYGIGIAAAAG
FT                   ADYLPGHLGVGIAIAMYLLTGLLWVIPDRRVERLVALS"
FT   CDS_pept        206513..206740
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01670"
FT                   /product="acetyltransferase"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55682"
FT                   /db_xref="GOA:D7GHW0"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW0"
FT                   /protein_id="CBL55682.1"
FT                   /translation="MLSGDKLIVFTHTEVEPNFEGQGVGSKIARFALDDVRDDGSRSVL
FT                   PLCPFIKGWILRHPDYKDLVYRAKPSNVKD"
FT   CDS_pept        206829..207062
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01680"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55683"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW1"
FT                   /protein_id="CBL55683.1"
FT                   /translation="MARKTYTGPEVDVTFDGEVCRHAAECVRGMPEVFDIDKRPWINPT
FT                   VADTPELAQHLRDVVSRCPSGALRIVEHPVEA"
FT   CDS_pept        complement(207196..207570)
FT                   /transl_table=11
FT                   /gene="fkbP"
FT                   /locus_tag="PFREUD_01690"
FT                   /product="FK506-binding protein (peptidyl-prolyl cis-trans
FT                   isomerase)"
FT                   /function="3.8 Protein modification"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55684"
FT                   /db_xref="GOA:D7GHW2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW2"
FT                   /protein_id="CBL55684.1"
FT                   /translation="MTNPNKPEVTLPDEVPDDLVIEDIVEGTGPEAKAGDLVDVHYVGV
FT                   ALSNGQEFDSSYGRGEPLSFQLGVGQVISGWDNGVQGMKVGGRRRLVIPPQLGYGARGA
FT                   GGVIKPNETLVFVCDLVGIH"
FT   CDS_pept        complement(207567..208265)
FT                   /transl_table=11
FT                   /gene="CoA"
FT                   /locus_tag="PFREUD_01700"
FT                   /product="Pantothenate kinase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.7.1.33"
FT                   /note="Pantothenate kinase (PanK) catalyzes the
FT                   phosphorylation of pantothenic acid to form
FT                   4-phosphopantothenic, which is the first of five steps in
FT                   coenzyme A (CoA) biosynthetic pathway."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55685"
FT                   /db_xref="GOA:D7GHW3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW3"
FT                   /protein_id="CBL55685.1"
FT                   /translation="MRTMTVSQSLTAAHELAKHGERHLLGLTGEPGVGKSTLAALLAAD
FT                   LGAAAVAVSMDGFHLAQKELERLGRASRKGAPDTFDSWGFLSLMQRLTTNDAPAVYAPE
FT                   YHRELHNPVAGAIRVDKHVPLVIVEGNYLLLPGRPWGLAHDMFDEIWFLQTDQELRHKR
FT                   LINRYMAFGKTAQHAERWTLGPDERNARTVRADRPGRCGDPTQLSAPDRPERHCPVDAR
FT                   PAGPRIGWRA"
FT   CDS_pept        208418..209029
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01710"
FT                   /product="exonuclease"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55686"
FT                   /db_xref="GOA:D7GHW4"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW4"
FT                   /protein_id="CBL55686.1"
FT                   /translation="MAGYAVLDLETTGFSPARGDRIIEIGLVRLDPQGHVDDEWSTLVN
FT                   PRRTVRATRVHHITSADVAAAPTMAELAPGLVDKLRDRVVVAHNSSFDVGFLTAELRTA
FT                   GMTIPPEPIPSVCTMRQSTRFLHARSRRLVDCCEAAGVSLRDAHSALGDARATAELFGH
FT                   YLRAAGGELPWQDVVDRARRYPWPQALFVEPQTHLVQRPE"
FT   CDS_pept        209381..210883
FT                   /transl_table=11
FT                   /gene="cydA"
FT                   /locus_tag="PFREUD_01720"
FT                   /product="Cytochrome d ubiquinol oxidase subunit I"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55687"
FT                   /db_xref="GOA:D7GHW5"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW5"
FT                   /inference="similar to AA sequence:Uniprot:Q6ABD3_PROAC"
FT                   /protein_id="CBL55687.1"
FT                   /translation="MDAQVLARWQFGITTVYHYFFVPITLGITWLLAILQTLWVRSGND
FT                   QWLRLVKFFGKLFLINFAAGVVTGIVQEFQFGMNWSEYSRFVGDIFGAPLALEALIAFF
FT                   LESTFVGLWIFGWNRLPKGLHLATIWLTALGAFISSIFILAANSWMQNPVGAVYNAATG
FT                   RAELSDFLALITNPVFLATLPHTIGAAFMTAGALLLGVSGWWLAKKRRDAQPADSLDTS
FT                   TWRKSARFSAWVLILASLVTFISGDFQGKVEAEYQPMKLAAAEGLLETQESAPFSVVAI
FT                   ITTEGSGQDKTYHKVFSLDVPGVLSILAKNDPNAKVQGIQDLRESYLQEGYATDNGTQN
FT                   ALQSQFADELKAMPVDPVPNVMVNYYSFRLMIGLGVLAFIIGIATLVQTRRDHLPKGGK
FT                   FYAVLMACLPFMPLFANSFGWILTELGRQPWIVNGVLPTWTAASPGNGAGAMWLTMILY
FT                   TLVYAVVAVIVLKLFIKTIKEGLPALVKVEKPTDDAPLSFAY"
FT   CDS_pept        210900..212033
FT                   /transl_table=11
FT                   /gene="cydB"
FT                   /locus_tag="PFREUD_01730"
FT                   /product="Cytochrome d ubiquinol oxidase, subunit II"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.10.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55688"
FT                   /db_xref="GOA:D7GHW6"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW6"
FT                   /protein_id="CBL55688.1"
FT                   /translation="MLTNSLIPLQASLDASPLQIVWFLLIAVLWIGFFFLEGFDFGVSM
FT                   LYPILGKDPKERRVMINTIGPTWDGNEVWLITAGGATFAAFPGWYATLFSGLYLPLFLV
FT                   LVGLILRGISFEYRAKMPDDRWRNAFDACASIGSLIVSLVFGIGFANFVKGMDVAPLTS
FT                   AAFGEPNLYTGGFWALFSPFGLLGGVLFILLFCTHGSMFLALKTYGSIHDKTVKFVHTL
FT                   APVTVAVLLIFVLAANIFYGTSKNPYLGSLSTVLMWAAGLLSVVVLGLAALAQRAERNG
FT                   WAFIGTGASILLMLAMIFVKMYGTLGFISADMSNPLNMVTASSSPLTLKLMTWFACFLV
FT                   PVVLAYQGWSYWVFSKRLSTKEMPEHEHEPNVAEVHV"
FT   CDS_pept        212057..215701
FT                   /transl_table=11
FT                   /gene="cydCD"
FT                   /locus_tag="PFREUD_01740"
FT                   /product="ABC transporter"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55689"
FT                   /db_xref="GOA:D7GHW7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR014216"
FT                   /db_xref="InterPro:IPR014223"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW7"
FT                   /protein_id="CBL55689.1"
FT                   /translation="MAGPLDPRLVKRATATRGFLVAVALVGVATAFLVLAQARLISDAV
FT                   AHVFDTHNTDGVLAACGLLMAVFVARAGLNWLNQWLAHRASAAVKSQLRTDVMTARLAR
FT                   PTDASTPTGTLITLVTQGLDSLDGYFSKYLPQLMMAVGVPLVVGVAILTQDLESTIIIA
FT                   ITVPLIPLFMALIGMATQKQVDRRFAVETRLANHFADLVAGLPTLQVFGRARAQLVGLR
FT                   RTEAAHRTETMKTLRLAFLSSFVLELLSTLSVALVAVSMGFRVVAGHFDLRTSLFVLIL
FT                   TPEVYLPIRQVGVHFHDSADGTAAADKAFELIEAAEATHIGGDAPAPDPAAATISFNDL
FT                   SVRYPGTDRPALSGFSCRVRPGEVVVLRGTSGGGKSTALSVLMGFQPATSGQVRVGDQD
FT                   LAEVNMADWRHHIAYVSQDPGMVNGTVADNVRMGHPDATDAQLRDALDRAGGRSLALDH
FT                   VVADEGEGLSSGERRRVALARALLRIELGGARLLVLDEPTAGLDQSTEAIAIRAVRASG
FT                   ASALVVSHRPAVIAMADQVVDVMAPAAERADGSDHRPDDSRAAGSWATDSRTSGNARAA
FT                   AAAVHALSSTAGEPSDVKQGTTPRGVSAPAGPAPGQAATSPSKLSKREARKQHRAWSTE
FT                   SGDSADFLLGEDQYPSSVLPHVAEARPDRPASAKGLEAESAPGQTSALVRQLIRGIPHG
FT                   TRRLVTSIILAVCATGSSVGLMALSGWLLSRAAEHPPVLYLLAASVGVRFFGIGRGVFR
FT                   YAERLVGHDLALRMEGSLRETVYAKLARTTLLGRHQGDLLVRVTADVDAVMDVVVRIVV
FT                   PFVSSVLVIGLTSVLIAFFSPGAAVILLLTSLIAGIGLPWLGQRLSRRADEAAVPLRGA
FT                   LADEVRQLARCAPDLVAFGADGAQLDRMRATGIRLRDAEARDAWTRGIASAGQMLSSGL
FT                   AVVGGLLVGGPSVAGGQLLGRDLAILVLTPLALHESLSDLTTAAQTMTRARAALRRVIA
FT                   LLREPPVGKGDRSVPEATGSARTGIPSGELMLRNLAAGWPGHGAVIKGVNLHVGPGERV
FT                   AITGASGVGKTTLAATVMGLIDPIAGTVQAPAAIGYLAQDAHIFATSVAENVRIGDKDA
FT                   TDAQVAQALSKAGLATMDPARVVGEEGATLSGGEARRIAMARILVGGRNDQLVILDEPT
FT                   EHLDSETAEALMDDVWSAVDKAAVVVITHDPELMEAAPSRLDLDDYRA"
FT   CDS_pept        complement(216139..217425)
FT                   /transl_table=11
FT                   /gene="dapE1"
FT                   /locus_tag="PFREUD_01750"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase related
FT                   deacylase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="3.5.1.18"
FT                   /note="N-Succinyl-LL-2,6-diaminoheptanedioate + H2O <=>
FT                   Succinate + LL-2,6-Diaminoheptanedioate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55690"
FT                   /db_xref="GOA:D7GHW8"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010182"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW8"
FT                   /inference="similar to AA sequence:Uniprot:Q03S16_LACBA"
FT                   /protein_id="CBL55690.1"
FT                   /translation="MMAVFTPEQQLRILSDLVAIQSANDHELQVANYLAKLLGDHGITA
FT                   TVLPAEPDADHKQAEPDRANLVAEIGSGAPVLALSGHMDTVSVGDADAWTSDPFTVTER
FT                   DGLLQGRGTTDMKAGLAAMVIAMIELKAQGLPRKGTLRLLASRAEEVGEYGAKELARAG
FT                   YMRDADALVVGEPSGWNIIYTHKGSVDFRLRSQGTAAHSSMPEAGFNAIPPLMEVLVRA
FT                   QQEFNARPASDPVLGELTFSTTVFHGGDQVNTIPDAAVAEVNVRTIPQFDNDEAIALLK
FT                   GLVGEQNRRGARISLDPYMQEPVVQAPRDSLLVRLATKLGERISGVTTPGGRRGRRHGR
FT                   VQPAQGQGTRLPLHDVRARQRDDAHRQREHRQADVPRFRAAVPAPVRGIPRPGRLTATG
FT                   RVADRAGRRPGATGWARSRPAPEWAPVRE"
FT   CDS_pept        complement(216240..216365)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01760"
FT                   /product="peptidase"
FT                   /function="3.10 Protein degradation"
FT                   /note="Pfam domain"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55691"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHW9"
FT                   /protein_id="CBL55691.1"
FT                   /translation="MMFGPGNETMHTANENIDKQMYLDFVQLYQRLFVEYLGQAG"
FT   CDS_pept        216412..216492
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01770"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55692"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX0"
FT                   /protein_id="CBL55692.1"
FT                   /translation="MTAATPTTGGRHAADALAELGGKPHE"
FT   CDS_pept        complement(217560..219257)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01780"
FT                   /product="efflux permease"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55693"
FT                   /db_xref="GOA:D7GHX1"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX1"
FT                   /protein_id="CBL55693.1"
FT                   /translation="MNDSRAIPDHDATANPGRSQRSANPGRSQRGGQLSGLRGELTAVI
FT                   TGGVMPIMDSTIVAIGMPNLIAAFHSNAATMQWVSTGYLLGLAVTVPIMGWLQARLGGR
FT                   SLWIAGLVVFLAGSVACALSWNEISLIAFRVGQGMAAGMLMTLMQTLPVQEARRHGIEQ
FT                   IGSLISVISVPVATGPILGPVLGGLVLHWGSWHWLFLINVPIGLVAIVFALLWMPRDGG
FT                   TPEGTTPRQSFDPLGFVLVSGGLVAILLALTNVATDGGFGHSSVLLPLGLGVVMLAAFL
FT                   AEPRTRDPRRALIDISLMRYRSVASGAASYFLAGGAMYAAQFLLPMFWQQLRGHSVLAA
FT                   ALLLVPQGIGSLLSRLVAGPLTDRIGSRTVATAGFFLVALMTLPFAFVSASTSDALLSG
FT                   LLFFRGLALGILFIPVMLAAYLDIPASAVANATIITRVAQQVGASFGTAVVAVVLEASL
FT                   RTGGVDGSGAFHQAFWATIAITVAGGVVALWLPGRQGLPGREGLPATQEPPGKQGSPEG
FT                   QGSPGKQGSPEDRALRDGQDLLDGHAAPGGLEPSGHLQPPDEPGSSDR"
FT   CDS_pept        complement(219711..219860)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01790"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55694"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX2"
FT                   /protein_id="CBL55694.1"
FT                   /translation="MQGYGLLIASGAVPYERQIFASAMTAFAQQAGALEVADAVKELYV
FT                   QQPA"
FT   CDS_pept        complement(219839..220333)
FT                   /transl_table=11
FT                   /gene="tetR2"
FT                   /locus_tag="PFREUD_01800"
FT                   /product="Transcriptional regulator, TetR/AcrR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55695"
FT                   /db_xref="GOA:D7GHX3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX3"
FT                   /inference="similar to AA sequence:Uniprot:A0NKA7_OENOE"
FT                   /protein_id="CBL55695.1"
FT                   /translation="MTTYDATGMLIISVAIREIRRVGYRNLSLRELAARAGMTTGALYR
FT                   RFSGKDELLAAAAASVGQQIVEEAQARMAGLTPTPHERLVLLGEVMSNRFEKDRELMDF
FT                   LFSALPVGRFWQGVTKPDRSSPLLALTLDTLDALFGENVDHERQRELFGRPAPSCRATG
FT                   C"
FT   CDS_pept        220537..220854
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01810"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55696"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX4"
FT                   /inference="similar to AA sequence:Uniprot:Q6M5W4_CORGL"
FT                   /protein_id="CBL55696.1"
FT                   /translation="MLVAFTISPMGNDNPDGSVHDAVAAAVKVVRDSGLPNETNSMFTT
FT                   IEGSWDECMRVVHDSCAAVEKVAPRVSLVLKADIRPGHTGELTGKVERLDAALEKLDES
FT                   K"
FT   CDS_pept        complement(221013..221033)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01820"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55697"
FT                   /protein_id="CBL55697.1"
FT                   /translation="MDQAFA"
FT   CDS_pept        221178..222809
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01830"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase:4Fe-4S ferredoxin, iron-sulfur
FT                   binding:Aromatic-ring hydroxylase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55698"
FT                   /db_xref="GOA:D7GHX6"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX6"
FT                   /protein_id="CBL55698.1"
FT                   /translation="MSPERRDITQLPDLTTGEGRVGPVRTRMPIYVDLLPPCNNACPAG
FT                   ENCQEWLRLVKETDPESAWRQLVRDNPFPAIHGRVCYHPCETACNRGDLDSAVSIHSVE
FT                   RYLGDLAIEKGWGFDKPRNNSGFRILVIGAGPAGLSAAYHLARLGHEVEIHDAGNQAGG
FT                   MMRYGIPEYRLPRDVVDAEIKRVESLGVKIELNHHVKDLVAEQKSGHFDAVFVAVGAHL
FT                   SRRVEIPSMDAGHMVDAVDFLRNVASGDKPVIGRRVAVYGGGNTAMDAARTARRLGAED
FT                   AVIIYRRTENEMPAHKEELEEAEREGVQVHWLRTINEMQQGDIKVEIMELDKDGKPHGT
FT                   GKYETLAADTVIMAVGQVADTGFLHDIPGMQFNGDVVKVDPTTLMTDVPGIFAGGDAVP
FT                   SERTVTVGVGHGKRAAKQIDTWLNHQNPQTKVKHPIVHFDDLHLWYFGDHPREVQPELD
FT                   PAARVSDFDEVVKGLSADEAIFEATRCLSCGNCFECDGCYGSCPEDAIVKLGKGHRYRF
FT                   DYDKCTGCGTCFEQCPVHAIEMIPEK"
FT   CDS_pept        222815..226582
FT                   /transl_table=11
FT                   /gene="nifJ1"
FT                   /locus_tag="PFREUD_01840"
FT                   /product="Pyruvate synthase/Pyruvate-flavodoxin
FT                   oxidoreductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.2.7.1"
FT                   /note="Oxidoreductase required for the transfer of
FT                   electrons from pyruvate to flavodoxin, which reduces
FT                   nitrogenase , Pyruvate + CoA + oxidized flavodoxin =
FT                   acetyl-CoA + CO2 + reduced flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55699"
FT                   /db_xref="GOA:D7GHX7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="InterPro:IPR037112"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX7"
FT                   /protein_id="CBL55699.1"
FT                   /translation="MTTTTRGPVPGSNGMPANPGLSGEAATATPSPVDVAAGAKDAADE
FT                   LAQSRREQDITHQMICDGNTAASDVAFRINELCSIYPITPSSPMAELADEWSARDRMNI
FT                   WGQVPHVMEMQSEAGAAGAMHGSLQGGALATTFTASQGLLLMIPNMYKISGELTSTVMH
FT                   VAARSLATQGLSIFGDHQDVMACRQTGWAMLCSTGVQQCHDNALISQVATLRSRVPFMH
FT                   FFDGFRTSHELNTCIQLTDDQLRSMVPDALVREHRERALSPDNPFIRGTAQNADVYFQG
FT                   REAGNKYYDSVPGIVQDAMDEFAAMTGRQYHLADYYGAPDADRVIVIMGSGAETVQQTV
FT                   SKLNEQGEKVGLVVIRLYRPFPTQAVLDCIPASVKKIAVLDRTKEPGSNGEPLFLDVVS
FT                   AVSEAYSNGERDNLPAIIGGRYGLSSKEFTPGMCAAVYDELAKDKPKRRFTVGITDDVT
FT                   HLSIPWDASLDLEDPETSRAVFYGIGADGTVGANKNTIKILGSEPGTYAQGYFVYDSKK
FT                   SGGRTTSHLRFGPDPIKAPYLVNQAGFIGVHHWADLERIDVLAFARKGTTVLINSPYPA
FT                   EDVWGHLPAPMQKKIIDLDLQVYAIDAGEVARSVGLGNRTNTVLQTCYFKISGVLPEDH
FT                   AIEAIKNSITKTYAKKSMEIVEKNHAAVDAALEHLHKIDVPAKVTSTEDYLPPVPSFAP
FT                   DFVKDVTAAMMTEQGESLPVSKLPADGSFPSGTTQYEKRNVSEIIAVWDQDNCIQCGNC
FT                   AFVCPHGVLRAKYYKPDVLDDAPKSFQAVPLNAAGLPDEMYTLQVFAEDCTGCGLCVEA
FT                   CPVHPIGGDPERKAINLDSVLDRTNERANVEFFQKIPEPPRTRVNYGAVRGAQFLQPLF
FT                   EFSGACPGCGETPYLKLLTQLFGDRATVANATGCSSIYGGNLPTTPWAKNKEGRGPAWS
FT                   NSLFEDNAEFGLGMRLAADLHNELARRRVDELSDAINDPELVDQLLNAPQAQESDLHAQ
FT                   AERVDALQDRLTDLVNDPNVDADTKAKVEDLRSVADNLLRRSVWIVGGDGWAYDIGSGG
FT                   LDHVLSTGRNVNVLVLDTEVYSNTGGQASKSSPMGAIAKFATAGKRTNKKDIAMQAVSY
FT                   GDVYVARVAFGADPEQTLKAFREAEAYPGPSLIIAYSHCISHGYNLRKGLDQQYKAVAS
FT                   GHWPLIRYNPEVRDSGGNPFLLDSARPRISLMDYRKTELRFKMLMVKDPEEAKRLNDLS
FT                   QEQVTRRFADYEEMASRPAEMFATDARRDV"
FT   CDS_pept        226575..227732
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01850"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="1.3.3.1"
FT                   /note="(S)-Dihydroorotate + Oxygen <=> Orotate + H2O2"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55700"
FT                   /db_xref="GOA:D7GHX8"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX8"
FT                   /protein_id="CBL55700.1"
FT                   /translation="MSEMSINYGSDALAAAAASAAAKSVAGNATTDQLMAPREVNAQVT
FT                   VPNTTDLSSNYMGLPLRNPVVASAGPLAQTVDSIKTLEDAGVGAVVMHSLFEEQLRYES
FT                   EQIVQQTEEQSESFAEALSYFPVTAIASVGATLSSQYLQVLEDGAKALEIPLIGSLNGA
FT                   SGGTWTAEARRMQDAGASAIELNIYLVPGDTSITGREVEDRHVEILRAVKDVVNIPVAV
FT                   KLSPYFSSFGEVATSLCDAGADGLVMFNRFLQPDIDVNKREVVSGFELSSPEIGRLPRT
FT                   WAAVLSGKVKSSLAVSGGVETRDDIVKGLLAGADVVMTTSALVRHGAAYAGRLIDGLRD
FT                   YLRRSDLTLDQLRGMLAVPSDASASEYERSGYVSAIEKAKRRYGV"
FT   CDS_pept        complement(227992..229416)
FT                   /transl_table=11
FT                   /gene="dha1"
FT                   /locus_tag="PFREUD_01860"
FT                   /product="Betaine-aldehyde dehydrogenase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="1.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55701"
FT                   /db_xref="GOA:D7GHX9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR015657"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHX9"
FT                   /protein_id="CBL55701.1"
FT                   /translation="MALLQNFINNRFVASTSTESFNLVDPATAEVTGQSPASNQADVDA
FT                   AYAAAKDATRTWGKMIPGERQRAMLKLADAIEAHSDELVAAQSRNTGQPKHLIASEEVT
FT                   VGADQIRFFAGAARIMEGLASGEYMENMNSVIRREPIGVVGQVTPWNYPLMMAIWKIGP
FT                   ALAAGNTIVLKPSDTTPESTLLLAQLAAEFLPEGTFNVVLGRAATGAMVVGSKVPGLVS
FT                   ITGSVRAGIEVAKAAAENLTRCHLELGGKAPCIVFDDADVDAAAEALTTAGFFNAGQDC
FT                   TSSTRLLVQAGVHDEFVAALAKYARSTRFGSPDDADALYGPLNNANQLARVQQAVDSLP
FT                   AHAEVVTGGKQADRPGFYFEPTVLDGLNQDDALVQNEIFGPVLTVQTFDTEDQAVAMGN
FT                   GVPYGLASSVWTRDHARALRMSAALDFGCVWINCHIPLVAEMPHGGFKSSGYGKDLSKY
FT                   SVEEYTRVKHVMSSME"
FT   CDS_pept        229967..230266
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01870"
FT                   /product="Hypothetical secreted protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55702"
FT                   /db_xref="GOA:D7GHY0"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY0"
FT                   /protein_id="CBL55702.1"
FT                   /translation="MKGSTKLLVIGVVLLVLGCGVTFLQYLNFTSADRQGPDGPELLPL
FT                   AVLDFAMSICGYLGAALTAVAIGLKVAAGGDARAVLPDLDDELDDEIALGRGPA"
FT   CDS_pept        230263..230304
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01880"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55703"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY1"
FT                   /protein_id="CBL55703.1"
FT                   /translation="MSARLPAPAGSTP"
FT   CDS_pept        230301..230510
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01890"
FT                   /product="Hypothetical secreted protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55704"
FT                   /db_xref="GOA:D7GHY2"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY2"
FT                   /protein_id="CBL55704.1"
FT                   /translation="MRGSTKMIIVGAVLVVAIMVAGEVWGAGSSSGGTTLWAALNPVTR
FT                   FGLLLGTMLTAVGVGIRVWMRRTK"
FT   CDS_pept        230582..230716
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01900"
FT                   /product="Hypothetical secreted protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55705"
FT                   /db_xref="GOA:D7GHY3"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY3"
FT                   /protein_id="CBL55705.1"
FT                   /translation="MKSRTVARVVRVALVALCAIIGVVLLVMGRHVLGAVGRPPGAGQ"
FT   CDS_pept        230802..231002
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01910"
FT                   /product="Hypothetical membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55706"
FT                   /db_xref="GOA:D7GHY4"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY4"
FT                   /protein_id="CBL55706.1"
FT                   /translation="MKLKNIIQALIALILIVAAVGLYKVGQVWPAWICVVVGIVVAVWG
FT                   GTASGRTRSGRPRNPERTRSA"
FT   CDS_pept        231284..231904
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01920"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55707"
FT                   /db_xref="InterPro:IPR025159"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY5"
FT                   /protein_id="CBL55707.1"
FT                   /translation="MSSVSDLVTLGRIAANQQGLVTATQARAAGVDTRQIWRLSRAGAL
FT                   ERVIRGVYRVCGAPATDFQEITATWLALSNPGRRLTAAGTTAATLYGIGDFLRTVPEFI
FT                   VAGDPSTTVENVRLRTGHVDQPRVRTLHGVPTLSPEQTIADLLAQHNDVSLVGDATVDA
FT                   LDKHLTTPQRVARALAPMAADHGLPDGDGSELLASILPAATAA"
FT   CDS_pept        231901..232857
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01930"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55708"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY6"
FT                   /protein_id="CBL55708.1"
FT                   /translation="MKGQGPYVDWFGVESAIQQAARRQAADHPGASVGQYLDHIRRDRF
FT                   LSRVFADPESGWLLKGGTAMLARVPTGRHTRDVDLSTTRATLDEAVEDLAHRVAVDMGD
FT                   HLRFQLESERPGLAVTQPGVLVARLSFACITDTGKRFDNVAVDLAVGPPPVGHIEHTRP
FT                   ADSPDLPRLISPPYAMFPLTDQLAEKVSTMMTPRPDGRPNSRAKDLVDVDIIAATQYVD
FT                   LRELRLALAVQQQRANTDLGRHLRVPPHWEPRYQSLATGTSAAAVAPTFADAVDLAARF
FT                   INPALDAVRTVRTTWGPEAMEWTVGTGSPAAGPHRGV"
FT   CDS_pept        complement(233088..234377)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_01940"
FT                   /product="Prophage LambdaBa04, site-specific recombinase,
FT                   phage integrase family"
FT                   /function="4.4 Phage-related function"
FT                   /note="voir cd01189"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55709"
FT                   /db_xref="GOA:D7GHY7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY7"
FT                   /protein_id="CBL55709.1"
FT                   /translation="MAPRGTPAERAADAAETSQKAQARRSRTRRRGRGSIQSYQTAAGK
FT                   RWRYQIWVPVDPEQPDLGEKKFSRGGFSTAADADAALQDALKRRDQQEKFGGKVPTLGV
FT                   YADAWVEGLKLADSTIAGYNKIIRNHLRPQLGHYPLDKLTPTRIARHYRDLEQHGRKDE
FT                   QDKGGPLSANTVHKAHVVLGAILDAAIEDGHIATNPAKRKAAKAPTTSQMRAEKPELVT
FT                   WTADQLAAFLAWDRDELQDELFALWWVIANTGMRRSEALALKWSDVNIKTSQVSIRRAI
FT                   NTEDWTKTKTTKTGNARVIDVDAATLKAIASYKVARAELSFELARADAYIFGDDDGQPR
FT                   SPDAMTSRWDRRLKWAVKVKRFEHLPRVTLKGLRHTHATILMELGVPPKVVQERLGHST
FT                   ITTTMNIYSHVTPTMQKNAVDRFASRLAGT"
FT   CDS_pept        complement(234408..234902)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01950"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55710"
FT                   /db_xref="GOA:D7GHY8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY8"
FT                   /inference="similar to AA sequence:Uniprot:Q856P1_9CAUD"
FT                   /protein_id="CBL55710.1"
FT                   /translation="MDLRTMSDALDAAGRKLSPSGISKLENGDRRVDVDDLTVIAYLLR
FT                   TSPAALLTPPDEQTTLTGVPETYLPEEIEKWARGELVLTSHGLLAYWQQEWVQNLNRIQ
FT                   YFESALRHGSPNQASHDDYKKRLADLKERQRLIRERGVQIDPTGRVFDAADYLDRFGPA
FT                   E"
FT   CDS_pept        235090..235200
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01960"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55711"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHY9"
FT                   /protein_id="CBL55711.1"
FT                   /translation="MRQSTLDIDDLRRRRSLVITRQEAAKPSASIPAPSR"
FT   CDS_pept        235383..236693
FT                   /transl_table=11
FT                   /gene="fic"
FT                   /locus_tag="PFREUD_01970"
FT                   /product="Fic protein"
FT                   /function="1.7 Cell division"
FT                   /note="filamentation induced by cAMP protein . Fic protein
FT                   and cAMP are involved in a regulatory mechanism of cell
FT                   division via folate metabolism. This family contains a
FT                   central conserved motif HPFXXGNG in most members."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55712"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ0"
FT                   /protein_id="CBL55712.1"
FT                   /translation="MGGYVERLWHPEDAGGLSRKDRAPGRYLAYVPDELGDSLPMLGAE
FT                   AQGAAEDALAVLARADERIGARGRYLNHLLIRSESISSSWIEGNRVTPKRLAIAELLHQ
FT                   GPRQALDVVANVRATESAIAELADHTRTIETSDIVDLQHVIEPRLERGVRQEQNWVGGP
FT                   GWSPLRAAFVPPPETEVPRLVADLARFVTDTAGNPVVRAAIAHAQFETIHPFIDGNGRT
FT                   GRALIHTVLRRGDALRNALIPISTVFAGDTDAYIAGLTGYRADPPTLDEWVLGFAQAAE
FT                   KAAGNAVRLAEDIAALDRDVHDRLVAFRRDRGLNPAVPRRDAVVLRILDTLASDPVLTA
FT                   EFVSTRLSVSPAAAHRALTELSEAGILGRTKDQRGRLVCWTADRHLALVALTERSNRVG
FT                   GGDTQGRKPRLGPALPDVSQFGARRQVSTTRRDAPGL"
FT   CDS_pept        236707..237306
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_01980"
FT                   /product="methyltransferase"
FT                   /function="4.6 Miscellaneous"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55713"
FT                   /db_xref="GOA:D7GHZ1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ1"
FT                   /protein_id="CBL55713.1"
FT                   /translation="MVDYWNHNTAYHAELLDAVPPSGGDVLDIGCGDGLLVEKLATKAT
FT                   RVIGLDPDPRAINQARRRLTETPNAQVVLGSFLTAPELDGQSFDLITCVATLHHMPLFA
FT                   ALEQMNAKLKPGGGLCIVGLSANKTAWDWIVSGVHVLPIRLLSKLRGESGYPGMAVARP
FT                   SESLAEIRRISSKVLPASRVRRRFWYRYTLTWTKPE"
FT   CDS_pept        complement(237488..238795)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="PFREUD_01990"
FT                   /product="conjugal transfer protein traA"
FT                   /function="1.10 Transformation/competence"
FT                   /db_xref="PSEUDO:CBL55714.1"
FT   CDS_pept        complement(238838..240757)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="traA"
FT                   /locus_tag="PFREUD_02000"
FT                   /product="conjugal transfer protein traA"
FT                   /function="1.10 Transformation/competence"
FT                   /db_xref="PSEUDO:CBL55715.1"
FT   CDS_pept        240955..241347
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02010"
FT                   /product="Hypothetical secreted protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55716"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ4"
FT                   /protein_id="CBL55716.1"
FT                   /translation="MTVAGLVTLMGLTGCVPFACSAIGWSNTLAVQLDGDTSAVDQVQL
FT                   CTDAGCAPAEDVDMTGPLGFVSVEDQAGDSWTFSVGMMRLERFTVRTLAGDGTVLSDTE
FT                   VTSEWVRVGGSEQCGGPGEATVTVQP"
FT   CDS_pept        241388..241795
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02020"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55717"
FT                   /db_xref="GOA:D7GHZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ5"
FT                   /protein_id="CBL55717.1"
FT                   /translation="MRRSRCAAAVFSIALAVGATLGAVTVFVSVFVSLRATPAARPDLD
FT                   SWTGAANVAAVAAIVGAIVGLIVAAASWSVAAVALGSAAGAALVLWFFATRPGVMLDAG
FT                   AFAALAVVAAALAVVALLVSERRVRSLSPQS"
FT   CDS_pept        complement(241799..242242)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02030"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55718"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ6"
FT                   /protein_id="CBL55718.1"
FT                   /translation="MVATFTLVTDCPTDAATMFDISLDIDAHVDSMSQSRERAIGGMMS
FT                   GRIGLGQTVTWRARHFGIWFTMTSKITTLDRPRSFIDEQVSGPFKTFAHRHTFEDTSGG
FT                   CRMTDTITVASPIFGALAERLVLVPYLRRLIQKRNAALIRKVG"
FT   CDS_pept        242316..242981
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02040"
FT                   /product="Hypothetical membrane anchored protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55719"
FT                   /db_xref="GOA:D7GHZ7"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ7"
FT                   /protein_id="CBL55719.1"
FT                   /translation="MENRTSPEHDALDVLLDRSRMALAEPGDLDAAVEVMLADLADRPR
FT                   GRVARLGRGRRVAAGIALSAVLAGAGMSAAAATGLWSWWAETPDLAYEFTSPSGEQCEV
FT                   RYGLMSTSPTTAPIDSSNLDAGLAEWLAGTDVLAVADVDGALAAFEAGEVEFFAAHLDD
FT                   DGGLTSEAVQPGEVLDADGLYAAAVEYAVSEVINDEVIARGLTGIAYGTESVCGEVMQ"
FT   CDS_pept        242978..243550
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="PFREUD_02050"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily
FT                   RpoE"
FT                   /function="3.5.1 Transcription initiation"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55720"
FT                   /db_xref="GOA:D7GHZ8"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ8"
FT                   /protein_id="CBL55720.1"
FT                   /translation="MTPDPQAQRLTEALRRESPDLLRYFRRRVTEPEDAADLLAETGLT
FT                   AWRRVRDLPADDEGARRWLFTVAHNTYLNHQRGSRRRHALADRVRRILARAERVSPPSD
FT                   DGIEVRDAIDNLTPELAEVVRFIHWDGLTVTEAAEVIGVSASTARARYQRARIELRDTL
FT                   SVATAATSGGAHQRRVALSDPSPGATP"
FT   CDS_pept        complement(243962..244417)
FT                   /transl_table=11
FT                   /gene="mar"
FT                   /locus_tag="PFREUD_02060"
FT                   /product="MarR, Transcriptional regulators"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55721"
FT                   /db_xref="GOA:D7GHZ9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHZ9"
FT                   /protein_id="CBL55721.1"
FT                   /translation="MRVTDVDPITRVRQSLQRQVVAAVLGNEKVARAHGLLVTDLQTLH
FT                   LLVLREDVRTPSQISDATGMPTSTVTKLIDRLETAGYVRRRPDPADRRKTVLELVAESI
FT                   APLRVLYGRTDQEFDDLSRQFTDSELDTVARYLDAVSGFYQIDRLRP"
FT   CDS_pept        244513..245148
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02070"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /function="4.6 Miscellaneous"
FT                   /note="This family of proteins utilise NAD as a cofactor.
FT                   The proteins in this family use nucleotide-sugar substrates
FT                   for a variety of chemical reactions.."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55722"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI00"
FT                   /protein_id="CBL55722.1"
FT                   /translation="MRVLIAGATGTVGQHVVAQALDRGHEVTAIARRPESLRTEHPRLR
FT                   TFAADVLDPDAVEPLLAGVDVVVSTVGIGTSKQPTTLYSEGTRNLVNGMARHSVSRIVT
FT                   ISSEVADHWAHQSPLKLWVALPLLQRFLGATYDDMRRMDIVLWESDAQWTTVRAPYIRD
FT                   RAGSGSYRIATDKPLRRGFSITAPDMATALLDIVERNDLGRRFVFVAN"
FT   CDS_pept        245166..246065
FT                   /transl_table=11
FT                   /gene="araC1"
FT                   /locus_tag="PFREUD_02080"
FT                   /product="Helix-turn-helix, AraC type"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55723"
FT                   /db_xref="GOA:D7GI01"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI01"
FT                   /protein_id="CBL55723.1"
FT                   /translation="MTRTASQIALSDVAPLTGPLAAVETVARAPSGPVAHLEAKIVHVM
FT                   NGRARIETARGELALSRGDVLVLAAGSVSSIRPDPWLRSWTVYVDETFFRHHMHWAIPE
FT                   HAPLIQGVPPSSWDGRPLHLRLDPIRLARLEPILRRMSLTTAVDSYTAAATALALFAQA
FT                   VELVTPAFVGLGSPPSDPRKNDRVRRAGKPPIRAEVRATMALIEERLSYPWRMNELATA
FT                   VALSRSQLTRLSHRHLGATPLQMQAELRVTEFTRLIEETELTITEAARRVGWNDPRVAT
FT                   IRFQRRYGVTPSHYRKGS"
FT   CDS_pept        complement(246357..248420)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02090"
FT                   /product="ABC transporter, transmembrane region"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55724"
FT                   /db_xref="GOA:D7GI02"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI02"
FT                   /protein_id="CBL55724.1"
FT                   /translation="MSVTKDEDSTVSGKKNTNKPAANKRPDYAQSASQSRGPGPGGGRA
FT                   AAVEKAVNFGPSLKRLFGEMKPDRVLIVVVMVLGAIGVAANVYGPKLLGKAANAVFAGV
FT                   IGKGLPAGVTKDQIVAALTQQGKTDQASMIAKLDVIPGQGIDFTHLGHILLLCLALYVT
FT                   AAVLTFIQAFIVNRVVQRAVYRMRDQISAKIDRLPLAYFDGQPAGELLSRVTNDMDNVQ
FT                   QSLQQTMSQVINSLLTLIGVIAMMLTVSWQLTLVTLCIVPLSLAVSIPIGKAAQKRFVG
FT                   MWKSTGELNAKVEESYTGHALVKVFGRRREVEASFHDTNEEMYKASFGAQFISALIMPA
FT                   NFFIGNLNFVAIAVLGGLRVASGTMQLGDVTAFIQYSRMFTQPLTQITSMTNLLQSGVA
FT                   SAERVFEVLDAGEQTPDEHGSLNLPVKGHVQFDHVDFSYSADQPLINNLSIEAKPGQQI
FT                   AIVGPTGAGKTTLVNLLERFYDVQGGKIAIDGVDIASVPRHQLRDQLGMVLQDTWLFGG
FT                   TIHDNIAYGKIDATDDEVIQAAKAAYVDRFVRTLPDGYETKIDEEGSNVSAGEKQLLTI
FT                   ARAFISDPSILILDEATSSVDTRTEVLVQKAMNRLRSGRTSFVIAHRLSTIRDADLILV
FT                   MEHGAIVEQGTHEGLIAAQGAYYRLYESQFSAAEQPEELAGSATSGAKRASS"
FT   CDS_pept        complement(248417..250150)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02100"
FT                   /product="ABC-type transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55725"
FT                   /db_xref="GOA:D7GI03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI03"
FT                   /protein_id="CBL55725.1"
FT                   /translation="MLVRLIWRYLRHYKAAAAIVIAAQLVATVSSLLLPNLNAKIIDQG
FT                   VSTGDTGYIWRTGLLMLAISVGQIGGQMVAAFFGARLAMGVGRDIRAAFFDRTLTFSQQ
FT                   EVNRFGAPSLITRNTNDVQQVQQLLLMTAIMLIGAPITMVGAVFMALREDMGLSWIILA
FT                   AIVALGVCVGIIVSRMSPLFGQNQLRLDAINRVLREQLSGIRVIRAFIREPSERKRFNA
FT                   ANTDIRQLGYRIGTLFAFLFPVVGLVMNLSSAAVWWFGGMRADNGQVQVGQLTAFMTYL
FT                   MQVLMSVMMATVMSMIVPRASISAKRIMDVFLTKSSVVQAEHPVTELTGPAEMDFDHVE
FT                   FSYPGAEAPVLHDISLELRPGTTTAVIGSTGSGKTTLVQLIPRLYDATKGKITINGVDT
FT                   RDLDMDLLWSKIGLIPQKAYLFSGTVASNLRYGKPDATDDEMWEALRVAQADDFVRQMD
FT                   GQLDAPIAQGGTNVSGGQRQRLSIARALVKKPDFYVFDDAFSALDVSTDARVRAALAPT
FT                   TKDAAVLIVAQRVSTIRHADQIIVLDSGHIVGRGTHAELLESSDTYREIVESQMSALEA
FT                   A"
FT   CDS_pept        complement(250150..250842)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02110"
FT                   /product="transcription regulator"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55726"
FT                   /db_xref="GOA:D7GI04"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI04"
FT                   /protein_id="CBL55726.1"
FT                   /translation="MTRAAPLPAEQRRESIIAAARPLLLAHGDAFTTKQVARAAGVAEG
FT                   TIFRVFSSKQDLLNAVVADVLDPTPLIKALDEMTPDADLDERVHHIIELLHRSMSDVRA
FT                   FFAAIHAIPAHGKLFRGSTLSNPKNPDPHHPDACDDAGSASPAHPPVAPDEQMRAKQQQ
FT                   TDLASQAAVERALSPFADQLSVDLATAAGFLRSVTFATIHPFLMNGAPPMTPDQLSALL
FT                   LHGLKKES"
FT   CDS_pept        complement(250920..251810)
FT                   /transl_table=11
FT                   /gene="folP1"
FT                   /locus_tag="PFREUD_02120"
FT                   /product="Dihydropteroate synthase
FT                   ((2-amino-4-hydroxy-7,8-dihydropteridin-6-yl)methyl-diphosphate:4-aminobenzoate
FT                   2-amino-4-hydroxydihydropteridine-6-methenyltransferase)"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.5.1.15"
FT                   /note="2-Amino-4-hydroxy-6-hydroxymethyl-7,8-dihydropteridine
FT                   + 4-Aminobenzoate <=> Dihydropteroate + H2O /
FT                   2-Amino-7,8-dihydro-4-hydroxy-6-(diphosphooxymethyl)pteridine
FT                   + 4-Aminobenzoate <=> Pyrophosphate + Dihydropteroate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55727"
FT                   /db_xref="GOA:D7GI05"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI05"
FT                   /inference="similar to AA sequence:Uniprot:A0LW01"
FT                   /protein_id="CBL55727.1"
FT                   /translation="MQQRPSPLRLGTRVFSTAAPAVMAIINRTPDSFYAPGRFTELDDA
FT                   LAALDRCIDQGADIVDVGGVRAGQDGPWVGEAEEITRVRPFLAAARQRHPGTLFSLDTW
FT                   RAGVARACAGLIDLVNDTWAGADPQLLHVAAEQHVGYVVSHTGGLAPRTDPVGVHYGDD
FT                   SDAAVVQAVRTGLLDGAARALAAGLSPDQVVLDATLDFGKTTAHSLALVRHTDELAGLG
FT                   HPLMMAISRKDFVGETLDLPVDQRLEGSLAATAVAAWQGAILFRAHDVQATRRVVDMVA
FT                   SIRGDRPPARAERGV"
FT   CDS_pept        252063..253565
FT                   /transl_table=11
FT                   /gene="proY"
FT                   /locus_tag="PFREUD_02130"
FT                   /product="Proline-specific permease proY"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55728"
FT                   /db_xref="GOA:D7GI06"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI06"
FT                   /inference="similar to AA sequence:Uniprot:Q6A8U6_PROAC"
FT                   /protein_id="CBL55728.1"
FT                   /translation="MSNQPDRPRGARPTTGGGATGQRVPSGAPSGLDDDPTTQPGLRRG
FT                   LKNRHIQLIALGGAIGTGLFYGSGQSIGQAGPAILLCYLVGGAAIFMVMRALGEMSVDT
FT                   PVTGAFSYYAWRNWGERAGFVSGWNYWFNFVAVSMAELTVVGKYVQFWAPGVPAWVSAA
FT                   AFLVVVTLVNLVSVKAFGEFEFWFAIVKVVAIIAMIVLGALIITTGLGNGGHPIGVENL
FT                   WVNDGFFPKGLWGVLLGLVIVMFSFGGVELIGITAGEAENPRTTIPRAINQVVWRILVF
FT                   YVGAVFVMLCLFPWNQLGTSESPFVTIFDKIGITGAANILNLVVLTAAASAYNSGLYSN
FT                   GRMLYSLARQHNAPRALMKVNRFGSPWVGVLVSSAVTAVAVVLTFLFPDTVFLYVMSIA
FT                   LMAAMTNWVMVVYTDVKFRQRIGPEGAAKLAYRMPGNPWTNYATLAFLGFVMVLMAFTP
FT                   DYRIALPIGAVWIAGLLCAYSLVKRWRDKHGIEAVSEDRWRM"
FT   CDS_pept        253702..254088
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02140"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55729"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI07"
FT                   /protein_id="CBL55729.1"
FT                   /translation="MRRRQEGSIMAQQTPVTQAGVFTNLASELPVVPKSTTSRVVLDND
FT                   LIRVVEFTFDAGELLTEHASPRAVVVQLLEGTMSFTVDGAESTLHVGDVVYLAPGTPHA
FT                   LVATTACRMSLVMVEAGAHLAGEN"
FT   CDS_pept        254360..255019
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02150"
FT                   /product="methyltransferase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55730"
FT                   /db_xref="GOA:D7GI08"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI08"
FT                   /protein_id="CBL55730.1"
FT                   /translation="MEFGPGVGLTAAELLAARPAFYVGIEPNTEGRAKLDAVLAGRPAR
FT                   VVTAEASATGLDAGSADLVVGEAMLTMSSPQQRRAIVAEAARVLAAGGRYAIHELALAD
FT                   AAPDPDRRTGRGEVSREISRTIKVGATPVKLAAWRALLTDAGFDVVWQGTAPMRLLEPS
FT                   RLIADEGPIGFARFATNMIRRPEARRRVLAMRNSFRAYKADLSAVAMVAVKRPTQH"
FT   CDS_pept        255309..257003
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02160"
FT                   /product="ABC transporter ATP binding"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55731"
FT                   /db_xref="GOA:D7GI09"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI09"
FT                   /protein_id="CBL55731.1"
FT                   /translation="MSHTSVSPSAFTRAAPTVVVDHASFELPDGQPVLSDVSAAFPAGR
FT                   TGLIGDNGTGKTTLMRLIAGELTPTEGSVHVAGSCSYLPQDVTSAADISVADQLGITAI
FT                   RQALTRIEAGSVDVHDYDLVGDDWDVDARAVAELAGLGLRADVGWLDRSMSELSGGEAM
FT                   GVALAATRLVRADVTLLDEPTNNLDAHARAALIGQLAHWPGAVIVVSHDRGLLEAVDAI
FT                   CELSWVGAGASRTQQVTMFGGNFSQFEAQREVQRAAAERELRSADAEVHRARAQMRAEQ
FT                   QRQQQRDRSARRENARGNVSKGERDFLANRAEKNTGGKKLMHNARLHDAEAARAAADAA
FT                   ARQPDVIRIPLPDTAVAPGKQIVQVKVGAGQQLRIDGPERIRVSGDNGTGKSMLLKLIT
FT                   GQVDAVPAGLFAAPVGLQLAPTVSTGVLSQRTDELDRFDTCIDALLDVAAQRTSGEARE
FT                   LLARFLITGDKAFQLPATLSGGERFRVAMARVLFTDPAPQLLVLDEPTNNLDMASVDHL
FT                   LEALDGYQGALLVVTHDAHLAGGLHFNRSWQLRRTDEGTVIEEQLGG"
FT   CDS_pept        257147..258754
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="PFREUD_02170"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.6"
FT                   /note="ATP + L-Lysine + tRNA(Lys) <=> AMP + Pyrophosphate +
FT                   L-Lysyl-tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55732"
FT                   /db_xref="GOA:D7GI10"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI10"
FT                   /protein_id="CBL55732.1"
FT                   /translation="MSEQRPEKAPQSRGNQSAGKQSGGNQSRKNEPRKNGAADVEQDLP
FT                   EQMRIRAEKRQRFLDEGKQAYPVDLRRDHTLAEVRATWGHLAAGEETQDEVTIGGRVIF
FT                   IRNSGKLCFATLQDGFTPDQDAERLQIMLSKAEVGDESLAAWKADVDLGDFVWVRGRVI
FT                   ASKRGELSVMASEWKLASKALRPLPTLHNDLSEEARVRQRYNDLIVRPAARTMVRQRAL
FT                   ITRKIRETLEEQGYLEVETPVLQSVHGGAAARPFTTHLNAFDIDMYLRIALELHLKRVM
FT                   VGGADRVYEMGRVFRNEGVDSSHSPEFTMLEAYQSWGDQFTIAETLKSIIMKVAEALDI
FT                   FEIPTDQGVIDLKGEWIWLPVYEGLSGEVGEEITTKTPVEHLRHIADAHKVDYDASWID
FT                   QKMVLHLFEELVEKGLTQPTFVCDFPEIAQPLARRHRSKPGCIEAWDLIIGGMERGTGF
FT                   SELIDPVIQREILTQQSLAAAAGDPEAMQLDEDFLNALEQGCPPMGGLGLGVDRLVMLF
FT                   TGAGIRETILFPLLRPLN"
FT   CDS_pept        complement(258940..259662)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02180"
FT                   /product="methyltransferase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55733"
FT                   /db_xref="GOA:D7GI11"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI11"
FT                   /protein_id="CBL55733.1"
FT                   /translation="MSEFPHQEHPSDQFPGGPDEPATSSPESVTEFWEDRYAGPEHVWS
FT                   ALPNHTFVQVVASLTPGRSLDLGCGEGADAIWLATQGWQATGYDISQTAIGRAQQAAAE
FT                   KNVADTTHFEAVNLDEWSQAPLPDDQGRGQYNLITASFLQSPVALDRIRILQRAARLLV
FT                   RGGHLLMVTHAAPPSWAPPEMASQGDFPKPEEDLKALDPDPRFFEVKLAETRRRPATDP
FT                   TGKPATMNDAVILIQRIR"
FT   CDS_pept        259807..260919
FT                   /transl_table=11
FT                   /gene="bkdA1"
FT                   /locus_tag="PFREUD_02190"
FT                   /product="2-oxoisovalerate dehydrogenase subunit alpha
FT                   (Branched-chain alpha-keto acid dehydrogenase E1 component
FT                   alpha chain) (BCKDH E1-alpha)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="1.2.4.4"
FT                   /note="Similar to Swiss-Prot entries Q9I1M2 and P09060"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55734"
FT                   /db_xref="GOA:D7GI12"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR017596"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI12"
FT                   /protein_id="CBL55734.1"
FT                   /translation="MDSDDPTQPLQLLTPDGTLVDNPRFHWEGSDEDLVDMLRQMTTAR
FT                   RFDVEGAALQRHGELGLWAPLSGQEAYQAAVTKVMKPQDMVFGTYREQSIALQKGVPLG
FT                   DILAVWRGSSLSRWIASDAQVAPYYMIIGAQPLHAVGYAMGVARDKAKHPTDPANDAVT
FT                   LTIYGDGASSQGDVNEALVFAASQQAPVVFLNVNNQWAISEPSSVQTRIPLYQRAMGFG
FT                   IPGIRVDGNDPLACHAVLNWAFDEVRSGSGPVLVEAVTYRMGPHTTSDDPTKYRSSQVT
FT                   EEWKAKDPIERLRSYLLERGLIDYAWTEKLNADLDTFGALVRDTCRALPNTPMSEVFDA
FT                   VTADPGLYLSEQRADCLDWLATPPSEGAAE"
FT   CDS_pept        260916..261890
FT                   /transl_table=11
FT                   /gene="bkdA2"
FT                   /locus_tag="PFREUD_02200"
FT                   /product="2-oxoisovalerate dehydrogenase subunit beta (EC
FT                   1.2.4.4) (Branched-chain alpha-keto acid dehydrogenase E1
FT                   component beta chain) (BCKDH E1-beta) Pyruvate
FT                   dehydrogenase E1 component subunit beta"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="1.2.4.4"
FT                   /note="44% identity with Swiss-Prot entry P09061"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55735"
FT                   /db_xref="GOA:D7GI13"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI13"
FT                   /protein_id="CBL55735.1"
FT                   /translation="MTTLTLAKGLNQGLHDAMDEDPQVLMMGEDIGKLGGVFRITEGLL
FT                   DDFGADRVIDTPLAEAGIIGTAIGLALRGYRPVCEIQFDGFVYPGIDQIINQLARYRSR
FT                   THGRQSLPVVVRIPFGGGIGSPEHHSESPESHFVHTPGLHVVACSNPHDAYWMIRQSIA
FT                   CPDPVIFFEPKRRYYAKGEVDTSAPDLPLFSARIVRPGADLTLLTYGPMVQTCLDAARV
FT                   ASAEGRDVQVIDLRSLSPFDMATIRDALKRTRRAIVVHEAHRTLGPGAELAARLDEELW
FT                   GELDAPVLRVTGYDTVYPPSRSEKGYLPDAERVLDAVDKSFDY"
FT   CDS_pept        261901..263247
FT                   /transl_table=11
FT                   /gene="bkdB"
FT                   /locus_tag="PFREUD_02210"
FT                   /product="dihydrolipoyllysine-residue
FT                   (2-methylpropanoyl)transferase. Lipoamide acyltransferase
FT                   component of branched-chain alpha-keto acid dehydrogenase
FT                   complex (E2) (Dihydrolipoamide branched chain
FT                   transacylase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.3.1.168"
FT                   /note="Similarity to Swiss-Prot entry Q9IMO"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55736"
FT                   /db_xref="GOA:D7GI14"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI14"
FT                   /protein_id="CBL55736.1"
FT                   /translation="MPEYNMPDPGEGLTEADIVEWHVKVGDQVKVNDNLLDIETAKSLV
FT                   ELPSPFAGKVTKIYAEAGATVAVGAPIVFIDDGTGPAPEHDGGAPAQGAEPGAQSSPAQ
FT                   ASSAQSSSNQSGPAQSSAPAPAAQGPAKAAPAAARPDADEASAQRDLDGGMTGERLLSL
FT                   DELPASKPTQQTVRQMLVGYGPADESTPSSTERRRRAHQVSRRGANERALRDEEIPVDT
FT                   VRRLTARNVVHSRTSKVHTTAWVSTDVSGTMELVANLRKRREFKDLHVTALLVWCKAVC
FT                   LAMRNNPMLNASWEDGSERIILHHDVNIGIAADTPRGLMVPVIKQAQNRDLLSMADELT
FT                   RLVNLAKAGTLQPSDYRDGTFTITNVGGLGLDAGTPIINGSESAILAMGAITRQPWVVG
FT                   QGDDEKIVPRWVTTLSISFDHRLIDGAIASRFLRDLAALVRDPAMAMAY"
FT   CDS_pept        complement(263473..264507)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02220"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55737"
FT                   /db_xref="InterPro:IPR032344"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI15"
FT                   /inference="similar to AA sequence:Uniprot:Q21DP8_SACD2"
FT                   /protein_id="CBL55737.1"
FT                   /translation="MPDYEQIIPRILTGAGTGDRRPSAAPAKARVVGAYLSQPLEQVKR
FT                   PAYAHAVLQLPGVTGLEIPLCTTMARDDAKWLMDVLPPGARNIATLMGACDEAAADDPA
FT                   FGLASTDPAGRNRALDLLQQARHSIARMTERGQHVLALEVHSSPTHRDNVDGTSQEFAA
FT                   SLAQAADWDWGETALVVEHCDAARSSGGASKGFLTLDEEIDAVETVRALSPRTPVMMSI
FT                   NWGRSAIDTRNAGGPLTQIDRLRRHGLLAGVILSGASDRASSYGAPWTDAQLPAAAPDG
FT                   SGEASSLLTPQRAVEAMERAGDHLLFDGVTFAIMPQWTPSQERLRYVRGLLSVMPRGHL
FT                   SVAF"
FT   CDS_pept        complement(264823..265110)
FT                   /transl_table=11
FT                   /gene="whiP"
FT                   /locus_tag="PFREUD_02230"
FT                   /product="Hypothetical transmembrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55738"
FT                   /db_xref="GOA:D7GI16"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI16"
FT                   /protein_id="CBL55738.1"
FT                   /translation="MPESQSRKKAQQKKAAKNKQAAATKSAKNREAVNVSSRAWVPWVF
FT                   VPMGLLGVIWLVVYYIGGQQIPLMYALSNWNFVIGLGLIAGSFFVATLWK"
FT   CDS_pept        265289..266023
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02240"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55739"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI17"
FT                   /inference="similar to AA sequence:Uniprot:Q6ABC5_PROAC"
FT                   /protein_id="CBL55739.1"
FT                   /translation="MADKKPGRGRKITRRMATVLVGALAGLLFVAAATTSHGSDLRPTR
FT                   QQDMADLVAAQATHNSQARSTASALQSQVNELSNHDAEAAGVASASMASAEAAAGLTAV
FT                   RGPVVQVTLTDAPLDENPAGVDPDMLVVHQQDIQQVVDALWAGGAEAMTIQGIRVISTT
FT                   GVKCVGNTVILNGVPYSPPYVVAAIGDQQALEQSLAASRNVQIYKQYVLAYRLGYDQKR
FT                   IADVTMPGYAGSVQLNQATPVR"
FT   CDS_pept        266136..266780
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="PFREUD_02250"
FT                   /product="Glutamine amidotransferase of anthranilate
FT                   synthase or para-aminobenzoate synthase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="4.1.3.27"
FT                   /note="Chorismate + NH3 <=> Anthranilate + Pyruvate + H2O
FT                   Chorismate + L-Glutamine <=> Anthranilate + Pyruvate +
FT                   L-Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55740"
FT                   /db_xref="GOA:D7GI18"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI18"
FT                   /protein_id="CBL55740.1"
FT                   /translation="MARILVIDNYDSFVYNLVQYLAQLGARVEVWRNDDARFATPGWAN
FT                   GFDGILLSPGPGTPEDAGVCVEVARTLGEQMPVFGVCLGLQAMAVAFGGRVVRAPEPRH
FT                   GKMSMISHDGQGVFDGLPDPLEVTRYHSLAVEPGSVPDVLDVTATSLDDQVIMALRHRE
FT                   LPVESVQFHPESVMTSNGYQLLANWLAACGDLGAPERAQGLSPLMTAVAGQ"
FT   CDS_pept        complement(266822..267676)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02260"
FT                   /product="Aldo/keto reductase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55741"
FT                   /db_xref="GOA:D7GI19"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI19"
FT                   /protein_id="CBL55741.1"
FT                   /translation="MRHLQISGVSVPAIGIGTWHMGGSPARFDAECDALRAGIDAGARV
FT                   IDTAEMYGSGASESMVGTAIKGLDRSELFIITKVLPNNASRKQMEHSLDASLARLGTDY
FT                   ADLYLLHWRGEVPLEQTVEEMQRLWHSGKIKSWGVSNFDLADMEELAALPHGNHVAANE
FT                   DLYNLSSRGIEFELIGWQRSLDIPLIAYSPLGASGGERGAREMRTSPAVNKVAEAHQVT
FT                   PSQVLLAWVIRNGHTLAIPQTSNEDHMRDNIAAANLTLTDDDLTLLDQAFPPPRHKVPL
FT                   DIL"
FT   CDS_pept        complement(267796..268317)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02270"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55742"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="InterPro:IPR027580"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI20"
FT                   /inference="similar to AA sequence:Uniprot:Q6ABI7_PROAC"
FT                   /protein_id="CBL55742.1"
FT                   /translation="MPTRNVYVSEPDLPVFDAAAQLAGSLSTAVAAGLRLYLAEHEKQQ
FT                   GRHDMKTIEVDVDEGPIVATKRFAGRQLLRWSAEDGTRSHSFRIFRTANDQFAVYARDD
FT                   PNWAAISDPADDNPIWNNPKTWGGDWWRKGRRELKVFATIADMRGVLPDELVAAVGQAV
FT                   EHPPVEDLDI"
FT   CDS_pept        complement(268513..268884)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02280"
FT                   /product="Hypothetical membrane protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55743"
FT                   /db_xref="GOA:D7GI21"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI21"
FT                   /protein_id="CBL55743.1"
FT                   /translation="MRSFYEDSRRVVAALLIAGLGIQGTLALIRGPEISRWVTTMGGGV
FT                   PVLLLCLVVGSPRPRLLVDALAFLTCALSIGVSWGASAQGSAYLTYVPPIIVATCFATA
FT                   ALILRAEGQLARDHSQPRL"
FT   CDS_pept        complement(269199..272594)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02290"
FT                   /product="Hypothetical secreted protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55744"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI22"
FT                   /protein_id="CBL55744.1"
FT                   /translation="MSVVERRQINAAINLRLSLLGLPHPDSNAESPDAILVEPLLARQR
FT                   ELSRRLKDRLSAPDLRIQRFLDDYLADCDEHPQLPRTTLVLDEPGLARGLSLPVDGDEF
FT                   HSDIVASYRLVNGVLHNPKHDRRTTAGVFHISTGGLPIPQDKVEVDKNVYARILARAFQ
FT                   APDEELALPYTANLPEQAHCWASLLMRPTVLPAVPGRTTEKSYEVHFIVPGGLMCNLDF
FT                   VEGIFGNAGDPYLPENDASLDPDSWTGHTGCVILAPHLTTMTKKSLGMPHYDDATERQR
FT                   RDGQCWRHEDDLYNDGKAFKVCARDERGVIVTVIADNYFGYCKKEVKTQISYSANLLGG
FT                   AEEEHSGGAEVYPAWNLNQDFTDRTPDDFTLADVISTNRELLDVRPEGYAVYKPEPNIV
FT                   FIPEHSHYSMRTQTISWTAHGAEQTIKLLAGKHYLSPDGYRIHAKHREMDATQWHLIGT
FT                   SSRAVTCHKPATVSGGGKSEISKSISDAFVFGNAFSHDIDSAMDQVQALFDTDFTNRFA
FT                   DASRNGTDHRPVLSIDRSLGSVIKLLTPSIQYNDEYNAFLEGIEPDVKELAFTVKRYYL
FT                   PEWGEDWRSHFTVGIMNGRHGNMVRLDGKKIITNMLRVGFREDGSWRLFTLRPDYSPAV
FT                   KVQTEDDITASTVTPPWEDAEGLPRKYVTNCEHLLFQRPDDAIHRGYDKQAEFDLASGT
FT                   DTFISNFEPLTHEQARDLLTDVQAYSEFTKPVRKLIERVAAMPDDQSPEFWVCSDDPRH
FT                   LPDGGRSKNPRYLQVRPTDSNPELTTVADVAGKLARKLPLAGHAPQPIDVVAAGRRNNP
FT                   PEDKVPALCAYNPLHYMELPELFMEYISSMTGKSPSTTGAGSEGALTKGPFNALPAVYD
FT                   LNAAVLSYALTDYDGWLSSAGYIGPNARVDHDISMLIPELFSHMGPNDRNTKRLISEGY
FT                   LEKMQDFDFDGHRVLASRLGYRINDRFVTHYFGRIFLHPDVVFSEEMLRPELQDEKIFA
FT                   DSIDVIVKTHQRVAQMYFDDGTVSLACPPIRALLEIMAHGASAEGWTLDSPEFRKLFER
FT                   ESVLASDWYAARLDAKQAEDVKQTEEGVERLKEYIERPDSGSVSARLHLADRLRELEAQ
FT                   LTYERSPEYRRSLVGTLGRQPRFV"
FT   CDS_pept        272752..273492
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02300"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55745"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI23"
FT                   /protein_id="CBL55745.1"
FT                   /translation="MTLRRHLAPALVAPALAAAIFLGGCAAQNPRGDASSSGASASVLT
FT                   RLDLPAPGGTVDKASFVARCAGAQQTIKSYQTVMTTRTVTPQAGTQESTTTFQYDFTDA
FT                   ARPKVRSITSTGTETIYIGSDMWTRAAGAGWAHTTNSASAVVSGKGMDNYVGQVAGEIA
FT                   SVVYAGDEDVNQVRAHHFVFKPVVAPGSASPSVLAHDETGYWVDQDFRPVRVQTSVTTG
FT                   GITSTTIMDSTQYGASFNIQAPAA"
FT   CDS_pept        complement(273496..274938)
FT                   /transl_table=11
FT                   /gene="htrA2"
FT                   /locus_tag="PFREUD_02310"
FT                   /product="secreted serine protease, trypsin-like serine
FT                   proteases"
FT                   /function="1.2.1 Transport/binding of proteins/peptides"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55746"
FT                   /db_xref="GOA:D7GI24"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI24"
FT                   /protein_id="CBL55746.1"
FT                   /translation="MSERNDQYDAHSAEGAGTGSTTPAGSGPAMQPPATQQSSAAQQGW
FT                   QAPRETWDATWSPASLDDGSSTFNADPSAAAAFSNAAGNGGGYGGYPPAPNGANWGVYP
FT                   PSNNHKGPNTRLAALLTALVVVLAMAVALVAPNWSGSGIGQLPVSTPSATQPAQASPST
FT                   SSQRAVAQSQTTASEAQSKGVVLITTQTTSGAAAGSGMVLSSDGYVLTNYHVVETSTQI
FT                   TATVASTNKQYNATVVGRDATNDVALLKLDGASGLDTVTIDSDTVNTGDQVTAVGNSSG
FT                   QGYLSAATGQVVSTSSSITVQNETSASQTETLTNVYETSTQAVPGDSGGPMFDAENEVM
FT                   GITTAGETQTNSRTGQSSTVSSYAIPIARAMSIVKQIESGQSSGTVQVGPKAYLGVTVQ
FT                   SSQSGSVTISQVVSDGPAAAAGLSVGQVITAVDGTRIDSQATLSSVLAQHKPGDKVSVT
FT                   VSSGYGGGTQTASLTLGTSPIN"
FT   CDS_pept        complement(275491..276855)
FT                   /transl_table=11
FT                   /gene="htrA3"
FT                   /locus_tag="PFREUD_02320"
FT                   /product="Trypsin-like serine protease"
FT                   /function="1.2.1 Transport/binding of proteins/peptides"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55747"
FT                   /db_xref="GOA:D7GI25"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI25"
FT                   /protein_id="CBL55747.1"
FT                   /translation="MSDQYGPHPHQPHRGDATPADAARNDAGPARSATGPTQGDADPWA
FT                   AMGGPDTQSPWARPHRAVSNAQAPNSPTPNGPVPDNRVPNGRALNSPTPNGPAPDTPAP
FT                   DSPVPTAPFFIPGDYPPPAPGQQPWGGYPVQQGQASFGGGWTPPGPGQAGWGGGWGPAP
FT                   QPPRRRRGPLLLVIGLALVVFTGALFGSIGVLLRPTMPGLAPPASGAASWGNYTPFMPN
FT                   ASPNDPGATVRPTAPSAEQTDASGDQIRGVAIVEAMLSVTEGSAGTGMVIGDSGIVLTN
FT                   YHVVQGTNGTINVTIASTGSTYSAKVLGHDKANDVALLSLNGASGLPTVKIDADGVRAG
FT                   DQVTSVGNTDGRRKIMAAPGEVLSTNESILTRDEGSTATNQLSGVYETSSRAMHGDSGG
FT                   PTYDSQTEVIGLTTAGSADDGSQFATAYVVPIARALDIANKISRNEPSGTVQMGP"
FT   CDS_pept        277112..277417
FT                   /transl_table=11
FT                   /gene="tnpC"
FT                   /locus_tag="PFREUD_24420"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55748"
FT                   /db_xref="GOA:D7GGH2"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GGH2"
FT                   /protein_id="CBL55748.1"
FT                   /translation="MSTGNEKTRRQRRKFTAQYRHEAARMVIDSGRTIAEVAQELGLGP
FT                   QLLGRWVKVEKETMTPSTLSPDEREELKRLRKENADLRMDNEFLGKAAAFFAAKHQ"
FT   CDS_pept        277414..278322
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24430"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55749"
FT                   /db_xref="GOA:D7GGH1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GGH1"
FT                   /protein_id="CBL55749.1"
FT                   /translation="MSEKYTLMQAEKARYPIARMARLLKVSTSGYYAWVAAQQRDGDHL
FT                   LPSLRARRRLDEAVRRIWVDSRSTYGYLRVCAQLRREGVVVDRKTVAASMRRQGLAGIS
FT                   PRRFRPVTTIPGTRTHSIPDRVKRHWDTGQVDRVWVTDITYLRTRAGWVYLCAIKDACS
FT                   RKVIATAMSTTMTTDLVEEALRRARILRPNAPRKVIIHSDRGTQFTSEQMYECCRELHL
FT                   DQSMGRTGVCWDNAMIESQWSVLKAEFYDRYEWDTPQQAIQGVEEWIYDFYNTKRLNSA
FT                   IGYQTPVEFEAQHAAALTRAA"
FT   CDS_pept        complement(278836..280191)
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="PFREUD_02330"
FT                   /product="Pyridine nucleotide-disulphide oxidoreductase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="1.16.1.1"
FT                   /note="Hg + NADP+ + H+ <=> Hg2+ + NADPH"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55750"
FT                   /db_xref="GOA:D7GGH0"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7GGH0"
FT                   /protein_id="CBL55750.1"
FT                   /translation="MDVDLLVIGWGKAGKTLAGRFAAAGKTVALVERSPEMYGGTCINI
FT                   GCVPTKDLVVSAEERRDSDDPQEFFRTAVAGRDALIGTLNAANHQMLEKPGVTLVDGTA
FT                   RFTGPRTVVVDTAEGQVELTGETVVIGTGATSRRVDLPGFDSPRVFDSTTIQHIDPLPE
FT                   RLVIVGGGFIGLEFASMFTHFGSKVTILDRGEEFLPRVDRDVAEAVRQTLLDMGVTIEQ
FT                   GVRPTSLDDDGTHAVVHTTKGDFAAEAVLVAAGRVPVTGELGLEAARIEVDERGFVVVD
FT                   DQLQTSVPGVYAVGDVNGGPQFTYISLDDNRIVWGAVMGQGTRRRSDRVAVPNTTFITP
FT                   PLSMVGMDETQARKSGRNVLMAKKEVAKIAAMPRPKIVGETHGLFKLFVDADSQEILGA
FT                   TIFSIDSQELVNMVALAIRLGAKVSDLRDGIWTHPSSTEAFNEVLGTLEPLA"
FT   CDS_pept        complement(280341..281759)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24440"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55751"
FT                   /db_xref="GOA:D7GGG9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:D7GGG9"
FT                   /protein_id="CBL55751.1"
FT                   /translation="MRTGDVPEGLRRQWRADRALRPAMFSPGRPQPSRTVQRDFWRLIA
FT                   TGISTAEAALVVGVSIPVASRWFRHAGGMPPISLVEPSGRYLSFAEREEIAILKAQGKG
FT                   VRTIARALGRDPGTISRELRRNAATRGGKLEYRAMVAQWKAHEAAKRPKEAKMVTNPRL
FT                   RDYVQDRLAGKVTHPDGRTVNGPDTPVWKGLNKPHRADRRWSKAWSPEQISRRLRIEFG
FT                   DDESMRISHEAIYQSLFIEGRGALKRDLVTCLRTGRALRSPRERSRNKPHGHVTADVVI
FT                   SERPAEAADRAVPGHWEGDLIIGTGRSAIGTLVERHSRATILVHLPRLEGWGQTPPVKN
FT                   GPSLGGYGAVAMNTALAASITALPQQLRKTITWDRGKELSAHATFALETGTKVYFADPH
FT                   SPWQRPSNENTNGLLRQYFPKGTDLSRWTAEDLEAVAHTLNNRPRKTLGWRTPAEVFEE
FT                   QLRSLEEAGVATTG"
FT   CDS_pept        complement(281906..283213)
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24450"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55752"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI30"
FT                   /protein_id="CBL55752.1"
FT                   /translation="MSDATFACPDLTKFCRLDDLGLVVTGQRIEPDRAVLACRVVDDDR
FT                   WCRGCGREGSPRDSVTRELAHAPQGWRPTTLVVTVRRYRCTGCTRVWRQDTSAAAEPRA
FT                   KLSRAGLRWALEGIVVQHLTVARVAEGLGVAWNTANDAVLAEGKRLLINDPARFDGVKV
FT                   IGVDELVWRHTRRGDKYVTVIIDLTPVRDGTGPARLLDMVEGRSKQAFESWLADRPQSW
FT                   RDAVQVVAMDGFTGFKTAAVEELPDVVTVMDPFHVTRLAGEALDVCRRRVQQAIHGHRG
FT                   MKGDPLYSARRTLCTGADLLTDKQATRLRSLFADDNHVEVEATWGVYQRMIAAYRHEDR
FT                   SRGRELMAKLIDDLSAGVPTVLVEITKLGRTLKKRAADVLAYFDRPGTSNGPTEAINRR
FT                   LEHLRGSALGFRNLTSYIARSLLETGGFRPQLHPRL"
FT   CDS_pept        complement(283180..283254)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02340"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55753"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI31"
FT                   /protein_id="CBL55753.1"
FT                   /translation="MMGVPTPSIQKTSTCLTLPSLAPT"
FT   CDS_pept        complement(283456..284451)
FT                   /transl_table=11
FT                   /gene="galE1"
FT                   /locus_tag="PFREUD_02350"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="5.1.3.2"
FT                   /note="UDP-glucose = UDP-galactose"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55754"
FT                   /db_xref="GOA:D7GI32"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI32"
FT                   /protein_id="CBL55754.1"
FT                   /translation="MSWLVTGGAGYIGSHVVRAFIEQGITPIVVDDLSSGHREFVPDGV
FT                   DFVEGQVQDTSLLERTMREHDVEGVMHIAGYKYAGVSVARPLHTYSQNVQGTAAVLEAM
FT                   QRVGVSRIVFSSSAAVYGTPDVDLVTEDQPTAPESPYGQSKLIGEWLLADQARALELTD
FT                   GATPLQHVSLRYFNVVGSGTDEVYDTSPHNLFPLVIEALIEGRTPRINGTDYPTPDGTC
FT                   VRDYVHVADLATSHVAAATAMAEGRELRPVYNLGSGDGLSVREIMDAMQRGTGHTFEPV
FT                   IGERRPGDPARIVANGDAAARDLDWRMRHSIDDMVTSAWQARTAHPDISE"
FT   CDS_pept        complement(284497..285885)
FT                   /transl_table=11
FT                   /gene="galP"
FT                   /locus_tag="PFREUD_02360"
FT                   /product="Sodium:galactoside symporter"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55755"
FT                   /db_xref="GOA:D7GI33"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI33"
FT                   /protein_id="CBL55755.1"
FT                   /translation="MPTHAASSGKTYLTWGNKIGYGSGDIAGNVVYAFLSAFLMIYLTD
FT                   QMGLNAGVIGTLMMVAQLFNGVTDIGFGALLDRTHTRMGKARPWMLWPYIGCAVTLVAS
FT                   FAIPGGLSETGKYIWFFLAYILLNSVFYTANNIAYSTLTALITRNPAERVQMGSIRFMF
FT                   AFTTSMLIQTFTVQGVRMLGGGADGWRAIAIIYAVIGLAVNTISVLSVKELPPEELDEG
FT                   HDPAAAERYSFKEGARILLANKFYLIILVIYLVQQIFTATLNMGIYFMTYVLGDATRLG
FT                   AFAWAINIPLIIGLLFTPVLVKRYGQMYRLNIWGYVVAVLGRLGVVAGGYMGSIPLMIA
FT                   SSAIASLGMSPLQGTLNALIAEASEYTFLRTGKHIDGMMFSCTTLGVKIGGGVGTALAG
FT                   WLLAASGYVGNATTQSSSAIHMLYFMYLWIPAIATLIILAFLTRLDVEKANRALRTSAD
FT                   RVTA"
FT   CDS_pept        complement(285908..288976)
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="PFREUD_02370"
FT                   /product="Beta-galactosidase (Lactase) LacZ"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="3.2.1.23"
FT                   /note="Lactose + H2O <=> alpha-D-Glucose + D-Galactose"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55756"
FT                   /db_xref="GOA:D7GI34"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023230"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI34"
FT                   /protein_id="CBL55756.1"
FT                   /translation="MSIPKHHQGLEVLHENTLAAHAYFVPASAAVTDVVTARESSDRVQ
FT                   LLNGQWDFRYHHSVNDLDEAFMDPGCTVEGFAPITVPGTWQHQGYDAHQYTNVRYPIPL
FT                   DPPHVPVDNPCGAYRTTFDHHADAAAPDTTLVFEGVDSCFYVWVNGHYVGYSQVSHATS
FT                   EFDITEALVEGTNHMAVLVFKWCDGTYLEDQDKFRTSGIFRDVYLVDRPTRHLFDYFTT
FT                   TQIHEAGATVRLRASYVGGPVETRATLLGADGTTVASGVLAEANDARGYSHAVELHVNR
FT                   PRLWNPEHPELYTLLLEMPDEVVTDQVGLREVSIDDVVLRLNDCPVTLRGVNRHDSAPA
FT                   TGPTVDVAHMRRDLELMVRHNINAVRSSHYPNDPRFYQLCDQYGLLVMSEADNESHGTQ
FT                   AQFLADESWDNVVEHWNELIADSPDWTEATLDRVQRCVQREKNRPSIFSWSAGNECAYG
FT                   CTLEVSLAWMKEFDPDRVTHYESAFYRDSKRSYDYSNIDLYSRMYPSQQEMLDYLAGDP
FT                   DKPLVLVEYCHAMGNGPGDLEDYWQLIHTDPRLCGGFVWEWCDHAVLAGHTDDGRPCYL
FT                   YGGDSGEVIHDGNFCVDGLVWPDRRPHPGLLELKNVQRPARVVAHDPGAGMLTLRNDLD
FT                   FTNLDEVVDLSWELVCDGIVLDRGDLSFTRPVPPHTETQVTCRPQLPRVGRCHLRVTQR
FT                   LRVGDAVRAAGQELGFDEVAVPVADPRNQQSVQLLEAPPGGVSPAVEQDPSAITVRGDG
FT                   FQYRFDTGTGMPTSMLVGDQEMFTAPAEVNIWRAPTDNDRRIRLEWERARYPYAAVRAH
FT                   ECSAQTLDGSVVVRARMTLDAATIQPILRLDASWTIDVAGRLRCQMDVTRTPGFPTLPR
FT                   LGLRFFLAPELDQASWVGLGPGENYPDKRQASRHGHFTSSIDGLFVDYLRPQENGSRGD
FT                   CDWVRVEQADAARGLTVTSPRPFSFNASRITQEQLSITRHDVELDPDDQVVLCIDHAMA
FT                   GIGSNSCGPELLARYRVDDETYHVDLVLAPTRR"
FT   CDS_pept        complement(288973..289188)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="murQ"
FT                   /locus_tag="PFREUD_02380"
FT                   /product="N-acetylmuramic acid 6-phosphate etherase
FT                   (MurNAc-6-P etherase)"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="4.2.-.-"
FT                   /db_xref="PSEUDO:CBL55757.1"
FT   CDS_pept        289289..290278
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02390"
FT                   /product="Transcriptional regulator"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55758"
FT                   /db_xref="GOA:D7GI36"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI36"
FT                   /inference="similar to AA sequence:Uniprot:Q6A8M8_PROAC"
FT                   /protein_id="CBL55758.1"
FT                   /translation="MRGWLPFKELSEMTAPREVAPDSTVPSRLDDVSSQPADRDTSPNS
FT                   TLLVERIRRARPSFSAMETAVADHLLSDPSAVVSATTAELAKAAGVSQASVVRFARSLG
FT                   YEGLPALRLSLARELTRLDVEHELSGVARGRIDASDSLHDLAHKIGFHEARSIEDTVSG
FT                   LDLTCLDEVAHAIAARRPVTVLGVGASGLVAEDLCQKLQRIGQQCQFTSDTHLQLVQAA
FT                   MRTPQDVVIGISFSGRTVETHKALALAANAGALSVAITGNPDSPIGQVVSHVLTTTARE
FT                   DELRIGALASRMAQLAVVDVLFARIAQLRFDDLDAALAVLPRDVVNAG"
FT   CDS_pept        complement(290240..291073)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24460"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /note="Integrase core domain. Integrase mediates
FT                   integration of a DNA copy of the viral genome into the host
FT                   chromosome."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55759"
FT                   /db_xref="GOA:D7GI37"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI37"
FT                   /inference="similar to AA sequence:Uniprot:A0JV34"
FT                   /protein_id="CBL55759.1"
FT                   /translation="MWVTTLTLLTTEVFVTHANAPLTPEGRRRLAVLVVEQGWSLRRAA
FT                   ERFQCSPATVKRWADRYRAGLPVRRPKPKRYEVAAPGQLVHVDIKKQGRIPDGGGWRAH
FT                   GRGSMQDRHAGVARDKAARAGAAGSRGYRYLHHAVDDHSRIAYSEILDDERRETAAGFW
FT                   TRANAFFAGLGVTVTAVMTDNGSCYRSGAFADALGDEVKHKWTRPYRPQTNGKVERFNR
FT                   TLAVEWAYAKPYASEAERAAAYETWLHHYNHHRPHTGIGGQTPSARVHNVTGKYS"
FT   CDS_pept        290327..290506
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02400"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55760"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI38"
FT                   /protein_id="CBL55760.1"
FT                   /translation="MEPGLVGCGALGFAGVGLRVGPLDGEGPVEPLDLAVGLRPVWPGP
FT                   LVLHLVAERVSEGA"
FT   CDS_pept        290427..290513
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02410"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55761"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI39"
FT                   /protein_id="CBL55761.1"
FT                   /translation="MPLVCGRYGRVHLCFTSSPSASAKAPDR"
FT   CDS_pept        complement(291097..291420)
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="PFREUD_24470"
FT                   /product="transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55762"
FT                   /db_xref="GOA:D7GI40"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI40"
FT                   /protein_id="CBL55762.1"
FT                   /translation="MEDVPDPQVPAKAQRRTYTARYKAKVLAEYEACDREGKGALLRRE
FT                   GLYTSLISSWRDQRDRGALEALGRSSGAAPATAAEKEAARLRRENERLTGELTVLPREV
FT                   VNG"
FT   CDS_pept        291647..292783
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="PFREUD_02420"
FT                   /product="Crotonobetainyl-CoA dehydrogenase
FT                   (Crotonobetainyl-CoA reductase)"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="1.3.99.-"
FT                   /note="fatty acid metabolism and xenobiotic degradation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55763"
FT                   /db_xref="GOA:D7GI41"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI41"
FT                   /protein_id="CBL55763.1"
FT                   /translation="MDFSLTEDQQLMVDGFTELMNSEAWEKYFHECDENSEYPERWVKA
FT                   ICDLGFDRILLPEEYDGLGLGWQTLAAAYEALGRAGGPTHVLYQLPGWDTVIREGTEEQ
FT                   KKDILKFVGSGKQMLNYAMTEPSAGSSWDDMSTTYSRKGGKVYLNGHKTFITSSMKVPY
FT                   LVVMARDADNMGTYTEWFVDMSLPGITKEPLHKLGLRMDSCADIYFDNVELREEDLFGT
FT                   EGNGFKRGVKDFDLERFEVAMTNYGTAYCAFEDAAKYANQRVQGGEAIARKQLIQLKFA
FT                   DMKVDITNMRNMLYEIAWKADNDQLGRGDCSMAKYYCSHAAARVVDNALQTLAGVGVTG
FT                   EHRVQRFYRDLRVDRVSGGTDEMMILAAGRGALRDYRS"
FT   CDS_pept        292853..294079
FT                   /transl_table=11
FT                   /gene="caiB"
FT                   /locus_tag="PFREUD_02430"
FT                   /product="Crotonobetainyl-CoA:carnitine CoA-transferase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="2.8.3.-"
FT                   /note="Engemann et al. Cai locus and corresponding enzymes
FT                   of Proteus sp."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55764"
FT                   /db_xref="GOA:D7GI42"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI42"
FT                   /protein_id="CBL55764.1"
FT                   /translation="MSLPTQKPSFGVLDGLKVIYSAVEIAVPTACEIMSEWGADVTWIE
FT                   NTHTGDSVRDTTYVKEMERRNQRSLSMNPFSDEGKEILFKLIEDADVFVESSKGPAWAR
FT                   KGITDEMLWERNPKLVIVHVSGFGHTGDPVRVNSAAYDLTVQDYAGYVYQNGTPDQPMT
FT                   AAPYTGDYFNSLMVVSSALAAVFRAQKTGKGESIDLAMYETMLRMGAYYMIDYLNAGIE
FT                   YPRAGARNQNLCAIGQYKCRNGVIGLCVYGVPQNKYLLEAIGLGELWGTEDYPEDTSAL
FT                   WLSSPKAELIESKLEEYLLARDVEDVEADFTAHKLAAQKCLSFEDILAEKHVQERGNFI
FT                   EWQNAEGQDVKGLNTVPVFKNRPGQFWRPLPPLGYDTADLLAKAGFSPADIERFKASGK
FT                   VRFGDQDES"
FT   CDS_pept        294104..295705
FT                   /transl_table=11
FT                   /gene="caiC"
FT                   /locus_tag="PFREUD_02440"
FT                   /product="Crotonobetaine/carnitine-CoA ligase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="6.2.1.-"
FT                   /note="Could catalyze the transfer of CoA to carnitine,
FT                   generating the initial carnitinyl-CoA needed for the caiB
FT                   reaction cycle"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55765"
FT                   /db_xref="GOA:D7GI43"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI43"
FT                   /protein_id="CBL55765.1"
FT                   /translation="MTMWDAAEAGEELSLGAIWDHQVRSRRTAEFLVFGDPDTGQVRTY
FT                   SYGEFDAWVNQVAHVLADAGVGQRTRVAVHLYNSPEFIACLLALAKIGGVLVPISPAYS
FT                   RVECADIVARTTPLVLVTEPELLAIHGDEQLAAIGTVLSLGGNPEHKPGRVLDFTTTVG
FT                   EASPEPGVHPALDGSDLLEVMFTSGTTARPKGVMLTHANFVFSGLFVNWQLAMGQDDRF
FT                   YSSMVGTHVNLQLSALAPVITAGATMIFEKRYSATRAWAQVRRHRATLIQSMAMMVRTM
FT                   MAQPVAPDERDHQVRLVHYFLPITDDEKAAFEHRFGVRLLNNYGSSESLVGVLTERPFG
FT                   PTRWPSVGRVGLGYRVRVASDAGHPMPVGEVGEIQVRGIPGVSLMAGYWRDPARTDACF
FT                   TDDGWMHTSDCGRMDADGWFYFVDRNVDVIKRAGETISSAEVEDALLHQPGVVDAAVVG
FT                   VPDPIKDEAIEAFVVPALGVKLDVEQIRKRCAERLAYFKVPEAIHVSSELPRGNYGKIR
FT                   KDLLRKELMTAKGRSL"
FT   CDS_pept        295702..296580
FT                   /transl_table=11
FT                   /gene="maoC"
FT                   /locus_tag="PFREUD_02450"
FT                   /product="MaoC acyl dehydratase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55766"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI44"
FT                   /protein_id="CBL55766.1"
FT                   /translation="MNRIKTEMVGQTFGPFVREYNFRDLELFALGCGAGIDGKDGLEYI
FT                   NEHDPLNPSLKVLPMFGAMLIVDSEVTRTIDYGYNYAGSLHWGFDIKYHQPITKMADTI
FT                   STKVKLAGLYDRGEGKGLLAQHIGDSYDAEGNLLFTNESWDALIYDGGWGGPKPPKDLV
FT                   DMPDRAPDAEVTERIPENQALIYRLSGDYHPQHIDWDYAAKNGEPRPILHAISYAGVVM
FT                   RHAIKTFVPGEPERITRFKTRITSPVLPGSTLRTQMWKVGEGELRFRLVDDDFDTTGAK
FT                   PHLNWGIIEYK"
FT   CDS_pept        296791..298149
FT                   /transl_table=11
FT                   /gene="yaaU"
FT                   /locus_tag="PFREUD_02460"
FT                   /product="metabolite transport protein YaaU"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /note="Belongs to the major facilitator superfamily. Sugar
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55767"
FT                   /db_xref="GOA:D7GI45"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI45"
FT                   /protein_id="CBL55767.1"
FT                   /translation="MPQQPVSQQPTSQQPVNLEDVGMSRALRKVVVFSSGGPFLEGYVL
FT                   GIIGVALVHMGPDLGINEHWSGLLGAAALVGVFVGAIAGGWVTDLIGRRKMFVIDLILI
FT                   GVLSLLCMVVSTPGQLFVLRLAIGVVIGADYPIATSMIAEFTPRKYRAMAMGAIAAVWY
FT                   LGANVAYVVGYLFDNVTRGWTWMLGSSVIPCVIILIGRWSVPESPRWLYSKGRTEEAAE
FT                   VVRGLYGQDVELGLQPEPTRTKFSKVFSRPYLWRVLFVGVIWLCQAIPMFAMYTYGPQI
FT                   SNAFGLGEGRNALLGEMVVGTFFLIGTIPAMFLAESLGRRRLVIGSFAVMTVALAVLGV
FT                   VPQPTTIVILVCFVLYALFSGGPGNLQWLYPNELFPTDIRGSAMGVAMAVSRIGTVVSI
FT                   YILPGFIARQGMGATMIAGAIISAVGFVVSLVWAPETRGHDLSETSAPQFKGR"
FT   CDS_pept        298154..298798
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02470"
FT                   /product="Beta-lactamase-like"
FT                   /function="4.2 Detoxification"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55768"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI46"
FT                   /protein_id="CBL55768.1"
FT                   /translation="MFTIEPVPFGSYQANCYVLTSAGRALVVDPGAEAPLLLAWLAGRD
FT                   VVGVVLTHSHSDHIGAANEVARAFGVPIMCGRADAAAMADPHLTGFDEEGSDYAVTRID
FT                   RALDEGDLIEFGDDTVQVLETPGHTPGSICLWSSAQGVLLTGDTLFAQGVGSTEYLRAD
FT                   PRALVATAARLGALADDAELWPGHGGRTYLSVERARNPMLRAGLGGVGQPA"
FT   CDS_pept        298982..299737
FT                   /transl_table=11
FT                   /gene="fixA (ydiQ)"
FT                   /locus_tag="PFREUD_02480"
FT                   /product="Electron transfer flavoprotein (FixA protein)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /note="Required for anaerobic carnitine reduction. May
FT                   bring reductant to caiA"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55769"
FT                   /db_xref="GOA:D7GI47"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI47"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5P5_PROAC"
FT                   /protein_id="CBL55769.1"
FT                   /translation="MTIVVAYKYAPNPQDAEVRGDGTVDWSRAKSAVSEYDPVAVQLGR
FT                   ELAGDAEVVGISVGGADVASSMAKKNAMSRGLDRGLVVADDAAADWNATRTASALAALV
FT                   KKVDGADLLLAGDSSVDEGAKMMSALVAGYLGWPCFQEVSALEKTDNGYRVTQDQPGGR
FT                   RVVEVTGPLVVAVAADAVKPKVPGMKDILAAGKKTVEVVPVADLEVSDAAIAITASEKP
FT                   AAPARKQQILSGDDAAAQLVAALRADSVL"
FT   CDS_pept        299774..300646
FT                   /transl_table=11
FT                   /gene="fixB (ydiR)"
FT                   /locus_tag="PFREUD_02490"
FT                   /product="Electron transfer flavoprotein, carnitine
FT                   metabolism (FixB protein)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /note="Required for anaerobic carnitine reduction. May
FT                   bring reductant to caiA"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55770"
FT                   /db_xref="GOA:D7GI48"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI48"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5P6_PROAC"
FT                   /protein_id="CBL55770.1"
FT                   /translation="MTNTWIVTTNAQIGNLVEAGRALGGTITVVAVGDAQIAGVDKVIS
FT                   ITADADVPAEAYAGAVADAVAAGDQDVVLAPNRPAERVLAGAVAARLNAPVLSSVKKVD
FT                   AEGAHVARFGGITLQTDALTARAVLIMDGGPAPEGDPVAAESVAAQAYPATVSSTESAQ
FT                   GERVDLTTAQRIIACGRGFKEQSELSLAQDAANAMDAQLACSRPLAEGVNWFDKDRYIG
FT                   VSGLTVAPDVYVAVGISGQIQHLAGMLDSKVVVAINNDKNAPIFKAAAYGIVGELEQVL
FT                   PQLTEALKA"
FT   CDS_pept        300649..301953
FT                   /transl_table=11
FT                   /gene="fixC (ydiS)"
FT                   /locus_tag="PFREUD_02500"
FT                   /product="Electron transfer flavoprotein-quinone
FT                   oxidoreductase (FixC protein)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.5.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55771"
FT                   /db_xref="GOA:D7GI49"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI49"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5P7_PROAC"
FT                   /protein_id="CBL55771.1"
FT                   /translation="MADEDEDIFDVVVIGGGVAGCTAAYKLAQQGHSVVLIERAAQPGS
FT                   KNLSGGVFYCRVMEQVFPGFVDNAPVERRITRNVVSFANPTSTVNIDYWDQRLAEPVNA
FT                   VSVLRAKLDAWLSEQCEEAGVMVMPGVKVDELVIEGGQVVGVRAGEDELRARIVIAADG
FT                   VNSFIAQQAGIRPKEPKKSLAVGVKSVIALDPATIEQRFHCSGDEGTAYAVVGDCTQGV
FT                   AGGGFLYTNKESISIGVVLRLDDLVAKGLASSDVHDHFLAHPAIAPLLEGGQLREYGCH
FT                   LTIEDGPAMVAHELHRAGLMIVGDAAGFTLNTGLTIRGMDLAAGSALAAASAAHRALTD
FT                   KDYSDESMARYERNLERDFVGQDMRTYAHMPELLDSPRMYGAYGEMIADVMHGMFNMDT
FT                   RPRTHAIKVATRAFKKSSVRLGELVRDGITALKAL"
FT   CDS_pept        301967..302260
FT                   /transl_table=11
FT                   /gene="fixX"
FT                   /locus_tag="PFREUD_02510"
FT                   /product="Ferredoxin-like protein fixX"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55772"
FT                   /db_xref="GOA:D7GI50"
FT                   /db_xref="InterPro:IPR012206"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI50"
FT                   /protein_id="CBL55772.1"
FT                   /translation="MIDYLASIPERLAHDAYETDEEESHIEVHQEEARRTGAGKLFVQV
FT                   CPAHVYSEEPDGTISVEYAACLECGTCLAVAPPGTLTWHYPRGGMGVVFREG"
FT   CDS_pept        304364..306136
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02520"
FT                   /product="DNA or RNA helicase"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55773"
FT                   /db_xref="GOA:D7GI51"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI51"
FT                   /protein_id="CBL55773.1"
FT                   /translation="MSTSAFDHFSPAYPGRAPWGTSNRLRAWQAAALEQYRDQAPRDFL
FT                   AVATPGAGKTAFALRVAAELLSARVIQRITVVCPTEHLKTQWAEAAAKVGIQLDPGLGG
FT                   SSRRGRSRQFHGTAVTYAGVAARVFHYRARTENFKTLVIFDEIHHAGDALSWGDAIAEA
FT                   FEPATRRLALTGTPFRSDDTPIPFIRYERHNDGSLHSAPDFTYGYAQALRDQVVRPVLF
FT                   MAYGGQMHWRTKMGDEVEADLAAPLTKDLSASAWRTALDPKGEWMSAVLGAADARLTQV
FT                   RSHMPDAGGLVIASDQQLARAYAKILHQITGEPATLVLSDDAGSNERITEFSESQSRWM
FT                   VAVRMVSEGVDVPRLAVGVYATSVSTPLFFAQAVGRFVRTRRRGETATVFLPTVPIILA
FT                   HATLLERERDHVIGKPKNDEGDLWAPEEALIAQANAAEGASDDLLGSFEALGSHANFDH
FT                   VLYDSQAYGLPAEATSQDEADYLGLPGLLEPDQVSALLKERQRKQLRRHDRADRRERVP
FT                   EAQRLHKALESSRKQLNSLVSQYARSSGVPHSHVHAALRRACGGPELARCTTEQVDERT
FT                   AMLRRWFMHPEARP"
FT   CDS_pept        306389..307060
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02530"
FT                   /product="Hypothetical secreted protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55774"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI52"
FT                   /protein_id="CBL55774.1"
FT                   /translation="MRRRVSHPLRVILVGMVVLACLVLTGSWALVHGAARDRVFTAHSA
FT                   PNRDVALVLGAGLNADGSPSLYLAGRLRAAYDLYVSQKVKVILVSGDNRTVTYSEPGAM
FT                   RSYLRLLGVPDRDVVADYAGLDTYDSCYRARNIFGVNSVTVVGQSYHLDRAVATCRSIG
FT                   IDDTIGVSDEQSHDTSTWRTGEMREIPANVKFVWDRVTHRKPVLGQRETSVTDALAEHD
FT                   R"
FT   CDS_pept        complement(307148..308566)
FT                   /transl_table=11
FT                   /gene="udgA (rkpK)"
FT                   /locus_tag="PFREUD_02540"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="1.1.1.22"
FT                   /note="UDP-glucose + H2O + 2 NAD+ <=> UDP-glucuronate + 2
FT                   NADH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55775"
FT                   /db_xref="GOA:D7GI53"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI53"
FT                   /inference="similar to AA sequence:Uniprot:Q40XQ7_KINRA"
FT                   /protein_id="CBL55775.1"
FT                   /translation="MHISVIGCGYLGAVHAACLAGAGHEVVGLDVDARKVAGLQAGEPL
FT                   FHEPGLAGLLGRTVGHGLRFTTDPGTLGAAEVIYVAVGTPQLGDGQVGVGQVGTGHAGN
FT                   RRATGNPAPDGSGAQGPVTAGRADLSQLDAALRQVEAHASRTHRTLVVGKSTVPVGTAA
FT                   RVAERLSQSDADLVVAWEPEFVREGHAIADIRAPARLVHGLPDDPEQARFARSQLARCH
FT                   RGIDAATPRLAVDYATAELVKTSANAFLSTKISFINAMAELCDAAGADVTALADALGLD
FT                   PRIGAGFLDAGIGFGGGCLPKDLRALQARAGELGAQPVAELLGRVDALNLRARDRATEA
FT                   LARLCGGSLAGRRVAILGAAFKPDSDDLRDSPALGIADRARAAGARVTITDPMATGGLR
FT                   RLRADLEVVDDTLTAATDADVVALLTPWPHYLRLDPAELGEVVAHKALLDGRNALDPDE
FT                   WKRAGWRYAGMGRR"
FT   CDS_pept        308658..310292
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="PFREUD_02550"
FT                   /product="Arginyl-tRNA synthetase (Arginine--tRNA ligase)
FT                   (ArgRS)"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.19"
FT                   /note="ATP + L-Arginine + tRNA(Arg) <=> AMP + Pyrophosphate
FT                   + L-Arginyl-tRNA(Arg)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55776"
FT                   /db_xref="GOA:D7GI54"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI54"
FT                   /inference="similar to AA sequence:Uniprot:SYR_PROAC"
FT                   /protein_id="CBL55776.1"
FT                   /translation="MSSLPSQLSERVQSVAGIDPEMRPATKPQFGHFQSNVALRLAKQQ
FT                   GKPPRQVAQEIVDKLDVGDLCEPVEIAGPGFLNFRLRADVLAGAVTDQLHDPRAGITPT
FT                   ELPQTVVIDYSAPNAAKQMHVGHLRSTIIGDCFNRVLRAKGHTVIAQNHIGDWGRQFGM
FT                   LIEQALDEKLDLDSLDLAGAEELYKRANAHLKSDDAFADRARERVVKLQNGDADTRAMW
FT                   RKMIDLSKAGFNKTYARMGVLLTDADYAGESMYNEMLPQVCDDLEQRGIAKLDQGALVV
FT                   FVKGFDAPAILRNSQGGYGYDVTDVAAVRYRVDDLEANRLIYVVGSEQTYHFNLIFAVC
FT                   REAGYLPAWVSAQHVGYGMVLGPDGKKFSTREGTAVHLNDLLDEAEEHAAPEIALAAIK
FT                   YADLSNSLQKDYVFDPVRMTQTTGDTGPYLQYAHARVSQILRKADAEGLSGDTISVLDE
FT                   VPEQELALWLTRFGDAVDEVADELTPHKLCTYLYELATKYSTFYENCPVLKSDGDVRTS
FT                   RLALCATTKRVLATGLDLLGIAAPERM"
FT   CDS_pept        complement(310470..311360)
FT                   /transl_table=11
FT                   /gene="fepC3"
FT                   /locus_tag="PFREUD_02560"
FT                   /product="FepC"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55777"
FT                   /db_xref="GOA:D7GI55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI55"
FT                   /protein_id="CBL55777.1"
FT                   /translation="MTIKSTPDSPTTAGSDVPHNAGADGAGTHSAGTHEAGTALVSRLG
FT                   AEHVKLAYGDRVVSDNLTVHIPPGSFTVIIGPNACGKSTLLRGLSRLLKPRGGEVVLDG
FT                   KAISTYRTKEVARIVGLLPQSSTAPEGITVADLVARGRYPHQGLIRQWSHDDEMAVNDA
FT                   MEVTGVSDLRNAPVDQLSGGQRQRVWTAMALAQQTPILLLDEPTTYLDISHQYSLLNLF
FT                   AALNRQGTTIVAVLHDLNQAARYATHLIAMKQGRIVAEGTPREVVTEQTMREVFDVDAL
FT                   VMDDPITGTPMVVPR"
FT   CDS_pept        complement(311357..312322)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02570"
FT                   /product="ABC transporter, permease component"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55778"
FT                   /db_xref="GOA:D7GI56"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI56"
FT                   /protein_id="CBL55778.1"
FT                   /translation="MIVACTIIAVACVAMSLLALSLGDYPLTIPEVVSALFGDQGFATT
FT                   VVTQWRAPRVVAGLVFGAALGLSGALFQTLTDNPLGSPDVIGFSTGSYTGVLIVTTLGA
FT                   TSAASTSVAAVVAGIITALVIYVLAWRGGMQGFRLIVVGIAATAMLTAINTFLLLRMRT
FT                   EVAMSASIWGAGTLSLVSWAKLTFALPAAALLVACTVLLARPLRQLELGNDTALAHGTR
FT                   VESSRLAILVVGVGLVAVVTAAVGPIAFISLSAPQVARRLARSAGIPLLTSAFTGALLL
FT                   VGADVVAQHLTTNPIPVGIVTIVIGGAYLLALLFREARSL"
FT   CDS_pept        complement(312436..313494)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02580"
FT                   /product="ABC-type transporter, permease component"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55779"
FT                   /db_xref="GOA:D7GI57"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI57"
FT                   /protein_id="CBL55779.1"
FT                   /translation="MTPNSSAPARTAELSSPHAPDATRRRLIGLVVGIALLVAACAASL
FT                   AVGSATVPLQTVWQALTGAHDSEAARIITTLRLPRSVLGLLAGAALGVAGALIQAVTRN
FT                   PLADPGILGVNSGSAFAIALGVGLFGASSPGQYLWFAFAGALVATVVVYLIGASGSGSV
FT                   SPARITLAGMALGAVLSGITSAMRLADDRRFSVIQAWQAGSFADRGWDVIVPTLPFLAA
FT                   GLVIAALLGRSLDAIALSDDLARALGTNVNRARLLALAAITLLAGGATAMVGPIVFVGL
FT                   MVPHVARWISGPRQGWIMVLCLVYAPVLVLAADVLGRIVLRPGEVAVSIVTAFIGGPVL
FT                   IYLVRRTKAGKL"
FT   CDS_pept        313742..314737
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02590"
FT                   /product="ABC transporter, binding lipoprotein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55780"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI58"
FT                   /protein_id="CBL55780.1"
FT                   /translation="MTLRRAVIALIAAMSLLLAGCSGSSSSSKSSASASGGAAAGSFPQ
FT                   SVDTAFGKVTIEKAPQRVVALGWGDAETALALGVQPVGASDWLNFGGEGVGPWAKGLYT
FT                   TAPTIIGTMEPNYEQIASLKPDLILDVKSSGDKDRHDRLSQIATTVGIPEGGTNYLTTM
FT                   DQQVTMIATALGQPAKARELLDGVDASYKKVADAHPQWKDKTVTVAARTSQGWGAYVEG
FT                   ETRLAALEKLGFKQNPAIASMTPSSSGFSVSVSSEQLSVFNADLIVAFPIYIDTTQITD
FT                   DAQWKQLSTVQAGHAAVIDGDLSSAFSVGTTLAVNYMLDNMVPKLEKATA"
FT   CDS_pept        complement(314916..315701)
FT                   /transl_table=11
FT                   /gene="ppgK"
FT                   /locus_tag="PFREUD_02600"
FT                   /product="Polyphosphate glucokinase"
FT                   /function="2.1.2 Main glycolytic pathways"
FT                   /EC_number="2.7.1.63"
FT                   /note="(phosphate)n + D-glucose = (phosphate)n-1 +
FT                   D-glucose 6-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55781"
FT                   /db_xref="GOA:D7GI59"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI59"
FT                   /protein_id="CBL55781.1"
FT                   /translation="MLGIDVGGSGIKGAPVDLEAGEMAVPRRKVLTPQPSTPEACAGAM
FT                   ATIIEQFADQIDGPIGVAVPAPVLHGVTPFMANLDQSWVGLDAAAYLSEKLGREVVLVN
FT                   DADAAGVAEMQYGAGRGKQGTVVLTTLGTGVGTALFHDGRLVPNTEFGHIEINGRDAES
FT                   RAASSYMEREHISYKKWAKHLQRYYSTLEKLLWPDLFIVGGGVSREYKRFLPLLNLQTP
FT                   IVPASLRNGAGTIGAALAASLRVGANVPPGAQRIASVPD"
FT   CDS_pept        complement(315813..317210)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02610"
FT                   /product="Sodium:sulfate symporter transmembrane"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55782"
FT                   /db_xref="GOA:D7GI60"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI60"
FT                   /protein_id="CBL55782.1"
FT                   /translation="MRKNWIFLGVATLAFLLVRFAIPTTGALTPSAKGALAVAVFAIIV
FT                   WVTQAVSDALSGFLIILLLVISSATNLAGSFAGFSNTSLWLIVVGFIMAAAMEKSGLSE
FT                   RIALSVVRLAGGSAIKIYWAIAGVMAVLTFLVPSITARTLLMLPIIMGIGQAFGAERGK
FT                   SNIVKALIFIVAMSGTMMSIGVLTAHVGNPATVGLIQAATGHTVSWSEWFKVGGPPAFV
FT                   LSALSVVVISLMWKPETSRVEGAKEYISGELARLGPVKKSEWYTLAVFMATLVLWATEP
FT                   PMLSTIVVGIIAVILLLLPGVGVLNWKEAQEKVPWNVFMVYGAGLSMGTALTTSGAAKW
FT                   LATTMFGPITHLSIPVQMIILLWFITILQVFFTGGGPKTNALTPIILAHAGAIGANQAS
FT                   FGLILGMNMNHQYLLPVSNMPNAVAMGTDFINTRELIRTGAVMSVLGAAFMSVMVLTYW
FT                   SWLGMVG"
FT   CDS_pept        317523..318497
FT                   /transl_table=11
FT                   /gene="galE2"
FT                   /locus_tag="PFREUD_02620"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="5.1.3.2"
FT                   /note="# UDP-glucose <=> UDP-D-galactose dTDP-glucose <=>
FT                   dTDP-galactose"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55783"
FT                   /db_xref="GOA:D7GI61"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI61"
FT                   /protein_id="CBL55783.1"
FT                   /translation="MSWLVTGGAGYIGSHIVQAFQQAGIDPVVIDDLSSGHEDFVPGGV
FT                   PFVRGSVLDTGLVQRTLEEHHCEGVVHVAGFKYAGVSVTRPLHTYDQNATGTVSVLRAM
FT                   RSAGVHRYVFSSSASVYGTPDVDEVTEQTALHPESPYGETKLIGEWLNHDMEPVDDQWQ
FT                   GVNLRYFNVVGSGSDQLYDTSPHNLFPIVFDLLLSGGTPRINGDDYPTPDGTCVRDYVH
FT                   VADLARSHVAAAEQMMAGTKLEKAYNLGSGTGSSVREIMDAIARVTGIAFTPEIAPRRP
FT                   GDPARIVARGDKAARDIDWKMRHSLDQMVESAWNARRAHPQGA"
FT   CDS_pept        complement(318544..319236)
FT                   /transl_table=11
FT                   /gene="tetR3"
FT                   /locus_tag="PFREUD_02630"
FT                   /product="transcriptional regulator TetR"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55784"
FT                   /db_xref="GOA:D7GI62"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI62"
FT                   /protein_id="CBL55784.1"
FT                   /translation="MTLRRYPKGSAKRLEILDAALEVFTTEGYRATSLRGIAERAHITP
FT                   AGIMHYFDSKEQLLSTVLQHRDALDVRRSDLDAQTNPVESLAQIMDSNMKVPGLVTLYL
FT                   TIAAAAVDPHHPAHDYLERRYHLLSGWLTSWITEMSQAGLVPQVVYPAGVATAIVAQAD
FT                   GIQFQWLLDPSVDMGMHVRRGGRRLLGLPFDKPIPQLPNPWTMRRALQLYPVTMVTGER
FT                   VGEAPVGH"
FT   CDS_pept        319561..321960
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02640"
FT                   /product="Beta-glucosidase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="3.2.1.21"
FT                   /note="D-Glucoside + H2O <=> ROH + alpha-D-Glucose"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55785"
FT                   /db_xref="GOA:D7GI63"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI63"
FT                   /protein_id="CBL55785.1"
FT                   /translation="MPGQPARAASVPESEQRRQAHQIVSRLAPDEKAALLSGADAWHTV
FT                   GLGRLDVAAVTLADGPAGLRKVTDPEVGVMRFDNAVRATAFPVPAALGNSFDPDVVAMV
FT                   GRAIGEEAREQSVGVVLGPGINIKRSPLGGRNFEYYSEDPILSGQLGAAWVQGLQSCGV
FT                   GACVKHFAANNQETRRMTADALIDEQTLYEVYLRAFEHVVRTADPWTLMCAYNRVNGTY
FT                   CSESHWLLTELLRDQWGFDGLVVSDWGAVLDRVRSLAAGVDLAMPPDLAHDAADIQSAI
FT                   ARGMLSPQGRDEACARVVELALKVTQDTTRELGRRVGAHHHVAREAAGRSIVLLRNRAV
FT                   DANNHGSANPVLPLAHGAKLAVIGEFAANPRFRGGGSSQVIPMLLDIPLDEIRGRADEP
FT                   VRYEAGFLLSGESDDELADRAVEAAEEAEVAVVFVGLPDDAESEGLDRTSILLPAVQTG
FT                   LVQRIAAANPRTVVVLTNGGVVQLAEWSSEVPALVEASLLGEAGGSAIADMLFGEVNPS
FT                   GRLAETIPLRLQDTAAYFNFPGDRNQVRYAEGLHVGYKWYNASQLEVAYPFGHGLSYTR
FT                   FSYNGLHLAADESGLHARFTLRNTGARVGREIPQLYVALRTSAYRRAGFEFKASAVVQL
FT                   APGEQREVTLSVPPADLGVWDADLHRWLVEGGDYDVAVGASSRDIRLNGIVTVRGEARP
FT                   RTLDRDSTVSEWLSSPLMAQFLAVQLANLATDPGAASDGAGPRDPQEFMSLAHDLRLSQ
FT                   LPVLAPQLHISREQIDQLIAAAGMDARPRPRRIDDSDVEGPDVSPR"
FT   CDS_pept        322362..323750
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02650"
FT                   /product="sugar transporter"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55786"
FT                   /db_xref="GOA:D7GI64"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR042471"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI64"
FT                   /protein_id="CBL55786.1"
FT                   /translation="MTSGTSPSQGSPQVLTTTGFDEVDTPQMRRFQRRVTLLSAGGTFL
FT                   DGFDLTVIAVALPLIKDEWHITALQQSIIVSAALVGSLIGALWLGHLTDRHGRKAMYVV
FT                   DLLGFVIFGALTAFSPSVLWLIIFRFLLGLGIGADYPISATLVSEFSSNKRRGMHSTSL
FT                   AAFWFVGSVFAYVVGLIVAPMGDLAWRAMLLVGAAVALVVFFMRIKLPESPRWLIAHGC
FT                   EQDAREVMHRVTGLQVAEHIKLVVPEAVPARKLFTPRFLKRTIFTCGFWFCYSTAYYAI
FT                   SMYTPTILAPFTKGDRTANIIGSGVVAIIGLIGSIIGMNTVDRWGRRPLIITSFAGLTI
FT                   SLAIIGVNTSPSLGFLIVLFSSAVLFANAGGGILNFVYPVELFPTNIRATASGLATSVS
FT                   RFGSILGVLVFPNVVKAWGQNSAIWIFAAVGAVGTIICIALAPETKNRTLEELNPEQGE
FT                   PSHV"
FT   CDS_pept        323743..325419
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02660"
FT                   /product="Metallophosphoesterase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55787"
FT                   /db_xref="GOA:D7GI65"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI65"
FT                   /protein_id="CBL55787.1"
FT                   /translation="MSDNAQPDDSRRVHTGDGAISDTTRHRIVRAEPYQGRYVELTDAP
FT                   GEPHVERNELAPGAGDGDASGWTPSDEPLLSLAQLTDFQLADLISPARTDYLQRRSDDP
FT                   RWTRMTPSYRPEEFLELHAIEGVAASIREFAEQHHLDVTVTTGDNTDSAQHNELATYMR
FT                   LVTGGPVDPTALGVGHPSSPTGLADDPAYWHPSGTAPDEFTDRGVPRRPGADAAAAKPF
FT                   TATGVGTPWLTVYGNHDALVQGRAVGSSLYSEYVQGNRKPVEPPAGYEPRDEALVDFVA
FT                   DPMVLTGGPSIPVPADPDRRVLDREGYVKGHLAADGLPVGHGFSELNAETHTAYYVWDA
FT                   VPGMRIITLDTNNAAGFWDGALNDGQFTWLAERLAEVSADSDDPRLVIIAAHHGLSTLT
FT                   NGYRDAEHHEELHLADDVEALLHRHPQVIAWISGHTHVNLVTPRPADGQQSSPGGGFVE
FT                   FSTAAVSEWPVQWRHLEVRIAPRGAVIRSTIHDSAAPLHAESWQTPLELASLHRAVAAN
FT                   DPDAVGGLEAQGSARDRNVIVHVPLPPELVSAVLRASLTRD"
FT   CDS_pept        325426..326154
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02670"
FT                   /product="MgtC, Mg2+ transporter protein"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55788"
FT                   /db_xref="GOA:D7GI66"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI66"
FT                   /protein_id="CBL55788.1"
FT                   /translation="MPFLSSELALRELILLSIAFVLCSVVGLERSIHQKNAGYRTHVLV
FT                   GMGACGLTLVSWYGFGAGIAGHGAGIDPTRIAAQIVSGIGFLGGGVIFKGRNFVRGLTT
FT                   AATIWITAAIGMSVGSGLVVLGAMLTVAHLLTIFIVGPLIRKIPPADRRREMTIVYEDG
FT                   QGVLRKILGAATDQGFAAEVRSTRRLPRKDRDLISMELRFFGNQPLRELVVPMSEIPGV
FT                   DRVLLHGVAEDEDDDDETSA"
FT   CDS_pept        complement(326224..327531)
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24480"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55789"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF54"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55789.1"
FT                   /translation="MSHPTFTTPCLTTFCGLDELGLEAVGQRLDPDRAVIECRVVEPDR
FT                   WCRECGCEGAPRDTVIRRLAHEPFGHRPTTLLIRVRRYKCCGCGRVWRQDTTAAAPVRA
FT                   KISRGGLAWGLAGLVLDHLSVTRVAAGLGVSWSAANDAILAEGRRRLIDDPARFEGVTT
FT                   IGVDEHVWRHTRHGDTYVTVIIDLTPVREKTGPARLLDMVAGRSKAVFKTWLAARPKPW
FT                   REGIEVVAMDGFTGFKTAAAEELPDAAPVMDPFHVIRLAGDALENCRRRVQHDVFGRRG
FT                   MKGDPLYQARRTLLTGAGLLTDKQQARLDALFAEDRHVEVEATWGIYQDMITAYRDKDR
FT                   GLGRFFLAHTIDKISASVPEQLVEIRKLARTLTQRASDVLGYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLSHYIARSLLEAGGFRPALHPRS"
FT   CDS_pept        complement(327498..327572)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02680"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55790"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF53"
FT                   /protein_id="CBL55790.1"
FT                   /translation="MEVLTLAICRKTSTCHTLLSLHLA"
FT   CDS_pept        complement(327613..327705)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02690"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55791"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI69"
FT                   /protein_id="CBL55791.1"
FT                   /translation="MLSLLRFSDSEIRLSAEPYIWLFTNEGVAG"
FT   CDS_pept        327879..329297
FT                   /transl_table=11
FT                   /gene="glpT"
FT                   /locus_tag="PFREUD_02700"
FT                   /product="glycerol-3-phosphate transporter"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55792"
FT                   /db_xref="GOA:D7GI70"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR005267"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR021159"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI70"
FT                   /protein_id="CBL55792.1"
FT                   /translation="MSTTDTARPARKRSWLSSPLPAPRLPDAEVKQRYPRMRFQVFMGI
FT                   FVGYAGFYLIRNNISLVAPILLKDGHIDKVGIGLIANAVLIAYGLSKFFMATVSDRSNA
FT                   RYFMPIGLALSAVANLLVAFVPALTGSIAIFAIMMFINGWFQGMGWPPSGRVLVHWFST
FT                   NERGWKTAIWNCAHNVGGMAVGAAASWGLAITGDSWQSAFWLPALIALVVALFAFLTIR
FT                   DTPASVGLPPIEDFRNDPAKVEVDNSEIAQQSYWRVIWEHVLKNRTMVLLALANVFVYA
FT                   LRYGVLSWTPTYLSQVHHVSVTKGIAGFSLFELAGLVGTLACGWVSDKVFHGNRTKTGI
FT                   TFMVGVGISLVAYWLAPVGTPYWLLMVFLFFIGAFIYGPVMLIGLQALDMSARQVAGTS
FT                   AGFTGLFGYVIGATLASTGVGWMVQHFGWGVTFGALTVCVVIAIILLACIGPEEKRLIA
FT                   SHDAAVEESFQEED"
FT   CDS_pept        complement(329587..329790)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02710"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55793"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI71"
FT                   /protein_id="CBL55793.1"
FT                   /translation="MRDSKNLPQDAVDMARAFIADYARRNDGDVTAGADFLKGPLDTMP
FT                   EIVDEALRQMQEFPQARRARVA"
FT   CDS_pept        complement(329883..330326)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02720"
FT                   /product="NUDIX hydrolase"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55794"
FT                   /db_xref="GOA:D7GI72"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI72"
FT                   /inference="similar to AA sequence:Uniprot:Q1FEK6_9CLOT"
FT                   /protein_id="CBL55794.1"
FT                   /translation="MGSVLYPKLQVLDVVAAVIVDGDHYLACRRDAGLDAGGKWEFPGG
FT                   KVKPGETAQQALRREIREELGVDVEVHDMLTSSQTTKSDRIIDIRFYLATAAERPTHSD
FT                   AHDKLTWLTADELPALDWATPDLAAVGQLNSKYALELSAPMLN"
FT   CDS_pept        complement(330410..330844)
FT                   /transl_table=11
FT                   /gene="naeIV, vsr"
FT                   /locus_tag="PFREUD_02730"
FT                   /product="NaeI very short patch repair endonuclease
FT                   (V.NaeI)"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55795"
FT                   /db_xref="GOA:D7GI73"
FT                   /db_xref="InterPro:IPR004603"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI73"
FT                   /protein_id="CBL55795.1"
FT                   /translation="MRSLSRKSPPASSAATRAKMQGNRRRDTKPELELRHLLHALGYRY
FT                   RVDFPIRLDGVRPRPDIVFTKNRVAVFVDGCFWHGCPKHFHMPKVHTDFWQAKIARNRA
FT                   RDERDTLALEAANWTVIRIWEHEPTSQALADVLEELPPRH"
FT   CDS_pept        complement(330828..336464)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02740"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55796"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI74"
FT                   /protein_id="CBL55796.1"
FT                   /translation="MYFPPDVPRPLLLALVSWANAVKTNPDGTPYSILVTKDSTLATTR
FT                   AASAAYDACEAASSVEAVSVAEAIRYRQGDRLVVVSAESADLESFSGTFRTVIPASFPA
FT                   NEDSALDNVCKGSAKILAEIAGSSDPEAVQSVARTLYDALGVVSDILSGAGDPRGSWSS
FT                   RWYEIAMQGLDTLARALQQSPRTDAGRESFREFVQARAFASFGLPRPRGDESTYKRGTT
FT                   GATLRAAIDEHWGSSGDAATAYEAIAASQSLNPIDWSTLDKGNLELGSPLQALQRSLTH
FT                   SHDMAALEAFSQVDEISFSTPFPPESKLEILSDLGVSLALGPSPTSASNFCTSEYVGKS
FT                   RLGTERLRVRLSIPGSTRAALTGGTARISVGASEFNYEQFAEDGVVEFYGYLTYATHRE
FT                   FERSRRFTIKVEFTDASAQPVTTRASAEVVVLPPTETVGISYFRLSSSGAMQKRIYSLG
FT                   PDSQDDSSDEFEDTYDSRSGLFVVFSTQSHPMAGKLTLLQSSAHPNTYSTIVPAGTSAE
FT                   IHTGIYTFRLSPDSGSTPQFSPLRAAATKSFVSNEALPDEVLTDVRATFEEYFSIPRAK
FT                   GSMGSSLGHVFCEPDGPTDQPAADTDIHESGRVLIFGGSSTSFGPIVGYRDDPTQAFDR
FT                   GVVSAFEDAFASIVDVLEGPESGEPWISRTSVASLWEANRPLLDRYLLAYVELVKEGES
FT                   LSKKRNHLPQLVATFPFSLSVWNRGHCLGVLISPWHPLRLAWLASAESTLRQASDVAGL
FT                   LGTLEGWRFPYMAGGEDRLKDLIAVPLDSGFEEIFAGWGLMVPLPAASGGESLQVPSTA
FT                   AGTPLPGASASGLTASAVSSALNDFLRVYSYVPELTIDLSSSTPMERLTEVDDCIVQLL
FT                   KQGLGTAHWLSGVKVLDSTNRLGAVPRRALQELGAAQRGTRLTWTRYDPDSTGLPAAMV
FT                   RVQEDPLMTISSEGMPGREDSGVIGETPLKRFGVEIPLVEEDSAYLHPLLPLDAECRDP
FT                   FLIALGQIESTVSQRGVRIAPRFRSEEEAARTAEWTVSGESLVSPAAIQEVLRNSGSLA
FT                   GQVSGSQAGQMLWEWRPPLFGGLTDQTELERRGYLTLSRIPDTLTQRIEDKLPPSLPDS
FT                   RRAATIQDLFATLGSRGVGLASLLAVGDKQASGAIGFYLALKLCEEAATPDRVRLVLPI
FT                   DSCQRFLDVLSGDQPRQSRHRADLLMIDIAKTGVSFIPIEVKMYHLGNPQPTFPGPASE
FT                   PVRMASEQASETRAQIQRMLKRRSRLENPADQLLWDNALASLLDAGLKLVPSTSSTPSW
FT                   LPRQFRLVVSGGARLTATAGIAMIFYELRDRKAPAIATSAARPDNDPVEVLMATSTAVL
FT                   DADQVPSPSAAKLFRAMVDRQASHPVDQDLGYTPNTNPAPPSPLPAQVDPGSSEPISPV
FT                   PGLAGVSSVRPSKPDLVPERDVAPVPARGLPAALRDSVPELPAPARELPASHDGPGNPT
FT                   TAPPKRPEPVDRPIPNGLRQQPLVGEPAIGDGVRFPVGAFESAVSVDDRPELWLGNTDL
FT                   NQLNIGVVGDLGTGKTQLLKYLIAMIRRESGIVQGDPVDMLVFDYKRDFVDQEFIDAVG
FT                   ATVLRPRNIPINLFSVPPHADQLTKEEKIRSFGDVLSKIYGGIGPKQGLALHDAIRSIY
FT                   DYGQTPTLEAIFDKYNEENSPDSVTAILDTFVRMEIFDDGSESAIPFSELIHGRVLVLN
FT                   LADLSVDESTKTALVTLFLNLYYDYMIKLRKWPFTKGTPSIRHISSYVVVDEAVNIMER
FT                   DFPVLRKLIREGREFGAGVILASQYLAHFKSKETNWLELLRSWFIHRVPSLPKRHLDEL
FT                   GLSRDLSDEEIARITRLPKFHSLFKSLDPRPRFIIDKPFYELLGETPRHRDENPLDGSD
FT                   EKPQ"
FT   CDS_pept        complement(336538..337989)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02750"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55797"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI75"
FT                   /protein_id="CBL55797.1"
FT                   /translation="MQDEPTLSRVLLGLGSPEYMSSPEGLMSALAWRGDSLRAEKSAVG
FT                   LIYEGKTTRSPRRTVIETRPAREADSQHLARALRDSGLSIDLDSLRDDWILPEAIFNSV
FT                   RGARAKASKARTVAPMTPGLARLQNPVGMVNKNNPAPYGRIIEMMFLYGSPSQEETPRP
FT                   LARDRWLQSTADQLRGNSLLAAIDSLSIAVLNDRLRDTGIEVVKSSGEQPLTEPPAQVQ
FT                   SAETPYKWFNHAWTLLTREDWRKALSPRVWTDWLLTVLRMAFSMGFLWEMRYYGSIGHW
FT                   ILGGSNDRLEQFLDGTIPLIPWVDSSTPNSQRNVHPIIRDVVRQGIAVREFLRDQQGNH
FT                   GDELLTDAVSIIRSNAQSMSELESLFVDIRQNDARGAKTMYESIFYSLRERESSDGGQD
FT                   YYALIRKMSNRTAVISPGVEWIALMASIACGNPGGEANLRELNAQLNQVGLHPPVHDLI
FT                   HLLEIAGLANGSADADEGVRIQSAY"
FT   CDS_pept        complement(337979..340090)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02760"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55798"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI76"
FT                   /protein_id="CBL55798.1"
FT                   /translation="MMATGNSDSPPLGPEAEASRDGSPSETFFKVLKAHAHGGTDAAVR
FT                   ASDSTSQRSVQALPAAGVKELIDWMRNHLEGGPKSRTPLMAYLVGGPGGGKSAAAAQVV
FT                   QGLAPLGPESPLAERSYRYASPAGNLTVINDATIPKQANKGSLAHDIDEAASAGENLLA
FT                   CVNRGVIVDDLGRAQRDASSGEEQTAGVTVLRWLAQPFGQDPRSDPSDRWCIRSDSGEP
FT                   WSFLRSGSLKRSGEHVAQLLVVFLDECSLLEVRPETTLSESGPIAGEYSVARFDALEPT
FT                   SNSSGYDLLSKILELASQHQDPLGAGSNPVTANIASLTHERIRRNFLHILRAAEIIGER
FT                   RFSYRDLWAVYSRALLGSLVSHDSIDSASTSMEVDMEVAGNNAYHPTKRWAAAQRLGQL
FT                   RFFMSVFAPTSGTEGPTSVFDQLASMVRTADPASDAPLGHLDKDAPSRSGWATPVYDAF
FT                   SVIGKESSPLNLLRPDLDPDLKNVVGPLETIIDRAYQSLQTSSNADLEDDRRRASQWYG
FT                   RYLLRLYAVSKGIPALYNEVTTWSRAWRTSKNDGTLNETLTGGLTSLLNPRRSESQRDT
FT                   SYVPTFASRAEPVTSTTTHPILVTQLGDMQFRTRVEGERIWVHVADQSSDAGKIALDLD
FT                   LIRLILTVSGQHSGITEMSSTISPRLERIRSARLRSVNSGPNPPQSIRVMSGKSTYPVA
FT                   VVKGPTNAG"
FT   CDS_pept        complement(340087..341745)
FT                   /transl_table=11
FT                   /gene="dcm"
FT                   /locus_tag="PFREUD_02770"
FT                   /product="DNA (cytosine-5-)-methyltransferase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.1.1.37"
FT                   /note="S-Adenosyl-L-methionine + DNA <=>
FT                   S-Adenosyl-L-homocysteine + DNA 5-methylcytosine and
FT                   S-Adenosyl-L-methionine + DNA cytosine <=>
FT                   S-Adenosyl-L-homocysteine + DNA 5-methylcytosine"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55799"
FT                   /db_xref="GOA:D7GI77"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI77"
FT                   /inference="similar to AA sequence:Uniprot:Q4FUP0_PSYAR"
FT                   /protein_id="CBL55799.1"
FT                   /translation="MPRFVELFAGCGGLSLGLRAAGWEEAMANELSPMAAQSFAFNLLG
FT                   VDLDRTSFWSQPIADRKVLWINSQLPPQQGDRLQENPYGTERPRYNDLSQVGNIPMDSS
FT                   RLIVGDIRALNDWMRDHPSQRPKDVDLISGGPPCQSFSMAGRRELGNRRNRLPWEFATF
FT                   VDLMRPKFVLLENVAGIIHPFTDGGTKYHAWFEVAKAFASIGYAPICFLLNAADAGVAQ
FT                   TRHRFILIGVRQDILQGSPALEGLLKDWVQPGLRLCQQLDHPGAGATSVESTSLEKSEM
FT                   RYWDLTAGTQLLAEAGTLVKLLAPGATPRLRTVREAIDDLSGPDRIPSDYVNGLNETLG
FT                   SLLRLPRPPGPAIENQTRRNHTPRVLARFAVYQAFANANRSLQANVKKMLRGKDLQVQE
FT                   TKELGRYLISRADGLPPFNGTRPPRDCEEAINYLKALESRKISQRVLDPNVPAPSALSI
FT                   PDDYCHYSEPRTLTVREMARIQSFPDNFVFRSWETTGGKRRSFQVPQYTQVGNAVPPLL
FT                   GKALGETMSALLAWSQPRSVQPISLPTLQKQGATP"
FT   CDS_pept        complement(341894..342898)
FT                   /transl_table=11
FT                   /gene="pfkB"
FT                   /locus_tag="PFREUD_02780"
FT                   /product="Carbohydrate kinase, PfkB"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55800"
FT                   /db_xref="GOA:D7GI78"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI78"
FT                   /protein_id="CBL55800.1"
FT                   /translation="MSEPVDRSRGRFLHLGQMIVDLTVYVDRIPERGGDVFADKATMNA
FT                   GGGYNVLWAVKQMGLSPDFFGAVGTGPMGDILRGAMRRIGVAAQGPTIAGLDTGYCVAM
FT                   TEPDGERSFISVSGADAQMGPDEFAGLALRDDDLVYLCGYSFMSPGTRTAVERFAAART
FT                   EWTQAGGRVLFDAGPMVAEFPGSSLQAMIDLHPMWSMNDLEGCLLAERLGVAARGEQER
FT                   CRLLSQRLGAPVILRVGSDGAWFADGDAARKVPTPRVGAVDTNGAGDAHAGVLGAALLE
FT                   GIPRDRALVLANCAGALSTTRPGPATCPDRLAIEDAADKLVGSADSLVGSTDS"
FT   CDS_pept        complement(342895..344415)
FT                   /transl_table=11
FT                   /gene="codB"
FT                   /locus_tag="PFREUD_02790"
FT                   /product="Permease for cytosine/purines, uracil, thiamine,
FT                   allantoin"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55801"
FT                   /db_xref="GOA:D7GI79"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI79"
FT                   /protein_id="CBL55801.1"
FT                   /translation="MTTAATSTTPAPDERLLEAPIEHGVLSHVEQRGIEPVPADKRNGT
FT                   PGQLFWIWFAANISILGIPLGATLIALGLNLWQAVLATAIGAFGSFAVVGVISVAGRRG
FT                   GAPSLTLSRAIFGVRGNAGPTLVSLVSRLGWETVTTLTGAFALISLYSIATGTTADAKA
FT                   HPVLTVVCIVIFVALTVVVSATGHAFLLTVQKWATWVFGALTALVALYLATTVDWSAFI
FT                   GNAPGPASAFVVGIGTIVAGTGVGWANSGADMARYQKLSVKTRSLVASASVGAGIPLVV
FT                   VIGLGSALTAGNSSIATASDPIAAVHQSLPTWVSVPYLIAAFAGLLMSNHISMYSAGLT
FT                   TITLGVRIRRVYAVVVDIVVTITGSIYFMLISDSFYGPFISFISVLAVPITAWIGCFLV
FT                   DMAGRRSYDAHGLLDLRPGARYWYWHGISLAGTGSWLIGLVVGLLFMSAKISDTEVWFA
FT                   GPLSHTWIGTNGLAWLVSLVVAAGLYALFGGLRRKDDAAAALAAGAAA"
FT   CDS_pept        complement(344593..345444)
FT                   /transl_table=11
FT                   /gene="impA"
FT                   /locus_tag="PFREUD_02800"
FT                   /product="Inositol-1-monophosphatase (IMPase)
FT                   (Inositol-1-phosphatase) (I-1-Pase)"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55802"
FT                   /db_xref="GOA:D7GI80"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI80"
FT                   /protein_id="CBL55802.1"
FT                   /translation="MSEQLDTQVLLAIAEQVVRRASAMALAGQQRDLQVQTKANRNDLV
FT                   TRVDKDIEEFVAAELTSRTGYPVLGEEGHGVDSFAGRVWVVDPIDGTMNYVETRRDYAV
FT                   SLALVSDGQPLIGVVADVVAGRLYSAVRGHGATCHPDEHDWTRSDVGGPATEPGRSTEE
FT                   LAQVPSDKGFRDSIIITDLKEIRAMPRLVAALVESRGHRRYGSAALECIEVASGRAGAF
FT                   VHLWVSPWDIAAAMVICAEAGVTVTRLDGTPLDVRHKGSILAGAPRAHAELLARLVSDP
FT                   TH"
FT   CDS_pept        complement(345437..346885)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02810"
FT                   /product="Major facilitator superfamily MFS_1"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55803"
FT                   /db_xref="GOA:D7GI81"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI81"
FT                   /protein_id="CBL55803.1"
FT                   /translation="MGSLKTAFNIVPAPKSDIPITTQRKRWLREFMKTYAVLIIGYGGF
FT                   YLLRTNFKSAQPFLRDQLGLTTTQLGTIGFGFSLTYGFGGLILGFFADGHNTKKIISAL
FT                   LIASGVVAITIGITLAVTHNPYGYLILLWSLTGLLQSPGGPCCNSTMNRWTPRKYRGRF
FT                   IGWWNASHNLGAMAAGALALWGANTFFHGSVVGFFVVPALVAIPIGIWGLFFGKDDPIE
FT                   LGWDKPEVIFGEPQAKADVVTQQVSKGRILMDYVVKNPAIWFLCIANVAAYVVRIGIDN
FT                   WNVLYTKSELGFSDYTAVNTTIALEIGGLLGSLCWGFFSDRLGGRRALTAAIGLALVVV
FT                   PIFVYAHATTPTVVYAALFFIGFLIFGPVTLIGISVIGFAPKTATVVVNAVPRAFGYVF
FT                   GDSIAKVLLGRIADPKKQGLEIFGHSLHGWGSTFTVLFVSAGVGLVCLVAVALFEERMI
FT                   RADREFSKEHPAADAGISEGADDE"
FT   CDS_pept        complement(347265..348419)
FT                   /transl_table=11
FT                   /gene="mmgA"
FT                   /locus_tag="PFREUD_02820"
FT                   /product="acetyl-CoA C-acetyltransferase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="2.3.1.9"
FT                   /note="2 Acetyl-CoA <=> CoA + Acetoacetyl-CoA and
FT                   Acetyl-CoA + Butanoyl-CoA <=> CoA + 3-Oxohexanoyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55804"
FT                   /db_xref="GOA:D7GI82"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI82"
FT                   /inference="similar to AA sequence:Uniprot:Q0S5Z8_RHOSR"
FT                   /protein_id="CBL55804.1"
FT                   /translation="MNTLADNPVIIEALRTPIGTTGGVFADQTTTDLAAPVLGELDARL
FT                   PTGTGFGEVVLGNVRGPGGDPARVAALAAGIDPAVPALTLDRQCGSGMAAIEYAWHRCR
FT                   SQPGVVAAGGVQAASTQPITLWPGRDGEPPSSFDRAPFAPPPWLDPDMGVMADRLAAEL
FT                   HISRERQDRYALRSHTRASTARDAGDFDAEIVPIARVRRDQRPRSGFTMARLARFPAAF
FT                   RPGGTVTAANSCGINDAAAAVTMVDAATHAHLATPGLRVLAARTVGYDPDRFGLGLVPA
FT                   VRAALDDAGLGLDQIDALEFNEAFAAQVLACADALDLDEHRLCPRGGAISLGHPWGASG
FT                   AILLVRLFSRLVREGAGRYGLAAISIGGGQGSAVVVEAVHPRGN"
FT   CDS_pept        complement(348416..349474)
FT                   /transl_table=11
FT                   /gene="menE1"
FT                   /locus_tag="PFREUD_02830"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="6.2.1.26"
FT                   /note="ATP + 2-Succinylbenzoate + CoA <=> AMP +
FT                   Pyrophosphate + 2-Succinylbenzoyl-CoA"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55805"
FT                   /db_xref="GOA:D7GI83"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI83"
FT                   /protein_id="CBL55805.1"
FT                   /translation="MNTSVIDTGPVCVLGEGPGVVHQFWQAHRRGRLIGLRTSGTTTGA
FT                   GRVIVRSTDSWVDSLDAVAQRCALTPHDRIWIPGPMGSTMNLFAACLAVHNGVEWSFDK
FT                   PECATIWQLTPARLSSLLDAGLPRSQRLREVIVAGDSLSRGLRDRATTRGINVVHYYGA
FT                   AEMSMIAMGSCRDDLELFDKVEVRTTDGTIWVRSPWLAQGYLRAAADAPRRSGALTPLR
FT                   RGDDGFVTVGDRGALDGRRLIVEGRDGAVTTAGQTVLLAPLLERLRHRAQGELFLLGLP
FT                   HAALGQVLTAVVTRRDDLGPVRAWAREHLTGADRPRRWQWVAHPPLTLSGKVDLRALAL
FT                   ELGGPTDRPDSP"
FT   CDS_pept        349644..349862
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02840"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55806"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI84"
FT                   /protein_id="CBL55806.1"
FT                   /translation="MNDAQSAFDKAAGKAKEVGGKVTGNDEMAAEGTTQNAKGKVEGAL
FT                   NEAKDKVADTVNGVKEGLKGVFNKDES"
FT   CDS_pept        349917..350732
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02850"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55807"
FT                   /db_xref="GOA:D7GI85"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI85"
FT                   /inference="similar to AA sequence:Uniprot:Q47PY7_THEFY"
FT                   /protein_id="CBL55807.1"
FT                   /translation="MPGGGGPGPSGAVPGSASGTAPGAARVRWIPIVVFYVLACALAWL
FT                   VISPLWISGKGLQNPLLGVLSPLMMYTPAAAALFVLMVVQRVRGRAVLASLGMWPIRPL
FT                   KRTLLLSLAALVGTALLPIVVTFIAAGLGLVRLDLVNFSGFAQVLQSQMPAGQTYPLSV
FT                   RTTVIVQLVMLLPASATNAMFTVGEEIGWRGFLMSSLRPLGTWPALGISGAMWGLWHAP
FT                   LILLGYDFGRRDALGVLLMIVSCGSLARCSDGYASAAATSGRRYSVMPH"
FT   CDS_pept        350666..350941
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02860"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55808"
FT                   /db_xref="GOA:D7GI86"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI86"
FT                   /protein_id="CBL55808.1"
FT                   /translation="MFGWLRIRSGNIWPSVFGHAALNGTAGFLGLVVAAGESPSVLATS
FT                   PLGWIGWTLVALVVVVLALAGQFRGKDQWAVNVAKAPAVGPSPFQP"
FT   CDS_pept        351099..351626
FT                   /transl_table=11
FT                   /gene="dps"
FT                   /locus_tag="PFREUD_02870"
FT                   /product="Starvation-inducible DNA-binding protein"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /note="Expression of DPS is induced by oxidative or
FT                   nutritional stress, including metal ion starvation."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55809"
FT                   /db_xref="GOA:D7GI87"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI87"
FT                   /protein_id="CBL55809.1"
FT                   /translation="MTNTISAIHQAEVSTTNLQNAESGFVASDILRDSLQSVLVDLIAL
FT                   SFSGKQVHWNIVGPNFRDLHRNFDDVVEIAREGSDTIAERMRALHVAPDGRTDVVSATT
FT                   TLPELPAGEILSSDAVDLVVKSIEATTRTIREVHDAVDSADPSTADLLHELINKLEQQA
FT                   WFIAAEKRQPQD"
FT   CDS_pept        351918..351992
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02880"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55810"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF53"
FT                   /protein_id="CBL55810.1"
FT                   /translation="MEVLTLAICRKTSTCHTLLSLHLA"
FT   CDS_pept        351959..353077
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24490"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55811"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI89"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55811.1"
FT                   /translation="MSHPTFTTPCLTTFCGLDELGLEAVGQRLDPDRAVIECRVVEPDR
FT                   WCRECGCEGAPRDTVIRRLAHEPFGHRPTTLLIRVRRYKCCGCGRVWRQDTTAAAPVRA
FT                   KISRGGLAWGLAGLVLDHLSVTRVAAGLGVSWSAANDAILAEGRRRLIDDPARFEGVTT
FT                   IGVDEHVWRHTRHGDTYVTVIIDLTPVREKTGPARLLDMVAGRSKAVFKTWLAARPKPW
FT                   REGIEVVAMDGFTGFKTAAAEELPDAAPVMDPFHVIRLAGDALENCRRRVQHDVFGRRG
FT                   MKGDPLYQARRTLLTGAGLLTDKQQARLDALFAEDRHVEVEATWGIYQDMITAYRDKDR
FT                   GLGRFFLAHTIDKISASVPEQLVEIRKLAHRE"
FT   CDS_pept        complement(353065..354138)
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24500"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55812"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI90"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55812.1"
FT                   /translation="MRRYRCTHCRRTWRQDTSKAAAPREKISRGGIGWALTAIVVDHLT
FT                   VSRAAAGLGVSWHTANTAIIAEGKRRLIDDPARFDGVTTIGVDEHVWRHTRFGEKYVTV
FT                   IIDLTPARNKTGPARLLDMVEGRSKQVFKEWLAARPAEWSSRIEVVAMDGFSGFKTAAA
FT                   EELPDAVPVMDPFHVVRLAGDALDRTRQRVQQDTLGHRGHAGDPLYGVRRTLHTGASFL
FT                   TKKQTARLDAVFAAEEHVEVEATWGIYQRIVAAYREPDKNKAKEMMRAVIDSVSNGVPA
FT                   LLKEIRRLGRTLKQRAADILAFFDRPGTSNGPTEAINGRLEHLRGSALGFRNLTHYVAR
FT                   SLLEAGGFRPLLHSHSR"
FT   CDS_pept        353074..353085
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02890"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55813"
FT                   /protein_id="CBL55813.1"
FT                   /translation="MRV"
FT   CDS_pept        354264..354548
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24510"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55814"
FT                   /db_xref="GOA:D7GF23"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF23"
FT                   /inference="similar to AA sequence:Uniprot:Q1BDS3_MYCSS"
FT                   /protein_id="CBL55814.1"
FT                   /translation="MSNSRKRHTPEQVVRKLGQADRMLADGSDIAAVCRELGISEQTYY
FT                   RWRNQYGGLKADDAKRLRELEKQNATLKRLLAEAELEKAALKELAEGNF"
FT   CDS_pept        354611..355414
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24520"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55815"
FT                   /db_xref="GOA:D7GF22"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF22"
FT                   /inference="similar to AA sequence:Uniprot:Q26XT5_MYCFV"
FT                   /protein_id="CBL55815.1"
FT                   /translation="MACRLAGLSRSAYRRPLKGDTVADPDRALRDWLRAWAKKHPRYGY
FT                   RRAYHDARGEGWAVNHKKIQRLWRAEGLRVPQRRRRKRVGSSTVDAPAAVAPNLVWAVD
FT                   FQFDADERGCPIKICSIVDEHTRECIGGLVERSITADRLTAHLEELVAVRGAPGVLRSD
FT                   NGPEFISDAMADWAGTRTGLFYIPPGSPWHNGYVESFNSRLRDECLNINSFYSLLHAQV
FT                   VIGDWKTEYNHQRRHSSLGYLPPAEYARQCTHQIETDDSQSDRTE"
FT   CDS_pept        355411..355800
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02900"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55816"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI94"
FT                   /protein_id="CBL55816.1"
FT                   /translation="MKGAAHMRQRPRHRVTRHALRAALPTPRVVLDDAALQHRPISLEQ
FT                   LPDGLKAELVETAERGQVRGHERRVVQVEVFRRMVSVRTSILEDLDAYPRTSRRSRATP
FT                   STAKSPVSSRFVKPESREHADSCPL"
FT   CDS_pept        complement(355871..356287)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02910"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55817"
FT                   /db_xref="GOA:D7GI95"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI95"
FT                   /protein_id="CBL55817.1"
FT                   /translation="MNDQAVSSQPTVFRRVMFGVAILLCDLLSAALSYWPLVMIGLVLM
FT                   QVKANVIGPAEHIVGAGEDSLAFMVFYVVSAIVVLMLAVLPAVIGNLALRRRAGWPPRV
FT                   CVAVAAAVILAPAVAAVVAPLTMNEIWYRATHWW"
FT   CDS_pept        complement(356341..358491)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02920"
FT                   /product="peptidoglycan binding domain protein"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55818"
FT                   /db_xref="InterPro:IPR015020"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI96"
FT                   /protein_id="CBL55818.1"
FT                   /translation="MYALTRALQHEVGLTALSDNFGTGTLSALTAIGNIGPSTSNANIA
FT                   NIANIYNIVVGGLYCKGYNGDNGNLDGTWTTTTTAAVTSLQSDIGVPTTGTVSPKVFKA
FT                   LLTMDAYILIGTGTGPVREVQRWMNATYIDKSWFYIIPADGSYSRDVQEALVYAIQDEL
FT                   GVAGANGNYGPGTRAAVAAQPNITVGSSDAAGHYWVRLFQAALRFNTYDASFTGTFTSA
FT                   DSSIVLSFQAFCLLTVNGQGDYETWSSLLVSNGDPTRNGRAADCASEVTAARASALVAD
FT                   GRVVVGRYLTNVEGSTLNKKIQTGELSVILGAGLRVFPIFQTLGDSLSYFSDAQGYSDA
FT                   GDAVQAATGYGFKRGTTIYFAVDVDVLGDDIPGSIIPYFQGVNRAMQRFGNLYHVGAYG
FT                   TRNVCRQLTDADLIQYSFVAGMSYGYSGNLGFTLPSNWAFDQISTITVGSGTGAIEIDN
FT                   DIYSGRDTGQASVNALPSGEVLDVAFDMSQEASLASDMDAYCDTVTSNTIGLIHGSPTD
FT                   VVGDVLQHDTLITNLSRAWGIRKALIQAVSFWEYWKTTALDPAADAVVESTYVYLEALE
FT                   AWEANPIGVAPTPPVVMSQDSSTGFAQIFSATAIWAHNWALGQGLISGSTWDASDWHTV
FT                   WAVWQDLHGDDDYNLSAVPQVLMAGAADVGITGSPRLDYTSAQITSILARYNGTGSAAA
FT                   DYGQEVRGVYNVFEQYNAALRG"
FT   CDS_pept        359295..360410
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24530"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55819"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI97"
FT                   /protein_id="CBL55819.1"
FT                   /translation="MVQAHLAVQATLLPPGLVGGRDAVGSTPAKHFTTRAITWAVNQLL
FT                   TRDVVISALARDLQVGWRTLWKAIEGPLQERLKEISDQASVEALGLDEHVWRHCGPHKN
FT                   RMITGVVDHTRPKRGKDGKTKPFARLLDVQVGRSGAVAEDWLASQGKEFASKIRIAAID
FT                   PYRGYANAISATLKEADMVVDIFHVTKLASQALDEVRRRVQQDTLGRRGHAKDPLYRAR
FT                   RLLLTGANHLTEKMATKLDALLQEGDPNWEVTITWTVYQKLIDAYQQSDSHDMVTLIDA
FT                   LKDCPIPEVARLGRTLKSWKREILAYWHTDRSNAGPTEAINNVIETTRRIARGFRNFDN
FT                   YRLRILASASGQRPYRQPPKPVRKGQPNHAE"
FT   CDS_pept        360502..361074
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02930"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55820"
FT                   /db_xref="GOA:D7GI98"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI98"
FT                   /protein_id="CBL55820.1"
FT                   /translation="MTAPTLSKERSTVLHPRVRFIVFYTISCVMQSAVRTIEMIFFVLA
FT                   VCVTVVEIFALTGVREAEHSLVGLAITILSLIMMPGLAWFEFRTGRARFPQRPGRGDTA
FT                   AVYLSVRHGPDRPAFKQPARTGALVDAERECCAFARWGIDDSHRLLQLTVTTPSGQLQA
FT                   LNIPLRSHTPAAAAGLSCEPFTNPKTH"
FT   CDS_pept        361288..361425
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02940"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55821"
FT                   /db_xref="UniProtKB/TrEMBL:D7GI99"
FT                   /protein_id="CBL55821.1"
FT                   /translation="MRRGRKRRGSTDPVPAVLPQIIAEVVSDEHVVLSVGGQRLSGLLR
FT                   "
FT   CDS_pept        361520..362845
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24540"
FT                   /product="Transposase (fragment)"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55822.1"
FT   CDS_pept        362888..363061
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24550"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55823.1"
FT   CDS_pept        complement(363331..368112)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02950"
FT                   /product="helicase"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55824"
FT                   /db_xref="GOA:D7GIA2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039442"
FT                   /db_xref="InterPro:IPR041635"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA2"
FT                   /inference="similar to AA sequence:Uniprot:Q7D7L9_MYCTU"
FT                   /protein_id="CBL55824.1"
FT                   /translation="MATRETIHDVIERFREAPSNGERGAKFERLMVEYFYTDPLLSVEY
FT                   DEVCTWPEWTHNEHTHDSGIDLVARNREDGTWTAIQCKFYDPKHYLQKGDIDSFFTASG
FT                   KSWDGMRFDNRIIISTTDRWSGHAETALANQSIPVQRISLADIAESPVDWMQQSKGSLD
FT                   FEPQKATRYGLRPHQKEAIAKIQEGFQTRDRGQWISACGTGKTFTSLKLAEERCKNNGG
FT                   QLKVLFLAPSISLVSQTLREWMAQTQTDIRPFVVCSDTKASKQAEDISVHDIPLPTTDA
FT                   AKLASLMAAGGRRGKQMTVVFSTYQSIDVVAKAQRESGQQFDLILCDEAHRTTGVTLTG
FT                   DEGESAFVKVHNNTYLPATKRLYMTATPRIYGEDVKKKADEHSALLTSMDDEATFGPEF
FT                   HRLGFGQAVEKGLLTDYKVMILCVQNDAIADSMQGAIANSDGEISLDDASKIIGCWNGL
FT                   AKRTTDLDFGKNPAPMQRAVAFAQNIKASKGFAQAFPELTSALADDADEDTPQLDVAVH
FT                   HVDGGMNALKRSEELAWLKAPVPEGECRILSNARCLSEGVDVPALDAVLFLSPRNSLVD
FT                   VVQSVGRVMRKAPGKDYGYIILPVAIDANESPDKAMRNNKRFKVVWDVLNALRAHDDRF
FT                   KAMINSIDFDGSTGNRIGVDVFGQTGTGTPTDDNSQTKKNLGLQMPLFSLEMRDAVLAR
FT                   IVKKVGERDYWDNWTDNVIHIHANQVSRIKGIVAKGEHDGDQIGAEFEEFHAGLQANIN
FT                   DSIDRDNAIDMLSQHLITQPVFDALFPTGGFATHNPVSIGMQRMVAALEGQGLETETAG
FT                   LEDFYNSVRTSAAGVNTPSGRQSLVHRLYEDFFKKAFPTQASSLGVVYTPVEIVDFILR
FT                   AADDVCRQEFGYGLTDEGVHILDPFTGTGTFIVRLLESGIIRPEDLARKYASELWANEI
FT                   MLLAYYIACVNIETTYQSIAAPSSDGGMEPAPAPYAPFRGATLTDTFQITEDGDKADTS
FT                   LIPANNQRIEAQLAAPIRVILGNPPYSAGQTSANDNNANLNYPTLDARIADTYAKSSTG
FT                   GLKKQLYDSYVRAFRWASDRISDSGIIAFVANNGWVDGNTAHGIRKSFTDEFSHIWVYN
FT                   LRGNARTAGDLRKREGGGIFDSGARTGVAILIATKNPAHDGECELKYHGTPDYQTREEK
FT                   LSTLTGERISSVDWTEITPNEEGDWLNQRSAAFDEFKPVHGDPESHFRERSLGVSTNRD
FT                   AWCWSFSAKRVAASMGCLMDNFNVFAAQRRGPETEEERDPKLISWTRELIRRAQNGKPL
FT                   NFDESAIRIADYRPFTREFIYLDKSVNTVQGKALTFFPTGGHQNLVLSISSSAGSNGIP
FT                   LMHSTVSDLHVGGDSDLFPRWTYEQTTDDGALFSSTPDEVDEWGYRRVDNITDNILDVY
FT                   QAKFGPSVTKDDIFFYVYGVLHSPQYRETFAADLKRVLPRIPLAASSDDFTAFAEAGRR
FT                   LSELHVGYEQVEPYPLHEQPPLGVDEWELYRVTKMKWQNKETKKALIYNSHITLGDIPA
FT                   EAHEYMLGSRSALEWLIDRYQVKTDKASQIVNDPNDWAREHDDPRYIIDLIKRVTRVSV
FT                   ETMKIVKALPELPL"
FT   CDS_pept        complement(368312..368791)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02960"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55825"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA3"
FT                   /protein_id="CBL55825.1"
FT                   /translation="MSEMDLRMKAARVAGQADLRDIRTAALHAEVDFPPQPGSNLGYDL
FT                   DSNFEFALPQDEGDLTVVMGQYTASLSVKEGDEKKEFARLGFTLMALYEVGTPQGDAFS
FT                   HEELEAFVRTSGQFALYPYARETMSMLTTRLGVPNLTLPVLRVALDKDEVQRALD"
FT   CDS_pept        complement(368791..369183)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02970"
FT                   /product="proteins of Bacteriophage / transcription
FT                   regulator"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55826"
FT                   /db_xref="GOA:D7GIA4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA4"
FT                   /protein_id="CBL55826.1"
FT                   /translation="MSQFRRALQSKLENPEVRAGYEDSRDRRKLIETMVQVRKDAGLTQ
FT                   QQVADRMGVVQSTVAQFEGSTDPRLSSVQRYARAVGAKSHFIVSTRPEPSQWTATSLVT
FT                   QQPSRASWEAKAAKVTATRSAFAKAA"
FT   CDS_pept        complement(369285..369641)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02980"
FT                   /product="Hypothetical protein"
FT                   /function="5.1 Protein of unknown function similar to other
FT                   proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55827"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA5"
FT                   /inference="similar to AA sequence:Uniprot:P95259_MYCTU"
FT                   /protein_id="CBL55827.1"
FT                   /translation="MTASAWEWWCASPGGRSAPKKDFYAFPGDIQGAFFDLMEAWLDGS
FT                   ITVDGDSCKSYGQFGVLYLRHQKGNNPYRLYFVQRGDIAVAIHATYKNQQKIDRKTKDL
FT                   LRARARKGSSKPFE"
FT   CDS_pept        complement(369793..369888)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_02990"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55828"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA6"
FT                   /protein_id="CBL55828.1"
FT                   /translation="MSRQRPAETIGQGRHGLDEKHRKRLAGHSPA"
FT   CDS_pept        complement(369885..370958)
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24560"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /note="over representated in Mycobacterium smegmatis"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55829"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA7"
FT                   /protein_id="CBL55829.1"
FT                   /translation="MRRYRCSGCGYVWRQDTTAAAEPRAKLSRRALRWALEGIVVQHLS
FT                   VARVAEGLAVAWDTANDAVLAEGKRVLIDEEHRFEGVKVVGVDEHVWRHTRRGDRYVTV
FT                   IIDLTPVRDGTGPARLLDMVEGRSKQAFKTWLADRPQEWRDGVEVVAMDGFTGFKTAAV
FT                   EELPDVVTVLDPFHVTRLAGEALDECRRRVQQAICGHRGRKGDPLYAARRTLSTGADLL
FT                   NDKQKDRLDTLFADDAHVEVEVTWSVYQRMIAAYRHENRRHGRELMARLIDSISTGVPK
FT                   ALVEITKLGRTLKKRAADVLAYFDRPSTSNGPTEAINGRLEHLRGIALGFRNLTNYIAR
FT                   SLLETGGFRPRLHPGFG"
FT   CDS_pept        370998..371243
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03000"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55830"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA8"
FT                   /protein_id="CBL55830.1"
FT                   /translation="MGKPSDHGVTWSPFAAAAPAPLVGLDHLAGQYGTIRLESLPGDNE
FT                   AEFVEAAEGSQVGAGERISAPADGSVVWAYPGFSDT"
FT   CDS_pept        371245..371397
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03010"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55831"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIA9"
FT                   /protein_id="CBL55831.1"
FT                   /translation="MAGSGGPAQLLGLVAGGKDAGNSELEKAGSHETGAGFPVTWRTDT
FT                   DHQGF"
FT   CDS_pept        371510..372490
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03020"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55832"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB0"
FT                   /inference="similar to AA sequence:Uniprot:Q415Z6_KINRA"
FT                   /protein_id="CBL55832.1"
FT                   /translation="MPNPVHDIDAGGQPMDKYDARVWKSLNEFWEKKSDPQTLTNRAAA
FT                   ALQHGGAAVEGAAKKATGAIPEMVKQPIRHVSDAAGEKVMEPVAKSVVHLLDLVNSWAL
FT                   DLNDPSWVVTHAQKQGLCIDAFTELHDADLKFCDRLLDRSTLTWRTVGALEGGAMGALA
FT                   MVPIAGTVASISADIIVIQVLSTAIAARVAYSYGFDAKDPDEQRFIQRLVNRTFMAQAA
FT                   KTQPMAQVGKAAGAIKGRVHWSDKLRNDHQIIKNLEKLMNLTGTNGGKVGVQSVGKAVP
FT                   VVGVLLGAGTNSAVLGNVAADAKRYCQTRFLCEKYGLQTPSALDF"
FT   CDS_pept        373123..373677
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24570"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="PSEUDO:CBL55833.1"
FT   CDS_pept        complement(373941..374738)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03030"
FT                   /product="Hypothetical protein"
FT                   /function="5.1 Protein of unknown function similar to other
FT                   proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55834"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB2"
FT                   /inference="similar to AA sequence:Uniprot:Q6AAP0_PROAC"
FT                   /protein_id="CBL55834.1"
FT                   /translation="MDDDFLKSMGFPASWEETYDLLDDDKLKSLARNERFDHLLVYADP
FT                   SGASVCMFETSEGFSTETFTVSGHERVPAEVWQVWPGTAEVNVLDEQGELITRVLAFVD
FT                   DPHMYPWYPLKDVGEPARFDGYRMGAIAVDVAVFDTVDAWRESQTPIITAGAPVHDPVA
FT                   GLPDEMFLGPTFVTSPWLFALYSGDETADNASPISIFKAVCERVETVTNALTGQQWYRI
FT                   DADCGFPVTVALPLGITPTPREGSVIDGKAFLTGTTGFWTDLA"
FT   CDS_pept        complement(374854..376161)
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24580"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55835"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB3"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55835.1"
FT                   /translation="MSHPTFTTPCLTTFCGLDELGLEAVGQRLDPDRAVIECRVVEPDR
FT                   WCRECGCEGAPRDTVIRRLAHEPFGHRPTTLLIRVRRYKCCGCGRVWRQDTTAAAPVRA
FT                   KISRGGLAWGLAGLVLDHLSVTRVAAGLGVSWSAANDAILAEGRRRLIDDPARFEGVTT
FT                   IGVDEHVWRHTRHGDTYVTVIIDLTPVREKTGPARLLDMVAGRSKAVFKTWLAARPKPW
FT                   REGIEVVAMDGFTGFKTAAAEELPDAAPVMDPFHVIRLAGDALENCRRRVQHDVFGRRG
FT                   MKGDPLYQARRTLLTGAGLLTDKQQARLDALFAGDRHVEVEATWGIYQDMITAYRDKDR
FT                   GLGRFFLAHTIDKISASVPEQLVEIRKLARTLTQRASDVLGYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLSHYIARSLLEAGGFRPALHPRS"
FT   CDS_pept        complement(376128..376202)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03040"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55836"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF53"
FT                   /protein_id="CBL55836.1"
FT                   /translation="MEVLTLAICRKTSTCHTLLSLHLA"
FT   tRNA            complement(376567..376640)
FT                   /locus_tag="PFREUD_03050"
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:376606..376608,aa:Gly)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        complement(376726..377421)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03060"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55837"
FT                   /db_xref="GOA:D7GIB5"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB5"
FT                   /protein_id="CBL55837.1"
FT                   /translation="MSSHDDAPRRMASGEGPATATAETSAEAEGHADLESGSQGFGTPP
FT                   ATPIATLPPLSPHAGGVPVSPTTGEPVRRRSIVATQVAFWASALCAGIGYSWYWFQAMH
FT                   KGQFHTASWVTGWLHPRPGGMWSLLLACGLAAVVAVMVALPCVTAYQAWTGHRFSRALS
FT                   WWALGGSLLGVLFNWWAVAAIPCALVGVVLLRLGSSRDYFTEWDTLRTPAPQPELPTDV
FT                   FYGPLPRFQ"
FT   CDS_pept        complement(377606..379162)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03070"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55838"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB6"
FT                   /inference="similar to AA sequence:Uniprot:Q6AAM0_PROAC"
FT                   /protein_id="CBL55838.1"
FT                   /translation="MPLVGDFVKGYGQLPLGLVAPTFGNDGYDALPVASDPSLPRSVDL
FT                   RDNSQGFNQKVETALRDGQIYVRNIGDKQWREAPMPSCLAGQVVGISLNEDLLIALDSQ
FT                   GWIYTMGNLLSDPSKWGWVRAWGSPFWFGDGLQSPTTEPNRWSLSVIGNQTDRTYTMPD
FT                   GTQQPISLAKVTQVTALSPDGSKIYTLDPWLAQDYSYEVGTPFNSRFRATSLSSSGSVH
FT                   FITNEYGDMYTKLSDFDINGSDPAQFRYTWRPDERPSATDALQHLLDPSTAAIQLPTAD
FT                   WAHQPKVPGRITDRISIHSTHAGSENRELRVEGESAAGMHGYWFKALDDPAWQFAPTGE
FT                   EIQGRWLDNSERDRSTETLVADSPYDYVGTMPTGGELVIDNFAYASARHDAALRVGDKS
FT                   YPLVLHTVDGRWGTALSMRMGFVGKEGAFGARPAGLVNAVPRNYAAAIEVPYETMLASI
FT                   SDPVLGQFIERDLANQRMHEVFLSVTPNTMKLYDSQHLGGDTTIPNFNKLVTLGEATPE
FT                   A"
FT   CDS_pept        379670..380323
FT                   /transl_table=11
FT                   /gene="ppaX"
FT                   /locus_tag="PFREUD_03080"
FT                   /product="pyrophosphatase PpaX"
FT                   /function="2.6 Metabolism of phosphate"
FT                   /EC_number="3.6.1.1"
FT                   /note="Pyrophosphate + H2O <=> 2 Orthophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55839"
FT                   /db_xref="GOA:D7GIB7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB7"
FT                   /protein_id="CBL55839.1"
FT                   /translation="MSTQDLPWKLVLFDLDGTLINSIDLVVTAWQHAFADVLGKQLDRE
FT                   TVLPWIGLPLTDTIAEQGGDKAEALRASYDQFMQANHDDMVTAFAGLPELLDDLAVYNV
FT                   GTAVVTAKGRELAERGLRVAGYPETLHVAAAMEDTREHKPNPAPLLAALAHEGAHASDA
FT                   VYVGDAIYDLQAAEAAGIPAIGVTWGAGKRDALHQQRALAFADAPDELRAQLLG"
FT   CDS_pept        380402..381451
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="PFREUD_03090"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /EC_number="1.1.1.95"
FT                   /note="3-Phosphoglycerate + NAD+ <=> 3-Phosphonooxypyruvate
FT                   + NADH + H+ glycine, serine, threonine metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55840"
FT                   /db_xref="GOA:D7GIB8"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB8"
FT                   /protein_id="CBL55840.1"
FT                   /translation="MADHLTVAVATPLSEELCLLIEAREPRCELIRDQSLLPPMRYPGD
FT                   HAGDPGFRRTARQEEAFRAMLTHADASYGIPGESPQLLAWTAEHNPGLRWVHTAAAGGG
FT                   AQVRQAGLSREQLDRITFTTSAGVHAAPLAEFAVFGVLAGAKLLPRLTAQKHDRTWGGA
FT                   FLMRQLSQMTVLVAGMGHIGNRCIDDFHALGARVIAYNRSVHDNPNVSAVYTTGQLGEA
FT                   VEQADAIVVTLPGTERTNKLLSAEILQQVRPGTILVNVGRGTVIDQAAMVNALADGRLA
FT                   FAALDVVADEPLPTDSPLWGLPNVIISPHTAGLDAHEDRSIAELFARSATLILDGREPL
FT                   NRVNTVELY"
FT   CDS_pept        381491..382303
FT                   /transl_table=11
FT                   /gene="kduD"
FT                   /locus_tag="PFREUD_03100"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /EC_number="1.1.1.125"
FT                   /note="2-Dehydro-3-deoxy-D-gluconate + NAD+ <=>
FT                   (4S)-4,6-Dihydroxy-2,5-dioxohexanoate + NADH + H+ and
FT                   2-Deoxy-D-gluconate + NAD+ <=>
FT                   3-Dehydro-2-deoxy-D-gluconate + NADH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55841"
FT                   /db_xref="GOA:D7GIB9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIB9"
FT                   /inference="similar to AA sequence:Uniprot:Q8EMM8_OCEIH"
FT                   /protein_id="CBL55841.1"
FT                   /translation="MAKDLPNDTTPTTAPSVTSLFGVSGRRAIVTGGDSGLGHGQAEAL
FT                   LEAGAQVVIMARTRSKVDAALAGWARRGLEGHGVVADLSDAASRGRGFDEAVATLGGLD
FT                   VLVNTAGMITRHRAEDYPLDEYRAVLAVNAEAPFGLSQRAARIFIAQGHGKIINMASML
FT                   SFSGGANVPAYAASKGAIAQLTKACANEWAAHGINVNAIAPGYMATDLNTSLQGEDNPR
FT                   YREITARIPAGRWGNADDLKGITVFLASGASDYLNGAVIPVDGGYLGR"
FT   CDS_pept        complement(382531..384054)
FT                   /transl_table=11
FT                   /gene="cat"
FT                   /locus_tag="PFREUD_03110"
FT                   /product="Coenzyme A transferase (Putative succinyl-CoA or
FT                   butyryl-CoA:coenzyme A transferase)"
FT                   /function="2.1.4 Substrate-specific entries to carbohydrate
FT                   metabolic pathway"
FT                   /EC_number="2.8.3.-"
FT                   /note="acyl-CoA + acetate = a fatty acid anion + acetyl-CoA
FT                   OR: succinate + acetyl-CoA = succinyl-CoA + acetate OR (in
FT                   Pf): succinate + propionyl-CoA = succinyl-CoA + propionate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55842"
FT                   /db_xref="GOA:D7GIC0"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC0"
FT                   /protein_id="CBL55842.1"
FT                   /translation="MNERISNEKLRGKIMTADEAAALIPNGAQIGFGGFTGSGYPKELP
FT                   QALANRIKAAHERGEEFTVNAFTGASTAPELDGALAGVDGMHYRMPYQSDPTLRKKIND
FT                   GTTLYTDIHLSHSAQLVAEGFMGKLDFAVVEAVRITEDGNIVPTSSVGNNKTYLDMAEK
FT                   IIIEVNSWQSPDLEGMHDIWNGYLTPPNRPIIPINNVGDRIGDTFLTIDSDKVVAVIET
FT                   TDRDRNSPFKPIDDDSRAIAGYLLDFYANEVKHGRLPKNLLPLQSGVGNIPNAVLDGLL
FT                   HSDLENLTSYTEVIQDGMVDLIDAGKLAVASATAFSLSPDYAHNMNENAKNYRKSIVLR
FT                   PQEISNHPEVIRRLGVLSCNGMIEADIYGNVNSTHVMGTRMMNGIGGSGDFTRNAYISA
FT                   FVSPSTAKDGAISAIVPMVSHVDHTEHDVMVIITEQGIADLRGLAPRLRAQKIIDNCVH
FT                   PDFRAQLQEYFDHSLVTSKAKHTPHDLRHSYDWHLNFIENGTMKLSHYR"
FT   CDS_pept        complement(384178..385368)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03120"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55843"
FT                   /db_xref="InterPro:IPR008323"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC1"
FT                   /protein_id="CBL55843.1"
FT                   /translation="MPRFEPFAALRYAPSADLDKVIAPPYDVLSDADIDELEARDPHNI
FT                   AWVDDPRGGDDRYVKAAALLRQWISEGVMVYDDQPSFTIYRMAFTDATGAHRVISGVLG
FT                   GLEVVDQGAGGVLPHERTTKKAVTDRLDLTRATSTNGSPVWGLSLAHGLTDALAAPGEP
FT                   VGEITVDGVRHSVERVVDPGRVAKIQEILAADDVLIADGHHRYSISRTYRDEVRKATGR
FT                   TDTPAEQTLAFVNELVEHQLAIEAIHRLVDGISWDDLNKALSRYFDIDPIDEELTPATL
FT                   SEMVAQARLVLLKPDGTASWLIPHEGAFDDMRALDGAWLEKALGDTDAQVTYQHGLDEM
FT                   RTMVADHAAGILIRPTSLTEIMRTAREGLLMPPKSTFFIPKLRTGFVLRPTASVSD"
FT   CDS_pept        385681..387021
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03130"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55844"
FT                   /db_xref="GOA:D7GIC2"
FT                   /db_xref="InterPro:IPR025902"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC2"
FT                   /protein_id="CBL55844.1"
FT                   /translation="MTIQAETTEPGGWSKRWARWRSYGLVENLFFVAAAAFSLMLAVVV
FT                   LRKGVSRPADVLFLIAFYLVLAYLALPRFHRILTALYVPDYYIGRTRTGDGLLGDPVNL
FT                   ALLGDGVQIRQAMEDAGWVEADPVNLNSALRIIAGSVMRRSYPTAPVSPLFLFGRQQDM
FT                   AFQQEVDGSPSKRHHVRFWRCPPGWLLPGGARVDWLAAGTFDRAVGLSLFTLQVTHKIE
FT                   PNIDVERDHIVATLEHAVPQTKVNVLENFSTGYHTRNGGGDTLRTDGALPVIDLSAVPV
FT                   HAEAPHEEQHQMLSDVGKRPVSLILAFLLILIGIGITFSEVAVDAFHDVAGQVAASGGT
FT                   RTEVIVANVVALVVLTGLQVVLSTLVFKGFNWARVLLLAVTSVTLVTRLAGAIVRVPGS
FT                   MDIVQMSVDVLIVYALTSLSARTWTHDRRTLRRELRRKRRDAKALGA"
FT   CDS_pept        complement(387159..387776)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03140"
FT                   /product="Isochorismatase hydrolase"
FT                   /function="3.7.6 Nonribosomal protein synthesis"
FT                   /EC_number="3.3.2.1"
FT                   /note="Young IG, Gibson F. Biochim. Biophys. Acta. 177
FT                   (1969) 401-11. Isochorismate + H2O <=>
FT                   2,3-Dihydro-2,3-dihydroxybenzoate + Pyruvate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55845"
FT                   /db_xref="GOA:D7GIC3"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC3"
FT                   /protein_id="CBL55845.1"
FT                   /translation="MLTPQNSVVVLIDFQPGQYATVGSVSREEIDLGVVTLAKLAHTYD
FT                   IPTVVSTVAVGMGVNAPTVPQIMNELPGVDQIDRTGVNAWEDPEFRAAIEATGRRKIIM
FT                   AGLWTEVCLAFPALDMIEAGYEIYPVADAVGGVSQVTNDRAFDRMIQAGAHPTTALALG
FT                   CELMRNWARPGTDDFRRIFNWYFHQQRSLGLLDAKILPSVGR"
FT   CDS_pept        complement(387889..388497)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03150"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55846"
FT                   /db_xref="GOA:D7GIC4"
FT                   /db_xref="InterPro:IPR012867"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC4"
FT                   /protein_id="CBL55846.1"
FT                   /translation="MNPQPAPVGQPNPSGRDTAQTRTRRPMTDPLNPPRGFWECSCPAL
FT                   VMLVIGLAINVAAWTQMPEVVPQHAGVTGQVDSWTSRNGFLAFTVISIVLFTAALLGAS
FT                   AAVGLSSEGLHAPGKRAERVTYWQHPDRWPIFRPRLWSLMAWFTGWFIVAMAVGANVFA
FT                   LSPRFNLPGWLALVVIFGAMGLELAWFVVRMFRLLDADV"
FT   CDS_pept        complement(388626..389480)
FT                   /transl_table=11
FT                   /gene="PF2369"
FT                   /locus_tag="PFREUD_03160"
FT                   /product="Putative aldo/keto reductase (oxidoreductase)"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55847"
FT                   /db_xref="GOA:D7GIC5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC5"
FT                   /protein_id="CBL55847.1"
FT                   /translation="MSAIPAPMIPLTNGTRGETVNIPQLGFGTYKVPPADTQRIVEEAL
FT                   EVGYRHIDTAEMYGNEAGVGKAIASAGIPRDQLFITSKLNNAFHDPKAAHKAFDDTMTA
FT                   LGIDVLDLFLVHWPMAKTTSLEATWTAMVDILGSGRVRAVGVSNYQPDHLRTIINATGV
FT                   TPAVNQIEVHPYLTQEPLRELDKELGIVTEAWSPLARGVVLSDPTIDRIAGELSRTASQ
FT                   VVLRWHIQRGDVVFPKSMHRARMEENAKIFDFELTDGQMAEITALNRNERQGSHPDEVQ
FT                   GVK"
FT   CDS_pept        complement(389583..390356)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03170"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55848"
FT                   /db_xref="GOA:D7GIC6"
FT                   /db_xref="InterPro:IPR025576"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC6"
FT                   /protein_id="CBL55848.1"
FT                   /translation="MSTSIKHWIPNQHGAWAMLAVPFAAAVILRARVADVPAWTIPLAV
FT                   LWLVGYLLFNAVLAWRKTAPARRQPLRSPLICYSLVCLVAGVAILMTGGLPLALWIVLF
FT                   APLVVAALVLAAHKRERSVLSGLTTVGAACLVFFVVRCGGWPLLAPGTDVWIGALLYGY
FT                   FGGTVFHVKALIRGRRDAGSARAGLIWHGAWLVVALLLGSAGLASWWWTPFFALLIVRT
FT                   AAMKHATNTGHVLRPALIGFTEVALSVVALVICMA"
FT   CDS_pept        complement(390563..391552)
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="PFREUD_03180"
FT                   /product="rRNA (guanine-N2-)-methyltransferase"
FT                   /function="3.6 RNA modification"
FT                   /EC_number="2.1.1.52"
FT                   /note="S-Adenosyl-L-methionine + rRNA <=>
FT                   S-Adenosyl-L-homocysteine + rRNA containing
FT                   N2-methylguanine"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55849"
FT                   /db_xref="GOA:D7GIC7"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR017237"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC7"
FT                   /inference="similar to AA sequence:Uniprot:Q6A650_PROAC"
FT                   /protein_id="CBL55849.1"
FT                   /translation="MDPVDRMIIEESPESAKHLLVIDSPELADAASDVAGRVSIYCDDR
FT                   RDADQVPRSLLIEALDAATLEGVDLVWMRLPKALAALDEYAERISAHALPGVHLVAAGR
FT                   TKHMTLSMNDVLGKHFKAVSASLGRNKSRALHAIGATPTELTWPRENLHPELSLGVIAH
FT                   GAVFATNKVDDGTRLLAERCADLHGNDLLDLGCGSGILATLLARANPEATVHGVDTSLA
FT                   AVDSTRITSEANGRHVTVHWAWNLNDWPADSLDVIVCNPPFHRGVAKDSEPALEMFTEA
FT                   GRLLRPGGEFWCVYNSHLPWKARLTASIGPTTVDFQNPFYTVTRSIAR"
FT   CDS_pept        391645..392967
FT                   /transl_table=11
FT                   /gene="matE"
FT                   /locus_tag="PFREUD_03190"
FT                   /product="Multi antimicrobial extrusion protein MatE"
FT                   /function="4.2 Detoxification"
FT                   /note="These proteins mediate resistance to a wide range of
FT                   cationic dyes, fluroquinolones, aminoglycosides and other
FT                   structurally diverse antibodies and drugs."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55850"
FT                   /db_xref="GOA:D7GIC8"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC8"
FT                   /protein_id="CBL55850.1"
FT                   /translation="MAIWTKSDRELFALAIPTFASLVSEPLLVLADTAFIGHLGAVPLA
FT                   GLGLGGNVLGVVTGLCVFLAYATTGTTARRFGAGDPRGAFEAGRDGMALGAVLGAVLAA
FT                   LIWALAPTIIGWYHPAPDVAAAAVAYLRLVILGLPFQLVVLASTGLLRGLQDARTPMAV
FT                   AIGVNLTNIGLDALLIYGFGFGIRGSATATATAQAASCLVLVAVIARRARARNLPGGGV
FT                   PLRPSLHGMFDAMSHGGWLVVRSLGLWISLTATTVVATRMGSLILAAHQVANSIWNFLS
FT                   FSLDALAIACQALIGRYLGAEDPSGAKRVMRRAMGWGVVQACVVGVVLVVARPLIIRIF
FT                   TTDPAITHLLLGALVVLACLQPLASLVFVLDGVLIGAGDTRYLAIAGLFVVVIHLPLLA
FT                   LVWHFDAGLVWLWIAYGGFLAARGLTLALRARSGRWASTGE"
FT   CDS_pept        complement(393183..394094)
FT                   /transl_table=11
FT                   /gene="mrr"
FT                   /locus_tag="PFREUD_03200"
FT                   /product="restriction system protein"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /note="Involved in the acceptance of foreign DNA which is
FT                   modified. Restricts both adenine- and cytosine-methylated
FT                   DNA."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55851"
FT                   /db_xref="GOA:D7GIC9"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR025745"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIC9"
FT                   /inference="similar to AA sequence:Uniprot:Q5YW31_NOCFA"
FT                   /protein_id="CBL55851.1"
FT                   /translation="MVPALRLLADGDIHRGNTVAAPVADALAITPEQREKLLPSGQPRF
FT                   ANRANWALSYLYRAGAVERPTRAHYRITDVGRQLLASHPAGLTEHDLRAVPGYVIPSNH
FT                   RNAASTSPASVPESSSTIPAETAALSPTEQIEEGIERIHEELASELLGRLHDQDPAFFE
FT                   DAVLSLLEAMGYPGTDGRITRTQLSRDGGIDGIVDQDALGLSRVYVQAKRYDLDAAVGR
FT                   PTVQAFAGALQGNGANQGVFFTTSRFSTDARDFAEKLPTRVVLIDGARLASLMIRYHVG
FT                   VQVKKTYEIGEIDEDFFAGTEL"
FT   CDS_pept        394636..395529
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03210"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55852"
FT                   /db_xref="GOA:D7GID0"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID0"
FT                   /protein_id="CBL55852.1"
FT                   /translation="MTSAPLEIHVIADSSGETGARVARAARMQFPNQRFTIVRHARVRN
FT                   ADTLLEVFDDISDSADPTVGQSRRVIFYTLVNGEMRGMVERYCDDKSIPRADLMGDALI
FT                   ALSQVAKTSADEVPMRPVGVEADYFERISAMEFAVRNDDGVMPDSLRESDICLIGASRS
FT                   GKTPLSIYLGYAGYKTVNVPIVPGIKAPEQLYEIDRWRIVGLTIDAERLLQIRQRRVKG
FT                   LGGYGTKDGYSDLAKIYDELDEVKAVQRSLGCPILDTTGLALEEAAARVIDIVERRAKQ
FT                   FGAHLRRPAGSMKLTP"
FT   CDS_pept        395612..395629
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03220"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55853"
FT                   /protein_id="CBL55853.1"
FT                   /translation="MVSKK"
FT   CDS_pept        395738..398395
FT                   /transl_table=11
FT                   /gene="ppdk"
FT                   /locus_tag="PFREUD_03230"
FT                   /product="Pyruvate phosphate dikinase"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /EC_number="2.7.9.1"
FT                   /note="ATP + Pyruvate + Orthophosphate <=> AMP +
FT                   Phosphoenolpyruvate + Pyrophosphate Cofactor : Magnesium.
FT                   homodimer"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55854"
FT                   /db_xref="GOA:D7GID2"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID2"
FT                   /protein_id="CBL55854.1"
FT                   /translation="MSEKYIYDLSEGDASMKSLLGGKGAGVAEMMRLGVPVPDGFTVTT
FT                   QACIETMNNGGTWPAGLRDQISDALARFEERAGRKLGASEKPLLVSVRSGAVVSMPGMM
FT                   DTILNLGISDESVAAVAAEANNERFAWDCYRRFIQMYGEVVEGLDAHIYEDALTAMKQR
FT                   KGASQDTDLTAEDLKELTTEFKQISDDALGGAWPSDPREQLMRAVEAVFNSWQNPRAKV
FT                   YRKANHISDDLGTAVNVMQMVFGNRGETSATGVCFTRNPSTGENALYGEFLTNAQGEDV
FT                   VAGIRTPRPLIEMKEVLPQAYGELVDTMHKMETHYRDMQDMEFTVENGKLYMLQTRNGK
FT                   RTAAAALKVASDLVDEGLIDKEEAVRRIEPDQLDQLLHPAIDPGQSATPITKGLPASPG
FT                   AAVGAAVFDADTAAERGEAGEPVVLIRFETTPDDIHGVLQAQGVLTAHGGMTSHAAVVA
FT                   RGFGKPCVAGATDIKIDTEAKTMTVGGVTVHEGDTLTLNGSTGEVFNTALKLIPPRLNE
FT                   DFLKVVGWADEIRDLGVEANADNGTDAAKARELGAEGIGLCRTEHMFFGDDRLPAMHEM
FT                   ILSENDEQRQVALDKILPMQQSDFEAIFTAMKGLPVTVRLLDPPLHEFMPDLVTQALKV
FT                   QEMELKGADPTKLAEERRTLAQVKKLHEQNPMLGTRGCRLGMLYPQIPDMQARAIARAA
FT                   LAVLDREGETVDLQIMVPLVHLRQELQRQREIVVAAVDDELDKAGQKLDYLVGTMIELP
FT                   RAALVADQIAQEADFFSFGTNDLTQTTLGISRDDAENGFLGWYEAQGVVKRDPFATIDV
FT                   DGVGQLVRMGTEKGRAANPKLSVGVCGEHGGDPDSIAFFQSVGLDYVSCSPFRVPIARF
FT                   AAAKAKLAQADASK"
FT   CDS_pept        398895..401711
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03240"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55855"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID3"
FT                   /protein_id="CBL55855.1"
FT                   /translation="MADEHNGAVGAPSTHLWGESAWLALDMWRISYTPGDWLMVAGPRC
FT                   VVMLRPLPSTDPAALEPLWRDVSSGAPLEQVIDTLNKQGLAQLSEVAVAGLTADGVRCL
FT                   LRGGVQVLDARSSQLLARGGSTPAWCDAVLSSLYLRIVPARDDGGSAMPLSAGPELEMS
FT                   VGMAQCAAVLVDMRVETLAARQPASVDAQVRAVQRAESGAEAFGAGAGLAAPGHGGGAS
FT                   APGDAPMGVDDDEDAVGGEDISDDQPVGADGRDVSRMDMADRSDVSRAGVPAARTDGAS
FT                   GARPWSVGTRATGGDERGSAELTADEQARDEQSADTSLDAEQSSPEQSGAGQSGAGQPG
FT                   AWQPHDQQADHQQPVDQQSDGGHSDVRQPVDQQSGGGHSDVSQPVDQQSGGGHSDVSQT
FT                   EGDQADEDQAGAEHGRQWSSASPEVLREMGLAADGSEPASAPPASAPAAGASQVFGTPE
FT                   RPAPSKVADTGQPDAARAAHAWFEESTGFAVGAPSDAEAFMFEPTQALPDKQAMPVVNP
FT                   PEPEAANDAKGPADAPATPDVDGSADAGTDPSGTDVAADEGSARRHRPGQDSAEGTPRR
FT                   RRPVTSGEGRSEENLGLSLVDDLMRDSERAANHPGESFSAGLFGAPIESSIDLSAPAPV
FT                   VGSREPHEPAEPPAHGVGTPANPAPTSGDAAPQPAPHQPAPHQDAPQQGNQQHGIQQHM
FT                   TPAGAHPEVVAGLTSPGAESPGPSGPSAGDPGHDRRPADGRADLEPEATLQPPASTGAP
FT                   FTPPAPAFPAPSEQGQRADVLPDAAPDRPGAVPPMPAGQASAASTMREPAVESPQGASA
FT                   SDTAGPSRAAGAVPRAPLFQIVTSGNQVAVLDRPAVVGRAPVVDDGLSRAVTVPSPGHD
FT                   ISRTHLRIEQRGDVVAVTDLHSTNGTVINEPGKSPSHLADGQTRLVPVGTVLELGTGER
FT                   IRIEAADA"
FT   CDS_pept        401947..402939
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="PFREUD_03250"
FT                   /product="carbohydrate or pyrimidine kinases PfkB family"
FT                   /function="2.1 Metabolism of carbohydrates and related
FT                   molecules"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55856"
FT                   /db_xref="GOA:D7GID4"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID4"
FT                   /protein_id="CBL55856.1"
FT                   /translation="MSDPSSSAPEVRAAARAARSALERVTNRRGRVGVLGSLNADLTVT
FT                   TRTLPGPGETVVGDPLVVRPGGKSANQAVACALAGADTLMVGAVGDDAHGEMLRESLTR
FT                   AGVDISGVRSAQVATGTAVITVDHRGENTIVVSAGANGTLGADDVHDAADALRAVSVLG
FT                   LCLEVSDPALLAAQRLVNSAGGTTVLNVSPLREVSAELVADAQVLIVNEHELAAVVGSD
FT                   PGREPADIAAALDGHGIGRAVVTLGAQGSVAVEAGLVVSVPAFPVQAIDTTGAGDAFMG
FT                   TLMAAIAAEVPLGEGAALASAFAAVAVTRRGAQASYPGQPELQEFLARW"
FT   CDS_pept        complement(403172..405037)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03260"
FT                   /product="Sensor protein"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /EC_number="2.7.13.3"
FT                   /note="two component system regulator"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55857"
FT                   /db_xref="GOA:D7GID5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID5"
FT                   /protein_id="CBL55857.1"
FT                   /translation="MSSSRPEQPGGSVQHPNEQPGAAHPGAIRDEAAHSGTTNSATTQS
FT                   GPGFVAPSGDASMSSNANASFPRQPDATATGASGAAPVSGATGTVPVSPGTVPTAAGQE
FT                   LLTQTTNGMARARKAPAMAKGTLSRQLVARISALVAAIAILLGVLSTFVVYQILVNEVD
FT                   HELSQSVGAESRNSSPTGSAISLGGLPADAVVVIQQGDGTTVGSVETYDRTQTVRTSSG
FT                   VNDAIAKVPVDPRAHTVRLAELGSYRVVASNVRIGVPNADGSESTVSAKLFVGVPMERS
FT                   NSVIHRLVIFEAILAALAIGTAAIIARSVVRRSLDPLNHLATTADEVSRMDLEKGEVNL
FT                   PPRIPNSETDPKNEVGRVGLSFNRMLDNVEGALTAREASENKVKQFVADASHELRNPLA
FT                   SIRGYAELAQRRANELNPDTAFAMSRITSESERMSGLVEDMLLLARLDTKPELQLAETD
FT                   VVEVVLNAASDAQVAGPDHHWRVNLPDEAVTVMADRNQLHQVVANLLSNARKHTPAGTQ
FT                   VDTSVGIEGDQAVIRVHDNGPGVPPEIADKVFERFARADVARTHDKEGSTGLGLAIVAA
FT                   VMAAHGGTAALDSSDGHTTFTLRLPLASDDSGRPAGPPPQADLSH"
FT   CDS_pept        complement(405018..405746)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03270"
FT                   /product="two component system response regulator"
FT                   /function="3.5.2 Transcription regulation"
FT                   /note="highly similar to protein Q9ADN7_STRCO from
FT                   Streptomyces coelicolor"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55858"
FT                   /db_xref="GOA:D7GID6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID6"
FT                   /protein_id="CBL55858.1"
FT                   /translation="MAGPNAPELLTRPDGTPIRVLAVDDENSLTELLSMAMRYEGWEPT
FT                   TAATGSDAVRAARDTNPDAIVLDMMLPDFDGLEVMRRVRAEQPDVPVIFLTAKDAVNDR
FT                   IVGLTAGGDDYVTKPFSVEELMARLRSLLRRSGATSKRSESELIVGDLVLDEDSHEVTR
FT                   GGDEIHLTATEFELLRYLMRNPKRVLSKAQILDRVWNYDFGGQANVVELYISYLRKKID
FT                   AGREPMIHTMRGAGYVLKPA"
FT   CDS_pept        406297..407262
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03280"
FT                   /product="ABC-type transport systems, periplasmic
FT                   component"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55859"
FT                   /db_xref="GOA:D7GID7"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID7"
FT                   /inference="similar to AA sequence:Uniprot:Q6AE20_LEIXX"
FT                   /protein_id="CBL55859.1"
FT                   /translation="MSNPTNPANPSGGTPGALPEKPHSGPSKGLIIGIVVIVLAIIVGL
FT                   VVFFATRKPKAAATTTVTIGVTDESQPYWAKLKELAAKENITVQTKNFASYTEVNPALR
FT                   QKQLDLNQFQHLLYLANYNVQNNDNIVPLGGSMIVPLGLYSKKHTSVDQIPQGGEIAIP
FT                   NDPTNEARALLVLQAAGLLKLNGGGTALSTPADIDQANSKVKVTPVDAAQTAASLPSVD
FT                   GSIVNNSFAADAKLDPSKALYKDDPNSAAAEPYINVFAVRKDDLNNPTYKRVVELYHEK
FT                   AVADLVVSGSNGTAVIVENKSQADLQAILDKLETQIKEKK"
FT   CDS_pept        407259..408524
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="PFREUD_03290"
FT                   /product="Methionine import ATP-binding protein metN"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55860"
FT                   /db_xref="GOA:D7GID8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID8"
FT                   /inference="similar to AA sequence:Uniprot:METN_PROAC"
FT                   /protein_id="CBL55860.1"
FT                   /translation="MTQSDPRPGDHTLTSQISFRDVSKVYQTASGSVTALKGINLDVKP
FT                   GEIFAVIGYSGAGKSTLVRLINGLEKVTSGSVEVNGFDVTNMTEHQLRKVRPEIGMIFQ
FT                   QFNLMQSKTVYENIAYPLRLAKWSKADMKARITELLHFVGLTEKAWVHPDELSGGQKQR
FT                   VGIARALATKPSVLLADESTSALDPETTQDVLGLLRRVNEKLGVTIVVITHEMEVVRAI
FT                   ADRVAVLDNGDLIEQGPVDQIFETPATETTKRFVNTIMRHNPSTEEWDRLRAENPDATL
FT                   VSVKSVDPGEFGAVLAQISDDASDDHKVSFAIVQGGVVQVKTRSIGSFTLALRGSPDAI
FT                   SRASDKLLAISHQKSDDAPAPPPREATDEPAQLVNSAPGSAGLMTGETVSPARAAGQDD
FT                   AAGQSDGARDNGIATNGLGVRA"
FT   CDS_pept        408521..409177
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03300"
FT                   /product="ABC transporter, permease protein"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55861"
FT                   /db_xref="GOA:D7GID9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7GID9"
FT                   /inference="similar to AA sequence:Uniprot:Q6AE22_LEIXX"
FT                   /protein_id="CBL55861.1"
FT                   /translation="MNWDTIGPVYGKAIVETLIMVVITLVIGGFAGLLLGLGLYSTRRG
FT                   GVMSNSGLHTVLNVVVNIVRPIPFIIFVTAIGPLTLLVMGTTIGTTAATFALCVAATFG
FT                   ISRIVEQNLVTVDPGVIEAARSMGAGPWRILFTVVIPEALGPLILGYTFVFVAVVDMTA
FT                   VAGAVAGGGLGQFAISYGYQRFNWGVTGLAVVTIIVLVQIAQFTGNRLARKVMRR"
FT   CDS_pept        complement(409301..410917)
FT                   /transl_table=11
FT                   /gene="slh1"
FT                   /locus_tag="PFREUD_03310"
FT                   /product="S-layer protein precursor"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55862"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR022038"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE0"
FT                   /protein_id="CBL55862.1"
FT                   /translation="MELRGTLAPNASITIRVPLTLPTLQDPATGLVFSIGAASYGISVN
FT                   AVPETSIRFASPLKAGDTSLVPYTGAFLATVKSKDGSKYTTVPSLQQYMPKAENGVNYW
FT                   VNNFRVAAASGASDGLLYLKGYYTVPTAPLAAAVKEHGYDTEFSGADRMTQYIYQASTT
FT                   SANVVDSDGNPVKVNPDRTAPYVGLRQVIDGHDAEVAVGGKFDPVGNLGLVVNDHAGNP
FT                   ITLPSDDVKIDISKVNTGANGTYPVTVTYAPDEVSNTFNVKVGTGTTGGGGGETGNTVT
FT                   PKAPTQGADQVTIPTIPGVDYQVDGKTVTGTITLNDGQKITVTAKAQDGYTLTEGATAT
FT                   WDFTYNKGTTPTCDTQYFTDVTPNMQFFNDICWLKANNITTGWPDGTYRPVTPINRDAM
FT                   IAYIYRMAGSPAFTPTKQTFSDVAPSNMYYKEIEWAAHEGITTGWPDGTLRPVTPVSRD
FT                   AMAAFLYRQSDSPAVALPASPSFHDVPADNMYYKDIEWMASTAISTGWPDGTYRPLADT
FT                   NRDAMAAFIHRAVTAGVLTVK"
FT   CDS_pept        complement(410990..411565)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03320"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55863"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE1"
FT                   /protein_id="CBL55863.1"
FT                   /translation="MSRIQLPRLSRIAIAAAASAALIGTSFIAPATAFAAPNTPTAVAA
FT                   AAANGTVASNDAAAEASSLVINDSDFAQGAYTDAHSNDKIQLYSQIAAYTTADGTGTPA
FT                   MSNAAGKKLVLPKSLGHSIVDADQVKSMYQVMTIKNTSDADFKVDEQMTLPRFYIGYDN
FT                   DSKSVDVDPSAFKGSELDPDLITGKLTD"
FT   CDS_pept        411947..412519
FT                   /transl_table=11
FT                   /gene="padR"
FT                   /locus_tag="PFREUD_03330"
FT                   /product="PadR, Transcriptional regulator PadR-like family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /note="This family includes PadR, a protein that is
FT                   involved in negative regulation of phenolic acid
FT                   metabolism.."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55864"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE2"
FT                   /protein_id="CBL55864.1"
FT                   /translation="MYGAFGRGPGGRGRRDNGFDGGLAAPFDQIEKQFRDFVQARTQSR
FT                   AARGDVRAAVLALLSEEPMHGYQIIHEIDKRSAGAWKPSAGSVYPTLQMLADEGLVSLE
FT                   EQDGKKVYSLTETGRSEAEAASDKPKPWESAADNDLPESMVLPRATARLVQAVGQVVTT
FT                   GNASTTQAVTEVIDEARRKVYSILAQD"
FT   CDS_pept        412562..414259
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03340"
FT                   /product="ABC-1protein"
FT                   /function="3.9 Protein folding"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55865"
FT                   /db_xref="GOA:D7GIE3"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE3"
FT                   /protein_id="CBL55865.1"
FT                   /translation="MSSDRPLRARYRRILGFFARLTVQMWFFDVVLPRVGLRRLAARGR
FT                   TRRFQKAAARFHALAAELGGLMIKLGQFMSTRLDVLPPEVTEELAGLQDEAPEVPFSQI
FT                   RPMAEAELGMPLSAAFESFESTPVAAASLGQVHRARLSPSEARDVGFRNVMVKVQRPGI
FT                   EQVIDIDLTALRRVAGWASHLKAISQRTDMHGIVEEFARSSAEEIDYLHEASNAERFAA
FT                   NFADDPTISAPAVVWERTSRRVLTLSDVSAIKVDDIEALNQHGIDPHEVAYAVADAYIK
FT                   QVFEDGFFHADPHPGNLFVTPVPDAMVGEVGRRWKLTFIDFGMMGEVPGDLRGQLKDVI
FT                   IAIGLRDSQRLVRCMEELHMLLPSADRSLLERAVGQLFDRFGGMSLAEMRELDPKEFID
FT                   FGRQFRDLMREMPFQLPEDFLLLIRAASLMNGLCTALDPDYNLWDSVQPYADQLVTGDP
FT                   GSQAKMILDEARALLEITLGLPRRLTRVLTMVERGQLSVEIPEIERQLSHIEVGVRRVV
FT                   AAVLFVGLLLGGILLRGTDPMWGLIMMGVSLVPLAYAVFGGLFRRFRV"
FT   CDS_pept        complement(414347..415663)
FT                   /transl_table=11
FT                   /gene="cytX"
FT                   /locus_tag="PFREUD_03350"
FT                   /product="Hydroxymethylpyrimidine transporter CytX"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55866"
FT                   /db_xref="GOA:D7GIE4"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE4"
FT                   /protein_id="CBL55866.1"
FT                   /translation="MEAPLTLTDKPPRTLGAGAQTAMWASFGVTLFGPLTGALVTQSVG
FT                   SLGGGLAACALGTLVGALLLGGAAGIGAHTGTPSMVGLRGLLGRGASVVPTVLNIAQNI
FT                   GWAMMEIIVITSAATHIVGAAWHWPFVIVAGALCTLMAIRPLGSVKILRTVMLWLVLAG
FT                   SIYLFVMVLRQPSHTIGQDAVIGFWPGVDLAAAQVVSFAPLAADYSRHATSGRSAFASS
FT                   AAGYGLAIFAYYALGVFAVAHLGGDLAGTNLLAALMVLPVGGLAIGLLLLDELDNAFAN
FT                   VYSSTVSVHNLAPRLDRRVISVAVGVVATVLAGLAGFDQYEGFLYLIGSAFVPLFTVAV
FT                   VDFFVTRRGRWDTTATAPFRWSPTLAWFFGFVAYQLIYPGSIPGWSDLWAGLAQALGFV
FT                   APGWLGSTLGSIVVSAVAAAGLGAIDTAVHRRRAEGRLA"
FT   CDS_pept        complement(415742..416608)
FT                   /transl_table=11
FT                   /gene="thiD1"
FT                   /locus_tag="PFREUD_03360"
FT                   /product="Phosphomethylpyrimidine kinase/
FT                   hydroxymethylpyrimidine phosphokinase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="2.7.4.7"
FT                   /note="ATP + 4-Amino-2-methyl-5-phosphomethylpyrimidine <=>
FT                   ADP + 2-Methyl-4-amino-5-hydroxymethylpyrimidine
FT                   diphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55867"
FT                   /db_xref="GOA:D7GIE5"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE5"
FT                   /inference="similar to AA sequence:Uniprot:Q47MN7_THEFY"
FT                   /protein_id="CBL55867.1"
FT                   /translation="MMSTPPAPDTTAPAGATAATRPPVALTIAGSDSSGGAGIQADLKS
FT                   FSALGAYGMSVIVALTAQNTTGVTGVLATPPEFVTAQLDAVTSDIRLDAVKVGMLASAE
FT                   LATTVRDGLAALRATTPDLPIVVDPVMVATSGAHLLPGDAVEALRGVLRHASLITPNLP
FT                   EAAVLLDEPQANSVDEMIGQATRLLELGPERVLVKGGHGHGAESVDVLASADDVQVLHA
FT                   PRIDTVNTHGTGCSLSSAIAALRPQRGSWDAAVRDAKDWLSGAIVHADALDIGAGGGPV
FT                   HHFYRWW"
FT   CDS_pept        complement(416605..417456)
FT                   /transl_table=11
FT                   /gene="thiE1"
FT                   /locus_tag="PFREUD_03370"
FT                   /product="Thiamine-phosphate pyrophosphorylase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.5.1.3"
FT                   /note="2-Methyl-4-amino-5-hydroxymethylpyrimidine
FT                   diphosphate + 4-Methyl-5-(2-phosphoethyl)-thiazole <=>
FT                   Pyrophosphate + Thiamin monophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55868"
FT                   /db_xref="GOA:D7GIE6"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE6"
FT                   /inference="similar to AA sequence:Uniprot:Q6A9C4_PROAC"
FT                   /protein_id="CBL55868.1"
FT                   /translation="MRPAMLRSEDRPMPRSDAQPDAQFDRQPGAGRRRSVDLSVYLVTD
FT                   TEQCGGVDGVVRTVREAVPAGVTLVQLRDHHLSDDDFVALGRRLVDVLDGTGVPLLIDD
FT                   RVHLVGPIGAQGAHVGQDDMPIDRARAMLGPDAILGLSTQTPGHVAAARAMGEQLVDYL
FT                   GVGALHSTGTKPEAGDLGMATVASVVEVSPWPVCAIGGVKADDAAPLAAIGCDGMSVVS
FT                   AICGQPDIAAATRRLVDAWSRATGVPATHTGHAEGNPVGQASPARQDPSASPNPSPDKA
FT                   AR"
FT   CDS_pept        complement(417453..418313)
FT                   /transl_table=11
FT                   /gene="thiM"
FT                   /locus_tag="PFREUD_03380"
FT                   /product="Hydroxyethylthiazole kinase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.7.1.50"
FT                   /note="ATP + 5-(2-Hydroxyethyl)-4-methylthiazole <=> ADP +
FT                   4-Methyl-5-(2-phosphoethyl)-thiazole"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55869"
FT                   /db_xref="GOA:D7GIE7"
FT                   /db_xref="InterPro:IPR000417"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE7"
FT                   /inference="similar to AA sequence:Uniprot:Q6A9C5_PROAC"
FT                   /protein_id="CBL55869.1"
FT                   /translation="MTDVHMAHGTTGTIDTATTEQAVDLAGALRAVRDNNPLVQCLTNI
FT                   VVANFTANVLLSAGASPAMVDNSHEAADFAAIAGGVLINTGTPYPETAKAMLLAAESAA
FT                   THHNPWVLDPVAAGLPWRTDVARNALAAGDPAIIRGNASEIIALAGSSSGGRGTDSTDP
FT                   VTAALATAKQLARTYHCAVAISGPVDHITDGERVLTVSNGHEWMTRVTGVGCSLGALMA
FT                   AFAAVVPNPVDAATAATALLCVAADHAAAESRAPGSFATALVDQLYLVSPEQLAAEADV
FT                   RALAA"
FT   CDS_pept        418709..418744
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03390"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55870"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE8"
FT                   /protein_id="CBL55870.1"
FT                   /translation="MKHNCPSGRHA"
FT   CDS_pept        418741..420135
FT                   /transl_table=11
FT                   /gene="aroP"
FT                   /locus_tag="PFREUD_03400"
FT                   /product="Aromatic amino acid transport protein aroP"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55871"
FT                   /db_xref="GOA:D7GIE9"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIE9"
FT                   /protein_id="CBL55871.1"
FT                   /translation="MSTTAADPAPAGLRRSLRNRHIQMIALGGAIGTGLFYGSAESIGQ
FT                   AGPAILLCYIVGGAIIFLVMRALGEMSVDTPTSGAFSFYAYKNWSPRAGFISGWNYWFN
FT                   YIAVSMAELTVVGKYIQFWLPGVPQWVTAAVCLVAITAINLISVKAYGESEFWFAIVKV
FT                   VAIIAMIVLGLVIILTGFGNGGHPIGFSNLWKNGGFFPMGVTGMLMGLVVVMFSFGGVE
FT                   LIGIAAGETDDPKKTIPKAITQVVYRILIFYVGAVFVMLCLFPWNELGTSESPFVVIFH
FT                   KIGIGSAATILNIVVLTAAISAYNSGLYSNGRMLYSLARQRNAPAVLGRVNRFGSPYVG
FT                   VLVSSCVTAIAVVLTYLFPDTVFLYVISIALIAGIINWTMIVITDIKFRKRIGPEGVRK
FT                   LAFRMPGHPVTSYVVIAFLAMVVVLMGFMPNYRISLIVGAVWLAVLWFFDWLLTRRHGV
FT                   RHISAE"
FT   CDS_pept        420252..421202
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03410"
FT                   /product="Cation-efflux transport protein"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55872"
FT                   /db_xref="GOA:D7GIF0"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF0"
FT                   /protein_id="CBL55872.1"
FT                   /translation="MADHAKVSDGADEQHSHSHGVSANADRRYLWGALIALALFMLGEV
FT                   VVAFITGSLALLSDAGHMLSDVASIGVALWAMTLAARPARGRWTYGFKRAEILAALANG
FT                   VTLLVLGLVLAVEAVRRLITPPQVHAPPVIVVALVGIAVNFLATWLLARANRTSLNVRG
FT                   AYQHILTDLFGFIGTLVAGLVILFTGWTRADALASLVVVALMLRAGWPLVKESGSILLE
FT                   AAPPDIDLDEVRKHLMDLDHVIDVHDLHVWTLTDGLPAVSAHVVTRDDCFIDGDMPELL
FT                   DELQDCLRTHFGIEHSTFQLEPGAHAQHEPGMHHH"
FT   CDS_pept        complement(421485..421649)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03420"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55873"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF1"
FT                   /protein_id="CBL55873.1"
FT                   /translation="MSHVGQSDADYAPEPTGPIAGGPSCIDALNTGVRGGPDPASVTLE
FT                   AFGRDIPEA"
FT   CDS_pept        421683..422237
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03430"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55874"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF2"
FT                   /protein_id="CBL55874.1"
FT                   /translation="MLNDPIAYADQLLAASVVDPDGTLNLPVDLEKVAGPLGIEVFARE
FT                   DLTADQSPQIGVADNNPNAVAIFVSAHEPHRDQTPKIGGALAALLLMPDDQTKTIEQRL
FT                   SLPVSDEQIAWSRAFIGELLVPAGTLLDQWNATFPEMDTPADAVHAVAVSYAVSDAFMA
FT                   DRLTTLGLLRPPAAPQDDVQA"
FT   CDS_pept        complement(422300..422413)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03440"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55875"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF3"
FT                   /protein_id="CBL55875.1"
FT                   /translation="MGQKTEGSKGHKARGPELSASVAAGPSDTSTLARPAP"
FT   CDS_pept        complement(422463..423446)
FT                   /transl_table=11
FT                   /gene="hflC2"
FT                   /locus_tag="PFREUD_03450"
FT                   /product="Stomatin/prohibitin"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /note="Prokaryotic HflK/C plays a role in the decision
FT                   between lysogenic and lytic cycle growth during lambda
FT                   phage infection."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55876"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF4"
FT                   /protein_id="CBL55876.1"
FT                   /translation="MISLVVLIVVILVVIALAFATIFVVPQQSGYVIERLGKFHRVSLA
FT                   GLHVKIPVVDRVAQKMNLRVAQMDVQLETKTLDNVFVVIVASTQFRVDPNNISTAFYEL
FT                   QDPAGQLKAYMEDALRSAIPSLTLDDAFARKDNIALDVQQTVGNEMARFGFNVVKTLIT
FT                   AIDPSKVVKEAMDSINAAQREKEATRQRADAQRIAIETQATANAEKVRLQGEGQANYRR
FT                   EIANGIGDQIKSLHSVGMDIEEVNRIVMFNQYLDVMRSLSESGNAKTVVLPASTPGAFN
FT                   QLYNEVTNALVTAQQTEAPTVIAGDEASLATHAQHDAPSRSTQPED"
FT   CDS_pept        423831..424763
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03460"
FT                   /product="Hypothetical secreted protein"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55877"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF5"
FT                   /inference="similar to AA sequence:Uniprot:Q3F013_BACTI"
FT                   /protein_id="CBL55877.1"
FT                   /translation="MKRIPVAIVGCAVALVAGSAVAGSAARAARLDAVARPSLSASVDV
FT                   SASGVGGAEQSAGQASPGGSTPAVSSPAASAPAGEPSRARGAAAQQPEATASSQPGSGT
FT                   TDAPAQTGITTIPAAVAASPTGALTDQVVAVVASGSSAQVHLLNRRAAGSWDDEWAQSG
FT                   FVGAGGVGRAHEGSSVTPAGSWPLGPAFGTGADPGTLLPYTQLNAGSCWVSDPGDPDYN
FT                   SYAERDACDVPNLRMADFSEQYRYGLVIGQNAERAPGAGSASFVHVSNGAAGAASVALP
FT                   QSAMASLLHEVHPGAHIVIASSIEELATY"
FT   CDS_pept        complement(424804..424977)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03470"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55878"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF6"
FT                   /protein_id="CBL55878.1"
FT                   /translation="MTRETTAQVAMHTMGAASTVYVWAARGPKWARITTTACTLTVVAL
FT                   DAYLLGRWLRTR"
FT   CDS_pept        complement(425207..425452)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03480"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55879"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIF7"
FT                   /protein_id="CBL55879.1"
FT                   /translation="MERRGWIYYRKRKRTAGVALGPLFEALHPSHQYVATEQQRQSTVR
FT                   KDSEDGQDRSPREDQPTVGPDAQIARHTHRAEPPSA"
FT   CDS_pept        complement(425481..426788)
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24590"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55880"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:D7GG08"
FT                   /inference="similar to AA sequence:Uniprot:Q9LCS0_9MICC"
FT                   /protein_id="CBL55880.1"
FT                   /translation="MSHPTFTTPCLTTFCGLDELGLEAVGQRLDPDRAVIECRVVEPDR
FT                   WCRECGCEGAPRDTVIRRLAHEPFGHRPTTLLIRVRRYKCCGCGRVWRQDTTAAAPVRA
FT                   KISRGGLAWGLAGLVLDHLSVTRVAAGLGVSWSAANDAILAEGRRRLIDDPARFEGVTT
FT                   IGVDEHVWRHTRHGDTYVTVIIDLTPVRDKTGPARLLDMVAGRSKAVFKTWLAARPKPW
FT                   REGIEVVAMDGFTGFKTAAAEELPDAAPVMDPFHVIRLAGDALENCRRRVQHDVFGRRG
FT                   MKGDPLYQARRTLLTGAGLLTDKQQARLDALFAEDRHVEVEATWGIYQDMITAYRDKDR
FT                   GLGRFFLAHTIDKISASVPEQLVEIRKLARTLTQRASDVLGYFDRPGTSNGPTEAINGR
FT                   LEHLRGTALGFRNLSHYIARSLLEAGGFRPALHPRS"
FT   CDS_pept        complement(426755..426829)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03490"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55881"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF53"
FT                   /protein_id="CBL55881.1"
FT                   /translation="MEVLTLAICRKTSTCHTLLSLHLA"
FT   CDS_pept        complement(426870..426956)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03500"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55882"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG0"
FT                   /protein_id="CBL55882.1"
FT                   /translation="MDVALGIAGTLMILLALDRLFTNEGVAG"
FT   CDS_pept        427126..427410
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24600"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55883"
FT                   /db_xref="GOA:D7GF23"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF23"
FT                   /inference="similar to AA sequence:Uniprot:Q1BDS3_MYCSS"
FT                   /protein_id="CBL55883.1"
FT                   /translation="MSNSRKRHTPEQVVRKLGQADRMLADGSDIAAVCRELGISEQTYY
FT                   RWRNQYGGLKADDAKRLRELEKQNATLKRLLAEAELEKAALKELAEGNF"
FT   CDS_pept        427473..428276
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24610"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55884"
FT                   /db_xref="GOA:D7GF22"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF22"
FT                   /inference="similar to AA sequence:Uniprot:Q26XT5_MYCFV"
FT                   /protein_id="CBL55884.1"
FT                   /translation="MACRLAGLSRSAYRRPLKGDTVADPDRALRDWLRAWAKKHPRYGY
FT                   RRAYHDARGEGWAVNHKKIQRLWRAEGLRVPQRRRRKRVGSSTVDAPAAVAPNLVWAVD
FT                   FQFDADERGCPIKICSIVDEHTRECIGGLVERSITADRLTAHLEELVAVRGAPGVLRSD
FT                   NGPEFISDAMADWAGTRTGLFYIPPGSPWHNGYVESFNSRLRDECLNINSFYSLLHAQV
FT                   VIGDWKTEYNHQRRHSSLGYLPPAEYARQCTHQIETDDSQSDRTE"
FT   CDS_pept        complement(428440..428616)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03510"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55885"
FT                   /db_xref="GOA:D7GIG3"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG3"
FT                   /protein_id="CBL55885.1"
FT                   /translation="MDKMRVLTLLTMAFATFTMWLPNGYWWARALVTTSLVVSVIIDII
FT                   HVQRLRKERRESS"
FT   CDS_pept        429006..429428
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03520"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55886"
FT                   /db_xref="GOA:D7GIG4"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG4"
FT                   /protein_id="CBL55886.1"
FT                   /translation="MMGTIVSFLVVGGLILWVLVDIHQNAKEERAKKARIQAREDKLEA
FT                   RADAEYEYQQALRLAELRLLEQQRINEALASPDDLDAILAQLERDAALDQAMGTEAMLN
FT                   DGVAPASRSASPQRRREAASLRCAKCGQARCSHVWR"
FT   CDS_pept        429343..429615
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03530"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55887"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG5"
FT                   /protein_id="CBL55887.1"
FT                   /translation="MRLPSAGAKQRHCDARSVARHGARMCGDESVPGSSKDVGQGQPRG
FT                   KEERDVLDVNDLDDAITRRVEPYLSSLSRTIMRAAHDDDDPDFLV"
FT   CDS_pept        429616..429738
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03540"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55888"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG6"
FT                   /protein_id="CBL55888.1"
FT                   /translation="MALQYALIDEVVIPKDILDAIEIDLTDPGFTPGMLPESRK"
FT   CDS_pept        429796..430095
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03550"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55889"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG7"
FT                   /protein_id="CBL55889.1"
FT                   /translation="MKMLDVDGIADALRRDLLPLLSEAGRFILWSPLEAGDPEFAIYLG
FT                   LQFALLDEVRIPEPLLEAIGVALDDPAFDPDLRPEATAWCAQLRSGDAADRNLP"
FT   CDS_pept        complement(430096..433260)
FT                   /transl_table=11
FT                   /gene="pf1861"
FT                   /locus_tag="PFREUD_03560"
FT                   /product="Putative carboxylic ester hydrolase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55890"
FT                   /db_xref="GOA:D7GIG8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG8"
FT                   /protein_id="CBL55890.1"
FT                   /translation="MADDPNNDMAPGLYETPLTEELRARVERTGLEATSKPIPAERRDA
FT                   ALSGSVQRTLREHLNALPEAPRKAVYTTNEILRQIAGPSAQLVTDSRGDPMELQSLTDG
FT                   RPRYATRPLTPLNESTLITNARRDESLAQALNLELATADRVDLLCAFVKWSGIQSIMDT
FT                   LAMLHEQGVPVRLLTTTYMGATDATAIHRLADELGFQVKVNYNTGTTRLHAKSWMIYRN
FT                   SGFHTAFIGSSNLSHAAMVDGLEWNVRVSAVNEPALFSKLGTAFDTYWDDPKFEPYLPG
FT                   RDDERLTTSLKQAVAQPGRHFDAAFLDIQPQPHQRIMLDDLAHERQQDFHRNLVVAATG
FT                   TGKTVLAALDYLRLCGDKPGSLSLLFVAHRKEILEQARSTYAHVLNDANFGELLVGGEH
FT                   PTEHRHVFASVQSLSRMNLDALDPTAFDVMVIDEFHHAEAATYRRILDHFQPRELLGLT
FT                   ATPERADGVNVASFFGDRIASELRLWDALDGDLLAPFHYFVQWDDTDLRGVKASGGEYQ
FT                   AGELSRLYTDNDGRSRLVLAAMRHRILDPTRMKALAFCVSVEHAHYMADVLSQAGVPSV
FT                   ALSGQSSREIREAAIRDLREGRLACLCTVDLFNEGIDIPSIDTVIMLRPTQSATIFLQQ
FT                   LGRGLRRAPGKSVLTVLDFVGHQREDFSFEPRLRALTGQGRKQLVDSVEKGFSELPAGC
FT                   EIQFDKMSQKEVLKNVKRQLATTTLRLVNEFADYARRSASPTEYSLRRFLAESGLTLGS
FT                   IFGRSKFRGEPVEMTFIRHRAGLAATIDVSPTGTYLRGRVRNFAHVDDPARAQAYVALS
FT                   SPQGPQWDDLGPMQRIAAEMLFYSVWPKGRDQDDQLIGSIRDGLDVLRAHGWFSDELRE
FT                   VMESSVDASRAVFERPGGNLAGTPLVVHGTYRREELLAAIGVGRADGDARMPGDVREGV
FT                   VWVESTGIGALSVQLEKDSDSFTDTTMYADYAINDTLFHWQSQSATTPGSSSGRRLLGE
FT                   HAQSFDLALFVRQRGNDDLGKGAPYTFLGLVDLVSYSGSKPISITWRLRRPMPQGLYLA
FT                   ARAAAT"
FT   CDS_pept        complement(433496..434812)
FT                   /transl_table=11
FT                   /gene="PPA1043"
FT                   /locus_tag="PFREUD_03570"
FT                   /product="Anaerobic C4-dicarboxylate transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55891"
FT                   /db_xref="GOA:D7GIG9"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIG9"
FT                   /protein_id="CBL55891.1"
FT                   /translation="MIWVHLLILLIFVFLGSRLGGVGIGLAGGAGVLVLVATGLHTDAA
FT                   KDVPWSVIGIIIPVICTIAALQVAGGMDYLVHLTEVLLRRHPKQITYLAPFVTFMLSLL
FT                   CGTGHTAYSVIPVIVDVAKEHDVRPSRPLSIAVVASQVAVASSPISAATVAMTTVVEPM
FT                   GIGYLQVLAVTIPTTFIGCAVGAIVASRQGKELKDDPIYQEREAKGLVSHSAAAAAPDF
FT                   KPAPSAIPSLLIFLASLVVIVVWATISSKQLGIMSNPPINSSSAIMVIMMTTAAIICVL
FT                   SRKPVSEVTTQSTFRAGMTAAICIMGVAWLGTTFFNNYMSQITTVGSSLLHQVPWLYAV
FT                   ILYFCAPLLFSHAATTAAFMPVAAKIGLTATTMLACYPAVANYYLLPNYPTTVAAIEMD
FT                   DTGSTRVGRFVLNHPFVIPGTVSIAVAVALGFFWAPIVA"
FT   CDS_pept        complement(435209..435484)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03580"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55892"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH0"
FT                   /protein_id="CBL55892.1"
FT                   /translation="MDQPRVPLTTSYEMLEVLTTKFGALLDGYEAQGVRAFEEAGEPYD
FT                   ALGLLLSDLHFKGVKIPKEYADKIWSITDPEDVEDFAMYLGPRPKA"
FT   CDS_pept        435942..436691
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03590"
FT                   /product="Hypothetical secreted protein"
FT                   /function="5.1 Protein of unknown function similar to other
FT                   proteins from the same organism"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55893"
FT                   /db_xref="InterPro:IPR011089"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH1"
FT                   /protein_id="CBL55893.1"
FT                   /translation="MAHHRSAGWLALAAFVAASVLVGCDPPATTGSPSTSASSSVATST
FT                   PTPSITQTSAAGEAVATGDAEAVRQLLNTLPVKGRAPKTGYERSEFGTAWKDVDHNGCD
FT                   TRNDILARDLTDKVYKPGTHDCVVASGVLHDPYTGTTIHFTRGQNTSTAVQIDHIVALS
FT                   DAWQKGAQQLSGDLRTQLANDPLDLLAVDGPTNQQKSDGDAATWLPPNKAFRCTYVTHQ
FT                   VQVKAKYSLWVTQAEKAAITNQLGTCS"
FT   CDS_pept        436781..437023
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03600"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55894"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH2"
FT                   /protein_id="CBL55894.1"
FT                   /translation="MMSTTPDTEPTTTGRAHEKITSTELVPIAPAVKHRLSATPPATRT
FT                   SPSRGHLEALREQLAQGDLSIDDAARLTREYIDNI"
FT   CDS_pept        437135..438190
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03610"
FT                   /product="Zinc-containing alcohol dehydrogenase"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /EC_number="1.6.5.5"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55895"
FT                   /db_xref="GOA:D7GIH3"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH3"
FT                   /protein_id="CBL55895.1"
FT                   /translation="MARTMHAVVTRDGGPLDGPNSLVDATVDAPAAPEGHDLLVEVHAT
FT                   SVNPVDTKVRSGGKPSDGKVLGWDAAGVVQAVGPEVTLFAPGDEVFYAGDLTRAGSDAE
FT                   LQLVDERIVGHKPHTLDFAAAAALPLTSLTAYEALFDKLRLTADSSGTLLVLGSSGGVG
FT                   SVLIQLAKQLTHVTVIAAASREDSTQWAVDLGADHVLNYHDDDFADQIVELAPGGVDDV
FT                   FSAHSRGQIPFFIKVLRPFGQIVAIDDEPELDYYALKNKALTWHWEFMFARSMFHAPDL
FT                   IRQHEILERIAELVDTGRVRTTLTRALQPFDATQLREAHRVVESGHALGKIVVARPQLT
FT                   RASRPSPGRLP"
FT   CDS_pept        438209..439435
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03620"
FT                   /product="CarB, Carbamoylphosphate synthase large subunit"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /note="Carbamoyl-phosphate synthase catalyses the
FT                   ATP-dependent synthesis of carbamyl-phosphate from
FT                   glutamine or ammonia and bicarbonate. Initiates both the
FT                   urea cycle and the biosynthesis of arginine and/or
FT                   pyrimidines. heterodimer of a small and large chain. The
FT                   small chain promotes the hydrolysis of glutamine to
FT                   ammonia, which is used by the large chain to synthesise
FT                   carbamoyl phosphate."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55896"
FT                   /db_xref="GOA:D7GIH4"
FT                   /db_xref="InterPro:IPR003806"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH4"
FT                   /protein_id="CBL55896.1"
FT                   /translation="MHGERVLLSEGSSLTARETLTVLGRRGVQVEIVSASSAPIARFSR
FT                   WCRRLHHAPAPATDPIGYLAGVDALMSTGRFTALIPTHEQAWLFAAGRRLLPHARVAVA
FT                   DIGAFGQLESKVRFARLLDHLALPQPAWAEVQQESDLDRLGFPVWVKAAFSTAGRGVRH
FT                   VHNHREAVSAWHALRSPDNPVMVQQSAPGRYRQVQAIFDHGRLVAAAVSEQLATGVGGS
FT                   AAARLSVGDPVAVDAIRRVGEHLDWHGGIDLDFFSSQGQPQFIECNPRTVEPGNAAAAG
FT                   VNLPQLLVDLATGAPLPHQPVIARAGVRTRSTMAIGLGAAESPGTRRAIGGALLRAVAR
FT                   RGPLRGSVEVLTPVLHDPPSIIPLLVTVPRVLANPRAVEHLAGRSVGAYAVGASAVAVA
FT                   SAAAAGQSG"
FT   CDS_pept        439606..440121
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03630"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55897"
FT                   /db_xref="GOA:D7GIH5"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH5"
FT                   /protein_id="CBL55897.1"
FT                   /translation="MSDTPRPSHDPRPKVTLRTVLIAIGVVLVVLIAGAIVVTTRNAST
FT                   PDTNPSPVAPAAVSTMSSGAVASRAAMMEEEKPDSEHVVEFRATTNRPGFVVYRVTDGE
FT                   GTRADMTQSWSHEERVKNLDGVFLKVKSLSGGDADAEVSCQILVDGQVWGSDSGSGRGA
FT                   FSKCLLRG"
FT   CDS_pept        complement(440156..440662)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03640"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55898"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH6"
FT                   /protein_id="CBL55898.1"
FT                   /translation="MIENPGQTNNQPQSDDTERPEVRLVPVQLEINGSYALQLEDDKKF
FT                   HPVAQDIVGLCELLVRRSEDLGAPLLPSIDQSDSANEVALANAAPFPIISDRYGTLEVP
FT                   VDMAGFLKSMDESTPYTGELLGTDLMHIGQMMKELSIKTGIQWVPMPVGKAENGELGTM
FT                   TPDQQ"
FT   repeat_region   441264..443653
FT                   /rpt_family="CRISPR"
FT                   /rpt_type=DIRECT
FT                   /note="repeat region CRISPR_1"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441264..441299
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_1"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441300..441337
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441338..441373
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_2"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441374..441409
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441410..441445
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_3"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441446..441483
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441484..441519
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_4"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   CDS_pept        441518..441631
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03650"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55899"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH7"
FT                   /protein_id="CBL55899.1"
FT                   /translation="MVRLLRRWEALAAHASMKGPSRRRGNSTTVVFMGMLL"
FT   misc_feature    441520..441559
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441560..441595
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_5"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441596..441631
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   CDS_pept        441628..441822
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03660"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55900"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH8"
FT                   /protein_id="CBL55900.1"
FT                   /translation="MSLNEGPLQKEGQFKTEPDHMRTVAASMKGPSRRRGNLSSKFSSH
FT                   RRKPSLNEGPLQKEGQSYY"
FT   repeat_region   441632..441667
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_6"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441668..441702
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441703..441738
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_7"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441739..441775
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441776..441811
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_8"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441812..441846
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441847..441882
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_9"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441883..441918
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441919..441954
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_10"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    441955..441989
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   441990..442025
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_11"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442026..442063
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442064..442099
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_12"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442100..442135
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442136..442171
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_13"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442172..442207
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442208..442243
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_14"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442244..442278
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442279..442314
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_15"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442315..442350
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442351..442386
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_16"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442387..442425
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442426..442461
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_17"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442462..442497
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442498..442533
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_18"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442534..442568
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442569..442604
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_19"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442605..442640
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442641..442676
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_20"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442677..442712
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442713..442748
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_21"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442749..442783
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442784..442819
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_22"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442820..442855
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442856..442891
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_23"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442892..442927
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   442928..442963
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_24"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    442964..443000
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443001..443036
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_25"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443037..443072
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443073..443108
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_26"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   CDS_pept        443107..443229
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03670"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55901"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIH9"
FT                   /protein_id="CBL55901.1"
FT                   /translation="MWVFWWSWVSGSGRLNEGPLQKEGQSQRQMLVSEVLTRPQ"
FT   misc_feature    443109..443146
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443147..443182
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_27"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443183..443219
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443220..443255
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_28"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443256..443291
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443292..443327
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_29"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443328..443362
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443363..443398
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_30"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443399..443435
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443436..443471
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_31"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443472..443510
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443511..443546
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_32"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443547..443581
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   repeat_region   443582..443617
FT                   /rpt_unit_seq="GCCTCAATGAAGGGCCCCTCCAGAAGGAGGGGCAAT"
FT                   /note="Direct Repeat CRISPR_1_DR_33"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   misc_feature    443618..443653
FT                   /note="CRISPR spacer"
FT                   /inference="ab initio prediction:CRISPRfinder"
FT   CDS_pept        complement(443868..444170)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03680"
FT                   /product="Hypothetical protein"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55902"
FT                   /db_xref="GOA:D7GII0"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII0"
FT                   /protein_id="CBL55902.1"
FT                   /translation="MSRRDSHCFLIAYDVPDDRRRTRLATVLKGYGERVQYSVFMVDCP
FT                   PSHLLVLRHDLTDAMDIDEDSVVICDLGMSTSADAQRITWLGGQRYQSGGRSIII"
FT   CDS_pept        complement(444167..445768)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03690"
FT                   /product="CRISPR-associated protein Cas1/Cas4"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55903"
FT                   /db_xref="GOA:D7GII1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII1"
FT                   /inference="similar to AA sequence:Uniprot:Q467D6_METBF"
FT                   /protein_id="CBL55903.1"
FT                   /translation="MSGDDKLPISLVAHTVFCPRRAWLEAQGEQADSYAMTAGTLAHRR
FT                   VDQPAESRPEVRRAVSVHSESLGITGRCDVVEVSSDGLSVVEYKSTPVRRKAEITPAQA
FT                   VQVGLQSMCLEEMGHHVTSGVVHFVNHHKDVPVPLGAEAREACRDWVTETRKVVEADSA
FT                   PPPLLDDSRCNGCSHATICLPDEQVHNGGELKRRISVADPHGEILHAVTPGARLSMRDR
FT                   QIRITRQGEQLAAVPLERVQGLVLHGNVDVSGALIREILWRRLTIVWCSGRGRVVGWAT
FT                   GAAAPNGQARMHQQALSEVGCLPVARAIVRAKLINQATLLRRNAAAATAPQEIRELSRV
FT                   AMRVESLPELFAVEGRAAKAYFSEFPLILKSDSAQDFLDEWPGRHGRGAIDPLNAALNY
FT                   AYGMLLADCVRAIAACGLDPHGGFLHSPSRNKPALALDLMEEFRAPVADSAVITCINNQ
FT                   TLTADMFSHTLGDVRLTRAGIAALTSAYERRVTTDIKHPTFGYPATWRRTMEIQARLLL
FT                   GFIDGTRSEYIGMTVR"
FT   CDS_pept        complement(445758..446759)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03700"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55904"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII2"
FT                   /protein_id="CBL55904.1"
FT                   /translation="MKFEITGTLDTAITHLALVGLANILQEAGAHRVRLWWQDGAVARP
FT                   TLQWEGPDAGEAVLAHARRHADPACWLQARRPAPEDGHALFSPRLKPPTDDEGWFELEE
FT                   LREHFLDAGLTRLDQRMIVNLGEPGYWVRQDGQPRPDHAASRWEMKTRNRGEEFIGQRL
FT                   APLAREVSTWTAGKVLDGLGGRAVNDVVGKNKPDSRTPTGLSSPGPTDNALAWCSLWGI
FT                   SAFTLVPKSIGVSATAGAVPPARSYPRLLVVPVVADPISPVLWTALARSRELLSAFSDD
FT                   PVRSVDARQLLVRRGVIGACSFPLDKSDNDSAPERTLLRGTLHSFQEDADVW"
FT   CDS_pept        complement(446756..449371)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03710"
FT                   /product="CRISPR-associated HD domain protein"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55905"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR013444"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII3"
FT                   /protein_id="CBL55905.1"
FT                   /translation="MTITLDDFATFFRAVNAGHDPFPWQTALLTGIAGSARWPSAITAP
FT                   TGSGKSAVVEVHVFLNALYSAGSGPRVPRRLSTVVARRALVDSQADRAQRVADWLDEGD
FT                   SPLAREMSALLQRLSAADDTPPLVIGHLRGGISLRSTWIDDPSACAVISATPDMWGSRL
FT                   LLRGYGSSMAARPREGGLLGLDNAVVIDEAHLSRQLVGTARWVSQHNADVAERLGVPGL
FT                   QVVESSATTRSASPDGIGIGPDDLADPTLRPRLTLPKPVTVVESAAWSGKKATDQYIST
FT                   LVDQVQDMARTADDGTIGCIVNRVDTALRVAERLGDDCPCWVGPTRPLDLAQLKRSYPA
FT                   LLGLDTAPRQAMPRFLVATQTVEVGVDLDLSGLVTELAPADSLTQRFGRVNRRGLRDSG
FT                   PLTVVAPPQDKLAEQLPYSLDDLADALQWLGGLPDTEGASPQAVADHPPKARTPERAIV
FT                   KLPHVGDVMRWDATADLMWADEDLELWVRDSLEPDDAQVGIVVRQPLPDEDAEVIPLLA
FT                   ATPVDQAEVFPAGIAVARAVVDRILEGRGDHARAFLSRADEITPLGADDASAIRPGDVV
FT                   IVDAGHALTRHGVVVSDANRAESLETRWGTPDVAVIQKDSADSQWLSALADLTAEDAQT
FT                   EYSDLGGEGLLTLGPPNALGELPWIVVTSQKTAEEDEELRQEWSASDQPVLLTAHQSNV
FT                   AGRARRLGERVALDPELTAALELAGAHHDDGKADPRFQHLRLSNYSSLVLAKSEHRSSQ
FT                   AVVRRQFAGGELPRGWRHELRSVAVSWAEVSLAPHGPLVARLIGTSHGRGRILPQPDAA
FT                   SLATPSDPAEVNERVAALFGSGEWPELMAATSTTYGVWGCAYLEALLRAADCQVSKEGS
FT                   "
FT   CDS_pept        complement(449368..450909)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03720"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55906"
FT                   /db_xref="InterPro:IPR019089"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII4"
FT                   /protein_id="CBL55906.1"
FT                   /translation="MSPLTIRAVFPLGVFQGHRADGSPDRLPDTARLFSALVNAAGQGS
FT                   EAIAVKGRLEPSSESTAALSWLEKHPPTMIRIPNHVPVSPDRRPDAYRKTGTVQGPKKS
FT                   PAMRIGARQISTGTAIDDCVGWFWADAPSEVQETVGRLCADVSCLGEDDSPVILTLDQF
FT                   VPTHELVASTQQLRPTGLAVRTPGPGRLDELIRAHHEAFPPKMPSAAQDSPSFSEMPRG
FT                   SRVPTEGLRVLRYKSPTPPPADSPWPLAMLLPLSAHIALEDGLTWCVAMHRMLISRLGD
FT                   GAPAIVTGHYARGASQPANRVAVQYLPPTLLSHRAESGDFPHGAIALLLPASIAAEDRG
FT                   EIVRALNSPRLGLWSSAGRVTLGTPLRIDASQFWPTPQPGWRRQWRTLDGMVPETRRQP
FT                   RHELLGAWGFPQSALLSVGHVFREELALTRANTYWETVSVVTDRGVQILGTHLIPDSEV
FT                   SRYVHKVPRSIGVVQPYSAQLDLADLVNDRALLALGQARHLGGGLLVPMDSPEVS"
FT   CDS_pept        complement(450911..452110)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03730"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55907"
FT                   /db_xref="InterPro:IPR013403"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII5"
FT                   /protein_id="CBL55907.1"
FT                   /translation="MTDLTYSDLEAACHAGGASVLSSVTELAPAAGPQAGIAPARYVQG
FT                   RDGTYAYETRFIGGEPSSVVVVDSKASQLNRVEDAISLAIEEGDASLSRMPSIRVDYET
FT                   LSATDYQLPHRFSDGHIRFGTIDGEVTTKYPAYVAARNASPANARALLELSPVSLAFGA
FT                   WDSTRKAHQARFRSCLVGEIIGQLADQTEAGRKPPRRGSARKDDIAPSVQLNEKDMLTL
FT                   LATQEDEMSPTTVDKITKDAKKAKNKPTSASVLGLGAIPPSLDGLGFVSCRRIIRSHVL
FT                   SFSALRQLRFGADNAGNVACRALLAALSLHGLALSDQELELRANCDLVEAGDPVVTLDG
FT                   RRGTHTELEPLVPEVTGPILATAIERAVATAGIRWDGQVLEVTGNPIILAGATADADED
FT                   "
FT   tRNA            complement(452454..452541)
FT                   /locus_tag="PFREUD_03740"
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:452505..452507,aa:Ser)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        452643..453917
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03750"
FT                   /product="Threonine dehydratase"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55908"
FT                   /db_xref="GOA:D7GII6"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR011820"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII6"
FT                   /protein_id="CBL55908.1"
FT                   /translation="MTTTEVSTLAHLVDQAAEGLAGVARVTPLQYNERISSTSGCRVWL
FT                   KREDLQPVRSYKLRGAYTFISKLSDDEKRAGVICASAGNHGQGVAWACARLGITGTVHV
FT                   PSTTPRQKRDRIRFFGGDHVRLVVGGDTYDDAARAAQVEADRTGATMVPAFDDPLIASG
FT                   QGTVARELVEQLGHAPDVLVVPVGGGGLLSGCGAWMRENHPETRIIAVEPAGAAGLAAA
FT                   MDAGRPVRLDHIDSFVDGAAVARVGDFTFKIARQLAPDLIAIPEGQVCTEMLSMYQVDG
FT                   IIAEPAGALAASALSVHPMDTTLGIDPSQEIAIIVSGGNNDVSRYAEVVERSGVHEGRR
FT                   RYFLVNFPQEPGALRRFLNEVLGPDDDIIVFDYTKHSNRDTGPALVGIELGDPTNFAEL
FT                   WTRMEESPLNVEVLEPDTAIYRMLV"
FT   CDS_pept        454391..454678
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03760"
FT                   /product="Hemerythrin HHE cation binding region"
FT                   /function="4.2 Detoxification"
FT                   /note="hemerythrin is an oligomeric protein responsible for
FT                   oxygen (O2) transportation. hemerythrin was discovered in
FT                   methanotrophic bacterium Methylococcus capsulatus."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55909"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII7"
FT                   /protein_id="CBL55909.1"
FT                   /translation="MTDLPITQTHHCTCAEGDTNTPELDARAIPHAIRHAAILGALQGL
FT                   GHNESMILVAPHNPLPLLDQIDSMWRDVFSLEYVQEGPDAWKIRFTRVAA"
FT   CDS_pept        454684..455694
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03770"
FT                   /product="transcriptional regulator ArsR"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55910"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII8"
FT                   /protein_id="CBL55910.1"
FT                   /translation="MDGQTGPVRRAADLGVGATDGAHPSDRGAPLDPQCQRLMDALLTT
FT                   PGPMTVAQLGADAEMRPNTVRFHLAHLGDAGLVSGVSARTTTRGRPGVLYRATARAFDS
FT                   GPQHPRLLTEVLMHHFLAEAATPPPSVEGPQRPTTVWERARRAGRAWSSHVETLPGGSP
FT                   AHGGAGPEHVTDGTAQFDALLTQLGNWGLAPNRIRDPGVPDGSAVPDESAAASTHSPVG
FT                   STIGPGPVSPDPAAAQRDHLPDRVRIGLNRCPFAHEASECPDLVCGVHAGIIDGLLAQL
FT                   GGSWRVARLTPHASAGQCLLDAELTHPALQAPPCPAAAYPDSVHRAGRGGTTPRA"
FT   CDS_pept        455769..457046
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03780"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55911"
FT                   /db_xref="GOA:D7GII9"
FT                   /db_xref="UniProtKB/TrEMBL:D7GII9"
FT                   /protein_id="CBL55911.1"
FT                   /translation="MSQPVAVPEQGSADPPLKPASQTRRVIVLLVPCGVAMVMGLDAAL
FT                   VLLGLPAPLSGERFSSAHGIIMTIGFLEALVSLESAVSLRRLWAYCAPAALAVGALLVL
FT                   TPLPLQAGQLLMLVGCALLIVNYSVLWTRKHEPMVAVQVGGALAALGAVLLWTGGVSIP
FT                   DLFAWLVTFLVLTIAAERVVISRFSPSVLTPAGARRYQRGIVVISALIVFACPLTTIWS
FT                   GRVLPVFGLALIALTVMAAWGDGARSDLRVRARATVAGSDAASDADTASGSAITPSQRF
FT                   TGVMVFISYMWLIVTGLLLVHPTLSGLHYDALLHAVFLGFVMTMVVAHVPTYLPFLLEI
FT                   RFRFNPGFWGVAVLLNVGLVVRIVADLAGSETGRTLGGLANIAALLSLVAVAVWAAVVK
FT                   GPEDPQAPAGDTRAISDTSPTKDSRA"
FT   CDS_pept        457043..459679
FT                   /transl_table=11
FT                   /gene="aniA"
FT                   /locus_tag="PFREUD_03790"
FT                   /product="Copper-containing nitrite reductase precursor
FT                   (Major outer membrane protein Pan 1)"
FT                   /function="2.8 Metabolism of nitrogen/nitrate and nitrite"
FT                   /EC_number="1.7.2.1"
FT                   /note="transmembrane and signal peptide (TM HMM and Signal
FT                   P)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55912"
FT                   /db_xref="GOA:D7GIJ0"
FT                   /db_xref="InterPro:IPR001287"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011707"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ0"
FT                   /protein_id="CBL55912.1"
FT                   /translation="MNIESPTTRRRPHGLASRRVWFTAVTVPVCLWALVALAALIGQRW
FT                   RADLGWIGLHAAALGVATNAIVTWSDYFVDALMRGAASSKARQIGVLAGLNVGTLALIG
FT                   GIEAALNPLVTAGAALIVVAIVVHCASLWRRSRGALTTRLGSTVVGYYIACAGWFVAAG
FT                   VFGFLMTTAGGGHLNRYLLAHIASAVLGWLGLAVIGTLVTLWPTILRTRMVPGAQTDAR
FT                   RALPLLNIALAVVVIGGVIGRGWLSALGLLGYLACLGFTLAAMMRAARVKPPRSFAARS
FT                   VIAGMAWLVGTLVVATVIAAMGPDTATIMNRLTALAWPLLAGFAAQLIAGSMAYLLPVV
FT                   IGGGPAMVRRRNRVMDMASNTRLVAANGAGLGFLLPLPTAGRVAMIAVAAACVAAFLTL
FT                   VVATAVIRRPLRMADVPPARTHGFEAMLGVGVLVIALAIATAISPATMVGKGTANGAGS
FT                   FGAVGNGQSQHVSVEAHDMKFTPNAIDVPAGTHLFIDVKNTDTGGMVHDLVLASGATSG
FT                   RLSPGASGTLDAGVISASTDAWCSIAGHKQMGMTMKINASGAAPAGGAAAASSPSATHA
FT                   TPDPNAQMTADPWDAALQPAGPETEHRITLDVTEKEVEVAPGVRQLRWVYNGQAPGPVL
FT                   RGHVGDKFAVTLINHGTMGHSIDFHAGALAPDGPMRTIQPGEQLTYDFTATKSGVWMYH
FT                   CATAPMSLHIANGMFGAVIIDPPGLTQVDKEYLIIQSDHWYGAQGEGNDAARIGDGNPD
FT                   AVVFNGYANQYDAHPLPATVGNRIRFWVLDIGPNEPISFHMVGGQFDTVWAEGAFRLEC
FT                   GYQPAAGVDPACGTLGPGGSQTLSLGPAECGYVEMVAPEAGHYKFINHVMSDAEKGAHG
FT                   TLEVSAG"
FT   CDS_pept        459833..461212
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03800"
FT                   /product="Hypothetical outer membrane protein"
FT                   /function="1.1 Cell wall"
FT                   /note="signal peptide (SignalP), transmembranaire C term
FT                   (TM HMM) (carboxypeptidase ?)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55913"
FT                   /db_xref="GOA:D7GIJ1"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR041033"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ1"
FT                   /protein_id="CBL55913.1"
FT                   /translation="MKITRALAATATLTALLVGTGVAGAAADVTWESSPGPHTFSVDVT
FT                   PVSYMVDSSGDAALRVEHIVDENGRALLCAQFDRPSPSGTQLRPLGRATPQLAYLANQL
FT                   EHPELNPDLAGLDAMQQYYVLQFVAHMYDSPHFADFTDVQDGQRVADPHGLIPRITAVK
FT                   ARADAASNGDFFEGHKISVSEPVPASALDPEGFWLSDPVTVSVQTGNAQVTVKPTWNEA
FT                   ATAAGTTLVDAATGAPLEAVADGAQVRLKTSADKLAGKAGRVGVTLDARFYGGTAKIGY
FT                   LYGGDEQVQQIVGYDEITYNEHLSTDISTAYTPVLGSLSGTKEGSAGERLAGVEFTVKD
FT                   AGGTALTTVATASDGTFTVPDVPWGTWFLHETKTPEGYLPLSQPVEVTIDGAHRRIDLP
FT                   TITNDKAPVAKGLSTINTGRPPSDNVLDPALVIAAGVLLGGGVGGGAWCVGSRVTQAMG
FT                   H"
FT   CDS_pept        461308..462024
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03810"
FT                   /product="Peptidase C60, sortase A and B precursor"
FT                   /function="1.6 Protein secretion"
FT                   /note="Sortase, Sortase domain; transpeptidase of
FT                   Gram-positive bacteria, cleaves surface proteins at the
FT                   LPXTG motif and catalyzes the formation of an amide bond"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55914"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ2"
FT                   /protein_id="CBL55914.1"
FT                   /translation="MRMPTGPHLRAARRWRWGRLWVVLVTVALVAAAVILFQHRAPQVA
FT                   AEPAPGIATNGSVVATGEPRTESAPLPPAPFVAARPTPEAAVALEVAADRLVIPSLGVD
FT                   APLLAAPLGEDGSLAVPDDPQQVGVSTIAAPVASSAGTTLLAGHVNMQRVPGALWRLSQ
FT                   ILPGARIITTDHGGVRQEWIVDGLTVHPKQGLPDGLTNTTGRRRLAVVTCGGEVHDGQY
FT                   EKNVIAWARSAPTPGT"
FT   CDS_pept        462094..465498
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03820"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55915"
FT                   /db_xref="GOA:D7GIJ3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ3"
FT                   /protein_id="CBL55915.1"
FT                   /translation="MDGDLDPGGREAPEDDFFEQDGPALFDDAASTESSSADSTKGTMA
FT                   NSTDTGSVDAPRDEPLASGEIPTPDAPVAATPDAPAPDNDPGAPLALYRRYRPDTFEQV
FT                   IGQDHVTLPLQRAIANNRVSHAYLFSGPRGCGKTTCARILARCLNCENGPTPTPCGHCT
FT                   SCRELATGGPGSIDVIEIDAASHGRVDDARELREGIFFAPVQSRFKIYIIDEAHMVTKE
FT                   GFNALLKVVEEPPPHVKFIFATTEPDKVIGTIRSRTHHYPFRLVPPKVLTDYLEKICVE
FT                   EHVQVEPGVLPLVVRAGAGSVRDSLSVLDQLLGSAGADGVSYQQATSLLGYTPDALLDE
FT                   MVDALAAGDGKGVFGTIDKVIEIGQDPRRFAEDLLQRLRDLVIVADVPDALSSGLIDVA
FT                   ADQAQRFEHQAALIGPGELTRAAEVIASGLTHMRGTTAPRLHLELMCARILLPGADVDG
FT                   RGTHARLDRLERRVGMPGVAEEPAVEQPAPPQWDDQANVSRGPHADVQPAADYQQGART
FT                   RQRSVRDGGPGLSGVGLTGPGYADGANQAQMGNVPGAAAGMGVGAPAGGSHAATARQRP
FT                   ATDQTAAPASGAARQQRPAAGPAPDGQATPPGNASRGHAGPTDTGPTSAGPGIAASDQA
FT                   ASDHPAPTDNLGDSPNAGTSHATAADGAATGVNTNADNAPGADNAGPAGPAPQATGAQA
FT                   PSSGDSFPAQAPSSAAGRLNTAEVRRLWPEVLTAVKGRRRFTWILLSQNAQVLQADVDG
FT                   LSLAFNSAGARDSFQNGGSNDVLREALIDVLGADLPIHCVVEGTAAMNEARGGEPARQR
FT                   PAPTQQQAPTQHPTSTQHQAPAQQQAPTQHEAPAGHSAPQDQAAPQRQPGAGQRPAPGQ
FT                   AEPDQSGTGPSEPAQPASDKREGGHQGPPAEGGERAGGSSQQHQSQQHRDDADQHLADP
FT                   PEVPRQRAAQAGSPGDDGSHRATGVPDDAAPARRNGRRRHVIPDLGEVASSMPTEQRDP
FT                   GWDPWATPQGDAGQPDPHGTGSFGTGPSGTGSPNAGPNGAGSAGAGPNGSGTRSSTTDG
FT                   TSTDGPQAAGHAGPRNNAAAPGASGRAPEPHHEIRWEVPPPDDEPPYDPDADVSMSDPN
FT                   VDETGKSAAELIISELDAEVIEEIEHG"
FT   CDS_pept        465749..466057
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03830"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55916"
FT                   /db_xref="GOA:D7GIJ4"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ4"
FT                   /protein_id="CBL55916.1"
FT                   /translation="MFPEGMDMNALLEQAQQMQVQLQQARDDLQDASFSGTSGGGLVEA
FT                   TVTGGGVLTGLVIKPEAIDPDDAEGLADLVVAAVRDATSKAAQEAEKVMPDLGSLGL"
FT   CDS_pept        466059..466685
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="PFREUD_03840"
FT                   /product="Recombination protein recR"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /note="May play a role in DNA repair. It seems to be
FT                   involved in an recBC-independent recombinational process of
FT                   DNA repair. It may act with recF and recO"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55917"
FT                   /db_xref="GOA:D7GIJ5"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ5"
FT                   /protein_id="CBL55917.1"
FT                   /translation="MYDGPIQDLIDELGRLPGVGPKSAQRIAFWLLDQPQADVEQLANT
FT                   LRTVKEGTHLCSICFNVTDSDICRICRDPRRDHSSICVVEESKDVMAIERTREFRGLYH
FT                   VLGGSISPIDGRGPGDLRIAELVRRLQDPKVSEIILATDPNLEGDATATYISRLLGETP
FT                   GIRVSRLASGLPVGGDLEYADEVTLGRAFSGRRYVNDEEPADQSA"
FT   CDS_pept        complement(466711..467520)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03850"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55918"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ6"
FT                   /protein_id="CBL55918.1"
FT                   /translation="MQPWQPPPDAQDAWMAIEKSLLMLTGSQVPQPRPGSELDRLDKEM
FT                   PDAAVVGLTNSLQQAVRTAQECARSMGDALFGEQPRGPGPAVLILARSLLLASGRVIYA
FT                   LGAEDDEVRLAHCLQVISQESGSLLQGMEEAHEFTQLHSLRPSDEFLAEVKSANKTVQK
FT                   LSRIRGERAMLREMAQAISEAAGPAGLPAEFAPTVREAALWVFHCYSGMAHGYAWSFEV
FT                   GAGDPSVDLWIVGTLGAFAVRLMTEMCRAPEELGPDDLGPDDVPLDA"
FT   CDS_pept        467799..471059
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="PFREUD_03860"
FT                   /product="Isoleucyl-tRNA synthetase (Isoleucine--tRNA
FT                   ligase)"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.5"
FT                   /note="ATP + L-Isoleucine + tRNA(Ile) <=> AMP +
FT                   Pyrophosphate + L-Isoleucyl-tRNA(Ile)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55919"
FT                   /db_xref="GOA:D7GIJ7"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ7"
FT                   /protein_id="CBL55919.1"
FT                   /translation="MTTSSERTPAKTEAPKNDGVNVEAADPTGFGHSYHAVPARIDLPA
FT                   VDHEIIALWEKNNTFTKSWEASEGGPRWNFYEGPPTANGQPGTHHIEARVFKDMFPRYK
FT                   TMQGFRVDRKAGWDCHGLPVELAVEKELGFDHKNEIEEYGIARFNEKCRESVTEHVDEF
FT                   AELTRRMGYWVNMDEAYWTMAPEYVDSEWWALQKIFNDGLLVQDFRVTPYCPHDETALS
FT                   DHEVSQGYREVTEPSIYVAFPLTSGPWAERGAKLAVWTTTPWTLISNTAVAVAPDVDYV
FT                   LASNGHEELVVAEPLFDAVLGEHDDEGKPVWHVVDKKQGAAMAGWDYERPFDFVPFDKR
FT                   ANYILTADYVTTDDGTGLVHEAPAFGADDMEVGRANGLPVINPIRADGTFEADLPLVGG
FT                   LFFKDADPKVIDDLAKRGILLRTVMYKHSYPHCWRCGTPLIYYAQPSWYIRTTQRKQEL
FT                   LDQNENTIWHPESIKWGRYGDWLRNNIDWALSRTRYWGTPLPIWRNDQTDKLYCVGSRA
FT                   ELAKLAGNPDLADMDPHRPFVDDVTFQLDGEQGTYRRVPEVIDAWFDSGSMSFAQWGYP
FT                   WVEGSQEKFEQHFPADFICEAIDQTRGWFYTMMTVPTLVFGESAYKRVLCLGHILAEDG
FT                   RKMSKHLGNILLPIPLMDDHGADAVRWFMAAAGSPWSARRVGPTTLQEVVRKVMLTYWN
FT                   TVAFQSLYARANDWTPDGDAPQVAQRQVLDRWLASATQQLVVDVTDALENYDTQRYGAL
FT                   ISGFIDEMSNWYVRRSRRRFWDGDVGALWTLHETLEVLTRLMCPLAPFITEKVWQDMFR
FT                   PTLPGAAESVHMTTWPKADTALIDAQLDDAMETARRLVEVGRAARAEAKVKTRQPLSRA
FT                   LVSSAALAKLDSELVGEITSELNVEELDSFASAGDVVEYSAKANFRALGKRYGKQTPVV
FT                   AKAIASADAARLAEQLAAGDTTLAVDGVGDVELSGDDVFLTERPREGWSVADVQGDTIA
FT                   LDLTMTPELVSAGRAREMIRFVQESRKAAGLDVSDRIDLAWSSPDDELARAIETHADFI
FT                   AGEVLATSMHREATPEPGWRSDDEAQVSVRVVKAEQPL"
FT   CDS_pept        complement(471186..472172)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03870"
FT                   /product="oxidoreductase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55920"
FT                   /db_xref="GOA:D7GIJ8"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ8"
FT                   /protein_id="CBL55920.1"
FT                   /translation="MTVRWGIAGSGRIARIMATEFTAAQHAELVAVGSRSAERAGQFAA
FT                   EFGLPHAHGSYRELLDDPDVDAIYIGTPNAQHYALALAVIGANKAVLVEKSMTCQVQHT
FT                   RELARAARQEGVFAMEGMWTRFLPAIRAAHEAVATGRIGDITCVQGDLFAYRAFNATDR
FT                   LFAPGLGGGAMLDLGVYALHFAQDFLGEPIAVDCTGQLAETRVDASASMQLRYASGATA
FT                   QLSISLQAHGPGRMTIMGTDGFIEVEPRFHHPTSIVVHRDDDEPEHVTLPFPGRGYRLE
FT                   LSAVSEAIEAGLTEHPFVPLDDSIAVAGAMTHALEQLGYRPLDDEDF"
FT   CDS_pept        472341..473615
FT                   /transl_table=11
FT                   /gene="ask"
FT                   /locus_tag="PFREUD_03880"
FT                   /product="Aspartokinase (Aspartate kinase)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.7.2.4"
FT                   /note="ATP + L-Aspartate <=> ADP + 4-Phospho-L-aspartate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55921"
FT                   /db_xref="GOA:D7GIJ9"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIJ9"
FT                   /protein_id="CBL55921.1"
FT                   /translation="MSRIVQKYGGSSVADAESIKRVARKIARAKQRGDAVTVVISAMGD
FT                   TTDELMDLAYQVSPQPQTRELDMLLTTGERQSAALLAMALNDLGVKARSYTGSQAGVIT
FT                   TERHGDARIVTITPGRIEKSLAQGNVTIVAGFQGVSQDTKDVTTLGRGASDTTAIALAA
FT                   VLGAKYCEIYTDVDGVFTADPRIVPTAKRIPEITYEEMMEMAAAGTKVLHLRAVEYARR
FT                   EGIAVHVRSSFSDNPGTWVKGHADIAKGNQMEEAMITGIASDASEAKITVVGVPDEVGR
FT                   AARTFDVMAAAEINIDMIVQNVSAVSTGRTDISFTLPMSDGQRAVQALNAVKDEIGFEE
FT                   LLYDDQIGKVSVIGIGMRTHPGVTAAFFDALAANDINIDMISTSEIRISVIVEAPKLAT
FT                   AVQAAHTTFGLDTNGEAVVYAGTGR"
FT   CDS_pept        473702..475645
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="PFREUD_03890"
FT                   /product="Conserved membrane protein, MviN-like protein"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55922"
FT                   /db_xref="GOA:D7GIK0"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK0"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5V9_PROAC"
FT                   /protein_id="CBL55922.1"
FT                   /translation="MPEQGPELPQETSAADHSPGHGSSSHGGAIDRLSRRPERAVHSAE
FT                   DTGRIPAVGAPIRRPRADAPTSGRPAEPAQPVGRGTSNSDETSTEMTMTNMAAVDDEID
FT                   AADRKNLGRNSLLMASGTLVSRVLGMVNAMLLAKVVGQALAADAFRLANTLPNYILVLL
FT                   SGGILNAVLLPQITKAMKRPDGGKDFVDRLLTATLTLILVVAVLCTAGAGVLMRVTTQL
FT                   EGAGLHLGIAFAYICMPQVLFYALFAVLGNLLNARGSFGAFGWAPVVNNVVAIGGEIVF
FT                   LGLWGQQADPSVWSSQMVWTLAGSATLGIVAQTLVLLPVLKKIGFRYTPRFGLRGYGFG
FT                   QVGRFAALTFIALCIAQAGGIYIANVASGMMYRAPQGTTVAGYAAYQNAMTLFQMPYSL
FT                   IGFSILTALFPQLARAWQRRASAGLGDARDLVYRGLTLPAVGIIPVAFLLMALARPIVR
FT                   GIYWGISPAQASVTAPLLMLMAAALLPFTIVTFQQQFCFALERGFTNLWMQCLVTAVQV
FT                   GFGFAAQRLDPAHGVEIICLGMIAGNSVLAIVFVLYARREMEGIGLARMIWLYLRLAVA
FT                   SLLGATPAYLVGRVVVASQADSLISQFGAMALGAVVFITGFLIGVKLLAIDEFRAFLRP
FT                   ILRRLHLVRSAG"
FT   CDS_pept        475709..477772
FT                   /transl_table=11
FT                   /gene="lysX"
FT                   /locus_tag="PFREUD_03900"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.6"
FT                   /note="ATP + L-Lysine + tRNA(Lys) <=> AMP + Pyrophosphate +
FT                   L-Lysyl-tRNA"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55923"
FT                   /db_xref="GOA:D7GIK1"
FT                   /db_xref="InterPro:IPR024320"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK1"
FT                   /inference="similar to AA sequence:Uniprot:A0QHC4"
FT                   /protein_id="CBL55923.1"
FT                   /translation="MNKVSFLRRLGNWLTSPRVLALLIGVGGIINVVGVIAAPHGSRRM
FT                   RMVLDVFSPTVVGLASVATAIVGLVLIALSSGLKHRKRVAWWLAVAMVVMTVLLHVVKG
FT                   FDFEQSIAGLVVLALLVAGHRHFTGIPDPRSRRSIWTTVILAPLAGITLGTVLLTVTAR
FT                   TQARDTTLIDRIVETIVGMVGIPGPVVFIRPHWDDRWFFAMLMIGIFVITTILVALLRS
FT                   PNGPHSLHPDEENELRSILPMNPRIGSLDYFATRRDRGVMVGASRRAAISYRVVGGVSL
FT                   AGGDPLGEPGQWGEVVDAWIAEANRYGWLPAVLACGEEAGRLFADRGMEVLHLGDEAII
FT                   DVADFSLAGRVMKPVRNTVNHAKRDGVVVDCLRAKDLSALEVAEVRTRADEWRDGPVER
FT                   GFSMALGRFGDPADGECVLVRARVDGQIVGLLYMVPWGKDGLSLDLMRRSPQAPNGVVE
FT                   SMVTGLVDWGRDNHLAHISLNFAVLRDIFQRGEQLGADPVTKVAYNVLMFLSRFLQLDS
FT                   LYRSNVKYQPRWQPRYICYEPGSLIEVAVACLRAEAFLTLPSFGRRRRQSRKWTELEAT
FT                   EQHARREAGVRDGQDEDGTASKDTRAVGKDLPGVDAAEAVTKGSRTPVGSKDEPQGDPA
FT                   KAADGETGNGSGVGKAGDTAEGAKAAGKGDAAGRNPGASSSEDGSPSGSKAD"
FT   CDS_pept        complement(477769..478155)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03910"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55924"
FT                   /db_xref="GOA:D7GIK2"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK2"
FT                   /protein_id="CBL55924.1"
FT                   /translation="MRFVSTAAGAAAVILGGWIAVMRFIPEIGGVKRDDLNKWLAIDTA
FT                   EVATLAGLSVTAAWRPSYSHVWALAGTALVVGDAALDVSIAKPGPDRDRAIGMAALIEV
FT                   PSALALGSWTLHRVIKRRRAARAA"
FT   CDS_pept        complement(478309..479274)
FT                   /transl_table=11
FT                   /gene="frk"
FT                   /locus_tag="PFREUD_03920"
FT                   /product="fructokinase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="2.7.1.4"
FT                   /note="ATP + D-Fructose <=> ADP + D-Fructose 6-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55925"
FT                   /db_xref="GOA:D7GIK3"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK3"
FT                   /protein_id="CBL55925.1"
FT                   /translation="MAVVVCGEALIDLIPDNSRAGTTQSSYWQAHSAGGPLNTAVALSR
FT                   LGMPTRFLGRFGIDGFGAQLRSHLRANGVDDSLGVQTLAGSTSLSVVSVDSSGAARYVF
FT                   HLRGTANFGWKPEEFPQLDADDWLHTGSLVATVEPGRSALLDFVRTTPAHLSYDLNVRP
FT                   TVEPDPDAYLALIDPFIHVVSQRGGVVRASDEDLLWLAGGHGEIDDLARAAVELYGMDL
FT                   LVVTLGAHGALATGVGRETVRVPGFPAAVVDTVGAGDTFTAGFLQGWLRDADLTAALLR
FT                   GCAAASIVCTRVGADPPTAAEVDELLAAGPTRTDPPPDTA"
FT   CDS_pept        479517..480995
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03930"
FT                   /product="aminoacid permease"
FT                   /function="1.2.5 Transport/binding of amino-acids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55926"
FT                   /db_xref="GOA:D7GIK4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK4"
FT                   /protein_id="CBL55926.1"
FT                   /translation="MARSDQEVNTRMADRQTTRLQRTLSRFDIVFLIVSAVVGLEMLGS
FT                   VSAEGPQTFTWLVVLIVIFVIPYALIFAETGSAFTGEGGVYLWVRRAFGRPVAAVASAF
FT                   TWITQPVWVGGSMAFLNAEAARNHLVHFAEGSPADYAFKLCFIWITVLAAILSLAKAKW
FT                   IPTVGAILKLTFISFFVITAIIYGATNGIQQITLGSFSPTRAGFITLVPLLIFAFLGFE
FT                   GSSSASGEMKNAPHDVAVSVMRSSAMAGFFYLVPVFAIILVVPPSSIDGVSGLLNAVAT
FT                   VFSVYGPAAKPMMVLAVVMFTLANIGQGAAWMIMSDRMQAMAAADGSFFGGFFGRFSPR
FT                   LGTPIRVNLLSGTVSTVFMLAAMQLTGSSAALFDVVLGVAITTYLFSYLLIIPAAMRLR
FT                   LHEPDVVRPFRAGPNWFFVTMCVVTTALVAFGSWASIFPGTLERLFGLPYDFSQASGVS
FT                   YGAFEALTLGTLAFIIILSLVGYWRGRPVRQGLR"
FT   CDS_pept        complement(481091..482809)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03940"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55927"
FT                   /db_xref="GOA:D7GIK5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK5"
FT                   /protein_id="CBL55927.1"
FT                   /translation="MTTGMAKSSSWAPFRIRAYLVLWLAQLGANIGSWMQTVGAQWFLV
FT                   EVGASAVFITLVQTATTAPSLLFGLPAGVMADSYDRRHVLLTANLIAAGASTLLAVVSF
FT                   LHVLTPVGLLACTFLLGCGMALNAPTWQAVIPSLVPRKQIPAATALGSVTINAARALGP
FT                   AFAGFLVALAGTSAVFAVNAAAYVLSVVAVLTWKRPAKRVGRREPFLSALFSGMRYTKA
FT                   APHVNRIMLRTALFIVPASAIWALLPVEAHGRLHMGSGGYGVLLACLGVGALSGVFVLP
FT                   WLRRRISSNKIVVVASIAYGAGTVGAAVLPSWGVGVSLVVAGIAWMCNFTTFNSLLQLT
FT                   LAPWVRARGMAIYLLIVMAGQALGSPLWGTVATLWTAQISFLVAGGLLLVFVPISVRFW
FT                   PIRPRTGELDRSHDLITHNLSMANSVDPRTGPIEIQVSYRVHPDKAPAFVTAMDAVRLS
FT                   RMRTGANFWELTHRLEDPGLFFERYSVPSWGEYLLQETQRMTGHDRANLRAALRLTSDE
FT                   PRVRRELPADAPIAGVPRMPGDEDHPMGDLRPRDPDMTTAQNSGTQEAPAGDQTA"
FT   CDS_pept        483096..483500
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03950"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55928"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK6"
FT                   /protein_id="CBL55928.1"
FT                   /translation="MALSLVAAGCSSTGATASVPTRSVEELTKDMGNAVNSQANTKSVR
FT                   ITDSGDQKDPTSADATQTFVVEGTMDGSNMLFEQNFSTGYSVSMILVDDKVYTKANDKY
FT                   WQLNGDVDGATVAKYADKWVSDDPTPPPTT"
FT   CDS_pept        483461..483772
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03960"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55929"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK7"
FT                   /protein_id="CBL55929.1"
FT                   /translation="MGQRRPNTTADNVKNTAPVKVLTTVFTELQSDTFQKVDIVKRNGK
FT                   KVYQMTNDKGSEVDVDPATMYPIHIKLSNHPDTFEFEKWNNATTQVAPPADQTVVYSG"
FT   CDS_pept        483836..484600
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03970"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55930"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK8"
FT                   /protein_id="CBL55930.1"
FT                   /translation="MKYRPLVVLGSCALALGLVAGCSAKPAVSGAGSSASSASSSASPS
FT                   RSAGEVIDAMMKAMQQATSVRIAQVQGSGSSAQASGSAGASASAAAPVSVVSEGSLTGA
FT                   NYLSDLSLAGGSHVNVLVVDDQTYLQGNDAYWASAGSPEDLRRTLVGKWVSKQAMIDGS
FT                   TLNKLEPSTVIAEQVADIRGQGFKEVEQDTRDGRQVFRLRANGDAEVVIDAATMLPSHV
FT                   KVSSRSFPTDLSEWNAVPLKTAPPEDQIVKVS"
FT   CDS_pept        484649..485365
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03980"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55931"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIK9"
FT                   /protein_id="CBL55931.1"
FT                   /translation="MKLRPLVLVVGAALSVTLVAGCGGNSSGGASSSAPVAAAPTKAAS
FT                   MVAGEAVAAIKKATSGRIAVTQTGSASSSSGASVPTTTSVEGQFDDSNYQLANSYAGGA
FT                   SLNVLIVDQKGYVKGNVTYWTGVGLPNDDATALSQKWAQGNSTRPEAFAEYSPSKVRDQ
FT                   LVSDLDATTFTSSESITVNNKAAYRLQSATGTQLVIDAETMLPSAMKSQTKTYDMSQWN
FT                   SVSPKVAPPTSQVTTG"
FT   CDS_pept        complement(485889..487457)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_03990"
FT                   /product="transport protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55932"
FT                   /db_xref="GOA:D7GIL0"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL0"
FT                   /protein_id="CBL55932.1"
FT                   /translation="MINFLVSYPLVTIMGVLSLGALLGQIKFGPLRFGAAGALFVGLMV
FT                   GMLDPRLGDGMTLVKSLGVGLFCYTVGLAAGSTFLSDLKRQWTLMLAGVVGLLLMAGFG
FT                   VGVGRMVNLSSGHVAGLFAGVLTSPAIDAAQHATNNSPDTLVGYAVSYPTGVIVAMIIV
FT                   AMVATKRWPGKRDNTSMAEAGITAVSTLVTHDTRMSEIPGWPSRIRMSYLRRAGEMRLI
FT                   TAADYLHHGDIVLVVGMPDDVQGAVEFLGHPSEMRLTENRRDVDYRRFLVSNPHLAGRT
FT                   IGDINVRSNLDGIVTRVRRGDLEMLATDDLILQPGDRVLAVVPRGRMGDAQDFFGDSEN
FT                   RISQLDALTLGLGIALGLLAGAIRVPLPGGINFELGSAAGPLIVGMVLGALHRTGPFRW
FT                   DLPHATNSVLRQMGLMIFLACVGLATGPAFLSQAFSLIGLKILLVSAVALVLGALVVLL
FT                   GAKWLGLSAQRAAGGFAGFVGQPAVLGYANQLVNDERIDSAYGALFALGTVVKILLVQV
FT                   IPLLL"
FT   CDS_pept        487640..488971
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="PFREUD_04000"
FT                   /product="Phosphoribosylamine-glycine ligase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.4.13"
FT                   /note="ATP + 5-Phosphoribosylamine + Glycine <=> ADP +
FT                   Orthophosphate + 5prime-Phosphoribosylglycinamide"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55933"
FT                   /db_xref="GOA:D7GIL1"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL1"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6A4_PROAC"
FT                   /protein_id="CBL55933.1"
FT                   /translation="MTAPSTGSSTHSSPSGHIRPTADSLTVLVVGAGGREHSLALAASH
FT                   DPGVGAVHVAPGNPGTAAFATNHPVDIMDGPAVAALATSIGADLVIVGPEAPLVAGVAD
FT                   DVRAAGIACFGPSRAAAQLEGSKAFAKKVMADAQVPTAQSRVATTPAQAAAALDEFGAP
FT                   YVVKDDGLAAGKGVIVTSDRAAALAHAAECDQVVIEEYLDGPELSLFVITDGTSAVPLL
FT                   PAQDFKRVGEGDAGPNTGGMGSYAPLPWLPADVVDEVMVQVVRPTLERMRELGTPFAGL
FT                   LYVGLALTAAGPRVVEFNARFGDPETEVVLPLLEGPFARVLLAAATGTLADAPALTVGP
FT                   GAAVGVVLASTGYPTDPHPGGVIKLPPAHDDVQVIHSGTALDAHGQLVSAGGRVLVVVA
FT                   RGIDLADARAKAYAAVDRIDFPDGFCRRDIASPQRLAAIADQLS"
FT   CDS_pept        489000..490433
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="PFREUD_04010"
FT                   /product="Adenylosuccinate lyase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="4.3.2.2"
FT                   /note="N6-(1,2-Dicarboxyethyl)-AMP <=> Fumarate + AMP
FT                   1-(5prime-Phosphoribosyl)-5-amino-4-(N-succinocarboxamide)-imidazole
FT                   These proteins are active as tetramers. The four active
FT                   sites of the homotetrameric enzyme are each formed by
FT                   residues from three different subunits"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55934"
FT                   /db_xref="GOA:D7GIL2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL2"
FT                   /protein_id="CBL55934.1"
FT                   /translation="MTVPNVLATRYASAQMKHIWSPEHKIVEERKLWIAVLEAQRDLGV
FT                   DFGGDDPDEVINAYQSVIDEVDLASIAARERVTRHDVKARIEEFNALAGYEHIHKGMTS
FT                   RDLTENIEQLQVLHSLQLVRSRAVTALARLGELAARYESQPIAGRTHNVAAQVTTLGKR
FT                   FATCANELLVAHARLSDLIDRYPARGIKGPVGTSQDMLDLLGGDVDKLAEFEQRIATGL
FT                   GFNHVLMSTGQVYPRSLDFDAVTALAQTAAAPSNLATSIRLMAGNELVTEGFKPGQVGS
FT                   SAMPHKMNTRSCERINGMSVVIRGYVSMVGELAGDQWNEGDVSCSVVRRVALPDAFFAI
FT                   DGLFETFLTVLADFGAFPAMIQAELDRYLPFLTTTKVLMAAVRKGVGREDAHEAIKENA
FT                   VAVALELRETGSKVNPLFERLAADKRLGLTRDELHALVSSPLELTGAARVQVGQVVAQV
FT                   EKIVADDPESAQYHPGAVL"
FT   CDS_pept        complement(490443..491549)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04020"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55935"
FT                   /db_xref="GOA:D7GIL3"
FT                   /db_xref="InterPro:IPR018702"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL3"
FT                   /protein_id="CBL55935.1"
FT                   /translation="MRQAELIMLVFGVVVAVFSATVYTITRRRHRADQALPDVDPGLIA
FT                   PTTHDQPPAGVEPGLAGALLNGRTDMRDVFVALADLAARGYLQITRLTAQGAGAPDWQM
FT                   QRTQKADADLPEADRAVLAAIFTAPPVPGTDERTPRPSVRLGLLLADHSEPLSQARQAL
FT                   RAEGTRLGWFHRDPHDHHTTWGWVGGVLTIVGLVLAVISAIDVMATSKWSAMVGPLLVV
FT                   AGGLLLASLGRLRAPRSALGNHLLDDLDAYRRHLDALRPEQVDPAGASALFKATLPWTL
FT                   VFGSAEDFATTMSTMAQRSAGWGKPVRLDLAWFSVPATARPAGTRVGASTSRHDAPTPP
FT                   ADNPLVSFARAVQEFVDAGGKQDGRDDG"
FT   CDS_pept        491647..492525
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="PFREUD_04030"
FT                   /product="Phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.2.6"
FT                   /note="catalyzes the seventh step of the de novo
FT                   biosynthesis of purine nucleotides, the conversion of
FT                   carboximideaminoimidazole ribonucleotide (CAIR) into
FT                   succinoaminoimidazolecarboximide ribonucleotide (SAICAR).
FT                   CAIR and aspartic acid react in the presence of ATP and
FT                   magnesium to form SAICAR."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55936"
FT                   /db_xref="GOA:D7GIL4"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL4"
FT                   /protein_id="CBL55936.1"
FT                   /translation="MKHAQYANLGLPLIHAGKVRELFDLPREPAHLLMVATDNISAFDY
FT                   VLDSMIPDKGVVLTQLSLWWFKQLGDIVDNHVVSTDVPDEVAGRAIVAEKLDMVPVECV
FT                   ARGYLTGSGWAEYQETGSVTGIALPAGLHDGSRLPEPIFTPATKAPMGEHDENVSFDQM
FT                   SRTVGYDTGAAIRDLTLRLYAKAEQIARERGIVLADTKFEFGRRPDGVLVLGDEVLTPD
FT                   SSRFWDADAYEAGRLESFDKQYLRDWLTHDSGWDRSSGERPPALPDAIVTATRERYLEA
FT                   FERLTGAPLAL"
FT   CDS_pept        492608..492853
FT                   /transl_table=11
FT                   /gene="purS"
FT                   /locus_tag="PFREUD_04040"
FT                   /product="Phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.5.3"
FT                   /note="ATP +
FT                   1-(5-Phospho-D-ribosyl)-5-amino-4-imidazolecarboxylate +
FT                   L-Aspartate <=> ADP + Orthophosphate +
FT                   1-(5-Phosphoribosyl)-5-amino-4-(N-succinocarboxamide)-
FT                   imidazole"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55937"
FT                   /db_xref="GOA:D7GIL5"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL5"
FT                   /protein_id="CBL55937.1"
FT                   /translation="MARVVVDVMPKPEILDPQGKAITGSLSRMGFDGLNVRQGKRFEIE
FT                   VDGGVTEERLVQVKEAAEKLLANTVIESFTVHIEDN"
FT   CDS_pept        492855..493532
FT                   /transl_table=11
FT                   /gene="purL/purQ"
FT                   /locus_tag="PFREUD_04050"
FT                   /product="Phosphoribosylformylglycinamidine synthase 1
FT                   (Phosphoribosylformylglycinamidine synthase I) (FGAM
FT                   synthase I)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.5.3"
FT                   /note="ATP + 5prime-Phosphoribosyl-N-formylglycinamide +
FT                   L-Glutamine + H2O <=> ADP + Orthophosphate +
FT                   2-(Formamido)-N1-(5prime-phosphoribosyl)acetamidine +
FT                   L-Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55938"
FT                   /db_xref="GOA:D7GIL6"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL6"
FT                   /protein_id="CBL55938.1"
FT                   /translation="MTSRIGVVTFPGTLDDHDALRAVEQCGGEAVSLWHASDSLNNVDA
FT                   VILPGGFSYGDYLRCGAIARFAPVMDSVIDAANKGMPVLGICNGFQILCESHLLPGALM
FT                   RNEKMKFICREQRLRVEVTDTTWTCAFAPFEEISIVLKNGEGNYIADDETLRMLRDNNQ
FT                   VVFRYLDNPNGSSDDIAGITNDRGNVVGLMPHPEHNIDELTAGSTDGRGFFESVLKFLS
FT                   ARV"
FT   CDS_pept        complement(493611..494309)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04060"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55939"
FT                   /db_xref="InterPro:IPR011434"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL7"
FT                   /protein_id="CBL55939.1"
FT                   /translation="MSINPPDAPYPNQPQGQPDFQPPSGTQPPPPGGQPPVPPQPPAGG
FT                   QPPQSPEGQGKKKHTVRNIVIAVVVLIAVIAGCQGLTKGSDSSSSSSTSSSTTQPATTA
FT                   TSRPATTSAPKTTQAAAPTTAAQPAVPPEYQSAAKKAASYAGSMMHVSKQGVYDQLVSE
FT                   YGEQFSAPAAQYAIDNVKADWNANALAAAKSYQSTLNMSPAAIHDQLTSSYGGKFTQAE
FT                   ADYALAHLND"
FT   CDS_pept        494661..495944
FT                   /transl_table=11
FT                   /gene="csbX"
FT                   /locus_tag="PFREUD_04070"
FT                   /product="Alpha-ketoglutarate permease"
FT                   /function="1.2.4 Transport/binding of carbohydrates"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55940"
FT                   /db_xref="GOA:D7GIL8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL8"
FT                   /protein_id="CBL55940.1"
FT                   /translation="MTNAQQNTNSSPGLLERQGIQGSLKWGFLAVMIFMAGNSLELGFI
FT                   SPFLQDRGLSASQVSVMLTVYGAVVAVASWLSGALADSWRPRRVMLTGFVLWLIFEVIF
FT                   LAGGVATGSYLVMIISYALRGVGYPLFAYGFLVWITMATPEERLGRATGWFWFSVALGQ
FT                   GVIAGYVPSLLIPVIGEITTLWLSVAFVVVGGVMALLLLKPENTEGHEQRPSAAETIAG
FT                   LARSATIVVHRPKIAIGGVVRIINQIAYFAFPAFFSYYMIKSVGFTTSNWQIVWAALNL
FT                   ANVFASLVMGYVGDKIGRIRTTAWIGGLGCAITVFAMYYGSVLFGTNMLAAIVPAMLFG
FT                   ITLGAYVPLSAIVPTLAPDQKGSAVAILNLGAGLSNFAGPLVVTLFLGSVGVAGVVWIL
FT                   VGLYVVSFVLTFFLRPSKKQAQAEGAAA"
FT   CDS_pept        complement(496030..496965)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04080"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55941"
FT                   /db_xref="GOA:D7GIL9"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIL9"
FT                   /protein_id="CBL55941.1"
FT                   /translation="MSKRDKATPPPWSQPGGRQGKYVQPFSQTRYRQPFEQGPDEAAPP
FT                   QAPDETTPPSGYQGTPPQSDYSEAQYQGTPYQDAQYREASYEQDQFQQSADQQPRQQTP
FT                   PRKGNLSMVGLVLGIIAVVAALVPNAGPPMAMALGLAAIVLGIVGLVKKHGATAIISMA
FT                   FGVVALVLSVVMTVAVYGPLKNAAASAANSILASANAGQPAPSADAETQRALRDDVRVS
FT                   FGNFTPGTESDWSSVPVTVTNISQQRQSYNISISAVNANGMEVNADSIYIPDLDAGRAT
FT                   DKIAFKYIDTDKMDAMKSATYTITRVLVIS"
FT   CDS_pept        497393..498202
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04090"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /note="No signal peptide (signalP) and 2 TM domains"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55942"
FT                   /db_xref="GOA:D7GIM0"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM0"
FT                   /protein_id="CBL55942.1"
FT                   /translation="MSDQQFPAGPNGTNPQGPGDVGPQGDPGGTVKMPPVSDPGGGAGG
FT                   GHSPSVVPTIVISLLFGVFGAIPAAIAAAHVRQPGRRKSVYWWSFALSWLVQLVVGVLI
FT                   AVLVFGASPAKVAAGLAGSSSPSASSASPSGAASASSAAASVPGQTTAPVTTVPAQTPG
FT                   AVAPGAAETPAATATQEGRMQAQWRESGFTICGQDLAVNGNTTCDFGTAVHDAYSQAVG
FT                   GAYGSYGSAKTVEAKDAETGGTSTMSCTSGTGGIFCSGDNGVTVVFD"
FT   CDS_pept        498591..498875
FT                   /transl_table=11
FT                   /gene="tnpA"
FT                   /locus_tag="PFREUD_24620"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55943"
FT                   /db_xref="GOA:D7GF23"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF23"
FT                   /inference="similar to AA sequence:Uniprot:Q1BDS3_MYCSS"
FT                   /protein_id="CBL55943.1"
FT                   /translation="MSNSRKRHTPEQVVRKLGQADRMLADGSDIAAVCRELGISEQTYY
FT                   RWRNQYGGLKADDAKRLRELEKQNATLKRLLAEAELEKAALKELAEGNF"
FT   CDS_pept        498938..499741
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24630"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55944"
FT                   /db_xref="GOA:D7GF22"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GF22"
FT                   /inference="similar to AA sequence:Uniprot:Q26XT5_MYCFV"
FT                   /protein_id="CBL55944.1"
FT                   /translation="MACRLAGLSRSAYRRPLKGDTVADPDRALRDWLRAWAKKHPRYGY
FT                   RRAYHDARGEGWAVNHKKIQRLWRAEGLRVPQRRRRKRVGSSTVDAPAAVAPNLVWAVD
FT                   FQFDADERGCPIKICSIVDEHTRECIGGLVERSITADRLTAHLEELVAVRGAPGVLRSD
FT                   NGPEFISDAMADWAGTRTGLFYIPPGSPWHNGYVESFNSRLRDECLNINSFYSLLHAQV
FT                   VIGDWKTEYNHQRRHSSLGYLPPAEYARQCTHQIETDDSQSDRTE"
FT   CDS_pept        499738..499902
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04100"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55945"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM3"
FT                   /protein_id="CBL55945.1"
FT                   /translation="MKGAAHTDQANGTVTATFRAAKTTMKLSVAQERCGDLKSFLAECE
FT                   AAGAELEQA"
FT   CDS_pept        complement(501875..502762)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04110"
FT                   /product="Phage major capsid protein, HK97 family"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55946"
FT                   /db_xref="InterPro:IPR024455"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM4"
FT                   /inference="similar to AA sequence:Uniprot:Q1B5C3_MYCSS"
FT                   /protein_id="CBL55946.1"
FT                   /translation="MAITGITGMLAKGQPQAWLPEGFGQLVIQPVQAMSAAIQAIGSTQ
FT                   ANANSNSYRVPVVKTDPSAAWVAEGEEIPASEQDLDEDADRFHKLAGLTIVSSELANDS
FT                   NPDAAEQVGLGLARDIARKLDGAFFGSRGASENQPRGLGDITGVNAIATDTTAWQSLDP
FT                   FTSATYAAENVGAQLAAFVANPNDALAIAQLKDQTGSNRPLLGTDPTTATKRLIDGVPL
FT                   LTSPAVAAGNVWGLPGLGQVLIVVREDVKLVRDESVFFTSDRVALRATMRVTTLFPHPA
FT                   AIQRISLKTADKAS"
FT   CDS_pept        complement(502934..503635)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04120"
FT                   /product="protein of unknown function"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55947"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM5"
FT                   /protein_id="CBL55947.1"
FT                   /translation="MSDTTPTSDQPRTAATPPDTEVQPTPTPAEPEQTTELTQAAGQET
FT                   GEPDRPTVKEAFPDGPDDIVRETIKYRKRAQAAEARATELEAELQTYRADELERLAGGV
FT                   FMLDQQGGNKVSNPLTGEFIKFGYQLKHPEDLFTVGGVDREAAMTGAVSVEQITEAAAR
FT                   LHEARPELFQPIDEDGRPTSRIKNTRQVEDQWRLQNKGKSFPVGMGSCTPTPPTNGLWK
FT                   DVVNGSAYRRQ"
FT   CDS_pept        complement(503632..503868)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04130"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55948"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM6"
FT                   /protein_id="CBL55948.1"
FT                   /translation="MQKKKREDPNGPEFIRTITARPSGKEKFGLFPADITETVARGYPD
FT                   GSVQLLTINSYQGSIFLGPQGPTITITKKGITS"
FT   CDS_pept        complement(503998..506520)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04140"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM7"
FT                   /protein_id="CBL55949.1"
FT                   /translation="MSTTNQLPAILGTLDSLGVPMWLTATRSGKQVPPRGWPTLTAADN
FT                   RARLGHYGPGMAVCGAVTERWAFVDVDTKAGASIEAAEAWLRGLGVSPWARVSTPSGGA
FT                   HFYVSGAPGQANYPGETVAKLTGLVGVEVFGGIAPSAHFAFLPGSERPKYPGRGYTVEW
FT                   EHPELIDADATPLWNALAHAAAERRTGQGSPEEGAKSAKRAGTDTPPPSHPSEGRPRAE
FT                   AYTRSVVNGEADKLAHAGEGGRNAQLHRSALKLGSGTTLTLDDTITALEAAAGACGLLG
FT                   DDGRAQVIATITSGWKAGRASPRDTPATNPDSAGVAPDMVTGTPTPAGRPKGMSVMDMA
FT                   LGSGEGGHDTPTQPSDSEPHRRLVFTAASQITPKPTQWVWIDDEEGRLPAGALSLAAGR
FT                   EGTGKSSFGIWLSSQITRGLLPGMWGGIPRNVIYLAVEDSWAQTLVPRLMAAGADLDRV
FT                   FRVEAVTAEGEESTITLPVDVGDLRAGISQHDVGLVVADPLMSLMSGRIDTHKEADTRR
FT                   ALEPLAKIADQTGAAILGIAHFNKSGGSDINSLITGSGAFKNVPRAVFGFARDEDTGES
FT                   VMTQGKNSLGRLDLPSLAYRIASTTVRLEDGETDVGRFEFMGTSTTTARDLLRANHDTD
FT                   TPESTDCAAWLREWATDEGGTLKAKEAKAAARQAGYSIDQTNRAKRKLGMDSKRSGFGK
FT                   NSEVFWVLPGTDSETPEPHTWHIGGIDGSPRDVPPMPPMAPPMGERPDSAPVPSVLHSA
FT                   DLPGFRAIRHPAAVPESPPEPLDVNGIVPGRVTPTYPKPAPTPAGQLDPDWLLFPGSTT
FT                   CKECGNDLLTETGSTGRCRAHHQARGAA"
FT   CDS_pept        complement(506517..507035)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04150"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55950"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM8"
FT                   /protein_id="CBL55950.1"
FT                   /translation="MSARQAFPLDGDGVPAMCDRCGTVRGYGGRQEWFAFLKCVECHTR
FT                   TRHAIVRGDRQDHAGLVLEAEEARARGQLAQLLRLREVWRRLGFTYSQEAEMPKPQEWG
FT                   AGCVAGGWFKFSGQWRREVIVHPDTRVDEEARSLGFMLEFYTTQGFPAEKAYCWRPRPV
FT                   SSDVGQVGA"
FT   CDS_pept        complement(507032..507196)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04160"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55951"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIM9"
FT                   /protein_id="CBL55951.1"
FT                   /translation="MNEIEQVMGATVTDIVEILVRAGGSMVALVEELEAGHAGPWVRYV
FT                   AARLGGGAA"
FT   CDS_pept        complement(507193..507432)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04170"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55952"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN0"
FT                   /protein_id="CBL55952.1"
FT                   /translation="MSSSAYSPALPNKERAGVRQRKRLAYTVMEASWLLGCGVGFCQVA
FT                   AQLDMSPNSLQRALYKAKRPDLAVQCHADAWGLR"
FT   CDS_pept        complement(507576..507788)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04180"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55953"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN1"
FT                   /protein_id="CBL55953.1"
FT                   /translation="MDEAQKRKLIDAAVKASEKAASARATADSLSAARRAAIKAAMDAG
FT                   VPRQELADALNVRRETLYEIAKYKN"
FT   CDS_pept        complement(507831..508019)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04190"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55954"
FT                   /db_xref="GOA:D7GIN2"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN2"
FT                   /protein_id="CBL55954.1"
FT                   /translation="MNEDKYLSQPQAARHLGVSIATIQRRIADGTLPAYRSGRMVRVKL
FT                   SDLERMMKRIPTIGAVA"
FT   CDS_pept        complement(508290..508664)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04200"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55955"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN3"
FT                   /protein_id="CBL55955.1"
FT                   /translation="MDCWTASQQLEELSALLKRHPYRQVAFRSVAEAGPTATWSPHFNS
FT                   MLEFGGLCFNCGRWFSVDREDSTYRLRYDARYCSNACRQAMYRLRVRLRAGHPLSPEKW
FT                   KSIRSTVTWALDPEPPHVNS"
FT   CDS_pept        complement(508829..509977)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_04210"
FT                   /product="phage integrase"
FT                   /function="4.4 Phage-related function"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55956"
FT                   /db_xref="GOA:D7GIN4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN4"
FT                   /protein_id="CBL55956.1"
FT                   /translation="MAGKRAFGQIDRLPSGNYRARYVGPDLVLHKAPHTFTNKSHAERW
FT                   LLDEQDLISRDVWEAPEVRTAKPRALTVGEWISKVIERRANRTRRPLAQTTIDLYRKDY
FT                   RLRISETLCAVRLADLTPAMVATWWHALPDTPTQNARAYALLRSAMSDAMEDELIERDP
FT                   CRLKEAGKPTPAHTGEAITVPELFTYLEAVPESRRLPLMIAALCGLRSGEVRGLRRRDV
FT                   DLKAGMLHVEQAVSRVRADNHRWEWRIAPPKTAAGVRTVALPSPVTDALRTWLKEAPVN
FT                   GWDGLLFPATDGHSPMPGTVLRDAHVKGREAIGRQTLTIHDLRRTAATLAAQGGATTKE
FT                   LMRLLGHTTVSVAMLYQVADEERDRARAQRLTQQLREGQAGQ"
FT   tRNA            complement(510114..510200)
FT                   /locus_tag="PFREUD_04220"
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:510165..510167,aa:Leu)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        510349..511029
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04230"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55957"
FT                   /db_xref="GOA:D7GIN5"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN5"
FT                   /protein_id="CBL55957.1"
FT                   /translation="MGEAFAGIAGLGIAGFDPLGALALMAAMALGARRRAIATLLVTTV
FT                   ATIVVTGFVLSSTVGPWAIAQIHRLHDPGHIVWGLIVLAAGVGLLAWAIVRLVRVPQPK
FT                   PDDATRSGHSVGMLAVIGIGVGLSAFIDPAFYGLLVVAGGIHSWPMRLGGIVLWACLSQ
FT                   IALLALSGAVFAGAFAPVHRFITRVRQQWGARASRFASWALLVIAVIICVEGAFELHGH
FT                   WWIP"
FT   CDS_pept        complement(511551..512789)
FT                   /transl_table=11
FT                   /gene="pf774"
FT                   /locus_tag="PFREUD_04240"
FT                   /product="Putative carboxylic ester hydrolase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="3.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55958"
FT                   /db_xref="GOA:D7GIN6"
FT                   /db_xref="InterPro:IPR000675"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN6"
FT                   /protein_id="CBL55958.1"
FT                   /translation="MSRSGRRNRLVAFLLLTALVASTIMLGTSSAHADDGWSSTQPLAS
FT                   THAKQQGCAQVLFVGARGSGEAAPYGNTIAPLEQELAARTAKARPDLKLAQVYLDYPAV
FT                   SLDDMNAAAIEQMVLPAASASTPPYSDSVDKGVAELQRLAVAEAKRCPSEKLLVAGFSQ
FT                   GAEVVTRALGSGNLDANLLGAIVLGNPLRYDGQNVSELDGTATNRSYGLSAALYYLRAA
FT                   SASSADKDKNEQMKQLLTALFAMFNGTVDNRQLDAAMDSARATVPGVDAPRTYSACMKD
FT                   DPVCDAAGALTRIMTGSSSVAQEHANGSATHGSYTPQNLPKTLDAVDAKLAALPHVEVQ
FT                   QAPVKTGLTLAAGALIGAGVALVAVLVFLGYRARRRARRKATAVPAVARKVPVMKARKR
FT                   KGMDDTAGGSAEA"
FT   CDS_pept        complement(512935..513399)
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="PFREUD_04250"
FT                   /product="Phosphatidylethanolamine-binding protein"
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55959"
FT                   /db_xref="InterPro:IPR005247"
FT                   /db_xref="InterPro:IPR008914"
FT                   /db_xref="InterPro:IPR036610"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN7"
FT                   /protein_id="CBL55959.1"
FT                   /translation="MRLFSDDLKQGEEIALVFAERGAGGRNILPQLGWDEVPAGAKSLA
FT                   LTCWDPDAPMEGGFWHWLALDIPVSTTGTVQGTPLPTGSVELQNDYGYRGYGGPNPPHG
FT                   QVHRYIFTVWALDVAHLEVPADAKPAAVEELLKAHALASATLTPVFTSTI"
FT   CDS_pept        complement(513433..515985)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04260"
FT                   /product="DeaD/DeaH box helicase"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55960"
FT                   /db_xref="GOA:D7GIN8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021904"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN8"
FT                   /inference="similar to AA sequence:Uniprot:Q6A5X1_PROAC"
FT                   /protein_id="CBL55960.1"
FT                   /translation="MTDTLTELLPTGDAAHDPDALFNAFETWTHAQGLEMYPHQSDALL
FT                   GLLTGANEIITTPTGSGKSLIATAAHFVALSNRGRSYYTAPIKALVNEKFFALIDIFGA
FT                   DLVGMVTGDASVNPDAPIICCTAEILANIALREGRDADVDLVIMDEFHFIADPDRGWAW
FT                   QVGLSELPQCQFVIMSATLGDVTELQGRLARWTGRETEVIGGAERPVPLTYHWALTPLH
FT                   ETISELVSTGQSPVYIVHPSQAAATEQAQALMSAKLIDTEHRHKIVAAIGGFRFSPGFG
FT                   NTLSKMLRHGIGVHHAGMLPKYRRLVEQLTQQGLLTVICGTDTLGVGINVPIHTVLFTG
FT                   LSKFDGRRQRLLRSREFHQIAGRAGRAGFDTIGYVVAQAPEYQVENARIAKKFANDERK
FT                   KKSVRHKKPPEGFINYTEATFNKLIESTPETLHARMRVTHAMLLNLLSRDEDTAVALVH
FT                   IIDAAVSDRMIRVRLLHRAVQLARSMVESGVIVRRDSPTPGGRLYDLSTELQDDFALNQ
FT                   PLSAFAMVALELLDPEADDYPLGVVSVIEATLENPRPILRAQESRERGEAIAEMKADGL
FT                   DYEERMAALDEVTYPTPMAEELDAAFTAFTASRPWLVEWGLRPKSVVRDMFERAMTFGE
FT                   YCAFYKVQRAEGTVLRYLSDAYRALRQTVPLAARTPEFDELLIWLGEIVRMTDSSLLDE
FT                   WTRLGEDVGDSGAGDEPGTHGPTRTLTSNKAAFRVLVRNAMFRRVQLAADDDVPALAAL
FT                   NSTDPQSSFTYNDWDDALGKYWDDHDDIGTGPKARGPQFLEIDDSTRLWKVRQIIDDPE
FT                   GDHDWSITATIDLDACDEADDLLVHVVGFARQDGPVGG"
FT   CDS_pept        516122..516820
FT                   /transl_table=11
FT                   /gene="eda, hga, kdgA"
FT                   /locus_tag="PFREUD_04270"
FT                   /product="2-dehydro-3-deoxyphosphogluconate
FT                   aldolase/4-hydroxy-2-oxoglutarate aldolase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="4.1.2.14"
FT                   /EC_number="4.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55961"
FT                   /db_xref="GOA:D7GIN9"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIN9"
FT                   /protein_id="CBL55961.1"
FT                   /translation="MMNTVTNSSSRLALPDALTTTRGVVLMPPDEDSGALMPVLEVLVQ
FT                   EGLTAIALPCPRSDETADDEGADTPQDPSAELTGLMAMYSFRATVGIHGVRTTADAQLA
FT                   IRAGARFAFCLFPEPGVLDALRVASIPAIVTALTPTEVEQAWQGAVSAVHVRPAEVFGT
FT                   GYAQGLHELVPDASMIATAQNRAAVEAWLWAGATAVSFGQSLLSRVFLSQDYSALRQRV
FT                   AEMVSAVKSA"
FT   CDS_pept        517046..518050
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04280"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55962"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP0"
FT                   /protein_id="CBL55962.1"
FT                   /translation="MTARRALSADDIDATVDQPTAPRRAGIPGRADAPIEFARPRRVAL
FT                   PSVEEDAILPFARCVSAQTTMTLPVITVDAVHAAKSSAKPHRGVSLPVAAVALTSALGL
FT                   GATLLPQTVAAAPDNGAAEARQTASVTRDTARTQLFTSDLATTEVATTSPTIPDTSAQD
FT                   LNDSFASLGKSTAQKLATDKAAADKAASEQAIAAANAAESVTGKGVKVAPNAATAATSA
FT                   AQTAINFALAQVGKPYVWGAVGPNAYDCSGLTMAAYKAAGISLPRVTYSQMAAGTAVSQ
FT                   STMVPGDLIFFYGGEHVGIYLGNGQVVHAADYGTGVIVGTVSSMPVSSVTHIG"
FT   CDS_pept        518242..519924
FT                   /transl_table=11
FT                   /gene="pgi, PPA2131"
FT                   /locus_tag="PFREUD_04290"
FT                   /product="Glucose-6-phosphate isomerase (EC 5.3.1.9) (GPI)
FT                   (Phosphoglucose isomerase) (PGI) (Phosphohexose isomerase)
FT                   (PHI)"
FT                   /function="2.1.2 Main glycolytic pathways"
FT                   /EC_number="5.3.1.9"
FT                   /note="reversible isomerization of glucose-6-phosphate :
FT                   D-glucose 6-phosphate = D-fructose 6-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55963"
FT                   /db_xref="GOA:D7GIP1"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP1"
FT                   /protein_id="CBL55963.1"
FT                   /translation="MNSPVDPTSTPAWAELENLHRSLDVDFRKWFAEEPNRAQQFTLRA
FT                   GDLTVDLSRNYLNQQVRDTLVSLAAQVDLAGRRDAMFRGDRINTTEDRSVLHVALRLPK
FT                   GAELDVDGVNVVDQVHEVLDREISFTEAVRSGERGGVTGKPITTVVNIGIGGSDLGPVM
FT                   VYEALKPYKHDRIECRFISNIDPADMYEKTHDLDAETTLFIVASKTFTTLETMTNARMA
FT                   KNWLINSLQSSGAIDGTADSRARAIKRHFVAVSTNAEKVSEFGIDHANMFGFWDWVGGR
FT                   YSVDSAVGLSALIAIGPDNWQDFLEGFLAIDKHFMITPIAENVPALMGLLNVFYSNFYN
FT                   AQSHVVLPYSQYLHRFPAYLQQLTMESNGKSTRWDASPVTTETGEIFWGEPGTNGQHAF
FT                   YQLLHQGTRVIPADFIGFARPAHALTEAGADVHDLFMSNFFAQTQALAFGKTADEVRAE
FT                   GTPEPLVPARVFSGNRPTTSILAPELSPRILGELIALYEHITFTEGAVWGIDSFDQWGV
FT                   ELGKTLAKNIAPLLTAGDEALMSQDSSTMSLIRAYKAMRAGNR"
FT   CDS_pept        519928..520713
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04300"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55964"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP2"
FT                   /protein_id="CBL55964.1"
FT                   /translation="MRRLRAGVPPELPAAGRHRQAAAGRHPRSAAAARPPAPAARPARC
FT                   AGVATLAVVAVLTAITAGCNVVVHAVAAGRRRTPGQLHAGVTPDTAMVLGAGVRGQRPT
FT                   PYLAARLDLAVRLWREGAISRILVSGWAEAPGDAAGVRYDEPAVMADYLVAHGVARGAV
FT                   LRDPAGLDTWTSAVRARRLHGLDAMVVVTQAYHLPRALAAARMAGIDALGVADTTRDHN
FT                   AKWWRYRLREVPACVKLVGEWALSRTGLRDAARARRGDQ"
FT   CDS_pept        520713..521933
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04310"
FT                   /product="Beta-lactamase"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55965"
FT                   /db_xref="GOA:D7GIP3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP3"
FT                   /inference="similar to AA sequence:Uniprot:Q2BF56_9BACI"
FT                   /protein_id="CBL55965.1"
FT                   /translation="MTSGIDEVLARGLRAGCYPGAIAQVSRAGTVRRAGVGSIASHGRD
FT                   GSPIPPAQREPVRPDLHYDLASITKVFTAITVLSLADEGVLAMDEPIAALLPAFRTSPK
FT                   RRRITALHLLTHTSGLPPVWPGWQDAGMRARSREAILADIVAMPLRWAPGERLDYSCVG
FT                   YITAMALAEQATGQGWEQLVTARVLRPLGLAHTGFNPLRHGVDVADIAPTEFRPALGLR
FT                   PAGGTHAPDAAGASRPGSATGGVDLTMVRGTVHDETAQVLGGVSGNAGMFSTLADLARL
FT                   AGALSSGLPGVLGRESFAMLWDDQLPRLLGGHADAEAARNGYRHGAGLCVAQTRAAGPD
FT                   APWLRSHTGFTGTSLVLNRAGDYAILLSNRVHPTRQAPDLAPVRVALTRAAGLAEPEEQ
FT                   AERGGQA"
FT   CDS_pept        522315..525101
FT                   /transl_table=11
FT                   /gene="Arth_4141"
FT                   /locus_tag="PFREUD_04320"
FT                   /product="FAD linked oxidase domain protein"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55966"
FT                   /db_xref="GOA:D7GIP4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP4"
FT                   /protein_id="CBL55966.1"
FT                   /translation="MSSATTEKAVGTTRLIDRVGMAHDASHYLLIPEVVITATDTAQVA
FT                   NTMAQAYRENRTVTFRSGGTSLSGQSLSDSILLDVRKNFRKVEVLDGGARVRCQPGATI
FT                   RNVNAHLARYGYKLGPDPASEIACTIGGVVADNSSGMACGTQFNTYNTLESMVLVLPSG
FT                   TVIDTAQPDADAKLHRAEPALWEGLSELRDRVRKNPESVAKITQQYAMKNTMGYGINSF
FT                   TDHDEPVHILEHLMIGSEGTLGFVAEVTFRTLPVQKHAATALLIVPELSVATDALEDLV
FT                   RNGALCLELMDAASLRVVQKYPEASPELAALDVKKDAGLLIEAVADDEKELDDRMDALN
FT                   SVLGGLPIANPPRFTKNIPERNNLWQLRKGLYTSVAGARPAGTTNLLEDIAVPVGSLTA
FT                   TSAELQDIFAKHGYDDAVIFGHAKDGNIHFMVTSDWRNPVDVEKYRDFTEDMVNAVLRH
FT                   EGTLKAEHGTGRVMAPFVERQWGAELYDVMKTVRRLGDPHGVLNPGTLLTDDPEGHMHH
FT                   FKMMPPVDDFVDRCVECGYCEPTCPSADLTQTPRRRIALLRSAEELPPEQAKELRKDYA
FT                   YEAVDTCAADSLCLLACPLRIDTGVFMKTFRAARHMAISKTAMNAAAKEWGPIVTFLRG
FT                   ALNVVDVVPSPIMTGVTVAARAVLPKDVIPKVGNDLPGGGPKRPEPESTSQDDFVFFPS
FT                   CMGSLFEPAKGGYKDGAAGAFEKLVAAAGQRARIPENISGLCCGTVWVSKGFTKGADTM
FT                   AERVYDSVWKATDNGRLPVVCDAASCTHGLHTTGQHLTGQKAENWKKVEILDTTTWVAR
FT                   NLLGKLKFSQNAGSVVIHPTCSMRHLDIVKDVEACALAVSDDVTVPVDAGCCAFAGDRG
FT                   LLHPELTASATKRETAEVTQRTYDEYVSGNRTCEMGMTRATGHTYHHVLEMLAQHLV"
FT   CDS_pept        complement(525260..526408)
FT                   /transl_table=11
FT                   /gene="fad"
FT                   /locus_tag="PFREUD_04330"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="1.3.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55967"
FT                   /db_xref="GOA:D7GIP5"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP5"
FT                   /protein_id="CBL55967.1"
FT                   /translation="MSFLSAELLAAIHKRAARHDRDNSFPEDDLNDLRTAGYLSAFVPK
FT                   EFNGAGLSVERICAEQTALAKAAPATALAINMHQIIVGMARYLVAHGNDKGRQVLHDAA
FT                   AGELFGFGISEPGNDLVLFGSISKAVPDGEGGFSFHGTKVFTSLAPAWTRLLTFGTDDS
FT                   GDDGPHSVFAILHRDDGGFYVKPDWDTLGMRATQSNTTVLDGAHAPADQVLARITPGPN
FT                   ADPVVFGIFSHFSAFIAATYQGIGERAIEVAAEQVATRHSVKNDDVYAHDPDIRWRLAD
FT                   AAIAMNGSAAQLRDIVRDLDDDADRGALWMPQLSAVKNACVEATMHAVDQAMRSVGGRS
FT                   YYTSNELSRLYRDAVAGLFQPTDQESLHAAWANVVLGPIAKG"
FT   CDS_pept        526794..528125
FT                   /transl_table=11
FT                   /gene="pf279"
FT                   /locus_tag="PFREUD_04340"
FT                   /product="Carboxylic ester hydrolase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="3.1.1.-"
FT                   /note="recombinant protein active on 1- naphthyl
FT                   propionate, extracellular (see dherbecourt 2010, AEM)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55968"
FT                   /db_xref="GOA:D7GIP6"
FT                   /db_xref="InterPro:IPR003386"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP6"
FT                   /protein_id="CBL55968.1"
FT                   /translation="MRRRTTIAALAAVLSFSPLAAQAAPASADGGTSSTPRSVATSTSS
FT                   AGVDPASACGDLVQLAPVLGSDHTPDGKQITPKPTADGRRVPVIIVHGWVSYDTHSDAR
FT                   DHLFSQYVDRTADPAGGTGYLLAQSQYRSSLIGMLQQVPGAEVYTFDYSQVGSRWVTDP
FT                   QIGPKLSQAIECLSDSYQQKPVLVTHSMGGLVARQALSNNDSKGRPISGRVSNVLAVGA
FT                   PNNGSDSAQMIASALTIGSEIPLAGLPIRMLWDYIGQCSEQMDATNTTCTGIRAVDAFR
FT                   SSGGEALRTGSAQLAQLPWWPDNVKVTAYVGDIQMGGISLFGLNSPRLLDLGDLLVSVD
FT                   SAKAGSQRSRQVNCEYGIISTKSAETGLVRLMLAGQGNSVEQPADLLSSPCFHEAMLHE
FT                   TTITGDLQRDLTEVLGANTAWHDPATAGEQSAGATTVSAVRESR"
FT   CDS_pept        528122..528622
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04350"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55969"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP7"
FT                   /protein_id="CBL55969.1"
FT                   /translation="MTKPWSRVVVAVLALLLVAGLVAAGVTGLFGGRARSGSTPGPQAS
FT                   PATMASGTATSPAAAVGSSSAPPADPADVAAGTQVLTSFPSEPSKYLAEQARDYFNVDP
FT                   AAVLAPGTTIAVDSSSWTPLDQAGAMVRIEVTVPGAAPTPYTAVMVKEADGTWKVMGTV
FT                   AAQ"
FT   CDS_pept        complement(528647..531811)
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="PFREUD_04360"
FT                   /product="ATP-dependent dsDNA exonuclease SbcC"
FT                   /function="3.3 DNA recombination, and repair"
FT                   /note="SbcCD cleaves DNA hairpin structures. These
FT                   structures can inhibit DNA replication and are
FT                   intermediates in certain DNA recombination reactions. The
FT                   complex acts as a 3prime->5prime double strand exonuclease
FT                   that can open hairpins. It also has a 5prim single-strand
FT                   endonuclease activity"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55970"
FT                   /db_xref="GOA:D7GIP8"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP8"
FT                   /inference="similar to AA sequence:Uniprot:Q0S485_RHOSR"
FT                   /protein_id="CBL55970.1"
FT                   /translation="MQILRLELSGIGPYAGTEHVDFSRLGADGLFLLEGATGSGKTTII
FT                   DAIVFALYGQVAADDSSGDRMVSTHRKAASEPYVDLVVDTSRGLYRVRRTPQFTRPKKR
FT                   GEGLTSVNATIRLWKLADPDDQDGEPISANIQDANKELQAAIGLSRDQFTQTVVLPQGH
FT                   FANFLRSKPEERRGLLQQIFGTELFERAQQELTAMAADYKARADQARTQIRSLAERFAH
FT                   SAWPDEAPTPDGSPASEATPVPADETPAGHQDVPVPGPTPREAFLALLDDDDTAPLVAA
FT                   AHTRLRELQADTEQRTQAVAGARERLGGARAARDAAQRIIALKAEHDALVVQRQELEAR
FT                   GDQIAADRVRLDAATRAAGSARPLAAARRAAAALSTATTEWEVVAAEIAATDDGVLLEQ
FT                   VRPHAVGNLGSPDGSDDAALSTLRDEITRLGTTRGQLGQLAQLEAGLPARHARLDADNA
FT                   RLAEIATRVATTQQELAELIAGRDELSQRHGQLPPTDDALTGASLAQQAATRTLEAAQA
FT                   AEQDASQLVALRAAEQEAIDAADLAEREYRTARAGWLDGLAGTLAGELVDGDECPVCGA
FT                   TSHPHPATPAQGAATRDDVERLAQQARSLADARARAAMQCDVAAQHRVDHQKAAGGKDV
FT                   AQARADLDRADAELAGASAAAAQRVELTARIADADRQVTTTRSTLAELQASASGLKGAI
FT                   ATATTQLDDDHHQIDRHREDYPDIAGRLAHVARRLDAATRIVDALQALAAARREGVARR
FT                   KEADQALADAGFATSDEAGAAMLDAEQIAALRQSITDFDTRRARIAAQLERAELVAAVA
FT                   SPVPDLESLDTKLADAEQAQEAAELALGRATAHLAQSRQAAEELEAASLALTRMAPEAA
FT                   PVVRMAELATAGDRNLRKVTLPTYVLLRRFEQVIDQANDRLESMTHGRYSLQRTDEKEG
FT                   RSRKLGLGLVVIDHLPVDTARETQTLSGGETFLASLAMALGLSDTVTAEAGGISLDSLF
FT                   VDEGFGSLDPESLDMVMGQLEKLRAGGRNVGVVSHVTEMKQRIAERISVRKLPDGSSTL
FT                   TTTVDD"
FT   CDS_pept        complement(531811..533061)
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="PFREUD_04370"
FT                   /product="SbcD, DNA repair exonuclease"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55971"
FT                   /db_xref="GOA:D7GIP9"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIP9"
FT                   /protein_id="CBL55971.1"
FT                   /translation="MSHPASDLVAMRILHTSDWHLGRTLRGVDLSDAHAAFLNQLVAVA
FT                   RSERADAVLVSGDVFDRALPPLDAVNMLNDALARLTEVAPVVLIPGNHDSPQRLGLNAK
FT                   LLRNQLHIRATLADIAHPVVLPDSTGHDGLVVYAIPYLDPDMTRDRLGELAGVDGDGRI
FT                   ARSHEAVVGAALSMVHRDLARRRSANGTRIPAAVMAHAFVTGAQPSDSERDLRIGGVDS
FT                   VPAALFADVGADYVALGHLHGAQAVAGSRDPASDHDEEAVMRYAGSPLAFSFSEQHQHK
FT                   STALVTFDEAGPVASVELIPTPVPRRLSDVRGSLQQVLGEDFAAQRDDWTRVVVTGEDR
FT                   PADLSRTVKKAFPHALEIRFESTLREREVRATVSAQADPLDVVGQFVADVSNRRPDAAE
FT                   LTVLRTALERATKQGER"
FT   CDS_pept        complement(533042..534259)
FT                   /transl_table=11
FT                   /gene="add"
FT                   /locus_tag="PFREUD_04380"
FT                   /product="Adenosine deaminase (Adenosine aminohydrolase)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.5.4.4"
FT                   /note="Adenosine + H2O <=> Inosine + NH3 and Deoxyadenosine
FT                   + H2O <=> Deoxyinosine + NH3 and Cyclic amidines + H2O <=>
FT                   Cyclic amide + NH3"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55972"
FT                   /db_xref="GOA:D7GIQ0"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR006650"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ0"
FT                   /inference="similar to AA sequence:Uniprot:ADD_STRVG"
FT                   /protein_id="CBL55972.1"
FT                   /translation="MPDVARRDLNLLPKAHLHLHFTGSLDIPTLRELSAWEGLDEAEQL
FT                   IDDDPLSVPATKRGWWRFQRTYDIARHVVISERALRAVVDAAARNDAAQGSRRTEIQVD
FT                   PTSYAPYVNGLVNALEIILDEAALASRRHGIQMGVIVAASRLHHPLDARTLARLSARFA
FT                   GRGPGGVIGFGLSNDETEGNTVEFGPAFRIARRAGIPGVPHGGEFRGPEHIAQVIDELH
FT                   PTRIGHGIHAAESPALLKRIVDAGITLEVNPASNVSLGVYPDYSKVPLRTLLDAGAQVA
FT                   LGADDPLLFLSGLTDQYRIARDYLGLSDAELAELARMSIRGSFAEQADKARWLAEVDAW
FT                   LAAAPESGPGLPAAGVVPVPGGLVARPSGLLVPERGLVAPPGNGGAESADAGQAVPDAR
FT                   NVTPGL"
FT   CDS_pept        534442..536241
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04390"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55973"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ1"
FT                   /protein_id="CBL55973.1"
FT                   /translation="MSAQTADTGWRDVARRVSPPDPNGTEQQLGLNDVFFSTTDRKGVI
FT                   EQANEVFVRISRYPREVLVGSPHNIIRHPVMPGAAFRAMWDYLLDDQPFVAYVHNLAAD
FT                   GSLYTVLATVTPLDGGFLSVRTRPERADLLGAADSIYGTVRHLELEWEAAGLGAPAAAA
FT                   QGLGVLAKQLTAAGIPDYTAFMQTVVPAEVQARIAAGATVPQRPWAVGRLADMAVHQRR
FT                   LTEELDDWVSLLGRLDELATQLSTLSGELAEHSHADAALRERIQQAKQRAEGFSPIMAG
FT                   LDLWSAMTLELSTLVAKVTDEVEQLRASCAATRFRIALARLHCDQVGYFTVELIDQTPD
FT                   WQLAAPGIVLLCRALSQGVAETAGAVQGNAQLAAKVASDINEMAQAVSIPRTLLASWQT
FT                   MAAGRELSDDLRELMPQVGSTIETTAEQIERIGRVAEECRRNAQPHDITAIREHVMALS
FT                   EAASVVAAESAPTPHADPQPVDSPEVDRQYDEPPAPPSETVAPAAGAPAGAPEVGTPAG
FT                   APGSGVPDAGQPGGEQSPVPSPTFTMPVPPDTGMPSKLSGYAPYRSPAQQPATPPAQAF
FT                   PPPPVQQPFRPEQFPPPQAPMGR"
FT   CDS_pept        536479..536850
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04400"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55974"
FT                   /db_xref="GOA:D7GIQ2"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ2"
FT                   /protein_id="CBL55974.1"
FT                   /translation="MEIGSLAEWVTGFAEVLAVSVALFLPSWERRRATREKRLRTLRTI
FT                   RRLTPRLLTLPATSDERSGDLRMLQTFLMVTDMMNIDPGVEDVIDTGQQIASMVHQGQP
FT                   VSDHDAAAIRALLDSLPSS"
FT   CDS_pept        complement(536865..537419)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04410"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55975"
FT                   /db_xref="GOA:D7GIQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ3"
FT                   /protein_id="CBL55975.1"
FT                   /translation="MAMSDKELPPLSRVFFSQAIVSLLILPINLAMAWGMSLIFHGDPR
FT                   FRDLFYLMVVAAFIDTAVRAVVDHHYSVREDRIAPVGVASFLLGSVATLVVVVALTALL
FT                   DPRLPPIVSVGTPFLVVGAWRAIDGYRFVHTHDMSDEAIHERDLRMLELNQPTEKVAAP
FT                   PGRTLRERLANRRAGFRQPLR"
FT   CDS_pept        complement(537773..538261)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04420"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55976"
FT                   /db_xref="GOA:D7GIQ4"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ4"
FT                   /protein_id="CBL55976.1"
FT                   /translation="MRGRPDNLAFRRFLSPMVGGGVGHGHRRHPEVSAALSGAYFLRTV
FT                   LIPIYAAVAWTISLLFGGFPGFRELLFTIVPCAFLAAPIQVLITRIFVRRERRARPRSV
FT                   VPILANLAVVALIVVVAAWSTGMHRGLLISVGVAMLVTDAVTEIWLYPRKDESRPRVV"
FT   CDS_pept        complement(538598..540355)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04430"
FT                   /product="Thiamine pyrophosphate enzyme"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55977"
FT                   /db_xref="GOA:D7GIQ5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR014092"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ5"
FT                   /protein_id="CBL55977.1"
FT                   /translation="MTKVNASNAMLQVLKDWGVDTIYGLPGGSFDSTMNAIHDFRDSIR
FT                   YIGVRHEEVGALAAVAEAKLTGKIAVTFGSAGPGAAHLLNGLYDAKTDNIPVLALIGQV
FT                   PTAMMNTDFFQELNENPMFADVSVYARTVTTAEQLPQVVDTAIRTAYSKRGVAVVIIPK
FT                   DLGWAPIEDNYVSSANAFTPSDWNLAARDADVARALDLINEAQRPILYYGQGAKGAGDE
FT                   IRALSELLGLPMVSTYLGKGIVADDDPGYMLPTGRVAGKPGVDVGKTADLVLFAGSNYE
FT                   FGGHMFSPTATFIDVNLETSVIGARHAAALGVRADAPTFLRQLLELARQQGDARNDHAD
FT                   WLAAAKQDKAEWTTWVDAKAADDREPIRIEPIYAEINKHAKPDAIFGIDVGNVNISSGR
FT                   FLKLGGDKRMVTSPLYATMGFGLPAGIAAALKYQGRQIWTLSGDGGFAMVVQDLATQAA
FT                   HNLPVINIVFTNKSLGYIEAEQDDTRQPHSGVALTDVDFAKVAEAFGVKGYTVRTLAEL
FT                   RRVLDEVSDTKVPVVIDIKVTNDRMLPVEAYPVNRADRPDFDDFAAHYEATPLRPFGEI
FT                   LAGHGIHLG"
FT   CDS_pept        complement(540495..542351)
FT                   /transl_table=11
FT                   /gene="nfa14140"
FT                   /locus_tag="PFREUD_04440"
FT                   /product="Putative monovalent cation/proton antiporter"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55978"
FT                   /db_xref="GOA:D7GIQ6"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR018422"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ6"
FT                   /protein_id="CBL55978.1"
FT                   /translation="MSVAILIFVVAMLLIAASDRLAEHTGVVAPVALLALGIIVGFTPW
FT                   VPDISVDPQMIVAVILPPLLYATATSMPTMDFRRNLTPIAVLSVLLVAVSAVVLGFIFE
FT                   KMVPGIGLAVGIALGAVASPTDAVATSIVRRQGVSNRLVTVLEGEGLINDASALVIMSS
FT                   ALAAVAAHVTAGEVIGHFAQEVIVALLIGWLAGEVMVWVRARVGSVTADTVLSLVTPFV
FT                   AYLPANALHGSGLVAAVIAGLVVGREAPERLHSSHRVAAGQMWATLQLVLESTVFGLMG
FT                   IQLPGILHDVARGELHFKLAAIVAGVGLVATIVVRAVMVVPLVLGSSRRNNRREQKRPR
FT                   LEMMNEMAGKMTEKVKDGPTTVSRGGRSMTITPERASTFRHRVWRALADIDYFTEQSFG
FT                   PREGAVIVWSGMRGAVTLAAAQMLPESTPHRSFLILVAALLASASLAIQGSTLSLLVRL
FT                   VKPTKTRPVTRAELRDIYGRMREAAQDVPVPPKLMAMLNAQGEDDSEVTGDIRGPAVSL
FT                   AWNLTSRMRESGVTLTQAQRNQVSALSFRYALDVIAAQRNALLAVRDTGKFRPQALDSV
FT                   FATLDADEMALELHAGPLLTQGIEDPNAPADQDPDDRLAPLE"
FT   CDS_pept        542470..542730
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04450"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55979"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ7"
FT                   /protein_id="CBL55979.1"
FT                   /translation="MAAATNPGITTLNRYFELSNTAGQNQRDLDELLGLFARDAELESA
FT                   RGEIANGEEGLKDFFRTFFRPQRGVAPCVEHRDDRPGPCSR"
FT   CDS_pept        542672..542845
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04460"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55980"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ8"
FT                   /protein_id="CBL55980.1"
FT                   /translation="MELHHVWNTEMTGPDRVRVDWAVAGRAADGHVFALSGHDDATVDQ
FT                   HGHIQTLTVRPD"
FT   CDS_pept        complement(542998..543447)
FT                   /transl_table=11
FT                   /gene="marR1"
FT                   /locus_tag="PFREUD_04470"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55981"
FT                   /db_xref="GOA:D7GIQ9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIQ9"
FT                   /protein_id="CBL55981.1"
FT                   /translation="MTTVVSHNVGGASDLVLPVLELSSEVTSATEAIIYRHQFTPAWWQ
FT                   VLDTAHTVPDIARRLNRTRQSVQRIADILVDNEWARWDANPKHRRSQLLASTLSGRQAA
FT                   AELEGGLQGWADSVGEGLTVAEMDQFRSLLDRILHGSRDYRAHNR"
FT   CDS_pept        543843..544589
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04480"
FT                   /product="membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55982"
FT                   /db_xref="GOA:D7GIR0"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR0"
FT                   /inference="similar to AA sequence:Uniprot:Q0L9U4_9ACTO"
FT                   /protein_id="CBL55982.1"
FT                   /translation="MDWSGIAAQLGAHLRASVAGVRPGEGWWIVVAVAAALVAVVVRPV
FT                   WRWTRIAVTIVHELGHAVVGLLSGRKWQRFVVHPDMSGEVSTLGRPTGIGRVLTTAAGY
FT                   PAPAVVGAVGIWAALAGWGPLVLLALAVMALGALVRARSAFTVLALLVVLAGDLAAWWF
FT                   GDVQLVAALVCGVSAFLMLGAWRQLLNVARSDDPGQDPVVLAMLTRLPRGGWVAVFVLV
FT                   VGAFSWWALMMLWPVLGGWLGLFSGR"
FT   CDS_pept        544801..546072
FT                   /transl_table=11
FT                   /gene="PPA2042"
FT                   /locus_tag="PFREUD_04490"
FT                   /product="Putative low-affinity phosphate transport
FT                   protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55983"
FT                   /db_xref="GOA:D7GIR1"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR1"
FT                   /protein_id="CBL55983.1"
FT                   /translation="MTLTLVIIVVVVALVFDFTNGFHDSANAMATSVATGAFGARQAVA
FT                   VAAVLNVVGACLSTEVAKTISSGIVDNSLVNPQTVLAGLAGAIVWNLVTWLVGLPSSSS
FT                   HAMFGGLIGAVLVTAGMAGVHWGVVVSKIILPALVAPVVAGIAAALSTWISYKITSPTA
FT                   HHASRIFRHGQRLSASMVALAHGTSDGQKTMGIITLVLIGAGYQQSGTHPHWWVIALAG
FT                   CAIGLGTYSGGWRIMRTLGKGLVEIKPAQGFCSETASTVAILASSHLGFGLSTTHVCSG
FT                   AILGSGIGRRGAEVHWGVAGRMGIAWLLTLPAAGVVGAVASFAASKGAVGLVGVLVMLI
FT                   GAAIVVLAVARHTKVDHTNVNDSHEVTVRLSPEPEVAAATPAPVPVQATVADLLKPAAE
FT                   KPGGHHREGTDGSNPRMAGSGAGR"
FT   CDS_pept        546069..546299
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04500"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55984"
FT                   /db_xref="GOA:D7GIR2"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR2"
FT                   /protein_id="CBL55984.1"
FT                   /translation="MNIDWGALALVSVVTLIGTVVVVAAVSTAALLLDLSRARAHAGTP
FT                   APAMRVGAYAMMVVCFAMLAFGLWLIIPYFH"
FT   CDS_pept        546537..547148
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04510"
FT                   /product="NADH-flavin reductase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="1.5.1.30"
FT                   /note="Reduced riboflavin + NADP+ <=> Riboflavin + NADPH +
FT                   H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55985"
FT                   /db_xref="GOA:D7GIR3"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR3"
FT                   /inference="similar to AA sequence:Uniprot:Q5Z0I6_NOCFA"
FT                   /protein_id="CBL55985.1"
FT                   /translation="MRITIFGATGHVGSQITAEALRRGHQVTAVSHSGKTVADTTPAQA
FT                   NFDDTPAVVELANQADVTVISVPPSRTADEPIEVNLDAHQRLIDAAPDTRIVVVGGAGS
FT                   LLVDGVPLRDTPGFPDAYRREATWGIELLKRYRQAPVGVDWLIVSPSPEIGPGERTGQY
FT                   VVGTDSPVGDHITTQDFAVGILDEIEAPAHHRMRITLADK"
FT   CDS_pept        547154..547765
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04520"
FT                   /product="NADH-flavin reductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.5.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55986"
FT                   /db_xref="GOA:D7GIR4"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR4"
FT                   /protein_id="CBL55986.1"
FT                   /translation="MKIAIFGATGMVGSRLVDEAMARGHEVTAVTRNGRAIPGTTAVAM
FT                   DFTDTPAVEELANASDVVIISIPPDRSRVEPIEVNLHAHQRLIDAVPSARIIVVGGAGS
FT                   LKVGGTYLRDRPGFPEAAMRNSTWGISMLERYQASPPALDWLVVSPSPLIEPGQRTGHY
FT                   VLGIDEPAGQRVSAENFAVGILDEIEDPDHHRMRITFADK"
FT   CDS_pept        complement(547818..549677)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04530"
FT                   /product="Hypothetical transmembrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55987"
FT                   /db_xref="GOA:D7GIR5"
FT                   /db_xref="InterPro:IPR027787"
FT                   /db_xref="InterPro:IPR027788"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR5"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6L8_PROAC"
FT                   /protein_id="CBL55987.1"
FT                   /translation="MPKHHGRARGAGNQNPRRLLTTLGTSTLGTWTRQARRHAQRLNIP
FT                   LPAALGGIAGYALAHTTSLLPRTPLFQGVVAAVNASVGYELGMMAADVAALRRAPKATP
FT                   GVNPAPTTASPIVPNPLTGVPTPRPGNGSLRSGLAAAALGATLIGVPLAALRSQRRTAE
FT                   FCQVPGPRVRWAPASAAASVAILGFFTLCWRITEMLLDWLSHHLGQRLAWRLAARALAT
FT                   LVVLAGTAVLFDQVILRGIRLAGRTVADRLDHSTPAGFTQPDRAVRSGSPSSGETWDSL
FT                   GLQGKRFVSGGPDAARIARVLGSPAQDPVRVYAALDGRGLAGIARAVLDEMDRTNAWQR
FT                   QVISIVTTTGRGNANEWSASALEYLLAGDCCTIATQYSGLPSAITLFTSREQPVAATRV
FT                   LFEAVQGRLAAMPANERPQLFLAGESLGAYGSNGIFTDVDDMVAHIDGALWLGTPNFTP
FT                   MHRELTRSRDAGSSAVAPVVDRGRHIRFAGRSAQLSADEAGRPLDAWQSPRIAYLQNET
FT                   DPVVWWGTRLLYRRPEWLAEHRPATTPMGRMHWFPFVTFWQVCADMPVCRNVPEGFGHK
FT                   YHASQITPAWAGVLGRDPRADYSAIEQALIEDVTIPPIKVFGI"
FT   CDS_pept        complement(549768..552359)
FT                   /transl_table=11
FT                   /gene="hrpA1"
FT                   /locus_tag="PFREUD_04540"
FT                   /product="ATP-dependent helicase HrpA"
FT                   /function="3.1 DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55988"
FT                   /db_xref="GOA:D7GIR6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR010225"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR013689"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR6"
FT                   /inference="similar to AA sequence:Uniprot:Q6ABF4_PROAC"
FT                   /protein_id="CBL55988.1"
FT                   /translation="MFDLDRIAAGLPVGGRLDELAAALTAPDARLVVQAPPGSGKTTVV
FT                   PPLAAHHHAGRVVVTQPRRIAARAAAHRLAELSGTALGREVGFTVRGESRRSDATRVEF
FT                   VTTGVLVNRVLRDPELAGVGTVILDEVHERRLDTDLAFAMVHDVADLRDDLALIAMSAT
FT                   LDAQRWASLLGTGTPAPVVDVPGALFPLSVEWAPPPSGVLPTYGGHLDNAFAAHLARVT
FT                   AATLAQHHAADGAPASALVFVPGARDVDQLIGLLRHEPGLAGDIEVAGLYGSMAAREQD
FT                   AVLRGGGRPRVIVSTAVAESSLTVPGVRIVVDAGLSREPRLDATRGVTGLVTVRESRAS
FT                   ADQRAGRAARLGPGVAVRCFARDEWAGMSAEATAEASVSDLAGAALTLACWGSARGQGM
FT                   TLPDPLPSDALDRAIATLRGLGALDARERPTALGRRLSTLPLDPRLGRALLVGAARIGP
FT                   SRAGKVMAMLASDERVPDGDLMVQWRALSSGRSPAARRWRHEATRLERMARGSDGRPGS
FT                   ASGAPLSDQAAVGLLAALARPDWIARRREPGGRAYLTASGTGVDLLRESSLVHSEWLAI
FT                   SELTRLDTRTGPARAAHASGSLVRAATALGEQTALDAGADLLDEQDTATWDPATGRVQT
FT                   RRQRALGAIVLSSTPVRTRAAAAAGAALAALPQVGLGIDEPGLLRWSDGAVGLRNRLAF
FT                   LHSVDASAWPDVSQPALVARADTWLARPLHTTGSTFDVDVTTALRTLLDWRQLAELDRA
FT                   APERLPVPTGSQVRVRYPSPESGEQKPVLAVKLQECFGMRTTPRVSGVPVLMELLSPAR
FT                   RPLAITDDLESFWVNVYPQVRAENRRRYAKHPWPEDPLTAPPRRGTTRSGR"
FT   CDS_pept        complement(552428..553201)
FT                   /transl_table=11
FT                   /gene="cobA"
FT                   /locus_tag="PFREUD_04550"
FT                   /product="CobA Uroporphyrinogen III methyltransferase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.1.1.107"
FT                   /note="* 2 S-Adenosyl-L-methionine + Uroporphyrinogen III
FT                   <=> 2 S-Adenosyl-L-homocysteine + Precorrin 2"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55989"
FT                   /db_xref="GOA:D7GIR7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006366"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR7"
FT                   /protein_id="CBL55989.1"
FT                   /translation="MTTTLLPGTVTLVGAGPGDPELVTVAGLRAVQQAEVILYDRLAPQ
FT                   DLLSEASDDAELVPVGKIPRGHYVPQEEINQLLVAHAREGRKVVRLKGGDSFVFGRGGE
FT                   EWQACAEAGIPVRVIPGVSSATAGPALAGIPLTHRHLVQGFTVVSGHVSPSDERSEVPW
FT                   RQLAKDRLTLVILMGVAHMRDIAPELMAGGLPADTPVRVVSNASLASQESWRTTLGDAV
FT                   ADMDAHHVRPPALVVVGTLAGVDLSHPDHRAPSDH"
FT   CDS_pept        complement(553198..554091)
FT                   /transl_table=11
FT                   /gene="cbiO1"
FT                   /locus_tag="PFREUD_04560"
FT                   /product="Cobalt import ATP-binding protein CbiO"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /EC_number="3.6.3.-"
FT                   /note="Part of the ABC transporter complex cbiONQ involved
FT                   in cobalt import. Responsible for energy coupling to the
FT                   transport system - The complex is composed of two
FT                   ATP-binding proteins (cbiO), fused or not, two
FT                   transmembrane proteins (cbiQ) and a solute-binding protein
FT                   (cbiN)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55990"
FT                   /db_xref="GOA:D7GIR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005876"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR8"
FT                   /protein_id="CBL55990.1"
FT                   /translation="MSALLAAHDLVAGFPDRPRVLDTVNLAIGRGTRLALLGANGSGKT
FT                   TLLSCLAGSLKPTGGAVERDGAPIDWGRKGLREHRRHVQMVLQDPDDQLFSADVSQDVS
FT                   FGPMNLGLEPDEVHARVREALTLLGADHLAERATHQLSYGERKRVATAGAVAMRPDVLM
FT                   LDEPTAGLDPLGVHQMRDALDRLTDAGTTIVMATHDVALALDWADEVAIVCDATVHQGA
FT                   PEALLSDADLVARSHLDTPWPLALAAALGLSARPRNLDEAVAALAPALGEFAATHDAAA
FT                   SVPGSDDTTNTDEETR"
FT   CDS_pept        complement(554088..554882)
FT                   /transl_table=11
FT                   /gene="cbiQ2"
FT                   /locus_tag="PFREUD_04570"
FT                   /product="Cobalt transport protein CbiQ"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55991"
FT                   /db_xref="GOA:D7GIR9"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="InterPro:IPR012809"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIR9"
FT                   /protein_id="CBL55991.1"
FT                   /translation="MSGLHIGALDDAAWGSPWRRRRVGEKVACSMGLVLTALLAPTWPG
FT                   TLLVAVAAIALIVGAARIRPRVLLAAMSAPIVFLILGAISVLFSVGTAPADAWWHAAFL
FT                   SVGPTSVAQAARLFAHGLSGTLAVMVLATTTPMVDLLTWLRRFRVPDPLLEIASLTYRL
FT                   LFVLAETTANVLAAQRCRLGDNPVGRWNGLSRRWHNTAAAVGAIGLRAWDRSSRLTEGL
FT                   AHRGFETSLVTLPVPRVASPRLITATVVVLAAIWSISLVVAR"
FT   CDS_pept        complement(554886..555386)
FT                   /transl_table=11
FT                   /gene="cbiN"
FT                   /locus_tag="PFREUD_04580"
FT                   /product="Cobalt transport protein CbiN"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /note="CbiN is part of the active cobalt transport system
FT                   involved in uptake of cobalt in to the cell involved with
FT                   cobalamin biosynthesis (vitamin B12)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55992"
FT                   /db_xref="GOA:D7GIS0"
FT                   /db_xref="InterPro:IPR003705"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS0"
FT                   /inference="similar to AA sequence:Uniprot:Q936W5_PROFR"
FT                   /protein_id="CBL55992.1"
FT                   /translation="MSEATITNPGAGAPNPTTPASDTSGHGLFAADRKWVTPVLVVALV
FT                   VIFVGSLIIGGIRTAGQDETFVGTDSAATEAAEEAGAKPWFQPLFEPAGEVESGLFAIQ
FT                   AAIGSGIIFYCLGRMSGKKAARKQDAAIGVTAAAADASTSSAAAISPDGSTPGPTAPGS
FT                   RNA"
FT   CDS_pept        complement(555379..556086)
FT                   /transl_table=11
FT                   /gene="cbiM"
FT                   /locus_tag="PFREUD_04590"
FT                   /product="Cobalt transport protein CbiM"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55993"
FT                   /db_xref="GOA:D7GIS1"
FT                   /db_xref="InterPro:IPR002751"
FT                   /db_xref="InterPro:IPR018024"
FT                   /db_xref="UniProtKB/Swiss-Prot:D7GIS1"
FT                   /protein_id="CBL55993.1"
FT                   /translation="MHIAEGVLPPVQCAIWFAAAAPFVVHGAVQVVKQIKHHPENRLLL
FT                   ATAGACTFLLSSIKLPSVTGSSSHPTGTGVGAVLFKPPVMAFMGLIVLIFQALLLAHGG
FT                   ITTLGANTFSMAIVGPWVGYGAYVLNKKLGGPLALGIFLAMFLSDLSTYCVTSFQLAFA
FT                   YPDPSSGVLGAAEKFLGIFAISQIPLSVAEGILGILLFRFLFKVAGPQLQALGVRIGNK
FT                   RTANAEVPEVAHV"
FT   CDS_pept        complement(556396..557160)
FT                   /transl_table=11
FT                   /gene="gntR"
FT                   /locus_tag="PFREUD_04600"
FT                   /product="transcription factor (transcription regulation)"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55994"
FT                   /db_xref="GOA:D7GIS2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS2"
FT                   /inference="similar to AA sequence:Uniprot:A0ZZU8"
FT                   /protein_id="CBL55994.1"
FT                   /translation="MSEEATNQPKFMSVDRELGIEIIDGVWAVGEARALEEIQERFNVS
FT                   RTVAREAARQLEAMGLARPRRRLGLVAQPQENWRMLHPVLINWRLHSTQRMAQMRAVVQ
FT                   LRQAVEPMAAANAARIAPIPDRGRLMSLAAEMRQFSDANDEESFIDCDNEFHEVMLACS
FT                   GNELFAALGELVGIVIRARVDFDAPHPARQPTIIAHEAVAEAIFKGDADGAHAAMSTLL
FT                   SDACHDFSGVNISLPTPTEAPTTPRQRPAATK"
FT   CDS_pept        557509..558852
FT                   /transl_table=11
FT                   /gene="gnuT"
FT                   /locus_tag="PFREUD_04610"
FT                   /product="Gluconate permease (transmembrane)"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /note="SignalP : Signal peptide probability: 0.976 Max
FT                   cleavage site probability: 0.772 between pos. 39 and 40"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55995"
FT                   /db_xref="GOA:D7GIS3"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS3"
FT                   /protein_id="CBL55995.1"
FT                   /translation="MTLHLILAALAGIATIVVLIVWLKVHPFLALMGGSAVMAVSAGVS
FT                   YTDMFASFTKGVGSTFADVGLLIVMGSIIGTLLISSGGADVIVDTILDKTPVKRLPWAM
FT                   ALIAFVVGIPLFFEVGVVILIPVVMYAAHRAKLPVILLGIPALAGLSVLHGLVPPHPGP
FT                   LIAISALNANIGMTMGLGLLIAIPVLIISGPLLGRLMAKWVPITAGDDYVQKEADAVHA
FT                   DDRKPSFAISIMAVLLPVVLMLARTVAELAHIDKTTAGRFLVFLGTPLIALLITAIFAM
FT                   FVFGYLLGRTRDMMNKLVGSAFGPVAGILLIVGAGGGFKQTLVDSGIAKMIGQGLADAN
FT                   LHPLFAAWLMAVLIRLATGSATVATITAAGIMAPMVGSLPPVEGSLMVLAIGAGSVFLS
FT                   HVNDAGFWMVKEYFGMTVGQTFKTWSLMETVISVTGLACVMGVSLVVL"
FT   CDS_pept        559009..559869
FT                   /transl_table=11
FT                   /gene="gnd1"
FT                   /locus_tag="PFREUD_04620"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /function="2.1.2 Main glycolytic pathways"
FT                   /EC_number="1.1.1.44"
FT                   /note="6-Phospho-D-gluconate + NADP+ <=> D-Ribulose
FT                   5-phosphate + CO2 + NADPH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55996"
FT                   /db_xref="GOA:D7GIS4"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS4"
FT                   /protein_id="CBL55996.1"
FT                   /translation="MGRNMAERISRAGHDVIGYDRDPQVSQVADLPALVDALELPRVVW
FT                   VMVPAGAATRAVIAELAGLLAPGDMVIDGGNSHYTDDRPNAETLGDKGIRYLDCGVSGG
FT                   VWGLDNGYGLMVGGDDADVARAMPIFDALRPEGPRDEGFVHAGRIGAGHYAKMAHNGIE
FT                   YGLMHAYAEGWELLEAADDLVTDVPGCFKAWTRGTVVRSWLLDLLVKALEENPGLEGVS
FT                   DYTTDSGEGRWTLDEAVARAVPMPVLAASLFARFSSRQETSPSMQMVAALRGQFGGHEV
FT                   HRKGE"
FT   CDS_pept        560277..562151
FT                   /transl_table=11
FT                   /gene="dnaK2"
FT                   /locus_tag="PFREUD_04630"
FT                   /product="Chaperone protein dnaK 2 (Heat shock protein 70
FT                   2) (Heat shock 70 kDa protein 2) (HSP70 2)"
FT                   /function="3.9 Protein folding"
FT                   /note="Belongs to the heat shock protein 70 family. Acts as
FT                   a chaperone. Several 70 to 75 kda Hsp70 chaperones are
FT                   expressed as disctinct heat shock proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55997"
FT                   /db_xref="GOA:D7GIS5"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS5"
FT                   /protein_id="CBL55997.1"
FT                   /translation="MARAVGIDLGTTNSVIAVLEGGEPTVIPNAEGSRTTPSVVAFAKN
FT                   GEVLVGDVAKRQAVTNPERTIRSVKRHMGTSWTTKIDDKEYKPQQISGFVLQKLKRDAE
FT                   AYLGEPVTDAVITVPAYFGDAERQATKEAGEIAGLKVDRIINEPTAAALAYGLDKAEKE
FT                   QTVLVFDLGGGTFDVSLLDISDGVFEVKATKGDPKLGGDDWDQRIVNWLIEQFKAKNGV
FT                   SLEKDKMALQRLQEAAEHAKIELSQTQTTDINIPYITATQAGPLHLEETLSRAEFQRMT
FT                   QDLLDRCKTPFNAVLKDAKIGVSGIDEIILVGGSTRMPAVQDLVKELSGGKEPNRSVNP
FT                   DEVVALGASLQAGVLKGEVKDVLLLDVTPLSLGIETKGGVMTKIIERNTTIPTKKSEIF
FT                   TTAEDNQPSVMIQVYQGEREFARDNKSLGNFELTGIMPAPRGVPQIEVTFDIDANGIVH
FT                   VYAKDTATGKEQSMTVTGGSALSKDEIDKMVKDAEANEEADKKRRESVDMRNEADMLTL
FT                   RTDKLLDENGDKLSDDVKQPVVEAVAKLKEALKGTDNDDEVKAAMDDLNQKASAMGQAV
FT                   YEASQQQQAAGAAAGEQGAPASGEASSNDDDVVDAEIVDDEDKKDDSK"
FT   CDS_pept        562316..562966
FT                   /transl_table=11
FT                   /gene="grpE2"
FT                   /locus_tag="PFREUD_04640"
FT                   /product="Protein GrpE 2 (HSP-70 cofactor 2) (Co-chaperone
FT                   protein GrpE2)"
FT                   /function="3.9 Protein folding"
FT                   /note="Participates actively in the response to
FT                   hyperosmotic and heat shock by preventing the aggregation
FT                   of stress-denatured proteins, in association with dnaK"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55998"
FT                   /db_xref="GOA:D7GIS6"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS6"
FT                   /protein_id="CBL55998.1"
FT                   /translation="MTDKPAEGNGDEQPQGDFANLTPEEFLARTADGTAKEAAAGARAN
FT                   AAHDALGQAKALAAERTEDLQRLQAEYVNYKKRVDRDRDVARAKGVESVVRDLIPVLDA
FT                   IHQAEAHGELTGGFKLVADELEGLAAKHGLVIFGQAGEEFDPRFHEAMYQVPTPGTGEM
FT                   RIHEVMQKGVRVGDSLIRPARVAVSVPNGEPAGDDTAADQDDNASGDDKAPDA"
FT   CDS_pept        563028..564200
FT                   /transl_table=11
FT                   /gene="dnaJ2"
FT                   /locus_tag="PFREUD_04650"
FT                   /product="Chaperone protein dnaJ 2 (DnaJ2 protein) (Heat
FT                   shock protein 40 2)"
FT                   /function="3.9 Protein folding"
FT                   /note="Participates actively in the response to
FT                   hyperosmotic and heat shock by preventing the aggregation
FT                   of stress-denatured proteins and by disaggregating
FT                   proteins,"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL55999"
FT                   /db_xref="GOA:D7GIS7"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS7"
FT                   /protein_id="CBL55999.1"
FT                   /translation="MSTKDYLEKDYYKVLGVPKNAKPEQIKKAFRKIARENHPDQHPGD
FT                   KKAEERFKQASEANDVLSDPAKRKEYDETRSLGGPGGPGGFRFNRSAQGGGPGVNVNDL
FT                   FRNMGGAGSMGAGGLGDILGGLFGQGGTGTSTRVNATPRRGADVEGQASISFRDAVEGT
FT                   TVKLRMLSDDPCPVCHGTGAEPGTMPRVCPTCEGSGVQVSMNGTTVPCPTCHGRGLIVD
FT                   HPCHACHGSGRAEGTHTMQIRIPAGVTDGQRIRVRGKGASGENGGPRGDLYVKVQVAPD
FT                   RVFGRSGDNLTVKVPVTFPEAALGTEISVPTLTSGSVRLRIPAGTPSGRTFRVRGKGVS
FT                   KAKGGHGDLLVTIEVSVPSHLDKKATEALKAYAGVVNEPNPRDAATSDES"
FT   CDS_pept        564293..564727
FT                   /transl_table=11
FT                   /gene="hspr2"
FT                   /locus_tag="PFREUD_04660"
FT                   /product="Heat shock protein transcriptional repressor
FT                   HspR2 (Hspr2 protein)"
FT                   /function="3.5.2 Transcription regulation"
FT                   /note="Binds to three inverted repeats (IR1-IR3) in the
FT                   promoter region of the dnaK operon"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56000"
FT                   /db_xref="GOA:D7GIS8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS8"
FT                   /protein_id="CBL56000.1"
FT                   /translation="MSEPWLPQVIDPDAAIFTVSVAANLTGMHPQTLRGYDRMGLVVPK
FT                   RAKGRGRRYSPRDVTRLRLIQRLSQEEVINLNGIRRIIGLEKELDDMRQRVSEITDLMR
FT                   QMTDMQQQVQRIFTAGPTGVQPGRHRREYLRALESGPTDL"
FT   CDS_pept        complement(564886..565842)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04670"
FT                   /product="BadF/BadG/BcrA/BcrD ATPase family protein"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.7.1.59"
FT                   /note="ATP + N-Acetyl-D-glucosamine <=> ADP +
FT                   N-Acetyl-D-glucosamine 6-phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56001"
FT                   /db_xref="GOA:D7GIS9"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIS9"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6B1_PROAC"
FT                   /protein_id="CBL56001.1"
FT                   /translation="MVDPGDSEGTLLCLDAGQTITRTQFRRNGTVIGESEHAGVLTDRP
FT                   LLPQLATAVRSGLHAADSTVDVAAIGVSGLVDNADASELLDMLAGTGIREVLLAHDSTT
FT                   SYLGAIGDELGAVVAAGTGSVTLAVGATRTARVDGWGYLIGDAGSGFWIGRAALDRAMQ
FT                   AHDGRGAPTALTAVVRRDFDDLEEAYLELQADELKVSRIAGYAQSVAELAATDMVCRRI
FT                   SEEAADLLAHAVFAGLRRVGQAEREDPMVGAVGNAFRNTVLRDRFEQVLRDQLPKLRFV
FT                   EGRGNGLDGCYRMTLVAPDSALRQRINRATASERPQD"
FT   CDS_pept        566142..568406
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="PFREUD_04680"
FT                   /product="Phosphoribosylformylglycinamidine synthase II
FT                   (FGAM synthase II)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.5.3"
FT                   /note="ATP + 5 prime-Phosphoribosyl-N-formylglycinamide +
FT                   L-Glutamine + H2O <=> ADP + Orthophosphate +
FT                   2-(Formamido)-N1-(5 prime-phosphoribosyl)acetamidine +
FT                   L-Glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56002"
FT                   /db_xref="GOA:D7GIT0"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT0"
FT                   /protein_id="CBL56002.1"
FT                   /translation="MVDTVENARTTPDVVQPWEALGLKADEYARIRDLLDRRPTGAELA
FT                   MYSVMWSEHCSYKSSKIHLKRFSELPQTTPRGPLLAGIGDNAGAVDIGQGYAITFKAES
FT                   HNHPSYVEPYQGAATGVGGIVRDIMAMGARPVACMDALRFGPLHSADTKRTLPGIVAGV
FT                   GGYGNCLGLPNIGGELVFDSSYYGNPLVNALCVGVMRHEDLHFAKATGSGNKVILYGAA
FT                   TGADGIGGASVLASETFEADGPAKRPSVQVGDPFMEKLLIECTLELFHAGVVTALQDFG
FT                   AAGISCATSELASAGDGGMHCELDLVPLRDPTMTPEEILMSESQERMMAVVEPADVDAF
FT                   MAICGKWDVQATVVGEVTEDDRLIIDWHGETIVDVDPNTVAVDAPRYDRPQLRPEWLDG
FT                   VQADHANNLPRGHDGAALAEAVVAVATSPNLADKSWATSQYDRYVRGNSVLSQPEDSGM
FT                   IRVDEQTNLGVALSMDANGRYAYLNPYFGAQLALSESYRNVATTGAQPVAITDCLNFGS
FT                   PEDPEVMWQFTEAIKGLVDGCKVLGVPVTGGNVSFYNQTDGINILPTPLVGMLGVIDDV
FT                   RLRIRQGFAHAGDTVLLLGDTKQELGGSAWEDVMHGHHLGGLPPFPDFDAEIALGKVLQ
FT                   AAAKQQLVSSAHDLSEGGLAVALVESCLHGNHGVSFTLPTDLDPCAELFSETQARAVVS
FT                   LPPQSVAEFTTLCADAGVPVRELGEVCGDQLLEARGFFTVQLDELRQQWQSTIPEAMQG
FT                   A"
FT   CDS_pept        568411..569757
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04690"
FT                   /product="Zinc metallopeptidase"
FT                   /function="3.10 Protein degradation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56003"
FT                   /db_xref="GOA:D7GIT1"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT1"
FT                   /protein_id="CBL56003.1"
FT                   /translation="MASGRDQEVIDQVREVLPGVLDDLRSMVRIPSVSSQAAHAGDITA
FT                   MADQLVGYLKMLGWDDVRIIEAGGKPAVLAHYPAPEGKPTVCLYSHYDVQPTGDLDAWT
FT                   SDPFVAVERDGRLYGRGTADDKGGLGVHLAALRAFKGKPPVGVTVLFEGEEEIGSPSLD
FT                   ALLDKYTDELEADAYLICDCGNWEVGTPAFTTSLRGVVDCVVQVSTLDHAIHSGEYGGV
FT                   APDALTALCRLMATLHDERGNVAVEGLVSGHAPEQLEYPDARMRAETGVLDGVEFIGDD
FT                   SFVDRMWNKPSISVIGLDTTPIAVSSNVLIPSASARVSLRVAPGDTAENAREKLFAHLR
FT                   SHAPWGARVTLSNAEAGEPASLPFEGPIAEEARAAFATAWGTEPVLNGTGGSIGMIASF
FT                   QRAFPQATILGTAVSDPHSRMHGIDESLHLGDWRKAAASEALLLDRLAR"
FT   CDS_pept        569757..570233
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04700"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56004"
FT                   /db_xref="InterPro:IPR018961"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT2"
FT                   /inference="similar to AA sequence:Uniprot:Q0S583_RHOSR"
FT                   /protein_id="CBL56004.1"
FT                   /translation="MAEDFTPRYESYPDRLIREALERGDFADNPLRGKPVKLGRPGEQK
FT                   SWIQERLEREDLSAILPPPLQLRREKARIARTLANVPTEQQARQIIDALNERIRDANLN
FT                   PATQPRVVISLLDAEQALSDWRDAHPGAPSHGPKRGPSGPAEGRADRPGTSGQR"
FT   CDS_pept        570133..570339
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04710"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56005"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT3"
FT                   /protein_id="CBL56005.1"
FT                   /translation="MTPTRAPPRTVRSGVPAALRRVGRIAPGPAGSDNRAPLVARHRPN
FT                   RRRAVARTPPIHENQAYRLVLTG"
FT   CDS_pept        570364..572040
FT                   /transl_table=11
FT                   /gene="fhs"
FT                   /locus_tag="PFREUD_04720"
FT                   /product="Formate--tetrahydrofolate ligase"
FT                   /function="2.1.1 Specific carbohydrate metabolic pathway"
FT                   /EC_number="6.3.4.3"
FT                   /note="ATP + formate + tetrahydrofolate = ADP + phosphate +
FT                   10-formyltetrahydrofolate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56006"
FT                   /db_xref="GOA:D7GIT4"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT4"
FT                   /protein_id="CBL56006.1"
FT                   /translation="MKSDVEIAMEATLKPISQVAEALGIQPEEYDPYGRDKAKLSLSLL
FT                   DRIADRPDGKLVLVTAINPTPAGEGKTTTNIGLSMALNRLGKKAITTIREPSLGPVFGI
FT                   KGGAAGGGYAQVLPMDDLNLQFTGDMEAIGAANNLLCALLDNSLHQGNPLGIDSQRVEL
FT                   RRVLDMNDRALRNIVIGLGKRSDGVPRESGFDITVACEVMAILCLTAGMDDLKARLARI
FT                   VTSYNGDFDAVTAEQLEATGAMALLLKDAIKPNLVQTIDNTPAIVHGGPFANIAHGCNS
FT                   VLATRMALKLGDYTITEAGFGADLGAEKFFDIVCPSAGFQPDGSVLVATVRALKYNGGQ
FT                   GVKELGTEDLDALGRGMANLERHVENLRSYGVPVLVAINRFPADTEAELALVRERCTAM
FT                   GVRVVDSEVFAKGADGGIELANAVVEMCEHPTQPARFQPLYRPEQGLRASIERVAREIY
FT                   RADSVHFTSLAESQLARLTKAGFGGLPVCIAKTQYSFSDDPHLLGAPTGFEITVRELSV
FT                   RAGAGFVVAFTGNIMTMPGLPRHPAAAGMDIEADGTIIGLS"
FT   CDS_pept        complement(572142..572768)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04730"
FT                   /product="Kinase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56007"
FT                   /db_xref="GOA:D7GIT5"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT5"
FT                   /protein_id="CBL56007.1"
FT                   /translation="MAARLIQHSPDPGSRHSVPMLIAMAGLRATGKSELAEQLATRMKA
FT                   VLVQVDALEEAIIGAGIWRNEATTTAAYDAAAAVARANLRNGLDVIVDAANYKAETRAL
FT                   WVGLADELHVDHMFLVTTCSDQAEHQRRIEHHRANGDGSQLTWEQVIERNMKTAFWGDE
FT                   PRLAIDTSKGLDVDHVMALVASFASDNQPVRISKGPRRGARRAQA"
FT   CDS_pept        complement(572770..574119)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04740"
FT                   /product="UPF0210 protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56008"
FT                   /db_xref="InterPro:IPR007841"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT6"
FT                   /protein_id="CBL56008.1"
FT                   /translation="MDTTHDILETIEMIEDNRLDIRTVTMGISLLDCADHDPKVAQRKI
FT                   YDRITHQARDLVTTAQGIETELGIPIINKRITITPMSIVAAGSEVDDYTGFAETLDRAA
FT                   KEVGVDFVGGFSALMSKSSTAADRRLLDSIPAALAATDVVCSSINIGSTKAGINMTAVA
FT                   RTGEVIQELAQATDGIGCSKFVVFCNAVGDNPFMAGGFHGVEEGDCCINVGVSGPGVVK
FT                   RALDKVPEATWGEMSETIKKAAFKITRMGQLVGTMAAERLNVDFGIVDLSLAPTPAVGD
FT                   SVAEIIETMGVGTVGGHGTTAALALLNDAVKKGGLMACSHVGGLSGSFIPVSEDAAMID
FT                   AVRSGSLSLAKLEAMTAICSVGLDMIAIPGDTPASTISGIIADEAAIGMMNNKTTAVRV
FT                   IPVPGATVGDEIDFGGLMGGAPVMAVNPSSAEHLISRGGRLPAPVHSFRS"
FT   CDS_pept        complement(574123..574392)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04750"
FT                   /product="UPF0237 protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56009"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR022986"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT7"
FT                   /protein_id="CBL56009.1"
FT                   /translation="MIAIVTVTGLDHTGIVAAVSTRLCELGINILNITQTIMGDYFTMI
FT                   MQCELDESRHGIGEVADELRRTGESTQVDVRVQSEAIFHAMHEL"
FT   CDS_pept        574662..575501
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04760"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56010"
FT                   /db_xref="GOA:D7GIT8"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT8"
FT                   /protein_id="CBL56010.1"
FT                   /translation="MSDDPTAGDPYRNDPYRGGANPYGANQYGGAYRGGQPDGSYPGYP
FT                   PPGMGDTAPIPVVNEDDPDPDDKRPSRIPTILVTLFLGPFGAIAAAVSAGRAHDRGFPR
FT                   ATYWLSFIFTWAVHLLIITALVVAWLLGAFDGVLKSSSTPSPSSSPVASATPTPSATAT
FT                   PTPTTTSAAPTATSARPSASATASASATPSGVSNLADFPAGAAKMCGASIAANSATTCD
FT                   FATAVADAYLRSGSFGQAATVQATSSTTGQTYTMNCNMDARAIITCTGGNGASVYMR"
FT   CDS_pept        575602..577143
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="PFREUD_04770"
FT                   /product="Amidophosphoribosyltransferase"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /EC_number="2.4.2.14"
FT                   /note="5-Phosphoribosylamine + Pyrophosphate + L-Glutamate
FT                   <=> L-Glutamine + 5-Phospho-alpha-D-ribose 1-diphosphate +
FT                   H2O"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56011"
FT                   /db_xref="GOA:D7GIT9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIT9"
FT                   /protein_id="CBL56011.1"
FT                   /translation="MELRPGCPVSPESQTDAEHDDVPHDECGVFGVFAPGEQVSKLVYY
FT                   GLYALQHRGQESAGMAVSNGQRIMVFKDMGLVSQVFDESTLNSLRGDLAIGHTRYSTTG
FT                   ASVWKNAQPTFKPTPSGGLALAHNGNLTNTDELEAFARARVGVGGEVPHKSSMDSTNDT
FT                   SLVTTIMASYDEPLEDVAMELLPKLVGAFSLVFMNENTLFAARDPQGVRPLVLGRLHSG
FT                   WVVASETAAIDIVGGTFVREIEPGEMIAIDAAGLRSRRFAPARPKGCIFEYVYVARPDT
FT                   VIAGRRIHNVRVKVGKILAREAPADADLVIPVPESGVPAAIGYAAESGIPFGMGLVKNN
FT                   YVGRTFIQPSQTLRNLGIRLKLNPLRDVIEGKRLVVVDDSIVRGNTQRQLVRMLREAGA
FT                   AEVHVRISSPPVEWPCFYGLDFATRAQLIAPGLTNDEICRSIGADSLSYVSLEGLIQAT
FT                   HVPKDNLCRACFDGIYPIEVPPGQSAEMGLDAPEAPACGGYENVEFDRINHKEAS"
FT   CDS_pept        577140..578201
FT                   /transl_table=11
FT                   /gene="purM"
FT                   /locus_tag="PFREUD_04780"
FT                   /product="Phosphoribosylformylglycinamidine cyclo-ligase"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="6.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56012"
FT                   /db_xref="GOA:D7GIU0"
FT                   /db_xref="InterPro:IPR004733"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU0"
FT                   /protein_id="CBL56012.1"
FT                   /translation="MSDSAYARAGVDIEAGDAAVELMKAHVARTKRPEVLGGIGGFAGL
FT                   FDASKLAAYRHPLLATSTDGVGTKVAIARAMGVHNTIGWDLVGMLVDDLVVCGAEPLFL
FT                   TDYIACGHVVPERIAAVVEGIADACVSAGCALLGGETAEHPGLMEPDEYDIAGATTGVV
FT                   EADELLGPDRVQPGDVALAMASSGLHSNGYSLVRHVLLDEGGLSLDATISQLGRTLGEE
FT                   LLEPTHVYAGQVMKLLDRVSVHAMSHITGGGLAANLVRVVPQGMRVDVDRATWRPAGIF
FT                   ELVQATGDISQADIEATLNMGVGMVALLPPDQVDAAQRVLDELGLNSWACGQVSATPGQ
FT                   PATVELSGSHPLS"
FT   CDS_pept        complement(578289..578357)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04790"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56013"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU1"
FT                   /protein_id="CBL56013.1"
FT                   /translation="MDRIRTNLTERLDEFAVTVPLR"
FT   CDS_pept        578435..578665
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04800"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56014"
FT                   /db_xref="InterPro:IPR021426"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU2"
FT                   /protein_id="CBL56014.1"
FT                   /translation="MGRGRQKAKQTKVARDLKYRPVQTDFASLERELRGESAHDPDDQG
FT                   HDAIPDNYLDLAKQYDPDSADAGAADDEKHR"
FT   CDS_pept        578917..579999
FT                   /transl_table=11
FT                   /gene="pf962"
FT                   /locus_tag="PFREUD_04810"
FT                   /product="Carboxylic ester hydrolase"
FT                   /function="2.4 Metabolism of lipids"
FT                   /EC_number="3.1.1.-"
FT                   /note="recombinant protein active on 1- naphthyl actetate
FT                   and 1- naphthyl propionate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56015"
FT                   /db_xref="GOA:D7GIU3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU3"
FT                   /protein_id="CBL56015.1"
FT                   /translation="MTAWLPDLLVTGYQAHTWVIPGAKRLDNEPEGPLTATLVRRGAPR
FT                   HERAVLYLHGWDDYFFQAHVADWFDAHGFDFYAVDLRRYGRNLHEGLYAGYVSDLRDYY
FT                   QELDHSVELIRHDHPGVPITFMGHSTGGLVGALWAAERPGLLNGMLLNSPWLDMQGSPV
FT                   FWRVMAPLAGAVAAINPLMELAITDLGLYKRALHVSGEGEWNWDTDFKSNPAFVPRFGW
FT                   GRAILAGQGAVAKGLHIDTPVLTLISTRSDFSRTWNDDMHGSDLVLDVRRIGAAALHLG
FT                   DLVTIRRVRGAVHDVMLSRAPVREVIFDEIDRWLDAYVRPEGAGALYWQRLGRPAAAAD
FT                   PAVPGTPQESDGKGDVAATQ"
FT   tRNA            complement(580171..580244)
FT                   /locus_tag="PFREUD_04820"
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:580208..580210,aa:Phe)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   tRNA            complement(580258..580331)
FT                   /locus_tag="PFREUD_04830"
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:580295..580297,aa:Asp)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   tRNA            complement(580535..580607)
FT                   /locus_tag="PFREUD_04840"
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:580571..580573,aa:Glu)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        complement(580722..582440)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04850"
FT                   /product="cell-wall peptidases, NlpC/P60 family secreted
FT                   protein"
FT                   /function="1.1 Cell wall"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56016"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU4"
FT                   /protein_id="CBL56016.1"
FT                   /translation="MNPFVKTARVAITSTLVAGSLATASLVFAPLAQADYSPLAATATV
FT                   NVRQGPDTSSSVLATLSSGDTVTQRGAEQDGWLPITYNGANAWIQAQYVASTTAATQKD
FT                   QISTAELTADAYVRTAANANAWVLGTAHTGDKVGITGQASGDYTPVNFYGRAGWIATKL
FT                   LSAADASVTSIKITTAISSDYLWVRGGESTAAQSIGMLYPGDRVDVTGDPVGGWVPINF
FT                   NGKTAFVAANYSRYLTDPTVVTLSTKTDVTNKDTATSTGTDSSTAGGSTATTPTTTAPT
FT                   TTAPATKPTTTPPATTQAAASTKYTTADVNVRVGPGIDQQPVTVLKENSQVAATGKTSG
FT                   DWTEVSYDGASRWISSQYLSDTKQAEAPAPAPAPDPTPAGPTGSRWTTAALNAYGSSTQ
FT                   PKPATTVVPEGTQVELTGKQADGRSEYTWNGTTYWSATEYLGTNAPATNTSANTAKPGA
FT                   NAVETAINFAMSKLGGPYVWGGTGPVGYDCSGLMQAAYAAAGVTLPRVTWDQVNAGKQV
FT                   SVGDLQPGDLVFFYDNGHVGMYIGNGNIVNALNEDAGIVVTPISYMPISAAVRIA"
FT   CDS_pept        complement(582880..583686)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04860"
FT                   /product="ABC transporter permease protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56017"
FT                   /db_xref="GOA:D7GIU5"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU5"
FT                   /inference="similar to AA sequence:Uniprot:Q5M0V6_STRT1"
FT                   /protein_id="CBL56017.1"
FT                   /translation="MSTITSIRATPNSATTGTTMAPAGVARWRQFGLVFQWQLRRNLTL
FT                   MPLYVVVQLVLSVATVVGYGLLIGDPAPDAARYLVTGAPTISLVMLGLAMTPQFVAQSR
FT                   TEGSLDWMRALPISRPVFLLADLAVWTMVALPGLVLSIIVGALRFHLDLSMSWLIVPAA
FT                   LLIALTSASIGYAIANLCPPTLAQLISQVLVFVILLFSPLSYPADRLPQWGQAVHHWLP
FT                   LESMGEIMRHTILSADFAAPLSAWLLLAAWCAAAVAGASWALGRRS"
FT   CDS_pept        complement(583683..584270)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="nodI"
FT                   /locus_tag="PFREUD_04870"
FT                   /product="Nod factor export ATP-binding protein I
FT                   (Nodulation ATP-binding protein I)"
FT                   /function="2.8 Metabolism of nitrogen/nitrate and nitrite"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="PSEUDO:CBL56018.1"
FT   CDS_pept        complement(584354..584722)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04880"
FT                   /product="ABC transporter related precursor"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56019"
FT                   /db_xref="GOA:D7GIU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU7"
FT                   /inference="similar to AA sequence:Uniprot:A0LTR8_ACIC1"
FT                   /protein_id="CBL56019.1"
FT                   /translation="MNTVLDVRGLHKHFGKGAHRVEANAGVTMAAHAGQVVGLLGHNGS
FT                   GKTTMVNQIVGLTRPDSGTITVGGIDATTHPALARRLVSLQAQANVPITGLTPRRAIEL
FT                   VGRMRGAPARAMRSGHAN"
FT   CDS_pept        584891..585658
FT                   /transl_table=11
FT                   /gene="tetR4"
FT                   /locus_tag="PFREUD_04890"
FT                   /product="Transcription regulator, TetR"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56020"
FT                   /db_xref="GOA:D7GIU8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIU8"
FT                   /protein_id="CBL56020.1"
FT                   /translation="MAEPDEGSDIGSALSSLSAALSQLSSAVVNQTSDEINARVTDPLR
FT                   RASEQITDVAERLGSGSSARPRGIEATREALLDAAAQLFAEKGYEGTGVSEIARRAGYT
FT                   KGALYANFASKQELFKALIERELARSHEDLESSLTGASMPSGADREAVQRQVLLTLEAN
FT                   LYAIRHPQMRDEVLADTRGQLRRIAEVIARTHGEALAEGQEPAQDYLDDAMVVAAVESF
FT                   AALGTMLSDDPVAAEAVTRSRDRIIGRILGSQD"
FT   tRNA            585797..585869
FT                   /locus_tag="PFREUD_04900"
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:585830..585832,aa:Lys)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        complement(586152..587357)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_24640"
FT                   /product="Transposase for IS3514b"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56021"
FT                   /db_xref="GOA:D7GHB2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D7GHB2"
FT                   /inference="similar to AA sequence:Uniprot:Q4JUH9_CORJK"
FT                   /protein_id="CBL56021.1"
FT                   /translation="MSKNHVAVMSVVSGSMSVAQASREFGISRQHVYRLVARYRAEGPE
FT                   GLEPRSRAPRSHPNQTPARVRERIIALRRQLVGEGLDAGPLTIAWHLERDGVRPPAHST
FT                   IRRILHQAGLVRPEPDKRPRSSFIRFNADLPNQTWQSDVTHWQLADGTPADIISWLDDH
FT                   SRCLLHISAHRAVSVHTVLDTFTATIALHGPPASTLTDNGIIYTTRLLGGPNSGPNRFE
FT                   LFLEAMGIVQKNGGPHRPTTQGKIERFHQTLKRRLNAKPDAHDIADLQTVLEDFQDLYN
FT                   HRRPHTSLARRTPGDVYRASPKDRPDPTGPRPVRDSDYRVKHVRVPRAGVITLRHHGAP
FT                   HALGVGAAHAGISTVITLDATTVTVIDPTTGQILSTHHIDPHRRYWPNTQRPPGRWPKH
FT                   DP"
FT   CDS_pept        587567..587992
FT                   /transl_table=11
FT                   /gene="arsR2"
FT                   /locus_tag="PFREUD_04910"
FT                   /product="Transcriptional regulator, ArsR family"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56022"
FT                   /db_xref="GOA:D7GIV0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV0"
FT                   /protein_id="CBL56022.1"
FT                   /translation="MREDTKACTFNVESQYVDLAAEVFSLLSDATRIRIILALRDGELS
FT                   VGDLADRVRKSPTAVSQHLAKLRWGKIVQARQEGTRVFYSLIDEHARKLVAQAVFQAEH
FT                   VVGGVPPHHLNGEGVPAAPAAPDATETASATDPGQRA"
FT   CDS_pept        587989..589860
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04920"
FT                   /product="Heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type
FT                   ATPase"
FT                   /function="4.2 Detoxification"
FT                   /note="SignalP : Signal anchor transmembrane according to
FT                   TM HMM"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56023"
FT                   /db_xref="GOA:D7GIV1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV1"
FT                   /protein_id="CBL56023.1"
FT                   /translation="MTTVTGSTSRTTIRQQAGTSLWSRIDRTDLARTLFVAACTAALAL
FT                   GLDWPSPTVPLLAVIGLVVGCWPVVVEAWHDIRQRRMSMELSMLLAIIAAGVIGEWTTS
FT                   LLITTFVLAAEILEDLSMDRGRDALTALMSFLPTTVTLREGHTTRDIALDDVAPGQVLV
FT                   IGPGERVPVDGVVDKGRSTLDQSRITGESMPVDVAVGDPVYAGSINQVGALEVRAERVG
FT                   ANSSYGRIVTAVREAQSSRAPVQRMADRFAAWLVYLSIAGAIVTFLVTRDLSATISVII
FT                   VAGACGIAAGTPLAVLAAIARIARVGAFVKDGAHLEALSVVDTVVFDKTGTLTRGVPTV
FT                   TDVRTAPGVSTQQLLAWAGAAEAYSEHPLGRAIAAHVRAAGVAPGTAQSFDYQPGRGVS
FT                   VEVDGRMISAGNARLVPDAPASAADGVATPVHISVDEHYAGTILLADQVRDSARSVVAE
FT                   LRHRGLRVMMITGDQPATARAVADELGITEVRAGLLPDEKLRAIDAERAAGHRLAMVGD
FT                   GVNDAPALMRATVGIAMGSGTDIARDSADVVLISSDLNDLAATLHIARRARRIVMFNFV
FT                   GTIVVDVIGMVLAAFGLLGPVLAAVVHVGSESAFILNSARLIPGRRH"
FT   CDS_pept        complement(589997..591163)
FT                   /transl_table=11
FT                   /gene="aspB (aspC)"
FT                   /locus_tag="PFREUD_04930"
FT                   /product="Aspartate/tyrosine/aromatic aminotransferase
FT                   (transaminase A)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="2.6.1.1"
FT                   /EC_number="2.6.1.57"
FT                   /EC_number="2.6.1.5"
FT                   /note="L-aspartate + 2-oxoglutarate = oxaloacetate +
FT                   L-glutamate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56024"
FT                   /db_xref="GOA:D7GIV2"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV2"
FT                   /protein_id="CBL56024.1"
FT                   /translation="MTVSHRARNAETFHALDFAQRAADLEAQGHHVVKLSIGEPDFGAP
FT                   PAVLAAGRDALDGRPLPYTPPLGLPELRSALSDFYRDRHGVQVPAERIAITMGASAALL
FT                   LATAATTDPGDEVILADPSYPCNRELVQSFGGTVVALPTTAATRYQLDADMVERAWGDR
FT                   TTSVMIASPSNPTGTSIPFDELAAICELARSRGGWRIVDEIYLELSDASPAHTVLEVDP
FT                   DAIVTGSFSKYFGMTGWRLGWAVLPPQLVGPVERLAMNYFLSASNPTQQAALACFTPET
FT                   LEVCERRRRELGARRRLVLEGLARIGLPVPVVPDGAFYVYIDVSGTGLGAWQFCEQALD
FT                   VAHVALTPGRDFGPTTGETHVRLSYAASRGELNEGLSRLGHFLASRRG"
FT   CDS_pept        complement(591226..592191)
FT                   /transl_table=11
FT                   /gene="ApbA"
FT                   /locus_tag="PFREUD_04940"
FT                   /product="Putative 2-dehydropantoate 2-reductase
FT                   (Ketopantoate reductase) (KPA reductase) (KPR)"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="1.1.1.169"
FT                   /note="(R)-Pantoate + NADP+ <=> 2-Dehydropantoate + NADPH +
FT                   H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56025"
FT                   /db_xref="GOA:D7GIV3"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV3"
FT                   /protein_id="CBL56025.1"
FT                   /translation="MTHPSSGSAGRRPRVALIGAGAIGMAVASGLLRAGRAVVVCGGHA
FT                   PIHRIEVTEHGTTSAWAVEHTDDPTTLGDVDTAIVAVKAQQTDSAADWLRAVARPQVTV
FT                   LVAQNGVEQRERVAPYLGQPGAGASPTDAPQVVPAIVYLNVERLAPGRARVNHVGDVDL
FT                   AFPVGEAARELADELTHGGLRVRLEDDFAAAAWRKLLTNISANPLTALTGRRAEVLHEP
FT                   AIRQAAGQLMAEAVTVAQAAGIHLTHADATAALDWLATIPGDATTSMLSDRLAARPLEY
FT                   DALTGAVVRTAARVGVEVPANKLMLALLSALPSGEGPHRR"
FT   CDS_pept        complement(592188..593213)
FT                   /transl_table=11
FT                   /gene="KradDRAFT_4229"
FT                   /locus_tag="PFREUD_04950"
FT                   /product="Zinc-containing alcohol dehydrogenase
FT                   superfamily"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /EC_number="1.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56026"
FT                   /db_xref="GOA:D7GIV4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV4"
FT                   /protein_id="CBL56026.1"
FT                   /translation="MRGVIMESAGVVRVEERDDPRIIEPTDAVIRITTTCICGSDLWPY
FT                   RGVVPVHHQVMGHEYLGVVEQIGSAVTTLHVGDHVVGSFCISDNTCEICRAGYQSRCVH
FT                   GEFVSQHIGTQAEKARIPYADGTLVAMPGKPDADLIPSLMATSDVLGTGWFGAVAAGVG
FT                   KGSSVAVVGDGAVGLMAVLAAKQLGAERIIAMSRHPERQQLAREYGATDIVEERGDAGA
FT                   ERIKQMTGGLGVQCAVEAVGTEQSLMQAVDATRPGGHVGFVGVAHEGVALPMDKMFAAE
FT                   VHLFGGPAPVRRFLPELIQLVWDRKINPGKVFDLTLPLERAAEGYKAMDERTAIKVLLT
FT                   L"
FT   CDS_pept        complement(593531..593875)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04960"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56027"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV5"
FT                   /protein_id="CBL56027.1"
FT                   /translation="MVALTAAGSLIGTESARGESASRTAATTQQATSQGITQSIAVDAC
FT                   GQRAEQTIAKAAPALAVKAHDTLDTATLQRDADRWQVQIGVRIGQKQHLAHCTVTGSAT
FT                   SPAIANFVYW"
FT   CDS_pept        complement(594428..595510)
FT                   /transl_table=11
FT                   /gene="tal1"
FT                   /locus_tag="PFREUD_04970"
FT                   /product="Transaldolase 1"
FT                   /function="2.1.2 Main glycolytic pathways"
FT                   /EC_number="2.2.1.2"
FT                   /note="Sedoheptulose 7-phosphate + D-glyceraldehyde
FT                   3-phosphate = D-erythrose 4-phosphate + D-fructose
FT                   6-phosphate."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56028"
FT                   /db_xref="GOA:D7GIV6"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV6"
FT                   /protein_id="CBL56028.1"
FT                   /translation="MNPRLKALSDAGVSIWLDDLSRARITSGGLAELIKDSSVVGVTTN
FT                   PTIFAGALSNGADYAAQLTELGDVSTAEAIKQLTATDVRDACDLFAPIYQSSEGYDGRV
FT                   SIEVEPGLAHDTEATTKQAAELYKLVDRDNVLIKIPATLAGLPAIEATIAAGISVNVTL
FT                   IFSVERYRKVMDAYMAGLEKAAAAGKDLSKIHSVASFFISRVDSEIDKRLGALNHPELA
FT                   GKAGVANGLVAFGAYQEVFASERFQKLAAKGANLQRPLWASTGTKNAAYPDTLYVSDLV
FT                   ARGVVNTMPEKTMQAFADHGELGEPIDGRAAEGQATLDKIAAAGVPLAEVFDQLETEGV
FT                   DKFVASWAELVESVASAMKR"
FT   CDS_pept        complement(595709..596308)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04980"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56029"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV7"
FT                   /protein_id="CBL56029.1"
FT                   /translation="MQARQANRAAHDTRANVNAAVQAAFSAAADAQKSHQELVARSRAA
FT                   VLHDTQDNGPAFPGTQERGRFNWVMEISRDEKGLVTSLRAVSEGSHIAHDVTFIVNSDE
FT                   HAERSVHFDVIRPGRPVDLRAEQTVAMHRDRVAEATKQQAANTAGIATDMPRKLGPIDT
FT                   HLRLSIIAVTEDGTPQAYVIERTLRTTEHGSVLVYA"
FT   CDS_pept        complement(596489..596836)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_04990"
FT                   /product="PRC-barrel"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56030"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV8"
FT                   /protein_id="CBL56030.1"
FT                   /translation="MSSTDRGYDHLYGARVIDRDGAFVGDVAQVYTDQVNGEALAVTVR
FT                   TGLFGARRLLVPLINAAVGWHRIDVPYLRAHVNSAPPAGTPVRSARDAYPHLSPVTEAE
FT                   IAAHYELTTLR"
FT   CDS_pept        complement(596958..597719)
FT                   /transl_table=11
FT                   /gene="pf1420"
FT                   /locus_tag="PFREUD_05000"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56031"
FT                   /db_xref="GOA:D7GIV9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIV9"
FT                   /protein_id="CBL56031.1"
FT                   /translation="MTLRCAFVGLNSGELRYMREDGHIVDRDDKVLAGNPFDISMGVLA
FT                   SCSIPGVFKPVEMNGEWYVDGGIRENVPVEGAVSNLGVTRPYVIVSGPSGLNYDAQVGS
FT                   GDLISILFRIQSIQSDESERDEVAYARSSGAVVIEPELSVHETMEFDPGTLRINRDYGW
FT                   MRAAEAMHEADAATQQVNREIIETRLQAWKRERQMKPGSPHEFDQAMLNEVGQLKLHLQ
FT                   SLLGSADKDLLPPDAQQWWTRSEGDDAPAAS"
FT   CDS_pept        complement(597716..598528)
FT                   /transl_table=11
FT                   /gene="pf2416"
FT                   /locus_tag="PFREUD_05010"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56032"
FT                   /db_xref="GOA:D7GIW0"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW0"
FT                   /protein_id="CBL56032.1"
FT                   /translation="MSRPAWFGVLPFLGRHASTRQETPAVQGLVIAGGGARASFQIGAL
FT                   RYLYEREHIAPSVITATSAGAILGSLLAQSKDPAEQLASLRGIEKLWLAMTQPSDMFTE
FT                   RSWFTQLKSHADALDVLRQVEEKAEHDDPGHQPGLWSRFGWGTRQAAAKQEGDAKQAGA
FT                   TPTHQVTGGAATGAGESPDAPDAAPTSTDNALSPQERTLALAMSEEPGEPLGWTPNVFF
FT                   QLAAGLPPTSPRHGGAWNAIGRCSSPGRSCVACCRATSSTPSRSPPRE"
FT   CDS_pept        598718..599686
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="PFREUD_05020"
FT                   /product="Co/Zn/Cd cation transporter CzcD"
FT                   /function="1.2.3 Transport/binding of inorganic ions"
FT                   /note="Members of this family are integral membrane
FT                   proteins, that are found to increase tolerance to divalent
FT                   metal ions such as cadmium, zinc, and cobalt. These
FT                   proteins are thought to be efflux pumps that remove these
FT                   ions from cells.."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56033"
FT                   /db_xref="GOA:D7GIW1"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW1"
FT                   /protein_id="CBL56033.1"
FT                   /translation="MARVTNVTSTEKASPMRETIAGRYAAPVDLSKFAWLSIAAAVVTI
FT                   VLKSGAAWLTGSVGLLSDALESVVNLVAAIFALVALKVSIKPPDSNHPFGHSKAEYFSA
FT                   AFEGIMIFVAAVVIIYSAVERILNPRMPEQLGFGLLISVVASLINGGVGFLLIRAGKQR
FT                   RSATLSADGRHLMTDVVTSVAVIIGVGLVALTNLQVLDPIVAILAGINILWTGWRLIRS
FT                   SSEGLMDIALPPEDEAKIEGVLDRFRADGEIDFHAVRTRESGNRRFMEMHVLVPDEWSV
FT                   KRAHDLAEDVIDELVKVEPDLRVSAHLEPKSDPRSYEDIDI"
FT   CDS_pept        599715..600179
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05030"
FT                   /product="Deoxycytidylate deaminase (dCMP deaminase)"
FT                   /function="2.3 Metabolism of nucleotides and nucleic acids"
FT                   /EC_number="3.5.4.12"
FT                   /note="dCMP + H2O <=> dUMP + NH3 Deoxycytidylate deaminase
FT                   catalyzes the deamination of dCMP to dUMP"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56034"
FT                   /db_xref="GOA:D7GIW2"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW2"
FT                   /protein_id="CBL56034.1"
FT                   /translation="MATIEPGQEITVPSWDEYFLGITQAVAARAKCTRRRVGAVLVGPD
FT                   HRIIATGYNGAAPGRPDCLEGACPRGRLSYDEIPGLGDYDRPGTPGFCIAIHAEMNALL
FT                   FATRDTKGATAFITDEPCPGCRKALAAAGIVRAVWPEGEFDGDQIVDFGC"
FT   CDS_pept        complement(600205..600603)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05040"
FT                   /product="PRC-barrel"
FT                   /function="3.6 RNA modification"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56035"
FT                   /db_xref="GOA:D7GIW3"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR014747"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW3"
FT                   /protein_id="CBL56035.1"
FT                   /translation="MADDNYDDLYNSDVVASDGKKIGGVGQVYLDDKTGQPTWVTVKTG
FT                   LFGTKENFVPLVHADIANGEIKVPYAEEVVKEAPTVDPDRHLDADEEADLYKYYGIETV
FT                   PAPGTDRDEADADQADADQAGTGPNATQ"
FT   CDS_pept        complement(600766..601194)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05050"
FT                   /product="membrane efflux protein MFS"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56036"
FT                   /db_xref="GOA:D7GIW4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW4"
FT                   /protein_id="CBL56036.1"
FT                   /translation="MIISMAAYTVLGLVAAFSTNYWVFALLQAPIGLATITALVTGNTL
FT                   LQSHTSASMRGRVLSLWMLMITGITPVISPVVGHLGDWLGPRATVMFGVICVGISTVII
FT                   TWVIMHTDSLRLRFDSPRRGWWYLERRRVTDEITMPVK"
FT   CDS_pept        complement(601228..602043)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05060"
FT                   /product="membrane efflux protein MFS"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56037"
FT                   /db_xref="GOA:D7GIW5"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW5"
FT                   /protein_id="CBL56037.1"
FT                   /translation="MFASLAVPNYRIYFTGMTVSNMGQWMARTAQSWLVLTVLTDHSAT
FT                   ALGTVTALQFLPTLFLMPIAGKLADRFPKRRILMLAQLVGLIDAAVLSTLVITGVAELW
FT                   HVYLIATIDGVGSSFDSPARQSFVSEVVSGRQLSNAISLNSASFNMTRLLGPGLAGVLI
FT                   AIIGTGPVIAVNTVSFAAMIICLALLKTRDLATPARAKDGGSIHEGLRYVRRRPDLMVL
FT                   LAIGFAVGGLGFNFQISNAVMTTGIFHRGSDAFGLLDSIMGVGALAAAL"
FT   CDS_pept        complement(602377..602631)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05070"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56038"
FT                   /db_xref="GOA:D7GIW6"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW6"
FT                   /protein_id="CBL56038.1"
FT                   /translation="MARILPVLVLLALTIFAVVDLTQTDPYDVPYMPKWMWLLVVIFLP
FT                   AVGPVAWIVLSRLHGMNDGSRDGGGAPPPDDNEDWLRKL"
FT   CDS_pept        602812..603693
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="PFREUD_05080"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.5.1.-"
FT                   /note="Conversion of 1,4-dihydroxy-2-naphthoate (DHNA) to
FT                   dimethylmenaquinone (DMK). Attaches
FT                   octaprenylpyrophosphate, a membrane-bound 40-carbon side
FT                   chain to DHNA. The conversion of DHNA to DMK proceeds in
FT                   three stages: the removal of the carboxyl group of DHNA as
FT                   CO(2), the attachment of the isoprenoid side chain, and a
FT                   quinol-to-quinone oxidation, which is thought to be
FT                   spontaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56039"
FT                   /db_xref="GOA:D7GIW7"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW7"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6F0_PROAC"
FT                   /protein_id="CBL56039.1"
FT                   /translation="MATASEWLEGARLRTFPTAISPVVAGTAIAWWHGRAPLGIAALCL
FT                   VVALALVIGVNFANDYSDGVRGSDENRVGPQRLVGSGAANPSAVKRAAFACFAVSALAG
FT                   LVAVLVTGHWWLLIVGVACILAAWFYTGGRHPYGYLGLGEIFVFVFFGLVAVGGTSYLL
FT                   SARVGAPGWLTAAGIGVLACAVLVTNNLRDIVGDTASGKRTLETRIGDRATRVLYAVLV
FT                   GVAALTVVGVAALTTWWALLGLACLVFLAPACRVILGGARGMALVATLKNTGLGELCYA
FT                   LGILAGVAISMI"
FT   CDS_pept        complement(603710..605479)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05090"
FT                   /product="nuclease (RecB family)"
FT                   /function="3.2 DNA restriction and modification (and
FT                   repair)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56040"
FT                   /db_xref="InterPro:IPR019993"
FT                   /db_xref="InterPro:IPR038720"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW8"
FT                   /protein_id="CBL56040.1"
FT                   /translation="MLDSYAARSCPVKTRNRFDRTVRLPVNTSSDIAIRASTDAMQELF
FT                   TGSTAFKKEVMDALAAHPDAVDLRSLMDEDWSERSAATADAVAAGALLIIAPVLPLDVA
FT                   GHRAGQPDVLVLGPPAPDGDTGYYPVIIKRHRVLEASPRGRRQPCTPLSGGQRLLRVAG
FT                   CGVRTHREGDLLQLAHYRRILEATGWCSGGVPVAGIIGTDEILIRQGRPVLGRNRTHRP
FT                   GDLKHLVISWANLGAKRLRTFARTASSGWRYRSSLERYDHEFAFRLRIAEIAARRTGSP
FT                   DDPDPRVRPIVVHECESCPWWVACKPQLNDDDLSLRIDKARLDVHEITVLRSMGISTIT
FT                   DLACTDVEQLLPTYLPEVQHRPGAENRLRLAAERADMLAHGIAVKKTSVGPIELPAQGY
FT                   SIDLDIETSAAARVYLWGFLVNNPDDDSGPHYVSFSRFEDLGHAGERALAEEAATWLVE
FT                   QLTAHPEAKVYHYSDYEVVHIRRIARKSASPSLRELAQNWTRTNFFDLFPVVQKNFFGV
FT                   HGLGLKKLAHNGAGFNWRDEDPGGLNSQCWFAEAVHGPNHEVRAGFATRVLEYNEDDVR
FT                   ATRALRAWMRTLS"
FT   CDS_pept        complement(605606..606301)
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="PFREUD_05100"
FT                   /product="Menaquinone biosynthesis methyltransferase ubiE"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.1.1.-"
FT                   /note="Methyltransferase required for the conversion of
FT                   dimethylmenaquinone (DMKH2) to menaquinone (MKH2) /
FT                   S-adenosyl-L-methionine + demethylmenaquinol =
FT                   s-adenosyl-L-homocysteine + menaquinol / Cofactor
FT                   biosynthesis; menaquinone biosynthesis; menaquinone from
FT                   chorismate: step 7/7."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56041"
FT                   /db_xref="GOA:D7GIW9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIW9"
FT                   /inference="similar to AA sequence:Uniprot:UBIE_STRAW"
FT                   /protein_id="CBL56041.1"
FT                   /translation="MARRATLDKKREQVAGMFDDVAPRYDLLNDVMSMGQDRLWRREVV
FT                   RAVDAQPGDYVLDLAAGTGTSSAPFAAAGAHVFPTDLSFGMLEVGKQRQPDLTFVQGDA
FT                   TALPYRDDSFDAVTISFGLRNVEDTAKALEELRRVTRPGGRIVICEFSTPTWAPFRVLY
FT                   QRFYLPRVMPLLAHLGSNPDSYSYLTETIAAWPNQQALARLMSDAGWKRVEWRNLSGGI
FT                   VAMHRGFAD"
FT   CDS_pept        606498..607181
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05110"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56042"
FT                   /db_xref="GOA:D7GIX0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX0"
FT                   /protein_id="CBL56042.1"
FT                   /translation="MARRSTVLKISNLVKKYGDHTVIDHFNLQVYESDAVALTGRNGSG
FT                   KSTVLRCIVGSDKPTEGTIEVLGEKAKDTEISFRRNVATVIDDLDFFPDLSVVEHLDLL
FT                   ARAHGLEDTDELVDSILEEVQLVPQSGQLPGTLSSGQRRRLALATAFVRPKKLLVLDEP
FT                   EQRLDQEGIDWLGKRLRHEKEHNGLAIIMASHEPSLVEAVGARIVRIGGGLEETQSLAE
FT                   PEQLA"
FT   CDS_pept        607178..608983
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05120"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56043"
FT                   /db_xref="GOA:D7GIX1"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX1"
FT                   /protein_id="CBL56043.1"
FT                   /translation="MSSRNKRRNRSRKERAAQPAARPPQQRRPAPTDDPDFEGFDPDYP
FT                   FVDVGFDAQGMVDERQLLLLVKDWRKGRATRRLRDVITDAYVAMFTVVVVAAMIISGLL
FT                   SAQNQASTCTSDGCVTARKLLPWLVVAGLWVGALAISRIFGPIVASAAEGFWLLDAPLR
FT                   RSSVLARRMWGMIFAAGGVAAVVAALVTVLVGLPLPTVGAWTAAAAFTTAAWMAFTAAE
FT                   QGAERTIMVRVAQIVVGGVAVVVLVAVIASASGWLSVGLGGTGSFELAIVVAAAGLVLA
FT                   ILASLIARRRLDNVGRAKLITGGELVSGMQGAAFALDFALMRDILIERRNHLRGHVKPA
FT                   RGHWRGTRALVWRDLQRLVRSPGPLVGFLVSLVVPYALESLGVGSLTPILSALIMVAVM
FT                   VPFMDSMRVLTRTKGLARLFPMTDSELRTATTIVPASLALIWAIVVTPAFLLNLNGQAA
FT                   SVSVSNTLWYGVITAAAGLLGAMRWVSAKSANYNMPMVATGAGAVPPGLMFNLIRGIDV
FT                   AVLVTAPLVLNWPPIVSAIIAMIAFMVLRSGGINQQELMEKSEEQRKELAAQKEAARGG
FT                   GGRTRPKQVISRSGTPARTRPPLRK"
FT   CDS_pept        complement(609029..610267)
FT                   /transl_table=11
FT                   /gene="dhbC"
FT                   /locus_tag="PFREUD_05130"
FT                   /product="Menaquinone-specific isochorismate synthase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="5.4.4.2"
FT                   /note="Chorismate <=> Isochorismate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56044"
FT                   /db_xref="GOA:D7GIX2"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX2"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6F5_PROAC"
FT                   /protein_id="CBL56044.1"
FT                   /translation="MIINPGSSRLHASTIAIDDPGALTQYVDGHGAAFLRGEDGFVAMG
FT                   EVARLDGATMSEADQWWTQLAADIEKESEMPGLVGTGPLAYGTFTFDPEHTAAASAFIV
FT                   PETIIGRRDGVSWLTQLGYDRVNPQMPEVQPAPQPPAELFFEDGQISGADWLALIARTS
FT                   AALRASGAEGVVLARDLHAIAEQKICPAWLLHQWRRNYGGSTCYLVDGLVGATPEILVH
FT                   RRGGLTTSRILAGTTQRLDNVDEPAEIARLLSSQQRMHQHRLSVESAATALGAHMSGIH
FT                   VPEAPFVLALPDMLHLVTDICGVTEGTFSTLALAAAVHPLSSVTGFPTDQARTILANSG
FT                   FDRGRFCAPVGWIDAQGDGDWFVALRAAQLSPDWKGVTLYASASVDPDTAPHNKLVSTE
FT                   MKFALMRQFLAGD"
FT   CDS_pept        610613..611944
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05140"
FT                   /product="electron transfer oxidoreductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56045"
FT                   /db_xref="GOA:D7GIX3"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR011777"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX3"
FT                   /protein_id="CBL56045.1"
FT                   /translation="MVHGEVQMGDAPALASAQLSTADQDSFATEADVIVVGAGPGGSAT
FT                   AAFCAMRGLSVLLLEKSQFPREKVCGDGLTPRAVRMLTRLGIDSTETAGWARNKGLRVY
FT                   GGRTEPFELPWPELADFPDYGLVCPRSRFDDVLAGHAMKLGVTLHTGVNVTEPITADDR
FT                   IVGVRDNQGREFRAPIVVAADGNSTRLAVAMGRQRDEARPMGVAVRTYFESPRAQGEWM
FT                   ESWLELWDGRPGESNQLPGYGWAFPMADGTVNVGLGMLNSSSAFGHTDYRALMRTWLAT
FT                   TPPEWQFDEAHQRGEIRGAALPMAFNRKPAYADGLLLVGDSGGMVNPFNGEGISYAMEA
FT                   GELAADAISEAHSRGVGTPGAERALHAYPTALSSRFGGYYRLGTIFVKLIGNPQIMHLC
FT                   TTYGLPHRSLMKLVNKLLANLTDEHRGDAMDHLINTLSRLAPPA"
FT   CDS_pept        611969..612004
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05150"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56046"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX4"
FT                   /protein_id="CBL56046.1"
FT                   /translation="MTYFDGRIERK"
FT   CDS_pept        612001..612366
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="PFREUD_05160"
FT                   /product="NADH-quinone oxidoreductase chain"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56047"
FT                   /db_xref="GOA:D7GIX5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX5"
FT                   /protein_id="CBL56047.1"
FT                   /translation="MNAYIPVIGLVALATLFVVIAAIVLSPLIGPHRYNRTKYDSFECG
FT                   IQPTPQTLTGGGRFSVKYYVTAMLFIIFDIEIVFLYPWAVAFDHLGSFGVIEMITFIIV
FT                   VFVAYTYVLRRGGLNWD"
FT   CDS_pept        612385..612942
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="PFREUD_05170"
FT                   /product="NADH-quinone oxidoreductase chain B"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.99.5"
FT                   /EC_number="1.6.5.3"
FT                   /note="# Ubiquinol + NAD+ <=> Ubiquinone + NADH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56048"
FT                   /db_xref="GOA:D7GIX6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX6"
FT                   /protein_id="CBL56048.1"
FT                   /translation="MGIEEKLPAGIFLTTVEQVQGWMRQASFWPLTMGLACCAIEMISY
FT                   GGPRADCSRWGQEIFRASPRQADLMIVAGRVGQKLAPVVRQLWDQMPNPKWCIAMGACA
FT                   SSGGVFNNYAVVQGVDHIVPVDMYLPGCPPRPDMLIDAVFKLKKGKVQHTTMGAHRVQE
FT                   VAELEQKALAAPATIEQKGLMR"
FT   CDS_pept        612939..613706
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="PFREUD_05180"
FT                   /product="NADH-quinone oxidoreductase chain C (NADH
FT                   dehydrogenase I, chain C)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56049"
FT                   /db_xref="GOA:D7GIX7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX7"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6G0_PROAC"
FT                   /protein_id="CBL56049.1"
FT                   /translation="MSEQNLPDKDEAAGRAMRAADDTRKHLAQLFSPKATDAGQEVISR
FT                   VQGMWGSGKPGESGDTSGFEGMRRVISLTGSTEPPFGGWFDDVADRMAELVPGFATRVM
FT                   VHRGEITFFVDRDKLLELAKHLRDDEALRFEICVSVSGVHYPEQTGHELHAVFHLLSMT
FT                   YNRRIRLEVEVSEDDPHLPSLVPVYPMANFHERETWDMFGIIFDGHPALTRILMPDDWV
FT                   GHPQRKDYPLGGIPVEFKGAVVPPADDRRSYNR"
FT   CDS_pept        613703..615076
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="PFREUD_05190"
FT                   /product="NADH-quinone oxidoreductase chain D (EC 1.6.99.5)
FT                   (NADH dehydrogenase I, chain D)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56050"
FT                   /db_xref="GOA:D7GIX8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX8"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6G1_PROAC"
FT                   /protein_id="CBL56050.1"
FT                   /translation="MSEQYSDASRAATDDDDIFAGPGDEKGDHAYLANGGDWDQVVEAQ
FT                   RERSDETIVINVGPQHPSTHGVMRLVMEMDGETIISLRPSIGFLHTGIEKSAEYRSWSQ
FT                   GSVFFTRCNYVAGIFNEAAYSLAVDKLLGITDKMPRRGNQLRVMAMEANRIASHITAVG
FT                   ATGLDLGATSVQEVALRERERTLDFLEAVTGLRMNNAYIRPGGVENDLPEDGLDLLDEL
FT                   IRQLRKNVPEIGQYTLTNPIFVRRNKGVAHMSLASAVMMGASGPVLRSAGYPWDLRKME
FT                   PYCGYENYDFEVCTADSFDSYGRFVIRLNEIEQSLRILEQVRDELAESKGEPYRIEDAD
FT                   LSWPSDLTVASDGQGNSNEHVKHIMGESMEGLIHHFKIVSQGFHVPAGEVYMAVEAPAG
FT                   ELGMHLVSDGGTRPYRAHLRDPGFNHVQSLPLLCEGGMLSDAVMAISSIDPVMGGVDR"
FT   CDS_pept        615132..615863
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="PFREUD_05200"
FT                   /product="NADH-quinone oxidoreductase chain E"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.99.5"
FT                   /EC_number="1.6.5.3"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56051"
FT                   /db_xref="GOA:D7GIX9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIX9"
FT                   /protein_id="CBL56051.1"
FT                   /translation="MSGHEFVSAFDDADGIDAVDQSTNITEETMAEMRAIAARYPDARS
FT                   ALMPMLHLVQSVDGRVSDAGMRAVAEIAGVNTAQVNGVATFYTMYKRRPAGHQHIGVCT
FT                   TALCAVMGGDILLSHVEKKLGIHEGETTPDGKFSLERLECNAGCDFAPVMMVNWEYMDN
FT                   MTPAKADELLDKLAAGETVKSTRGATITDWRSAERVLAGFDDGRADEGPSAGESSVRGL
FT                   KIAEANNWQAPGQPGAKEVGK"
FT   CDS_pept        615860..617200
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="PFREUD_05210"
FT                   /product="NADH-quinone oxidoreductase chain F (NADH
FT                   dehydrogenase I, chain F) (NDH-1, chain F)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56052"
FT                   /db_xref="GOA:D7GIY0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011537"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY0"
FT                   /protein_id="CBL56052.1"
FT                   /translation="MTDTLTPILTKDWDTPDSWKLDTYVRGGGYDAARKALTTMKSPEV
FT                   IDLVKASGLRGRGGAGFPTGMKWSFIPQDNPKPKYLVVNCDESEPGTCKDMPMLIATPH
FT                   TLLEGIIIACYAVNAHHAFIFCRGEVLHAIRRLSQAVREAYDKGYLGKDLFGTGYDLDI
FT                   VVHSGAGAYICGEETALLSALEGHRGQPRLRPPFPAVEGLYACPTVVNNAESIASVPAI
FT                   VRNGAEWYQSMGTEKSKGATIYSLSGHVKRPGQFEAPLGITFRQILELGGGVRDGHQLK
FT                   FFTPGGSSTPMFTPEQLDVPLDYEGVSAAGSILGTKALQVFDETTSVVRTTLRWTEFYK
FT                   HESCGKCTPCREGSWWLVQTLRNLEAGKGQEGDVDKLLDVCDNVSMKSFCTLADGFVAC
FT                   ITSAIKHFRSEFEAGYHTPAWELFPYEKSALFADPDRESITMTGATA"
FT   CDS_pept        617197..619608
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="PFREUD_05220"
FT                   /product="NADH-quinone oxidoreductase chain G (NADH
FT                   dehydrogenase I, chain G)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56053"
FT                   /db_xref="GOA:D7GIY1"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY1"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6G4_PROAC"
FT                   /protein_id="CBL56053.1"
FT                   /translation="MSTDTKSSEVATKPDLVTFTIDGAEVSVPKGTLVIRAAEMIGIDI
FT                   PRFCDHPLLDPVAACRVCLVEVPDAGNGRAMKPQPACALSAMPGMKVETADSNPTVAKH
FT                   QSGMIEFLLINHPLDCPICDKGGECPLQNQAMSHGRGETRYEGVKRTYAKPTHINAEIV
FT                   FDRERCILCQRCTRFSEQISGDDFISLSERGAFSQVGEYADQPYASYFGGNIIQICPVG
FT                   ALTSADYRFQSRPHDLVSTQSSCEHCASGCELRVDHRHFQVKRRLAGNEPAVNEEWNCD
FT                   KGRFGFRSGHGDDRITTPLVRRNGALEPASWPEAIDAAAEGLSRAGESVGFLPGGRLTV
FT                   ENAFAYSRFARAVVGSNDIDFRSRAASAEEATFLTNHVVGRKLADSITFGALEKATKVV
FT                   LVSFEPEDESPMVFLRLRKAWRKNKLQVVSLAPFATRGSEKMGARLWPTAPGTEAAELD
FT                   KLAAAGELDNQTIILVGERAALSAGALTKVAELAERTGAGFAWIPRRAGELGALEAGLL
FT                   PGLLPGGRHVADASARVDVQAAWGADQLPAQSGRDAAAIIRDVASGSVEALVTAGIQAE
FT                   DFADPDAVLAAVSAAGFVVSLEQRRSEIADRADVVLPVALIEDQVGTFINWEHRERPVA
FT                   LVNEETTSPMTDVRVLAALADALGSDLGMRTPTQARLAFDEISDWSGNADKLPVEAPAT
FT                   TDAGSGNFVLSSWRLLIDDAAGLDGATALLETAPAPSVRLAPADATGLGVADGQAVTVR
FT                   VGGTTFTAPLTIVPSMVPGVVWVPGNTRNSVNSGLVAAAGTRVEVTGGAA"
FT   CDS_pept        619605..620975
FT                   /transl_table=11
FT                   /gene="nuoH"
FT                   /locus_tag="PFREUD_05230"
FT                   /product="NADH-quinone oxidoreductase subunit H (NADH
FT                   dehydrogenase I subunit H)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56054"
FT                   /db_xref="GOA:D7GIY2"
FT                   /db_xref="InterPro:IPR001694"
FT                   /db_xref="InterPro:IPR018086"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY2"
FT                   /protein_id="CBL56054.1"
FT                   /translation="MIPQENMIFGADPWWVVLIKVVVVFVAVLLWIIFNVWFERRIIAK
FT                   MQNRIGPIMNGPLGLPQTIAEGVKLLFKEDFRPARTDKLVFNLAPMLIAIAAFSSWAVI
FT                   PFGGEVTIFGHTTRLQITDLPVSVLLVLAIASIGVYGVVLAGWASNGTYSLLGSMRATA
FT                   QLISYEVAMGLSLVAVFMYAGSMSTSQIVAAQMQNLDFFGFETFFPSHYWLLLLPSFVT
FT                   YFISMFGETNRLPFDMAECESELVSGHITDYSGFRYAMFYLAEYINLLTVSAVCTTLFL
FT                   GGYSAPWPFNMIAGGALSNGWWGLLWFVLKAQFLVFSFTWVRGAVPRVRYDQLMDLGWK
FT                   VLIPINLVWILFLAVMRGGIANGWFANPAMRVIVGVIVVALLAYALWPRKKEAEPDDAD
FT                   DEVFDAFADGYPVPPMPGQKLAAYAGIVASEPAPPSRAPSGGDPSGPDSGKSIKGVL"
FT   CDS_pept        620976..621548
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="PFREUD_05240"
FT                   /product="NADH-quinone oxidoreductase subunit I (NADH
FT                   dehydrogenase I subunit I) (NDH-1 subunit I)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56055"
FT                   /db_xref="GOA:D7GIY3"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY3"
FT                   /protein_id="CBL56055.1"
FT                   /translation="MGAWSGFGITFRTMFRKSFTQGYPEKGKERLVAPRFHGRHQLNRW
FT                   PDGLEKCVGCELCSWACPADAIYVEGADNTEEERYSPGERYGRVYQINYLRCILCGMCI
FT                   EACPTRALTMTNEFKLADETRESLIYDKDRLLAPLLPGMEQPPHPRRLGDDEDDYFLGL
FT                   PPSNQLDERGVVVAARAAANNWTGVAK"
FT   CDS_pept        621545..622414
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="PFREUD_05250"
FT                   /product="NADH-quinone oxidoreductase chain J (NADH
FT                   dehydrogenase I, chain J)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.5.3"
FT                   /note="Ubiquinol + NAD+ <=> Ubiquinone + NADH + H+ /
FT                   Ubiquinol <=> Ubiquinone + 2 H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56056"
FT                   /db_xref="GOA:D7GIY4"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY4"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6G7_PROAC"
FT                   /protein_id="CBL56056.1"
FT                   /translation="MIPLVTAQAVAFWVLGPLSVIAGVGMVVNRKPVHSALCLAGLMVC
FT                   LAGLYASLDAPFLFVAQIIVYTGAVMMLFVFTMMVIGIDTVDEMIETIKGQRVAAIIGV
FT                   VGLLALLVLAVGHGIVSSPAGLEQATGADGNVRSLAYLIFSDYVFPFEATAALLITAAL
FT                   AAMVLAHGEPLFKKEQQKERINRRTKEFGEKGTQPGPLPNPGVYARHNSVDYPSLLPDG
FT                   SISDDSIIPTLAERGIVVVDKNRLLTPTKSANKAIVDVRDDQKGIVPGDDELAAEPTDE
FT                   NGLKEVNR"
FT   CDS_pept        622411..622710
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="PFREUD_05260"
FT                   /product="NADH dehydrogenase I chain K"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56057"
FT                   /db_xref="GOA:D7GIY5"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY5"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6G8_PROAC"
FT                   /protein_id="CBL56057.1"
FT                   /translation="MNPNAFIVLSAILFCIGVLGFLVRRNAIIAFMSIELMLNAANLSL
FT                   ATFANVHGNLDGQVAAFFVMVVAAAEVVVGLAIIMTIFRTRRSASVDDENLLKH"
FT   CDS_pept        622721..624628
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="PFREUD_05270"
FT                   /product="NADH dehydrogenase (quinone)"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.99.5"
FT                   /note="Acceptor + NADH + H+ <=> Reduced acceptor + NAD+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56058"
FT                   /db_xref="GOA:D7GIY6"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY6"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6G9_PROAC"
FT                   /protein_id="CBL56058.1"
FT                   /translation="MNLLQTMNPVAATGLFSYAWLMIAIPLAVAGLLLVLGKLADAWGH
FT                   LLGVLAPIASFVIALLLFISMMGSDEASRSVRVPVYTWVSAGAFSIDISMLVDQLSILF
FT                   ALLVTFVGSLIFIYSIGYMKEDPKRRRFFAFLNFFVASMMTLVLADNYIMLFIGWEGVG
FT                   LASYLLIGFWQERNSAALAAKKAFVTNKVGDLGLFAASFAMFSLFGSVRFDVVSNSVAN
FT                   VSPAWATALGCLLLLAACGKSAQVPLQVWLLDAMEGPTPVSALIHAATMVTAGVYLVVR
FT                   SHAIYALSNSASLAVAIVGLASVFAGAWIGCAKDDIKKVLAGSTMSQIGYMMLAAGLGP
FT                   AGAAFAIFHLLTHGAFKANMFLGAGAVMHGMNEDTNMHHFGALAKAMPWVFGTFACGYL
FT                   AIIGFPFFAGFYSKDHIIVAAFDKGPIFGWLALIGAGITAFYMTRLMMMTFMGNKRWLP
FT                   GVHPHKPGALMVVPLVILAIISVVGGLALNGWIQGWLEPAVANEIEPVHVFDTGWISLV
FT                   TLLAVALGVVIGVVLYRSNIAQETPVSHNFFVLAGRNELYANQFNEAVLMRPGQALCNG
FT                   LELTDNHLVDGTVRSSAAVVTGASGALRLLQNGYVRTYGVTMALGLVVIGVVMILGQLA
FT                   "
FT   CDS_pept        624643..626184
FT                   /transl_table=11
FT                   /gene="nuoM"
FT                   /locus_tag="PFREUD_05280"
FT                   /product="NADH dehydrogenase I chain M"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.5"
FT                   /note="Ubiquinol + NAD+ <=> Ubiquinone + NADH + H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56059"
FT                   /db_xref="GOA:D7GIY7"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY7"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6H0_PROAC"
FT                   /protein_id="CBL56059.1"
FT                   /translation="MTFPWLTVLGLLPLLGSVIVFALRGRGGKVAAMVFSLVTLVVGVA
FT                   TFFMTGLTEKVSWISPIGAWYALDLDGMSKVLVLLTVILVPIVLIAEWHVGDSSTQNQN
FT                   AADTTSQVAPARWSSETFMALALMLEGFTLYVFMASDLLLFYIFFEATLIPMYFLIAGW
FT                   GGARRAAAAMKFLLFSLFGGFVLLLGVIGMYAVSAGAGKPSLLTADLAGLSMGQGMERW
FT                   LFVAFFIAFAIKAPMVPVHTWLPDAAEQARPGASTLLVATLDKIGTFGMIRFCLAFFPE
FT                   ATKWASPFVLVLAVISIFYGAFMAIGSKNLLRLVAYTSVSHFGFMVLGIFSFTTESIAG
FT                   SIFYMLAHGFSAAAMFLVVGFLIDRRGSALIADFGGAQKLVPLIAGVYLTAGLATLGLP
FT                   GLANFAGEYMIMAGVWQRHLVFVAVAVVATVLAAVYIMLSYQRVFTGPATEQSEKHMTH
FT                   DLTGRERLVIAPLIALLLFFGCVPKPTFDVVNPTAKEAMVQVSMVDPQPTVKRGK"
FT   CDS_pept        626188..627744
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="PFREUD_05290"
FT                   /product="NADH dehydrogenase I chain N"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.6.5.3"
FT                   /EC_number="1.6.99.5"
FT                   /note="Ubiquinol + NAD+ <=> Ubiquinone + NADH + H+ /
FT                   Ubiquinol <=> Ubiquinone + 2 H+"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56060"
FT                   /db_xref="GOA:D7GIY8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY8"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6H1_PROAC"
FT                   /protein_id="CBL56060.1"
FT                   /translation="MHTPTIEYGLIAPLIVLIVGAIVSVLAEAFIKRGKRFSVQFAIAV
FT                   ITMAVALGLVCFDWSSQPGAAVMGALSIDGPTRVVWMLLLSFGLLSALLYGERRIGGGA
FT                   SSFAPQGHTVPGSLAERQAIAARQENSEVFALLEMSLFGMLVFSAANDLLTMFVALEIL
FT                   SLPLYVMCALARRRRLLSQEAALKYFMLGAMSSAFFLFGAALLYGYTGSFNFALMDRSI
FT                   TLSTESIGLLLAGTALVTSGVLFKVGAVPFHNWVPDVYTGAPTPVTGFMAICTKIAAFA
FT                   GLLRVLYVALGGARWDWQLVLVVIALATMLIGAVVGLAQTDVKRLLAYSSIAHAGFIMI
FT                   AVVGAVTAAGGLAAGESGSVSSVMYYLAAYGLATLGAFAILPMVRRAGGEANGFDAWAG
FT                   LGRRRPVLAVIMTLFLASMAGIPLTGGFIGKLLAFSAGWQGGYAWLAVVAICLSVVTAA
FT                   YYFRVVWIMFFKEPDMEVDVVKAGWPTWLVIIIGVVGTVVLGIAPGPVLDLFTGAAQFL
FT                   R"
FT   CDS_pept        627665..628735
FT                   /transl_table=11
FT                   /gene="idsA"
FT                   /locus_tag="PFREUD_05300"
FT                   /product="Heptaprenyl diphosphate synthase component II"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.5.1.30"
FT                   /note="all-trans-Hexaprenyl diphosphate + Isopentenyl
FT                   diphosphate <=> all-trans-Heptaprenyl diphosphate +
FT                   Pyrophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56061"
FT                   /db_xref="GOA:D7GIY9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIY9"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6H2_PROAC"
FT                   /protein_id="CBL56061.1"
FT                   /translation="MSVLLFSALRRGRYLTCSPAQHSSCADKETTLTQAEDEAFEAYVG
FT                   DQLDAVERRLSAITLTAANPFLAEAAEHIIAAGGKRFRPMLVAVTSQLGPQPNDAAAQI
FT                   AAVVVELTHVASLYHDDVMDDAALRRGVPSANAAYGNSTAIMVGDWLFARASNQVATLG
FT                   NDFVRMQADTFAELVTGQIDEMRGPQPGHDAMLHYLNVVAGKTGALIRTSAVFGAMTSG
FT                   ASREVLDALAQFGMQIGVVFQLADDLMDIMSDDSGKAPGTDLREGVSTLPTLMLAASED
FT                   SDDDELKSLIAGDLADDDVLARTLAMLRANHVIEEARADIVQRAELARKQLDLLPDGAA
FT                   TRALSRLCDEVVSRSN"
FT   CDS_pept        complement(628865..629320)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05310"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56062"
FT                   /db_xref="GOA:D7GIZ0"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ0"
FT                   /protein_id="CBL56062.1"
FT                   /translation="MSPLEAIKSCFRNYVNPNGRSGRAEFWWFLFFILVVDSVLGLLAV
FT                   LTGDHTTLADDGWFYAYMSHNVWFNALGWVFSLAMLLPFIMVQIRRFHDQDRSGWWLLL
FT                   HFIPGFGNFIVLVFMAIGGTFGPNRYGPGRYDPRAAFDPDTPLTPTR"
FT   CDS_pept        complement(629393..630598)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05320"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56063"
FT                   /db_xref="GOA:D7GIZ1"
FT                   /db_xref="InterPro:IPR008523"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ1"
FT                   /protein_id="CBL56063.1"
FT                   /translation="MSFGEAVSTCLRKFADPNGRASRAEFWYFYLALLLGNVGAFLLAT
FT                   LVSIVVPPVGGGLFLLILVANVVSLIPLLCVQARRFHDQDLSGALVLLNLFFLVIPLVF
FT                   MCLEGTRGPNRHGPDPRWGDDAGYGPALYGPGQGGYALPAPDVSYGQPGYGPQPGYGQP
FT                   DAPGFGQQAYGQGYEQSTWGRADYAQPGYGHQQAAPAWRPDASVPPSPAFGQQGAQPDP
FT                   DARSYYPDGSRDVPGEPSAAPAGGPDPAPHQSSPFPPASSYPTGGNGYPASPVRPGTQV
FT                   GPQAQPTQEPAGSRDAFMPGPQDAEPTLLDTGAHHDARNGAEDDTVRLENPAASEQTVV
FT                   LGDTAASESTVVLGDTTPVPTTDPDQFWASPGADSATRPPKNATPPPSGDDSQEPPAVT
FT                   GR"
FT   CDS_pept        complement(630686..632641)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05330"
FT                   /product="Metalloprotease (Peptidase family M13)"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /note="In bacteria they may be used for digestion of milk.
FT                   believed to be involved with milk protein cleavage.."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56064"
FT                   /db_xref="GOA:D7GIZ2"
FT                   /db_xref="InterPro:IPR000718"
FT                   /db_xref="InterPro:IPR008753"
FT                   /db_xref="InterPro:IPR018497"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042089"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ2"
FT                   /protein_id="CBL56064.1"
FT                   /translation="MSTPAFHFEDFDKSVAPTTDLFRHVNGTWLKNAVIPDDRSNWGAF
FT                   AILRENSEKAVHEIVEGLEAGDDPTTEQAKIANLYASFMDEETIEALGVSPLAPILARV
FT                   DAIASVADLASFWGWSVRHGINPLADFDNDSDPGNPNRYLMFVGQAGIGLPDEEYYRLP
FT                   DHEDLRALYLAHIRKSFDLAGVADADGQATMAFELEKQIAACHWDKVRTRDMTQMYFPQ
FT                   TWDDFTAATPTLEWDSFLAGAELPREAVSEVVNAQRTFLGDVAKLVIPENLDRWRAWAR
FT                   WQVVSGLSPYLNRDLSAQSFEFYSKGLRGVPKQRARWKRGVSVTEGVLGEAIGKRYVAK
FT                   HFPPETKAAADRLVRNLLEAYRASISTLDWMTEATRAEALDKLSKFRTKIGYPDKWRDY
FT                   SALEIAPDDLLGNVLRADSFEFDHTIEQLSGPVDRDEWFMYPQTVNAYYHPLRNEIVFP
FT                   AAILQPPFFNVDADDAVNYGGIGGVIGHEIGHGFDDQGSTCDGDGRLRNWWTDDDRKAF
FT                   EDRTHALIAQYNELAPSVCPEVHVNGELTIGENIGDLGGLSIAYQAWLLSLGGVEPAPQ
FT                   DGYTAAQRLFLGWAQVWQNTTRPEQMRQSLAVDPHSPDEIRCNQVVRNISAFHEAFGTK
FT                   PGDPMWLEPSDRVQIW"
FT   CDS_pept        complement(632789..633868)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05340"
FT                   /product="Thiamine pyrophosphate (TPP family)"
FT                   /function="2.6 Metabolism of phosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56065"
FT                   /db_xref="GOA:D7GIZ3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ3"
FT                   /protein_id="CBL56065.1"
FT                   /translation="MSIDATQADEQANGLLGVPLATTPLNRKDFVTEEPRWCPGCGDYS
FT                   ILSAFQQVLPELGIARENTMVVSGIGCSSRLPYYLNSYGIHSIHGRATTLATGLAVTRP
FT                   DLAVFVVTGDGDALSIGGNHLLHALRRNVNITILLFNNRIYGLTKGQYSPTSAVGQVTK
FT                   SSPMGAPDRPVNPVSYALGSEATFVARSLDSDREHLVSTIAAAAHHRGASLVEIYQNCP
FT                   VFNDGAFEALKGPGADEAVIPLVAGEQIRFGTDRELCVVPDANGGVRIAKVSEVKEADI
FT                   VVHDPTNPDPTRAFALSRLTDSGVMHRAPMGIFRDISLPSYDDQVRTQITQATHGEANP
FT                   SSDPALQNLINGTDTWLVE"
FT   CDS_pept        complement(633865..635754)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05350"
FT                   /product="Pyruvate flavodoxin/ferredoxin oxidoreductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56066"
FT                   /db_xref="GOA:D7GIZ4"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ4"
FT                   /protein_id="CBL56066.1"
FT                   /translation="MNPGQQTPQRQRLNRVVIRFAGDSGDGMQLTGDRFGAESAEHGND
FT                   IATLPDYPAEIRAPQGTIAGVSSFQIQFADEDIVTPGEHVDVLVAMNPAALRANLADVV
FT                   RGGLVIVDKHSFAKRALEKAGYQADPLTDGSLEGYQLVEVDITTLTATAVSAFETSRRG
FT                   AARSRNMFALGLVSWLYGRPTEDTVHWLGETFASRPSVRDANIAALRAGENYGENTEQF
FT                   AVRYEVPPAPVPAGRYRRITGNLATAYGLMVGAARAGMTLFVGSYPITPASDILHELSK
FT                   RKAFGVITVQAEDEIAGIGAALGASLGGALGVTTTSGPGFALKQEMINLAVMTELPLVI
FT                   VDVQRSGPSTGMPTKTEQGDLLQALWGRNGESPLPVFAPSSPSDCFQVTVDACRAAVEN
FT                   RTPVVLLTDAFLANGAEPWQVPDLSQIAPIDPHFATGPNGFDEKGKPTFLPYKRDPQTL
FT                   ARDWALPGTVGAEHRLGGLEKSVEAGTVSYDPANHEQMVHTRAERVARIPVPDALVDDP
FT                   EGEADLLVVGWGSSWGPITAAVRDLRAAGRHVAQVQLRTLNPLPANLDQVLHRYRRVIA
FT                   PEVNLGQLALVLRAKYLVDVRTFSKVRGQPLPVGELTQYLAGHLDEIEQEARR"
FT   CDS_pept        635926..637515
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05360"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56067"
FT                   /db_xref="GOA:D7GIZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ5"
FT                   /protein_id="CBL56067.1"
FT                   /translation="MVVEGSRAVAWLANCWRDLADALRVRVVRRGLYGTLLIAIGALSP
FT                   AYLPRSSPWWTWLSARRAEGLPSKLIGTAATMAGLLLIMSAWYRLRPGARGGAPGDATG
FT                   PAAYLTLKHWAVLAWWSLPFLAAPPIFSHDAYSYAAQGWLVHNGISPYYSGPGVLPGGF
FT                   ADQVAWVWRDTPSPYGPLAMQISHLLLHVCGFDPYWSAVAQRVPALLGVVLIGIFLPRL
FT                   ARRVGCDPAFTAWFGVLNPLLIIDFVGGAHNDSLMMGLVVFGLWLATIPGGRRYSSRSW
FT                   AAGGWWWLAGAAIIGVGATIKQPAFLAAYVVPMLARRWGSLKVGETAITVTRVLTSFAV
FT                   SIAVFAGISIATGLDFGWYNAVSVPGSVGSPAPASIVGNGVQWVMNLFGADPTAKLGIS
FT                   ITQTVFLAVGAVVLALGAVTIARKRPATFISWGYLVVAIASPALHSWYMLWGGLTLPLA
FT                   QPRRRLVAVAIWVNLALLCYDAVDMAWRNDGVAIGVAAVAASVFMTWIHQASVRVTRHP
FT                   GHATHLELPATS"
FT   CDS_pept        637682..638068
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05370"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56068"
FT                   /db_xref="GOA:D7GIZ6"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ6"
FT                   /protein_id="CBL56068.1"
FT                   /translation="MANLQQAATSTTLTFTNRERLAVLITTTLGVIGVGWSAVGLVRDG
FT                   ISARELVGFIGQTLIYLALLIGILQRRGWAVTLVRFFAFCTVAQIIVSPNYPTTARFLT
FT                   TLVFLACVVTLLWSLKGFRTVRRT"
FT   CDS_pept        complement(638127..639068)
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="PFREUD_05380"
FT                   /product="Exodeoxyribonuclease III/exonuclease III"
FT                   /function="3.1 DNA replication"
FT                   /EC_number="3.1.11.2"
FT                   /note="Exonucleolytic cleavage in the 3 prime- to 5 prime
FT                   -direction to yield nucleoside 5 prime-phosphates"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56069"
FT                   /db_xref="GOA:D7GIZ7"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ7"
FT                   /protein_id="CBL56069.1"
FT                   /translation="MLRLATYNVNGIRAAQRRGFTGWKQRCLPDVACLQEVRCPYEALP
FT                   MEAFAGFHVAYDAGELKGRNGVAVLSRTPFDAVRVWSDQAMFISPAGDARMAGADELSV
FT                   PDYPLARPLRSFNHEGRYVEVDLADQPLTVACVYVPKGDSLLAPGIRSRDPLTDEQLAG
FT                   VQRRYDRKMAFLAGFSRHLTRARRAAHAAGREFLVVGDFNIAHTRLDVKNWRPAQKASG
FT                   FLPEERAWLSEQLSPRTLVDVVRAAHPDQDGPYSWWSWMGQAFARDTGWRIDYHLASPQ
FT                   LARRSARAFVDRDHGADERVSDHAAVVVDYDL"
FT   CDS_pept        639168..639641
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05390"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56070"
FT                   /db_xref="GOA:D7GIZ8"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ8"
FT                   /protein_id="CBL56070.1"
FT                   /translation="MAREPQVFHADGPVRRTWASKLAATLAVLVVVALIVGPVVVRAVH
FT                   RSNADAAEASLLLLGLACVVVGLVAVLCAFVAVVRDRGTSRVGALLFLADAGVQVVYGL
FT                   IGISSTQMQGLADQAYSWSWAAISLLVTVVACAFTFMPPRPLTTRKDARRPVR"
FT   tRNA            639739..639821
FT                   /locus_tag="PFREUD_05400"
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:639773..639775,aa:Tyr)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        640165..640728
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="PFREUD_05410"
FT                   /product="Peroxiredoxin/Alkyl hydroperoxide reductase
FT                   subunit C /Thioredoxin peroxidase/Alkyl hydroperoxide
FT                   reductase protein C22/General stress protein 22"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="1.11.1.15"
FT                   /note="2 RSH + ROOH <=> R-S-S-R + H2O + ROH"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56071"
FT                   /db_xref="GOA:D7GIZ9"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7GIZ9"
FT                   /protein_id="CBL56071.1"
FT                   /translation="MSLVGTQILPFKASAFHQGEFVDVTDEDLKGKWSVIFFYPADFSF
FT                   VCPTELGDLADHYDQFQKMGVEIYSASTDTHFVHAAWHKESEEVKKVQYVMLGDPSGQL
FT                   ATNFQVLREGQGLADRGTFLIDPDGVIQLVEVSADGVGRDASELVRKVRAAQYVRQHPD
FT                   QVCPAHWDETGDTLTPSLDLVGQI"
FT   CDS_pept        640907..642607
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="PFREUD_05420"
FT                   /product="Alkyl hydroperoxide reductase subunit F"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="1.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56072"
FT                   /db_xref="GOA:D7GJ00"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ00"
FT                   /protein_id="CBL56072.1"
FT                   /translation="MRLPGPFIAFNPKDDMAVLDAALISQLNQLMDRVTHPVELVMSLD
FT                   DRPESAQISDMLEQVAALSANITVRRDDSAHDRRPAFSITRPGSDISITFAALPTGHEF
FT                   NSFVLALLQVGGNPVKLDEKVVAGARAITTPKNFVTYISLTCQNCPTVVQAINAMAVLN
FT                   PLITNTVVDGSLFRGEVEAEKIKATPTMYLNGELFGQGRMEAAQILSGMDSDAGASMAA
FT                   ELSSRKPYQVLVVGQGPAGVASAIYLARKGTRTALIGDRFGGQVNDTLSIENVISVPHT
FT                   EGPKLASDLRTHASQYEIDMIDGVRASELLPTTDGDDLVRVRLEGDAQLSADAVVLATG
FT                   AHWRQMGVPGEQEYRNKGVTYCPHCDGPLFKGKDVAVIGGGNSGIEAALDLAGVARHVT
FT                   VVEFMPACKADEVLLDRVDQTTNITVLTNSAVTEVVGDGSQVTGLHYDDRATGEHRELA
FT                   LDGVFVQIGLMPNTDWLKGAVKLDAHGQIVIDDRGATNVPRVFAAGDCTDVPFKQIIVA
FT                   EGAGAIAGLSAWESLIREQSTAAPKGSDAASTTGSQDARKGEPQAAMAR"
FT   tRNA            642652..642724
FT                   /locus_tag="PFREUD_05430"
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:642685..642687,aa:Thr)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   tRNA            642803..642878
FT                   /locus_tag="PFREUD_05440"
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:642836..642838,aa:Met)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        643006..643176
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="PFREUD_05450"
FT                   /product="50S ribosomal protein L33 RpmG"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56073"
FT                   /db_xref="GOA:D7GJ01"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ01"
FT                   /protein_id="CBL56073.1"
FT                   /translation="MAKKAGDVRPKITLACTVCKERNYITKKNRRNTPDRLELSKFCPR
FT                   DGRHTLHRETR"
FT   CDS_pept        643324..643758
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05460"
FT                   /product="R_hydratase_like, (R)-hydratase [(R)-specific
FT                   enoyl-CoA hydratase]."
FT                   /function="2.4 Metabolism of lipids"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56074"
FT                   /db_xref="InterPro:IPR016709"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ02"
FT                   /protein_id="CBL56074.1"
FT                   /translation="MPIGPEHVGRTYPSTAPYRVSRAKILEFVKSLGDPNPAYLADDDT
FT                   PFTAPPTFAAVIAASAWGAMFDDPDLGLSLQRTVHADQRFDIERLMREGDDVTATLTIT
FT                   KVHNRGLTDIVTIAVKLDTVDGEHLCTATSTLLNSREAAE"
FT   CDS_pept        643755..644186
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05470"
FT                   /product="R_hydratase_like, (R)-hydratase [(R)-specific
FT                   enoyl-CoA hydratase]"
FT                   /function="2.4 Metabolism of lipids"
FT                   /note="Catalyzes the hydration of trans-2-enoyl CoA to
FT                   (R)-3-hydroxyacyl-CoA as part of the PHA
FT                   (polyhydroxyalkanoate) biosynthetic pathway. The structure
FT                   of the monomer includes a five-strand antiparallel
FT                   beta-sheet wrapped around a central alpha helix, referred
FT                   to as a hot dog fold. The active site lies within a
FT                   substrate-binding tunnel formed by the homodimer"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56075"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ03"
FT                   /protein_id="CBL56075.1"
FT                   /translation="MSAFDPAAVRAGDVLPPLTLTITRGGIVRYAGASTDFNPIHWSDR
FT                   KARELGLPGVLAHGMWTMGASLRIITDWCADPRRVLDYQVRFTRPVQVPDDDRGVQVQV
FT                   SASVTGVEAGVATVAVDARIDHEGKPVKVLGNARAHIRL"
FT   CDS_pept        644256..645389
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="PFREUD_05480"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase
FT                   (UDP-N-acetylmuramate dehydrogenase)"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="1.1.1.158"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56076"
FT                   /db_xref="GOA:D7GJ04"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ04"
FT                   /protein_id="CBL56076.1"
FT                   /translation="MSIADEEDYDLFDSCELDPTSGILPEREISDSPVLADHTSFHIGG
FT                   RAKRFVVARTEAEVLDEVKRADEAGEPLLVLSGGSNMLVSDDGFDGTVLQIATRGVEGE
FT                   ISGCGGAVMNIAAGENWDDFVQLAISREWRGVEALSGIPGMVGSTVIQNVGAYGAEVGE
FT                   LVYRVRTWDRQEKSYRTFANADCKFSYRNSIFKQSRLPGSPTGRYVVLEVTLQFLLGNM
FT                   SMPIRYAELAHRLGIEVGEHAPAQKVRDEVLALRRSKGMVIDPDDHDTWSAGSFFTNPI
FT                   LTSQVAAGLPEDAPRFDAGGGMVKTSAAWLIDHAGFHKGFGEGAATLSGKHTLALTNRG
FT                   QATAADVVALARQIREGVHQALGITLVPEPVLVGLSL"
FT   CDS_pept        645411..646895
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05490"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56077"
FT                   /db_xref="GOA:D7GJ05"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ05"
FT                   /protein_id="CBL56077.1"
FT                   /translation="MATRASSRLLEWGTSALVTALFVVLWWRQRAVSPATHEEASSLLH
FT                   AQLGVGGLWTATAHADRSWFAYWLCLVPMGSGPDALTVARTFSLVCAAVMVFALAATAG
FT                   RLWGTGGALVAGGFLVANPAIVTLALSARGEMLGLALLALASWLLVALLESYQDLGLGP
FT                   GIVYGLLLAAMVVCDLTLAPVMVAHLFYAATMRPSGEGWRQLVPGWLAGAAIAVLIWAN
FT                   GHAGYTVAPGPQDGSGQLRAVVRLLLDASGDFPGQVMLGGAALIIIIAIVNTHGNAFFD
FT                   TGLGLAVLMVVAQPGADLLLALTGRATPPDQVLGATTLGAALLLGCAAGQWRGANMQSL
FT                   VVLLLAAGLGIFGWRSYSQVKPSWRNADGNPPLARDLMLTTAPGDVVAVDEKSGPGLTG
FT                   AIALAMGDQRLWQEARDQLTAASPRVFLVAGHEPWASAPASTAQAGGNLTGAGLTGSVR
FT                   WVSLDASSAPDWQHCTIKDSDPYARATVTHLECAAS"
FT   tRNA            647086..647161
FT                   /locus_tag="PFREUD_05500"
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:647119..647121,aa:Trp)"
FT                   /inference="ab initio prediction:tRNAscan-SE:1.21"
FT   CDS_pept        647328..647915
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="PFREUD_05510"
FT                   /product="SecE/Sec61-gamma subunit of protein translocation
FT                   complex"
FT                   /function="1.6 Protein secretion"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56078"
FT                   /db_xref="GOA:D7GJ06"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ06"
FT                   /protein_id="CBL56078.1"
FT                   /translation="MADRSERAKRRAEQAQSGPVKRHRSTGEHMEADDLPGSMLPEANG
FT                   EPDPAVIDDADAEELTNADDTVDSTPDKGDPDDVRIDDESQLDEAERRADEAQDEKPTP
FT                   IVRKHSTSPVRKAGGARAKAGKPTQAKKGHKRAGPITFTKQSVGELKKVVWPTGEQTGQ
FT                   YFVVVLVFVLFIMAVVAGLDFGLTRLLLWLFG"
FT   CDS_pept        647935..648822
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="PFREUD_05520"
FT                   /product="Transcription antitermination protein NusG"
FT                   /function="3.5.4 Transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56079"
FT                   /db_xref="GOA:D7GJ07"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ07"
FT                   /protein_id="CBL56079.1"
FT                   /translation="MTQTPDEGDNKPLEETELNLGSNDDQGDTDTGINLDFADFSDDDA
FT                   KSGAELNLGPLPTEEGEADKAEPAADQDAEKPDEPDEKAPSQEDEAVAKALEELHDDLV
FT                   VKPGEWYVVHTYSGMENRVKQNIDNRVKSLNMEDYIYETVVPTEDAVEMRKGQRKKVTR
FT                   VFMPGYVLVRMEMTDESWSTVRHTPSVTGFVGQGQTPAPLDLSEVEHMLTPSVTAQVVA
FT                   SGEAKAGADQEKVEVVDYAVGDQVMVIDGPFAGVHATITEINTHNQRLKADVEILGRET
FT                   PVDLTFPQIQKVID"
FT   CDS_pept        648932..649360
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="PFREUD_05530"
FT                   /product="50S ribosomal protein L11"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56080"
FT                   /db_xref="GOA:D7GJ08"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ08"
FT                   /protein_id="CBL56080.1"
FT                   /translation="MPPKKKVAAVVKIAIAAGSATPAPPVGTALGPHGVNIMEFVKAYN
FT                   AKTEAQRGTIVPAEITIYEDRTFDFITKTPPAAELIKKAAGVQKGSGQPDKEKVGTITS
FT                   DQVREIAETKMPDLNANSVEQAMKIVAGTARSMGVTVK"
FT   CDS_pept        649482..650192
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="PFREUD_05540"
FT                   /product="50S ribosomal protein L1"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56081"
FT                   /db_xref="GOA:D7GJ09"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ09"
FT                   /protein_id="CBL56081.1"
FT                   /translation="MKHSKRYRADAALSDPEQLYTPDEALAIIKQYTPGKFDETVEVSM
FT                   RLGVDPRKADQMVRGTINLPNGTGKTARVLVFAQGAKATEALEAGADEVGGDDLIARVN
FT                   DGYLDFDAVVATPDLMGKVGRLGRVLGPRGLMPNPKTGTVTMDVTKAVSDIKGGKIEFR
FT                   VDRHSNLQFIVGKLSFTTEALEQNFRAAADEVYRLRPSTSKGRYVKKITVSTTMGPGVQ
FT                   VDPVAARPASEVSS"
FT   CDS_pept        650368..651231
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="PFREUD_05550"
FT                   /product="Lipoyltransferase
FT                   (Lipoyl-[acyl-carrier-protein]-protein-N-lipoyltransferase)
FT                   (Lipoate-protein ligase B)"
FT                   /function="2.5 Metabolism of coenzymes and prosthetic
FT                   groups"
FT                   /EC_number="2.3.1.-"
FT                   /note="Catalyzes the transfer of the endogenously
FT                   synthesized lipoate to apoproteins, creating an amide
FT                   linkage that joins the free carboxyl group of lipoic acid
FT                   to the epsilon-amino group of a specific lysine residue in
FT                   lipoate-dependent enzymes. Utilizes
FT                   lipoyl-acyl-carrier-protein as a source of lipoyl groups."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56082"
FT                   /db_xref="GOA:D7GJ10"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ10"
FT                   /protein_id="CBL56082.1"
FT                   /translation="MTDQREEATVQPTTPQAVNGVLPPNWVPHPAGLDYERHCLDAAPG
FT                   ALYDYETGWEHQREILDAVAHHRSPNRVLYVQHESVYTAGRQTQPEDRPFDGTPVVDVD
FT                   RGGRITWHGPGQLVGYPIIFLQRGVGVVDYVRRVEEAVIRLLAQYGIATGRIPGRTGVW
FT                   LASDGIRPERKICAIGVRCAHQTTMHGFALNVDPAFDRFDNIVPCGIDDADVTSIRREL
FT                   GRAPSLSQVADDLTPHLTEMMSFAPYQMSPDVPRTQHAAFHHPTADHPAADHHQPQPNV
FT                   VKEIRL"
FT   CDS_pept        651228..652178
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="PFREUD_05560"
FT                   /product="Lipoic acid synthetase"
FT                   /function="4.6 Miscellaneous"
FT                   /EC_number="2.8.1.-"
FT                   /note="Octanoyl-[acyl-carrier-protein] + 2 sulfurs =
FT                   lipoyl-[acyl-carrier-protein]. Catalyzes the
FT                   radical-mediated insertion of two sulfur atoms into an
FT                   octanoyl group bound to acyl-carrier-protein (ACP) to
FT                   produce a lipoyl group"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56083"
FT                   /db_xref="GOA:D7GJ11"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ11"
FT                   /protein_id="CBL56083.1"
FT                   /translation="MTTPAQGRRLLRIEKKNSQTPIEKGRPAWLRTRLSMGPEYLDVRE
FT                   RTGGEGLHTVCQEAGCPNIFECWEDREATFLIGGEHCTRRCDFCQIESARPTGYDRDEP
FT                   RRVGESVKQLGLRYATITSVCRDDLPDEGAWLCAETIRQVHSQNPGVGVEMLAQDFSAK
FT                   QELLDQVFEAAPEVFGHNVETVPRLFKQIRPGFDYDRSLQVLTMAHEAGVISKSNLILG
FT                   MGETDDEVAQALQDIHDAGAELVTITQYLRPNVTLRPVDRWVTPQQFVEFGKLADQIGF
FT                   MGVMSGPLVRSSYRAGKLYRQAMSGREAAAQAAEA"
FT   CDS_pept        complement(652368..653255)
FT                   /transl_table=11
FT                   /gene="tnpB"
FT                   /locus_tag="PFREUD_24650"
FT                   /product="Transposase"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56084"
FT                   /db_xref="GOA:D7GE48"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D7GE48"
FT                   /inference="similar to AA sequence:Uniprot:A0QCS7"
FT                   /protein_id="CBL56084.1"
FT                   /translation="MDGRRLGVELICRLLQVAPSSYYAAKTRAPSARALRDEELIPQLV
FT                   EIWEANYRVYGVRKLWKAARRGGIMIGRDQTARLMRVAGIEGARRSKRVKTTRPDPASS
FT                   RHPDLVKREFTATAPNRLWVTDLTFVPTWAGVAYVCFIIDAFSRMIVGWRVASHMRTEM
FT                   VLDAIEMARWSRGAHHEDLRCHSDAGCQFTSIRYGERLAEIGATPSIGTVGDSYDNALA
FT                   ETVNGYYKAELVRGPTRSGPWKTVEDLELATLGWVHWHNTQRLHGYLGDVPPAEFENAF
FT                   YAVPNDSNLLIGIK"
FT   CDS_pept        complement(653288..653632)
FT                   /transl_table=11
FT                   /gene="TnpD"
FT                   /locus_tag="PFREUD_24660"
FT                   /product="Transposase IS3/IS911"
FT                   /function="4.5 Transposon and IS"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56085"
FT                   /db_xref="GOA:D7GE49"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D7GE49"
FT                   /inference="similar to AA sequence:Uniprot:Q1BDJ0_MYCSS"
FT                   /protein_id="CBL56085.1"
FT                   /translation="MPKELANGKPTTRRYSVEEKAAAVRMVRTLRAELGVTQGTVQRVA
FT                   TQLGYGVESVRMWVKQADVDDGVVPGVSSAEEQRVKELEQENRELRRANEVLKRAASFF
FT                   GAELDRHYRK"
FT   CDS_pept        653935..654582
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="PFREUD_05570"
FT                   /product="50S ribosomal protein L10"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56086"
FT                   /db_xref="GOA:D7GJ14"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ14"
FT                   /protein_id="CBL56086.1"
FT                   /translation="MARPDKAAAVAELTEKFTESNATVLTEYRGLSVQDLQDLRRSLGD
FT                   NASYAVVKNTLTKLAAKEAGVEGLDDQLTGPTAVAFISGDIATVAKGLRDFAKANPLLV
FT                   IKGGVMDGQILDAETVTKLADIGSREELLAKLASAMKASMSNAVATFAAPLSQAARLMG
FT                   ALESKAQGDPSVIGGAGTPAADQKQDTAEESAPEAASAAEESADAADAASNE"
FT   CDS_pept        654599..654994
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="PFREUD_05580"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56087"
FT                   /db_xref="GOA:D7GJ15"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ15"
FT                   /protein_id="CBL56087.1"
FT                   /translation="MAKLSTEELLDQFKDMTLIELSDFVKAFEDAFDVKAAAPVAVAAA
FT                   PAAGAGEGEGAADDANAEVDVVLDSIDSSKKIQVIKEVRALTSLGLKDAKDLVESAPKI
FT                   VLEKVNKDTANDAKEKLEGAGATVSFK"
FT   CDS_pept        655241..655891
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05590"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56088"
FT                   /db_xref="GOA:D7GJ16"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ16"
FT                   /protein_id="CBL56088.1"
FT                   /translation="MMKGEVPRMARRHWWRRIIPGLSTSVRLVAIGVAVLVVAVMTVVN
FT                   VMTSKNTNQPGSRAGTWNTALPSTGVPTAASSSSNAVSTDSRAYSELVRLSDQGWTATQ
FT                   PLTNQWVAELGSSVVVPPSQPTPTPSGSASPSGAPAALARFESAQKNDPGAGREVRLLR
FT                   RSTYNPPVVDDRFTFVIIVSGTFSTADDVRNWCSDQFGSAPPDRCDPLQLHPR"
FT   CDS_pept        656217..659693
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="PFREUD_05600"
FT                   /product="DNA-directed RNA polymerase beta chain (RNAP beta
FT                   subunit) (Transcriptase beta chain) (RNA polymerase subunit
FT                   beta)"
FT                   /function="3.5.3 Transcription elongation"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56089"
FT                   /db_xref="GOA:D7GJ17"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="InterPro:IPR042107"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ17"
FT                   /protein_id="CBL56089.1"
FT                   /translation="MAASRTALNNSDVVSTTGRISFAKIREPLGIPNLLDLQVKSFNWL
FT                   VGNENWQNEVDQALSEGRTDVNTKSGLEEIFEEISPIEDFSQTMSLSFRDHRFEEPKYT
FT                   IEECKDRDATYAAPLFVTAEFMNNDTGEIKSQTVFIGDFPLMTDKGTFIITGTERVVVS
FT                   QLVRSPGVYFEQTPDKTSDKDIFTCKVIPSRGAWLEFEIDKRDTVGVRLDRKRKQNVTV
FT                   LLKALGWTEERILEEFGEYESIRMTMEKDHVTTQDEALLDIYRKLRPGEPPARDAAQTL
FT                   LDNFYFNPKRYDTAKVGRYKINKKLGLSLPYDQQVLTMDDIVAAIHYICALHEGKTELA
FT                   DGLPVEPDDIDHFGNRRVRTVGELIQNQLRTGLGRMERVVRDRMTTQDIEAITPQTLIN
FT                   VRPVTAALKEFFGTSQLSQFMDQNNPLAELTHKRRLSAVGPGGLSRDRAGMEVRDVHPS
FT                   HYGRMCPIETPEGPNIGLIGSLASFARVNAFGFIETPYRKVDKGLVTDHIDYLTADEED
FT                   RFVIAQANATMNDKGELTEDRVLVRVSHGDVDLVPADEVDYIDVSARQMVSVGSALIPF
FT                   LEHDDSSRALMGANMQRQAVPLVRNESPYVGTGMEYRAAVDVGEVTLASKPGTVTGVTG
FT                   DLIDIACDDGTYQTFKLEKFQRSNAGTCVNQRPIVTPGQHVEAGTPLADGPCTDQGELA
FT                   LGRNLLCAFMPWRGLNYEDAIIISQRVVSEDILTSIHIEEYEVDARDTKLGPEEITHDI
FT                   PNVSDDMIASLDDRGIVRIGAEVRPGDILVGKVTPKGETELTPEERLLRAIFGEKAREV
FT                   RDTSMKVPHGEEGTVIGVRIFDREENDELPPGVNQMVRVYVAQKRKVQVGDKLAGRHGN
FT                   KGVISRILPIEDMPFMADGTPVDIMLNPLGVPSRMNLGQVLEMHLGWIAHSGWDLGDAT
FT                   DPWAEHLREVGLEHVDGDVRLATPVFDGAEEHEITGLLAHGLPNRDGDHIVDSDGKTTL
FT                   FDGRTGEEFPEEVGVGYMYMLKLHHLVDDKIHARSTGPYSMITQQPLGGKAQFGGQRFG
FT                   EMEVWALEAYGAAWALQEMLTIKSDDVAGRVKVYEAIVKGENIPEPGIPEGFKVLVQEM
FT                   KSLCLNVEVLGSDGAVIDLRETEDDYRTVDELGIDLSRRPGTDSYKLESEG"
FT   CDS_pept        659795..663685
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="PFREUD_05610"
FT                   /product="DNA-directed RNA polymerase beta chain (RNAP beta
FT                   subunit) (Transcriptase beta chain) (RNA polymerase beta
FT                   subunit)"
FT                   /function="3.5.3 Transcription elongation"
FT                   /EC_number="2.7.7.6"
FT                   /note="RNA polymerases catalyse the DNA dependent
FT                   polymerisation of RNA. Prokaryotes contain a single RNA
FT                   polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56090"
FT                   /db_xref="GOA:D7GJ18"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ18"
FT                   /protein_id="CBL56090.1"
FT                   /translation="MLDVNTYDTLKIGLATADQIRGWSYGEVKKPETINYRTLKPERDG
FT                   LFGEQIFGPTRDWECACGKYKRVRFKGIVCERCGVEVTRSNVRRERMGHIELAAPVTHI
FT                   WYFKGVPSRLGYLLDIAPKDLEKVIYFAAYMITRVDEDARSRDLSSLEAKVATEHKHIE
FT                   GRRDADVEKRMSKLEEDLAKLEEEGAKADAKRKVKDGGEKELKTIRDRAQRELDRLDAV
FT                   WDRFKGLKVQDLEGDEVLYREMKNRFGKYFDGFMGAEAVKRRLETFDLAAEADSLRETI
FT                   LTGKGQRKTRALKRLKVVSAFLDTGNSPMGMVLDAVPVIPPDLRPMVQLDGGRFATSDL
FT                   NDLYRRVINRNNRLKRLLDLGAPEIIVNNEKRMLQEAVDSLFDNGRRGRPVTGPGNRPL
FT                   KSLSDMLKGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKMHQCGLPKQMALELFKPFVMK
FT                   RLDDLNYAPNIKSAKRMVDRQRPQVFDVLDEVIREHPVLLNRAPTLHRLGIQAFEPLLI
FT                   EGKAIQLHPLVCAAFNADFDGDQMAVHLPLSAEAQAEARILMLSSNNILKPADGKPIAL
FT                   PSHEMIIGMYYLTQDLDGLTGEGRAFSSKAEAVMAYDLHQLDLRAKCKIRLSGVVPPVG
FT                   LEDKQRADGSLLLDTTLGQVIFNEALPDNYPYVTSHVGKKQLSAIINDLAIRFPRPVVV
FT                   ATLDNLKDMGFRWGTQSGVTVSIGDVQTPPNKPEIMASYEKKAAKIDKLYDRGAVTEEE
FT                   RRGELVQIWNDATAELTDAMEKNFTKTNPIYMMVNSGARGNMTQMRQIAAMRGLVANPK
FT                   GEIIERPIKSNFREGLTVLEYFISTHGGRKGQADTALRTADSGYLTRRLVDVSQDVIIR
FT                   EEDCGTERGLMKAIAEPGADGMLVPAKMLDTSVHGRILATDATDESGKVVIEAGTMLDS
FT                   TVVGNAIRAGITSIKVRSVLTCEATTGACAKCYGLSLANGKMVEVGEAVGIQAAQSIGE
FT                   PGTQLTMRTFHTGGVAGDDITQGLPRVVELFEARTPKGKAPIAEADGRVKIEETDRGRK
FT                   LTIVRDDGGEDVEYALPRRARLEFEDSNRVRHSIADGVHVGVGEQLTGGTIDPQDVLRV
FT                   RGLRKVQEHLVEEVQKVYASQGSPIHDKHIEIVIRQMLRRVTVIESGDTPMMPGELVDR
FT                   KTYEAANRKAVEEGGRPAEGRPVLMGITKASLATESWLSAASFQETTKVLTDASIHGKS
FT                   DHLVGLKENVILGKLIPVGTGLERYRDIRVEPTAEAKANSFQVNYDPFDYDFGSGSGAA
FT                   VPLDDLDFGDLR"
FT   CDS_pept        664145..664516
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="PFREUD_05620"
FT                   /product="30S ribosomal protein S12"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56091"
FT                   /db_xref="GOA:D7GJ19"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ19"
FT                   /protein_id="CBL56091.1"
FT                   /translation="MPTIQQLVRKGRSDKVSQSKTPALKGSPQRRGVCTRVYTTTPKKP
FT                   NSAMRKVARVRLSSGIEVTAYIPGIGHNLQEHSMVLVRGGRVKDLPGVRYKIVRGSLDT
FT                   QGVKGRKQARSRYGAKKEK"
FT   CDS_pept        664516..664986
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="PFREUD_05630"
FT                   /product="30S ribosomal protein S7"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56092"
FT                   /db_xref="GOA:D7GJ20"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ20"
FT                   /protein_id="CBL56092.1"
FT                   /translation="MPRKGPAPKRPVVVDPVYSSPLVSQLVSKILVDGKKTVAQSIVYT
FT                   AMEGTREKTGVDPVQTLKKALENVKPAVEVRSRRVGGATYQVPIEVKPARSNTLAMRWL
FT                   VSFSRDRREKTMAERLQNEILDASNGLGASVKKREDTHRMAEANRAFAHYRW"
FT   CDS_pept        665157..667256
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="PFREUD_05640"
FT                   /product="Elongation factor G (EF-G)"
FT                   /function="3.7.4 Translation elongation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56093"
FT                   /db_xref="GOA:D7GJ21"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ21"
FT                   /protein_id="CBL56093.1"
FT                   /translation="MAIDLQTDLAKVRNIGIMAHIDAGKTTTTERILYYTGVNHKIGEV
FT                   HDGAATMDWMEQEQERGITITSAATTCFWNNYQINIIDTPGHVDFTVEVERSLRVLDGA
FT                   VAVFDGVAGVEPQTMNVWRQASKYNVPRICYINKLDRTGASFDWCVQTIRERLHAVPVL
FT                   LQLPIGAEADFIGIIDLIDMDAKTWRGETELGEHYEVEEIPAELAEKAKATRAEMIETV
FT                   AENDDTFMELYLGGEDWTNEDLKAAIRRGVLANAFTAVVCGTSFKNKGVQPLLDAIVDY
FT                   LPSPLDIPAVVGFKPGDESVEIDRHPAKDQPLAALAFKIAADPHLGRLTFVRVYSGVLT
FT                   TGESVLNSTKGNKERIGKIYQMHANKRQEVEEMPAGMICAVMGLKNTGTGDTLCDPQNP
FT                   IALESMTFPDPVIEQAIEPKSKADQEKLGVAISRLAEEDPTFQVHTDEETGQTIIAGMG
FT                   ELHLDVLIDRMKREFHVEANIGTPQVAYRETLRRPVTGIDYTHKKQSGGSGQYAKVIID
FT                   LEPQPAGTGYEFVNAVTGGRIPKEYIPAVDAGIQEAMQFGVLAGYPVEDIKVTLTDGAY
FT                   HDVDSSELAFKIAGSMVFKEAARRADPALLEPEFAVEVTTPEEYLGTVIGDLNGRRGRV
FT                   KEMADEHGNKVIRATVPLAEMFGYVNDLRAKTSGQATYTMEFESYGIVPKGIADEIIAK
FT                   AHGTE"
FT   CDS_pept        667491..668681
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="PFREUD_05650"
FT                   /product="Elongation factor Tu"
FT                   /function="3.7.4 Translation elongation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56094"
FT                   /db_xref="GOA:D7GJ22"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ22"
FT                   /protein_id="CBL56094.1"
FT                   /translation="MAKAHFERTKPHCNIGTIGHIDHGKTTLTAAITKVLADKYPQWNS
FT                   FEAFDDIDKAPEERQRGITISISHVEYQTEKRHYAHVDCPGHADYVKNMITGAAQMDGA
FT                   ILVVAATDGPMPQTHEHVLLARQVGVPAIVVALNKCDMVDDEELIDLVEMETRELLTAQ
FT                   EFDGENCPVVRVSAFKALQGDEKWAEQIMKLMDAVDDYIPQPERDTDKPFLMPVEDVFT
FT                   ITGRGTVVTGRIERGVITTGETVELVGLADTQTTTVTGVEMFRKILDEGQAGDNVGLLL
FT                   RGTKKEDVERGMVVTKPGTTTPHTEFKGSVYVLTKDEGGRHKPFFSHYSPQFYFRTTDV
FT                   TGTVVLPDGVEMVMPGDNTDMEVELQKPIAMEVGLKFAIREGGHTVGAGRVTEIVK"
FT   CDS_pept        complement(668875..670353)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05660"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56095"
FT                   /db_xref="GOA:D7GJ23"
FT                   /db_xref="InterPro:IPR018650"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ23"
FT                   /protein_id="CBL56095.1"
FT                   /translation="MPSLRPSSASTGRLRRMVTAPQRHPQLWLALICLIALAAYLVTSI
FT                   VKFNRLRDGMDITIFDQAIRSFAQGHAGYTTLKAPGMPIFGDHFHPIILTMVPLYWLWD
FT                   DPRMLLITQGICIAWAGWLLGRLAIRRLGPGTGLLIAAGFLCGIGTQYAIIFDFHELVL
FT                   ATPLMAMALASFIEARWTACWVWSASLMVAKEDMCFLVGGIALAMLVRRHWVRGLSLGI
FT                   FAVAWTAIAVFVVVPAFNPDHVYPYLHAVGAVAVAGVQTSAHGAWFGPLKTLGSAAILL
FT                   SGTAFVALRSPLIWAFVAPFLTRAVSKNPQHWTTGFHYNLLPMLVACYAFVEAWPRLVD
FT                   AAGRTLPGRRGTLRRWWRAVALPMVGIVALASIPLGPLWHEWTIGRCRDECRVFPAALA
FT                   QLPAGSRVATDVYLTSHVAAHADVSQWRPPDYLDDRGQPVTPDWLLLDRETISYQNKDS
FT                   HWVDQFLADPVVRGTRYEVVWQRDPMVILRPAHS"
FT   CDS_pept        670434..671036
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05670"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56096"
FT                   /db_xref="GOA:D7GJ24"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ24"
FT                   /protein_id="CBL56096.1"
FT                   /translation="MSDRDRAGDGGRTGDPGSGREHAAPRGPRAATPGHIPARAEVEIP
FT                   TARLVLHGVDPAQAEQLARGISPLPCVAGYPHADSDTAARMQRHALEVDNWVPGYGLYL
FT                   MVRRADGLVVGDIGFHTPPDQRGAAEVSYGVADSVRRRGYASEALVALTAWAHAHGAST
FT                   VLAEVDPTNHASRGVLAKAGFLPVRSDGPKLRLRHQG"
FT   CDS_pept        671193..672656
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="PFREUD_05680"
FT                   /product="Glutamyl-tRNA synthetase (Glutamate--tRNA ligase)
FT                   (GluRS)"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="6.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56097"
FT                   /db_xref="GOA:D7GJ25"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ25"
FT                   /protein_id="CBL56097.1"
FT                   /translation="MTTPARTRVAPSPTGDPHVGTAYMALFDKAWAVRTGGQFVLRIED
FT                   TDRNRLVPGSEQQIVDSLNWLGLTPDESPEQGGPYAPYTQSQRLDTYRPVVDKLLASGH
FT                   AYHCWCSQERLAAMREEKAAKKQDTRYDRLCYGMTKEERAKLPGFTETPVVRMYIPDDA
FT                   PLVFHDLIRGEVKAPFPDDQVILKADGFPTYHLAVVVDDHEMKINTVVRGEEWISSTPK
FT                   HLLLYKWLGWELPAFAHMPLLRNTDHSKISKRKNPAARLMWFKEQGYLPQALRNFLQLL
FT                   AYPPAEGDQELESFADFVGNFAWSKVNTVGPVFDTKKLDWLNGQYIRELSDSDLADQLV
FT                   DFIAASRQWGDDPDPSWAEVIRRATPIIKPRLVKLSDAWDQIAFLVEADDSVYIEDTAR
FT                   AQLKDNAGEVLDATAKVLATVEPFTADAIQQALRDELVDAMGIKPRQAFAPLRVATSGR
FT                   KVSPPLFESCEILGRASVLARIAGLRETL"
FT   CDS_pept        complement(672653..673648)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="PFREUD_24670"
FT                   /product="Integrase, catalytic region"
FT                   /function="4.4 Phage-related function"
FT                   /note="Integrase core domain. Integrase mediates
FT                   integration of a DNA copy of the viral genome into the host
FT                   chromosome."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_24670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56098"
FT                   /db_xref="GOA:D7GJ26"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ26"
FT                   /inference="similar to AA sequence:Uniprot:A0JV34"
FT                   /protein_id="CBL56098.1"
FT                   /translation="MTHANAPLTPAGRRRLAIVVVEEGWSLRRAAERFQVSAGTAKRWA
FT                   DRYRAGEPLTDRTSRPARCPGRLDRRTERRIIGLRTTRRWGPHRIAYHLHLARSTVGRV
FT                   LTRYRMPLLAHLDRATGAAVRRPPAVRYEKASCGELVHVDIKKQGRIPDGGGWRIHGAG
FT                   SRQHIANGRARYQRARAGKTVSGYRYLHHAVDDHSRLAYSEILDAQDADAAAGFMARAL
FT                   DWFSAAGIAVAAVMTDNGWCYRSKAFARALGPITHVRTRPYRPQTNGKVERFNRTLSDE
FT                   WAYARAYYNEEDREQAYYAWIHEYNHHRPHTSLNGLTPSDRVPNLAGKNN"
FT   CDS_pept        673798..674670
FT                   /transl_table=11
FT                   /gene="pabC"
FT                   /locus_tag="PFREUD_05690"
FT                   /product="Branched-chain amino acid
FT                   aminotransferase/aminodeoxychorismate lyase"
FT                   /function="2.2 Metabolism of amino acids and related
FT                   molecules"
FT                   /EC_number="4.1.3.38"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56099"
FT                   /db_xref="GOA:D7GJ27"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ27"
FT                   /protein_id="CBL56099.1"
FT                   /translation="MIISVLGTGVVDSNAPIATADDLALTRGEGVFDSTVVYRQVTGPR
FT                   ILHLDWHLARLERSAQGMGIECPSRDAWRRAIDDALDVWHGHNAVIRLILSRGREVVTD
FT                   DPAQHLAYVLLSDIKGKRAHPAQIRVTQLSIGRPHDAFVDAPWLLGGVKTLSYATNMSA
FT                   FRYATARGFDDVLFTTTDGYCLEAPRAGLIWAKDGRLGTTSREGTGVLDSMTVRAAVAG
FT                   ARSEGFEVVDGLLGAEEIFSADGAWLVSVSYGCTPIIEVDGRPLSVHEHLTQRMAVWTK
FT                   QPYNDDALD"
FT   CDS_pept        675105..675416
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="PFREUD_05700"
FT                   /product="30S ribosomal protein S10"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56100"
FT                   /db_xref="GOA:D7GJ28"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ28"
FT                   /protein_id="CBL56100.1"
FT                   /translation="MAGQKIRIRLRAYDHEVIDSSARKIVDTVTRTGAKVAGPVPLPTE
FT                   KNVWCVIRSPHKYKDSREQFEMRTHKRLIDILDPTPKTVDSLMRLDLPAGVDIEIKLP"
FT   CDS_pept        675413..676087
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="PFREUD_05710"
FT                   /product="50S ribosomal protein L3"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56101"
FT                   /db_xref="GOA:D7GJ29"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ29"
FT                   /protein_id="CBL56101.1"
FT                   /translation="MRPQNMTTEHKVKGLLGTKLGMTQLWDENNRLVPVTVIQAGPCVV
FT                   TQVRTPDTDGYSAVQLGYGAIRAKSVTKPAAGQFARAKVTPRKYLAEIRTSDASEYTLG
FT                   QELGPDTFRTDDVVDVTGVTKGKGTAGVVKRWGFKGLGASHGVHRKHRSPGGIGACATP
FT                   GHVFKGLRMAGRMGNARKTVQNLAVAGVDADKGLILVRGAVPGNKGALVVLRTAAKKGE
FT                   AK"
FT   CDS_pept        676084..676785
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="PFREUD_05720"
FT                   /product="50S ribosomal protein L4"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56102"
FT                   /db_xref="GOA:D7GJ30"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ30"
FT                   /protein_id="CBL56102.1"
FT                   /translation="MNETTSIDVVNAEGKKAGSVELPGELFDAQANVPLMHQVVTAQLA
FT                   AARQGTHSTKTRAEVSGGGKKPWRQKGTGRARQGSIRSPQWAGGGISHGPQPREYSQRT
FT                   PKKMVATALRGALSDRAREGRIHVVSEFVGGDKPSTKSAAKVIAGLGDYGRVLVVLERS
FT                   DENNWLSMRNLIGVHVVSWDQLNTYDVLLADAIVFSESAIKAYVAGPAKGKSVKAVATS
FT                   REAEAVEEKAK"
FT   CDS_pept        676782..677093
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="PFREUD_05730"
FT                   /product="50S ribosomal protein L23"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56103"
FT                   /db_xref="GOA:D7GJ31"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ31"
FT                   /protein_id="CBL56103.1"
FT                   /translation="MSDFKIRDPHDVLISPVVSEKSYGLIDENKYTFIVDPKANKTEIR
FT                   QAVEAVFGVKVVGVNTANRKGKKRRTRYGVGRRPDTKRAIVTVAENDHIDIFGNAPAE"
FT   CDS_pept        677132..677968
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="PFREUD_05740"
FT                   /product="50S ribosomal protein L2"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56104"
FT                   /db_xref="GOA:D7GJ32"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ32"
FT                   /protein_id="CBL56104.1"
FT                   /translation="MAIRKYKPTTPARRGSSVSDFNEITRSTPEKSLLAPKSKTGGRNN
FT                   SGRITTRHIGGGHKQAYRIIDFKRYDKDGVPAKVAHIEYDPNRTARIALLHYADGEKRY
FT                   IIAPQGLEQGATVYAGVGADIKPGNNLPLRNVPIGTQVHSVEMRPGGGAKLGRSAGASI
FT                   QLVAREGQYATLRMPSGEMRMVDVRCRATIGSVGNAEYSNIHWGKAGRSRWKGIRPTVR
FT                   GVVMNPVDHPHGGGEGKTSGGRHPVSPWGQKERRTRSKNKASSKLIVRRRKSGKKR"
FT   CDS_pept        677986..678267
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="PFREUD_05750"
FT                   /product="30S ribosomal protein S19"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56105"
FT                   /db_xref="GOA:D7GJ33"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ33"
FT                   /protein_id="CBL56105.1"
FT                   /translation="MPRSLKKGPFVDGHLQKKIDVQNENGTKTVIKTWSRRSMVTPDML
FT                   GHTIAVHDGRKHVPVFITEGMIGHKLGEFAPTRTFRGHVKDDKKARRR"
FT   CDS_pept        678293..678778
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="PFREUD_05760"
FT                   /product="50S ribosomal protein L22"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56106"
FT                   /db_xref="GOA:D7GJ34"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ34"
FT                   /protein_id="CBL56106.1"
FT                   /translation="MSNTTQRPSRRVALLGDRPGSYAIARHVRMSAQKVRRVADTVRGM
FT                   DATQAIATLRFAPQAAAEPVRKVIESAVANAETSEGLHNEQLVISQIYVDEGVTMRRIR
FT                   PRAKGSASRILKRASHITAVVEPAETAGHPPLKKASSAKNSSKATAADTTSDDTKEA"
FT   CDS_pept        678781..679599
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="PFREUD_05770"
FT                   /product="30S ribosomal protein S3"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56107"
FT                   /db_xref="GOA:D7GJ35"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ35"
FT                   /protein_id="CBL56107.1"
FT                   /translation="MGQKINPIGFRLGITTDHKSRWYAEKQYSELVGEDDKIRAWLVKN
FT                   LERAGISSVEIERRSDRITIFLYAARPGIVIGRNGAEAERVRGELEKMSGKQIQLNILE
FT                   VKNPETDAQLVAQGIAEQLGARVAFRRAMRKAQQSAMRSGAKGIRIRCSGRLGGAEMSR
FT                   SESYREGRVPLHTLRADIDYGFYEARTTFGRIGVKVWIYKGDVTGTRAERAAQKAARQA
FT                   APSRQRSNRRPGRGERGGRRRADAAREQAPRSDAATSAPAAAPATENAGA"
FT   CDS_pept        679605..680024
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="PFREUD_05780"
FT                   /product="50S ribosomal protein L16"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /note="highly similar to SwissProt entry RL16_PROAC from
FT                   Propionibacterium acnes"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56108"
FT                   /db_xref="GOA:D7GJ36"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ36"
FT                   /protein_id="CBL56108.1"
FT                   /translation="MLIPRRVKYRKQHHPNRRGMAKGGTELAFGEFGVQALEPAYMTNR
FT                   QIEAARIAMTRYIKRGGKVWINVYPDRPLTKHPAESRMGSGKGSPEFWVVNVKPGRVLF
FT                   ELAGVTPDVANEALRLAIHKLPFKARIITRDEGEI"
FT   CDS_pept        680026..680274
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="PFREUD_05790"
FT                   /product="50S ribosomal protein L29"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56109"
FT                   /db_xref="GOA:D7GJ37"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ37"
FT                   /protein_id="CBL56109.1"
FT                   /translation="MAKTESLKAADLRAQSRGDLNDQVVKLKEELFALRFQAATGQLEN
FT                   HSRLREVRKDIARIYTVLQERNLGIVDDPDREGKAEA"
FT   CDS_pept        680271..680546
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="PFREUD_05800"
FT                   /product="30S ribosomal protein S17"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /note="highly similar to Swissprot entry RS17_PROAC from
FT                   Propionibacterium acnes"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56110"
FT                   /db_xref="GOA:D7GJ38"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ38"
FT                   /protein_id="CBL56110.1"
FT                   /translation="MSQTDSTTERAGRKVREGVVVSSKMDKTVVVAVEDRVKHGLYGKV
FT                   ITKTIRLKAHDENNEAGEGDRVRIMETRPLSATKRWRLTAVVEKAR"
FT   CDS_pept        680677..681048
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="PFREUD_05810"
FT                   /product="50S ribosomal protein L14"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56111"
FT                   /db_xref="GOA:D7GJ39"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ39"
FT                   /protein_id="CBL56111.1"
FT                   /translation="MIQQESRLKVADNTGAKELLCIRVLGGSKRRYAGLGDTIVCTVKD
FT                   AIPGGSVKKGEVVKAVIVRAVKSHRRVDGSYIKFDENAAVILGGTTSEPRGTRIFGPVA
FT                   RELRDKHFMRIVSLAPEVI"
FT   CDS_pept        681050..681421
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="PFREUD_05820"
FT                   /product="50S ribosomal protein L24"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56112"
FT                   /db_xref="GOA:D7GJ40"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ40"
FT                   /protein_id="CBL56112.1"
FT                   /translation="MAKMKLKKGDRVQVIAGKDKGVVGEIIAVDPANERVTVQGANIVR
FT                   RHTRDSADASGAQVKGGIISVEAPLHVSNVQLLVKDGSKDVLTRIGAQRQKVSKRRADG
FT                   SEYEGTRGVRIARKTGKEI"
FT   CDS_pept        681421..682083
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="PFREUD_05830"
FT                   /product="50S ribosomal protein L5"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56113"
FT                   /db_xref="GOA:D7GJ41"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ41"
FT                   /protein_id="CBL56113.1"
FT                   /translation="MARKNADAGLAVAEVAQATAPEMPRLKKKYREEIVKALHDEFNYD
FT                   NPMLIPGLTKIVVNMGVGDAANDRKILDGAVKDLTAITGQKPQTTKARKSIAQFHLREG
FT                   QAIGCHVTLRGDRMWEFADRLLSLALPRIRDFRGLNSNQFDGHGNYTFGLTEQVMFLEI
FT                   DQDKIDRVRGMDITFVTTARNNEEGRALLKHLGFPFKATDDAKVPSARDFRRNGNRK"
FT   CDS_pept        682092..682277
FT                   /transl_table=11
FT                   /gene="rpsN1, rpsZ"
FT                   /locus_tag="PFREUD_05840"
FT                   /product="30S ribosomal protein S14 type Z"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56114"
FT                   /db_xref="GOA:D7GJ42"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR018271"
FT                   /db_xref="InterPro:IPR023053"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ42"
FT                   /protein_id="CBL56114.1"
FT                   /translation="MAKTALKVKQARKPKFAVRAYTRCQRCGRPRSVYRKFGLCRICLR
FT                   TLAHAGDLPGVTKSSW"
FT   CDS_pept        682437..682844
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="PFREUD_05850"
FT                   /product="30S ribosomal protein S8"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56115"
FT                   /db_xref="GOA:D7GJ43"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ43"
FT                   /protein_id="CBL56115.1"
FT                   /translation="MTMTDPIADMLTRLRNANQAFHDETSMPSSKIKAGIAEILKQEGY
FT                   IADYAVKDPEADEVGKKLVVTLKYGDDRKRSIAGVRRISKPGLRVYAKSNQLPKVLGGM
FT                   GVAIISTSQGLMTDRQAHEKSVGGEVLAYVW"
FT   CDS_pept        682875..683417
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="PFREUD_05860"
FT                   /product="50S ribosomal protein L6"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /note="This protein binds to the 23S rRNA, and is important
FT                   in its secondary structure. It is located near the subunit
FT                   interface in the base of the L7/L12 stalk, and near the
FT                   tRNA binding site of the peptidyltransferase center, Part
FT                   of the 50S ribosomal subunit, elongs to the ribosomal
FT                   protein L6P family"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56116"
FT                   /db_xref="GOA:D7GJ44"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ44"
FT                   /protein_id="CBL56116.1"
FT                   /translation="MSRIGRLPITVPSGVEVNLDGQKVAVKGPKGNLDWNIPEPITIKK
FT                   NDEGQLELSRPDDEREHRSLHGLSRTLVNNMIIGVHDGYQKDLEIIGVGYRVISKGPTQ
FT                   LEFALGFSHPVTVDAPEGITFEVKTPTSFTIHGIDKQVVGEIAAKIRKIRPPEPYKGKG
FT                   VRYAGEHVRRKVGKAGA"
FT   CDS_pept        683420..683803
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="PFREUD_05870"
FT                   /product="Ribosomal protein L18"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56117"
FT                   /db_xref="GOA:D7GJ45"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ45"
FT                   /protein_id="CBL56117.1"
FT                   /translation="MAININHRRNLAQRKASQMRRQKRVRKHIFGYPERPRLVVTRSAR
FT                   HMFAQVIDDVAGRTLASASTMETELRGMSGDKTAKAEKVGELIGQRAKEAGISQVVFDR
FT                   AGNQYHGRVAAVADGARKAGLGL"
FT   CDS_pept        683757..684437
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="PFREUD_05880"
FT                   /product="30S ribosomal protein S5"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56118"
FT                   /db_xref="GOA:D7GJ46"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ46"
FT                   /protein_id="CBL56118.1"
FT                   /translation="MPRSPMAPARLVSDSDDGKEEPAMNTQAQGRGRGQGNDRRGRDDR
FT                   RGRDNDRNRDQYLERVVTINRVAKVVQGGRRFSFTALVVVGDGEGTVGVGYGKAKEVPA
FT                   AIAKGVEEAKKNFFKVPMVQRSIPHPVQGEKAAGVVMLRPASPGTGVIAGGACRAVLEC
FT                   AGIQDVLAKSLGSPNAINVVHATVAALKMLEEPEQIAKRRGKSVADVTPAALLRARQEV
FT                   EVKA"
FT   CDS_pept        684437..684619
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="PFREUD_05890"
FT                   /product="50S ribosomal protein L30"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56119"
FT                   /db_xref="GOA:D7GJ47"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ47"
FT                   /protein_id="CBL56119.1"
FT                   /translation="MAQLKITQIKSTVAEKPHVRSTVKALGLKRIGDVVTKPDRPEFRG
FT                   MAQAARHVVTMEEVK"
FT   CDS_pept        684621..685064
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="PFREUD_05900"
FT                   /product="50S ribosomal protein L15"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56120"
FT                   /db_xref="GOA:D7GJ48"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ48"
FT                   /protein_id="CBL56120.1"
FT                   /translation="MAIKVHHLRPAPGAKQTKHRVGRGEAGKGGKTAGRGTKGTGARKN
FT                   VPENFEGGQMPLHMRLPKLRGFQNPFRVSYQVVNISRIADLFPAGGAVGVDDLVKAGAV
FT                   RDGQLVKVLGDGDITVKLEVTADKFSASAKEKIEKAGGSVTVQ"
FT   CDS_pept        complement(685421..686068)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05910"
FT                   /product="NAD(P)H-dependent FMN reductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56121"
FT                   /db_xref="GOA:D7GJ49"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR023932"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ49"
FT                   /protein_id="CBL56121.1"
FT                   /translation="MKVLAISAGMGQPSATRMLVDRLAAATVKHAGAAGLELDEPIEVI
FT                   ELRDIATELMSSEISRVPSPRVAGAIESVEAADTLIVVSPIYNTQPAALLSLFFEVADD
FT                   AILRGKPVLLGATGGTARHSLAIDRALLPLFHYLHALVVPTSIFAATDDWGSPASLDKR
FT                   TEDAAGSFVGLLAMRAGVPNTDELSGSDTDKASHGDDDFELENDFETMLKSI"
FT   CDS_pept        complement(686179..687375)
FT                   /transl_table=11
FT                   /gene="mer"
FT                   /locus_tag="PFREUD_05920"
FT                   /product="Coenzyme F420-dependent N5,N10-methylene
FT                   tetrahydromethanopterin reductase"
FT                   /function="1.4 Membrane bioenergetics (electron transport
FT                   chain and ATP synthase)"
FT                   /EC_number="1.5.99.9"
FT                   /note="5,10-Methylenetetrahydromethanopterin + Coenzyme
FT                   F420 <=> 5,10-Methenyltetrahydromethanopterin + Reduced
FT                   coenzyme F420"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56122"
FT                   /db_xref="GOA:D7GJ50"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR023934"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ50"
FT                   /protein_id="CBL56122.1"
FT                   /translation="MDTTENRVPVQIGIFSVSDLTPDPTTGITPTEHERLKNYALIVKK
FT                   AEEIGLDAFALGEHHNPPFVSSSPTTTLGWLAAQTSKITLSTATTLITTDDPVKIAEDY
FT                   AMLQHLADGRVDLMLGRGNTGPVYPWFGKDIRQGINLALENYNLLHRLWREEVVDWQGK
FT                   FRTPLQGFTAIPRPLDDVPPFVWHGSIRSPEIAEQAAYYGDGFFHNNIFWTMNHTKRMV
FT                   DLYRRRYEHYGHGRYDQAIVGLGGQFFMRKNSQDAIKEYRPYFDNAPVYGHGPSMEEFT
FT                   EYTPLTVGSPQQVLERTLSFKDDVGHYQRQMFLIDHAGLPIKTVLEQLDLLGEILPEMR
FT                   KGFLEGRPDDIPDAPTHASLVAARDAAGVAPVEHVKVGADDVTGTSDAPEPPDSVFEK"
FT   CDS_pept        complement(687626..689344)
FT                   /transl_table=11
FT                   /gene="bopA"
FT                   /locus_tag="PFREUD_05930"
FT                   /product="solute binding protein of the ABC transport
FT                   system"
FT                   /function="1.2.1 Transport/binding of proteins/peptides"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56123"
FT                   /db_xref="GOA:D7GJ51"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ51"
FT                   /protein_id="CBL56123.1"
FT                   /translation="MRSTTTKAFAGVAVLALALAGCGSNSGSSTKSADSNAKLSYSINE
FT                   QAATNLKDGGNLNLSIEEITPQLNMFQANMTVDTSTLWNWYNPQLIKFTPSGDMKLDKN
FT                   YLESVNSELKDGKTVVTYKINDKAKFNDGTDLDWTAFQATWQANSGKEQEYNANTIDGY
FT                   DQIDSVKAGDNAKTVVVSFVGPYPWYSSLFNNVLHPAVNSADIFNNGYTGGTLASAHPE
FT                   WGAGPYALTGFDANAGVVTFERNPNWWGDKGKLDKITYTVRADVQAQVNAYKNGEADTV
FT                   ETSTSELLTQVTSVADTDIRRGTRAANYLLTMNSKSELLSDTAVRKAIATGINRAQLQQ
FT                   VLFQGLDYSEAIGGSLTLYPFQKGYQDNLSKVVAKTDTAAATKALEEAGYAKGSDGTYA
FT                   KDGKALSLRLPLFSSSTTSKAMYQAFQTQMKAVGIDVQIIQKSSKDFSTTVKNRDFDLL
FT                   ISGWASTDPNGVAFFCQKFCSDSTLNKSGTGTAELDNLIKGPGGLTSLQTAEDQESKAN
FT                   ELEVQALGTFGILPIYNGPEIFAVKKGLANVGAGVYATTRAQIGDFPENIGWQKD"
FT   CDS_pept        complement(689415..691514)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05940"
FT                   /product="ABC transporter, ATPase subunit"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56124"
FT                   /db_xref="GOA:D7GJ52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ52"
FT                   /protein_id="CBL56124.1"
FT                   /translation="MTDPILSVNDLHVSFPSEAGVVDAVRGVSFDLYPGRTLGIVGESG
FT                   SGKSVTSLAIIGLLADSAKVTGSVTFDGTELLGLSDQQMTRHRGNDIAMIFQDPLSSLT
FT                   PVFSVGDQIIEALKAKNPHISESDARARAIELLGLVGIPNPATRVKSFPHEFSGGMRQR
FT                   VVIAIAMANNPRVIIADEPTTALDVTIQAQILDLLKVAQRETHAAVILITHDMGVIAGS
FT                   ADEVLVMYAGKPVEQAPVYEVFSHPRMPYTLGLLGAIPKVHHNDNAPLVPIKGNPPILI
FT                   NLPDGCPFAPRCPVAVDHCRTREPALEVIDTIDQTVSHPDTAPGEAELVHSSACWRSGE
FT                   IHGGEIDGKPVFPVPPRPASDIRETPRDERATTIKVDHLVKTFPLIKGALLKRRVGSVY
FT                   AVDDISFDVRAGETLSIVGESGSGKSTTLLEIMAMSHDTVGEIELDGKRLKTLSRAQRR
FT                   AERRNIQMVFQDPMGALDPRFTVYDIIAEPLHTLGFPRDGIEARVNELMNLVGLDPAHI
FT                   DRFPGAFSGGQRQRIGIARALATNPKVLALDEPVSALDVSIQAGVINLLAELQAKLELS
FT                   YLLVAHDLSVVRHISDRVAVLYLGGIVEIGDVDAVFDESRHPYTQALLSAIPIPDPTVE
FT                   RTRSRVVLKGDLPSPTDNEPGCRFASRCPLFQTLPEQDRARCLHETPALHGGEGADHLV
FT                   ACHFR"
FT   CDS_pept        complement(691511..692497)
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="PFREUD_05950"
FT                   /product="ABC transporter, permease protein OppC"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56125"
FT                   /db_xref="GOA:D7GJ53"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ53"
FT                   /inference="similar to AA sequence:Uniprot:A0QCN6"
FT                   /protein_id="CBL56125.1"
FT                   /translation="MSQTPDQLVPDESGYVATADGDQNLNLPAHRTRRMRLYVRRFWRN
FT                   KPAVVGLGVFAFLVLCSLVGGRFTPFRYTDMDFGALGAQPGTPGSVVRPDGTLVNATHL
FT                   FGTNSGGIDVFAMLMHGIGRSMTIAVSVSLVTTLFAAFISALAAYLAGLTERIVLAVIN
FT                   FLLILPSFLLMALIANHYSGAWQMLIVVMIVFGWMYPARVIWSLSTSVREREYISAARF
FT                   MGARGPSVVIRHMVPNIGSLLVIQFTLGVVSTVMTETGLSFLGFGVKIPDVSLGTMLQS
FT                   GVSAISSTPWLFWFSAGTLTLLTVSVALISDGLRDALDPNSAAGGRA"
FT   CDS_pept        complement(692499..693629)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_05960"
FT                   /product="ABC transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56126"
FT                   /db_xref="GOA:D7GJ54"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ54"
FT                   /protein_id="CBL56126.1"
FT                   /translation="MSHDGAHPVQEATAASQNVMTPTRGLADNATESDAAEQSRTARRP
FT                   RGAGVIKYLLRRVLGWIGMIFLATNLTYFLANLFLDPKANYLERNPPIPDDQIDRMLHP
FT                   YNLDPTVSLIDRWWTWLQDVLLHWNWGMSPDGQAVNTQVAFRVWNSAQLMLGATILACA
FT                   VGIAVGVYTASRQYKLGDRIFQAISIVAMNTHIVVASMVAVIVAIAINGAAGQRIFFVT
FT                   GSASIGVHGFFPVLLDKAQHLILPTLCLLFINYASYHFMQRSLLLDNINADYVRTARAK
FT                   GLTKPQAIRRHALRTSIIPVATQVAFAIPGIFTGAVLTEKIFGWQGMGDYFVTTIAKND
FT                   IHGVVAVAAFAAAMTAVGAILADIFVVLLDPRVKVS"
FT   CDS_pept        693872..695185
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="PFREUD_05970"
FT                   /product="Preprotein translocase SecY subunit"
FT                   /function="1.6 Protein secretion"
FT                   /note="Involved in protein export. Interacts with secA and
FT                   secE to allow the translocation of proteins across the
FT                   plasma membrane, by forming part of a channel. One of seven
FT                   secretory proteins (secA-F and secY) that comprise the
FT                   prokaryotic protein translocation apparatus. Cell membrane;
FT                   Multi-pass membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56127"
FT                   /db_xref="GOA:D7GJ55"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ55"
FT                   /protein_id="CBL56127.1"
FT                   /translation="MISGFLNAFRTPDLRKKMLFTLFILVIFRIGSTIPAPNVNIAAIQ
FT                   KCASDATTGDQAGVYAMINLFSGGALLHLAIFALGIMPYITASIILQLLTVVIPRLEAL
FT                   KKEGATGQETITKYTRWLTIVLGVLQATSFTMMAVSGQLYRTCTESVVYSDGVFPIIVM
FT                   ILTMTAGTSLIMWMGELITDRGVGNGMSILIFTQIAARFPSSMWSIKTAHQGNQGWLLL
FT                   VLVVAVGLLVMAGVVFVEQAQRRIPVQYAKRMVGNRLMGGSTTYIPMKVNQAGVIPVIF
FT                   AASMLYLPMLYAMFRPEGAAATWIATNLNGRGDTVWYNVIYVAMIIFFTFFYVSITFDP
FT                   VEVSDNMRKFGGFIPGIRAGKPTEDYLAYVLSRLTAPGSLYLALISLIPTVAIVLLGAD
FT                   QNFPFGGTSLLIMVGVGLDTVKQIDSQLHQRNYEGFLK"
FT   CDS_pept        695182..695757
FT                   /transl_table=11
FT                   /gene="adk"
FT                   /locus_tag="PFREUD_05980"
FT                   /product="Adenylate kinase (EC 2.7.4.3) (ATP-AMP
FT                   transphosphorylase)"
FT                   /function="1.2.6 Transport/binding of nucleosides,
FT                   nucleotides, purines and pyrimidines"
FT                   /EC_number="2.7.4.3"
FT                   /note="ATP + AMP = 2 ADP."
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56128"
FT                   /db_xref="GOA:D7GJ56"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ56"
FT                   /protein_id="CBL56128.1"
FT                   /translation="MRLLIMGAPGAGKGTQAVGIATHYGVPAISTGDMFRDNVKNGTPL
FT                   GKQVDAIMKAGDFVPDELTEQIVADRLDQPDAQGGFLLDGFPRTMHQVDALDDYLDKHG
FT                   HSLDAVISLDVDPEDLIARLLKRAELEGRADDNEETIRHRMEVYTSSTAPLLDAYKSRG
FT                   LLVAVDGNGTVDEVGARIAAAVDAKVGR"
FT   CDS_pept        695754..696599
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="PFREUD_05990"
FT                   /product="Methionine aminopeptidase (MAP) (Peptidase M)"
FT                   /function="3.10 Protein degradation"
FT                   /EC_number="3.4.11.18"
FT                   /note="Removes the amino-terminal methionine from nascent
FT                   proteins. Release of N-terminal amino acids, preferentially
FT                   methionine, from peptides and arylamides. Binds 2 cobalt
FT                   ions per subunit. Belongs to the peptidase M24A family"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56129"
FT                   /db_xref="GOA:D7GJ57"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ57"
FT                   /protein_id="CBL56129.1"
FT                   /translation="MSPLHVERIEVKSLDQIKAMRVAGLVVAEGLAAMGDAVRPGITTG
FT                   EIDQIGRDVLAAHGATSNFLGYGTEWGLPPYPGVACISVNEVVVHGIPGSRVLQPGDIV
FT                   SIDYGAIVNGWHGDAARTFAVGEIDSDSQLLSDVTRESMWAGISTIGTGRRIGDVSHAV
FT                   EESIDSHGRDFGIIRDYTGHGIGTAMHQAPDIPNYGKAHRGPKIGPGMCLCVEPMVTLG
FT                   MDDTAVLDDEWTVVTVDSSRAAHWENTTAVLPNGLWVLTEPDGGRAQLEAHGASYAGLD
FT                   "
FT   CDS_pept        696625..697011
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06000"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56130"
FT                   /db_xref="GOA:D7GJ58"
FT                   /db_xref="InterPro:IPR012551"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ58"
FT                   /protein_id="CBL56130.1"
FT                   /translation="MSQLPIGSRPPRDPQRPVADAQRDDLTQRLNTAYERGDLSLEDYQ
FT                   GLLAQLFEAHTTGDLVPVVQALPAQYRVPSAPQGAEVDTNLAPGEVNQSRKRADLSLPM
FT                   AKVGIGIAAVLAIIVVAIVIGVAL"
FT   CDS_pept        complement(697042..697326)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06010"
FT                   /product="Hypothetical protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56131"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ59"
FT                   /protein_id="CBL56131.1"
FT                   /translation="MAFFAVNYTYDPAKDVEAVRPRHREFLRGLAERGVLRASGPFPGL
FT                   EPQRALLIFEADSAEEVATLLDQDPMHTEDILKVREILEWNPVIGIFAV"
FT   CDS_pept        697685..697906
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="PFREUD_06020"
FT                   /product="Translation initiation factor IF-1"
FT                   /function="3.5.2 Transcription regulation"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56132"
FT                   /db_xref="GOA:D7GJ60"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ60"
FT                   /protein_id="CBL56132.1"
FT                   /translation="MAKKEGALELEGTVVEALPNAMFRVELDNGHKVLSTISGKMRQHY
FT                   IRILPQDRVVVELSPYDLTRGRIVYRHK"
FT   CDS_pept        697999..698112
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06030"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56133"
FT                   /db_xref="GOA:D7GJ61"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ61"
FT                   /protein_id="CBL56133.1"
FT                   /translation="MKVRPSVKRMCEHCKVIRRRGVVRVICTNPRHKQRQG"
FT   CDS_pept        698365..698739
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="PFREUD_06040"
FT                   /product="30S ribosomal protein S13"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /note="highly similar to SwissProt entry RS13_BIFLO from
FT                   Bifidobacterium longum"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56134"
FT                   /db_xref="GOA:D7GJ62"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ62"
FT                   /protein_id="CBL56134.1"
FT                   /translation="MARLQGVDLPREKRLEVALTYIFGIGKTRADAILEATGISPDIRV
FT                   KDVTDAQLVELRDFIDANYEVEGDLRRSVDADIRRKIEIGTYQGRRHRAGLPVRGQRTR
FT                   TNARTRKGRKKAVAGKKKAR"
FT   CDS_pept        698785..699192
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="PFREUD_06050"
FT                   /product="30S ribosomal protein S11"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56135"
FT                   /db_xref="GOA:D7GJ63"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ63"
FT                   /protein_id="CBL56135.1"
FT                   /translation="MATTSRKAASKTKVRRKVKKNVVTGEAHIKSTFNNTIIAISDPNG
FT                   AVIAWASAGTVGFKGSRKSTPFAAQMAAEAAGRRAMDHGMKRVDVFVKGPGSGRETAIR
FT                   SLGAIGLEVGTISDVTPVPHNGCRPPKRRRV"
FT   CDS_pept        699223..699828
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="PFREUD_06060"
FT                   /product="30S ribosomal protein S4"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56136"
FT                   /db_xref="GOA:D7GJ64"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ64"
FT                   /protein_id="CBL56136.1"
FT                   /translation="MARYTGPMTKKSRRFGTDLVGNDKAFERRPYAPGVHGRGRTKDSE
FT                   YSLQLKEKQKARYAYGVLEKQFHRYYEEASRRPGRTGDLLLQILESRLDNVVYRAGFAS
FT                   TRRQARQMVSHGHILVNGKKVNIPSFRVAPLDIIDVRAKSQEMTPFVIARETFGERDVP
FT                   GWLTVKPNKMRVLVHQLPTREQIVLDVNEQEIVELYSR"
FT   CDS_pept        699953..700972
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="PFREUD_06070"
FT                   /product="DNA-directed RNA polymerase alpha chain (RNAP
FT                   alpha subunit) (Transcriptase alpha chain) (RNA polymerase
FT                   subunit alpha)"
FT                   /function="3.5.3 Transcription elongation"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56137"
FT                   /db_xref="GOA:D7GJ65"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ65"
FT                   /protein_id="CBL56137.1"
FT                   /translation="MLIAQRPTLSEEVVNDFRSRFVIEPLEPGFGYTLGNSLRRTLLSS
FT                   IPGASITSIKIEGNQHEFSTLPGVVEDVTEIILNLKGLVLSSEEDEPVAMYLRKSGAGE
FT                   VTAADIAVPTGVEIYNPDLHIATLADDGSIEMELVVERGRGYVSSTLNNNPDAEIGRIA
FT                   VDSLYSPVLTVSYKVEATRVETRTDFDRLIVDVETKPSIRPHDAVASAGKTLVELFGLF
FT                   RELNVEAEGVEMGPSPVDEQLAADMALPVEDLNLSVRSYNCLKREGIHTVGELVSRSEQ
FT                   DLLDIRNFGSKSIDEVKEKLGDLGLTLKDSTPGFDPLAAADRFEDEDDGADYAETEQY"
FT   CDS_pept        701016..701603
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="PFREUD_06080"
FT                   /product="50S ribosomal protein L17"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56138"
FT                   /db_xref="GOA:D7GJ66"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ66"
FT                   /protein_id="CBL56138.1"
FT                   /translation="MPKPTKGPRLGGSPSHQRIILANLATQLFEHGKITTTQTKARRVQ
FT                   PFAEQLITKAKRGDLHSRRLAAKTVKDKFVLHRLFDEIAPTMAEREGGYTRVTKIGNRK
FT                   GDNAPMAVIELITEKPSVKAAPKAADKAADVKADIETKAEKKADKANEASSEKVEAVEE
FT                   KAEEAKAKSAEVKEAKKAERTVQESVEKSDHE"
FT   CDS_pept        701740..702885
FT                   /transl_table=11
FT                   /gene="gtfE"
FT                   /locus_tag="PFREUD_06090"
FT                   /product="Glycosyltransferase"
FT                   /function="1.1 Cell wall"
FT                   /EC_number="2.4.1.-"
FT                   /note="transferase activity transferring glycosyl groups"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56139"
FT                   /db_xref="GOA:D7GJ67"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ67"
FT                   /protein_id="CBL56139.1"
FT                   /translation="MRIAQLANFVAPHSGGMRVALDGLGREYVAAGHERILIVPGLRDA
FT                   EVETASGVVCQIASPRVSGTYRMIVRPGAVRRALRRFRPTNVECSDKWTLAWTGRWATH
FT                   HGVGSVLFSHERLDDMLAGWLRARRPMRRMVGFLDRRIVPRFDRVVVASQYAAEEFARW
FT                   SPRVRVVPLGVDLSDFRPLPPTPRDAGAPLRLVLVSRLSREKDPQLAIDAVLELHRRGV
FT                   PVRLDVFGSGPDEEALRSRARGGPITFHGFIADRGELSARLGAADLSLSVSPKETFGLV
FT                   VLEALASGTPVLTSNRGGAREIITPGAGVVDEPASGHVPWGAWAPSRPTALAEAIEQLI
FT                   GRLGPGMRRAARQRAEQFSWQDCAHRMLQVHRETRGNGGGQ"
FT   CDS_pept        complement(702981..704066)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06100"
FT                   /product="Resuscitation-promoting factor RpfB"
FT                   /function="4.1 Adaptation to atypical conditions"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56140"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010618"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ68"
FT                   /protein_id="CBL56140.1"
FT                   /translation="MKNGLKTLLIGGVGIATLAVGGVGTAIADNEVSLNVDGQQKTVHH
FT                   FGGTIVDMLDKQGIQLGDHDQVIPDASQKLHDGENVTVRFGRQITVTFNGQTHTLWTTS
FT                   TNLAEILAQLGVSDDAKLSVDRSMNIGREGLTFTAVTPRHVKVIADGRTVEVSSTDPTV
FT                   GGLLKGLGIEVGGDDVTSAPLESLPVEGMTLTVQRGHVDEKTVDEPIDYDTVRQEDPSI
FT                   PSGTTKVKTAGVEGTRTVTYRIKTLDGKEAQRDVLSQTVHKQPVSKVVLVGTGQAASGG
FT                   ATDTANSGIWDRIAQCESGGNWSINTGNGYYGGLQFAASTWAAYGGTAYAPTANLATRD
FT                   QQITIANKVYAASGLSAWGCS"
FT   CDS_pept        complement(704360..704968)
FT                   /transl_table=11
FT                   /gene="sodA"
FT                   /locus_tag="PFREUD_06110"
FT                   /product="Iron/Manganese superoxide dismutase (Superoxide
FT                   dismutase [Mn/Fe]) (SODM)"
FT                   /function="4.2 Detoxification"
FT                   /EC_number="1.15.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56141"
FT                   /db_xref="GOA:D7GJ69"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ69"
FT                   /protein_id="CBL56141.1"
FT                   /translation="MTFYTLPELPYDYSALEPYISGEIMELHHDKHHKAYVDGANTALD
FT                   KLAEARDKADFGAINKLEKDLAFNLAGHVNHSVFWKNMAPKGSAPERPTDELGAAIDEF
FT                   FGSFDNMKAQFTAAATGIQGSGWASLVWDPLGKRINTLQFYDHQNNLPAGSIPLLQLDM
FT                   WEHAFYLQYKNVKGDYVKSWWNVVNWDDVALRFSEARVA"
FT   CDS_pept        705167..706207
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06120"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56142"
FT                   /db_xref="GOA:D7GJ70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ70"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6S1_PROAC"
FT                   /protein_id="CBL56142.1"
FT                   /translation="MSEQTPPPGGTSGPDPAREEPVISAFTEPQESATTPSGAHIPTPV
FT                   PMPGFAPPPPMPAPTAAGIIGDDPSLDEPVPTSVAPGRTRPVRPAGPPALSIVGLRKAF
FT                   GAKLAVADLSMAVPQGCMFGLVGPNGAGKTTTLSMATGLLRPDAGQVLVGDVDVWADPA
FT                   RAKALMGVLPDGLRLFDRLSGRELLKFVGQMRRMDEATIADRSNQLLSTLGLSEDANTM
FT                   VADYSAGMTKKIGLACALIHRPRLLVLDEPFESVDPVSGETIREILHEFVAGGGTVVLS
FT                   SHVMELVETLCDAVAVMAAGRLLAIGDTDDVRQGKPLQQRFLELVGAHHLEGGGLSWLG
FT                   RSQSSN"
FT   CDS_pept        706177..707769
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06130"
FT                   /product="ABC transporter"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56143"
FT                   /db_xref="GOA:D7GJ71"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ71"
FT                   /protein_id="CBL56143.1"
FT                   /translation="MVGTLAKLQLTLAWRGVRSSTGRIIGTVIMGIYGLGLTALLVFGL
FT                   VMMRTPAMDAWRGPVLTLAFGLVTLGWPLITMFTAGSNELLDPGRFALFPVTARQLIPG
FT                   LFAAAMLGAGALDTALLALGTVISWSGGLGTAMAAAVGAVLGVATCVISARALTALMSR
FT                   VLASRRFRDVGGVAFFAVIMAVSFGMQFGSRIFADSGAPQDVIFIAARITSWTPFGWAW
FT                   ALPWDVAQGAWLPAAAHLVLAAALVWALLRLWERSLARALVSPLDSAAVGGTVKSGRFD
FT                   FLAPRGPIGAVARRDLRYWRRDPRRLIQLLAVIVVPVFMFAPGLAQGMSQGSNFAVDFA
FT                   AVLGGVIVASTLAWSISYDGSALWMQVLSGVTGREDRIGRCWSVTIVTAPYLLVVLFGS
FT                   LFLTGDWQLLPGLIGALITAFGSSLGVGSLVGALWQQAMPAPGGNVFSRGSGTTAENFL
FT                   GSMIAMIAPIVLTAPNLALAIVSWWKPWAGWAAIVVGLVIGSLACWAGVRLGGRHLDNH
FT                   WPEVLNKVKETHA"
FT   CDS_pept        complement(707784..708635)
FT                   /transl_table=11
FT                   /gene="pf2694"
FT                   /locus_tag="PFREUD_06140"
FT                   /product="ABC-type transporter, permease components"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56144"
FT                   /db_xref="GOA:D7GJ72"
FT                   /db_xref="InterPro:IPR017196"
FT                   /db_xref="InterPro:IPR024529"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ72"
FT                   /protein_id="CBL56144.1"
FT                   /translation="MNLLTRHREPATAGGYLMPLEPRKRLSARTSVMLAVTAVLGLVAF
FT                   CWPLFVRPGAVLGSDSSGRTATPFVMGAIMAVVLALLIAELSNEDLDVKALAMLGVLAA
FT                   VGTAVRPVSAGTAGIETVFVLLILAGRVFGPSFGFMLGILTMFSSALLTGGVGTWLPYQ
FT                   MLGAGFVGLLPGLLPRRWPRPGSAGEIVVLCLYGFVAGFGYGYLLDFAFWPFTTGLGMG
FT                   APGFDPEASPWRNLHTFFVLDTVTSAGWNMGRALTNAVLIALLGRPLMRILRRTSRQAR
FT                   FD"
FT   CDS_pept        complement(708632..710248)
FT                   /transl_table=11
FT                   /gene="cbiO2"
FT                   /locus_tag="PFREUD_06150"
FT                   /product="ABC transporter, ATP-binding protein, cobalt"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56145"
FT                   /db_xref="GOA:D7GJ73"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ73"
FT                   /protein_id="CBL56145.1"
FT                   /translation="MIEFRDVSFTYTGASDPVLHDVSFQIPEGDLCLLVGRTGTGKSTL
FT                   LRSINGLVPWFDGGRLTGTVQVDTMVTSQHRPRDLARVVGSVGQNPLAGFVTDKVEDEI
FT                   AYGMEQLGVAQPAMRRRVEDTLDLMGIADLRHRPLTDLSGGQQQRVAIAAVLAAQPRVV
FT                   ILDEPTSALDPTAAQDVLSSITTLVHEVGLTVVVAEHRLERVMAFADSVAWLPGDGSVQ
FT                   VGPAGDVLARADVRPPLVGLAQALGWSTVPLTVRDARRRVKAEHIVLTDPPQAPAPDGP
FT                   VVLTATKLVVDYGETRAVNAVTTAFRAGEITALMGRNGAGKSSLMWAMQGAVASSGTLE
FT                   VTGADPRTVSAEKARELVTLVPQTAADLLYLPSVGDECRQADKESGRDEGTAAGLLSEL
FT                   GVALDMGRDPHDLSEGQRLALVLAIQLSSRPRVVLLDEPTRGLDYTTKAHLATMVRTLA
FT                   SRGVCIVVATHDVEFAAASTDRTIVMAEGDIIADDTTREACTASPTFSPQLAKVFWPQP
FT                   ILTVADVRRGRRQQADGAIRP"
FT   CDS_pept        complement(710245..711378)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06160"
FT                   /product="ABC transporter-associated permease"
FT                   /function="1.2 Transport/binding proteins and lipoproteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56146"
FT                   /db_xref="GOA:D7GJ74"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ74"
FT                   /inference="similar to AA sequence:Uniprot:Q6A6S6_PROAC"
FT                   /protein_id="CBL56146.1"
FT                   /translation="MSRLLPRLAAPVVAAPASVHRMARRSTHPWAWWCWAIGAAAAVSL
FT                   THNLALIVLVCAAVITVVMVRRSDAPWARAMGLYITLALVIVTIRMLFQITIGGIRYGR
FT                   VLFTLPQLQLPGWMAGIRLGGPVTLEGLVYTAADAGRLGAMIICLGAANALANPKRALR
FT                   SVPSALYEVSTALVIAMSVAPQLVESLLRIRRARRLRGGTVRGLRGLGALIIPVLQDSI
FT                   ERSMSLAASMESRGYGSTRDKARVGRGAGFAMLASLALLCFGAFSLLSLANGAVLGIST
FT                   LGAGVVAAVIALRSSGRQLAVTHYRPDPWRARESITALCGLAVIGVTVQLGIIAPKVLT
FT                   PPAQPATWPALDPLMIVIIGLILAPIAATTTPPAGEA"
FT   CDS_pept        complement(711391..711942)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06170"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56147"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ75"
FT                   /protein_id="CBL56147.1"
FT                   /translation="MKSSPTLAVAALGLCAITALAGCSSSTSGSSSSPSNTATALSMKD
FT                   CTSQGKVWLVVQTDQDKTLANQCVGTPSTGTAALEAANVAIGRSSDGKMICTLGDYPNP
FT                   CPATFTGAYWQYYTATPNGSWTYSDKGADDSSPKAGSIEGWCYGTTCTPKLDGVSAAPS
FT                   ASQSAEASATNSATSSVSGS"
FT   CDS_pept        complement(712054..712098)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06180"
FT                   /product="Hypothetical protein"
FT                   /function="6 Protein of unknown function, without
FT                   similarity to other proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56148"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ76"
FT                   /protein_id="CBL56148.1"
FT                   /translation="MGSVLRTVEATAEE"
FT   CDS_pept        complement(712252..712881)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06190"
FT                   /product="methyltransferase"
FT                   /function="4.6 Miscellaneous"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56149"
FT                   /db_xref="GOA:D7GJ77"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ77"
FT                   /protein_id="CBL56149.1"
FT                   /translation="MDTRHDEEPQMTQYFVNPEGPAKYHQLHATIWGHDYEFRSSNGVF
FT                   SQYRLDLGTSVLLRTLDPPVDRPARFLDLGCGFGPIAVALATECPRARVDAIDVNERAV
FT                   ELTAMNAKALGVASQVSASAPDQVPADVRYDEIWSNPPIRIGKPALHELLDTWLNRLTD
FT                   DGVAHLVVAHNLGSDSLAKWLTGQGWQVDRLGSAKGYRVFDVTRRH"
FT   CDS_pept        complement(712889..713767)
FT                   /transl_table=11
FT                   /gene="truA"
FT                   /locus_tag="PFREUD_06200"
FT                   /product="tRNA pseudouridine synthase A (tRNA-uridine
FT                   isomerase I) (tRNA pseudouridylate synthase I)"
FT                   /function="3.6 RNA modification"
FT                   /EC_number="5.4.99.12"
FT                   /note="tRNA uridine <=> tRNA pseudouridine"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56150"
FT                   /db_xref="GOA:D7GJ78"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ78"
FT                   /inference="similar to AA sequence:Uniprot:TRUA_PROAC"
FT                   /protein_id="CBL56150.1"
FT                   /translation="MGDRRFRLDLSYDGTHFHGWAMQPGQRTVEGELATWLTRIAGTAQ
FT                   PVRLVVAGRTDAGVHARGQVAHADLPATMDAAELKRRLLRALPPDIVVRRLTVAPPGFD
FT                   ARFAAIWRRYVYRLWDLSSHPDPLLRGMVTTKSLDLDPELMTAAGSRLLGLRDFAPFCR
FT                   RREGATTIRTLLQCEARRVADGCGTIELTVRADAFCHSMVRSLTGALVAVGSGTQSMDW
FT                   LDEVAAGPTRAGSVTVMPARGLCLEQVAYAPDHELAQRARAAHARRTLPAGPETTTGPV
FT                   DSDDCGCGFEG"
FT   CDS_pept        complement(713760..714614)
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="PFREUD_06210"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase
FT                   (tRNA(m7G46)-methyltransferase)"
FT                   /function="3.7.2 Aminoacyl-tRNA synthetases"
FT                   /EC_number="2.1.1.33"
FT                   /note="S-Adenosyl-L-methionine + tRNA <=>
FT                   S-Adenosyl-L-homocysteine + tRNA containing
FT                   N7-methylguanine"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56151"
FT                   /db_xref="GOA:D7GJ79"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ79"
FT                   /protein_id="CBL56151.1"
FT                   /translation="MSDNSRVHHAMADGAAGGRVGPGGTSSDPSGTSHSSVDPINGRRG
FT                   VVSFVRRSPRMNESQRQALASHSSEYLVEVPHDRLSTSVRHGATMSWPQVFGRQAPLVA
FT                   EIGSGVGDSLVAMAGARPSDNVIAFEVYLTAVASTMGKLARADVHNVRLVVADGGEGLR
FT                   ELVRPGELSELWTFFPDPWPKKRHHKRRLVQPGFAALVADRLAPGGLWRLATDWADYAD
FT                   QMREVLDAEPGLTNVYSDRPGGWAPRPDRPFTRFEKRGLDAGREVRDLAYRRVHPEGDG
FT                   ENG"
FT   CDS_pept        714824..715222
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06220"
FT                   /product="Hypothetical membrane protein"
FT                   /function="5.2 Protein of unknown function similar to
FT                   proteins from other organisms"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56152"
FT                   /db_xref="GOA:D7GJ80"
FT                   /db_xref="InterPro:IPR005185"
FT                   /db_xref="InterPro:IPR031308"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ80"
FT                   /protein_id="CBL56152.1"
FT                   /translation="MMPKPLATLLNVIWLVLGGVWLALGYVVAGVIGCVLIVTIPAGIA
FT                   SFRMARYVLWPFGRTVVPKPGAGAGTAAMNIIWMIVAGWWLALLHIISALAQAVTIVGI
FT                   ANAVVSLKMIPISVMPFGKQIVSTTSNR"
FT   CDS_pept        complement(715354..717471)
FT                   /transl_table=11
FT                   /locus_tag="PFREUD_06230"
FT                   /product="GTP phosphohydrolase
FT                   (mRNA-translation-assisting)"
FT                   /function="3.7.4 Translation elongation"
FT                   /EC_number="3.6.5.3"
FT                   /note="GTP + H2O <=> GDP + Orthophosphate"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56153"
FT                   /db_xref="GOA:D7GJ81"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D7GJ81"
FT                   /protein_id="CBL56153.1"
FT                   /translation="MSSKANAMRTVSSPTDLRNVVLVGSAGSGKTTLFENLLRARIPGY
FT                   RGERDDAERASALTLATIGNHNDTAGSDVVINLLDAPGHPDFYGDLRAGLRAADGAVFV
FT                   VSAADGVDPITAALWAECAEVNKPRAIVVTKLDTDKADFFATTELIHEAFGAGTHPAYL
FT                   PLLREEGGEVIGNISLLTGHVHDYSSGQRVTRDTTPLERAEMDAFRADYVESIITESED
FT                   EDLLERYFNGDDLETGKVVEALFRALYHGTFFPVIPVLMDGIGVEELLGMIHRGFPMPN
FT                   RRVLPAITTAGNDLVEPELGDPAGPLVAQVIRTVADPYAGRLSMVRIYSGTLRTDATVH
FT                   VAGHREAMTGRALDHYPDHDDEERVGQITVPVGTDTAVQDAAIAGQIVYVARMAHAQTS
FT                   DTLSDTDAPMVVEPWPLPRPLLPLALHATSRNDDDKLSNALQRLLVEDPTVSVERDPAT
FT                   DQLVLWTMGQAHLDLLLARLTGRYGVNVEREEIKIPLRETFIAETVGHGRHVKQSGGHG
FT                   QYALANVRIEPGERGSGFVFAEEVVGGSVPRQFIPSVEKGVRTQLDRGVLSGYPVVDVK
FT                   VTLTDGKAHSVDSSDMAFQAAGAAALRDAASAETVALLEPFDEVTVVCGNEYVGAVMTD
FT                   LGSRRGRVTGQHGGDDGRTTVTALVPASELTRYAIDLRGLSHGTGRFEREPAGYELMPP
FT                   ELAQQVLDERG"
FT   CDS_pept        717751..718194
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="PFREUD_06240"
FT                   /product="50S ribosomal protein L13"
FT                   /function="3.7.1 Ribosomal proteins"
FT                   /db_xref="EnsemblGenomes-Gn:PFREUD_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL56154"
FT                   /db_xref="GOA:D7GJ82"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="Inte