(data stored in ACNUC8465 zone)

EMBL: FN822744

ID   FN822744; SV 1; circular; genomic DNA; STD; PRO; 1954080 BP.
XX
AC   FN822744;
XX
PR   Project:PRJEA48123;
XX
DT   30-JUN-2010 (Rel. 105, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Leuconostoc gasicomitatum LMG 18811 complete genome, type strain LMG 18811T
XX
KW   complete genome.
XX
OS   Leuconostoc gelidum subsp. gasicomitatum LMG 18811
OC   Bacteria; Firmicutes; Bacilli; Lactobacillales; Leuconostocaceae;
OC   Leuconostoc.
XX
RN   [1]
RP   1-1954080
RA   Johansson P.;
RT   ;
RL   Submitted (30-APR-2010) to the INSDC.
RL   Johansson P., Department of Food Hygiene and Environmental Health,
RL   University of Helsinki, P.O. Box 66, 00014 Helsinki University, FINLAND.
XX
RN   [2]
RA   Johansson P., Paulin L., Sade E., Salovuori N., Alatalo E.R.,
RA   Bjorkroth K.J., Auvinen P.;
RT   "Genome sequence of a food spoilage lactic acid bacterium Leuconostoc
RT   gasicomitatum LMG 18811T in association with specific spoilage reactions";
RL   Appl. Environ. Microbiol. 66(9):4344-4351(2011).
XX
DR   MD5; 7f4d56234fa0a4685f1b8edc304269a0.
DR   BioSample; SAMEA2272393.
DR   CABRI; LMG 18811.
DR   EnsemblGenomes-Gn; EBG00001033807.
DR   EnsemblGenomes-Gn; EBG00001033808.
DR   EnsemblGenomes-Gn; EBG00001033809.
DR   EnsemblGenomes-Gn; EBG00001033810.
DR   EnsemblGenomes-Gn; EBG00001033811.
DR   EnsemblGenomes-Gn; EBG00001033812.
DR   EnsemblGenomes-Gn; EBG00001033813.
DR   EnsemblGenomes-Gn; EBG00001033814.
DR   EnsemblGenomes-Gn; EBG00001033815.
DR   EnsemblGenomes-Gn; EBG00001033816.
DR   EnsemblGenomes-Gn; EBG00001033817.
DR   EnsemblGenomes-Gn; EBG00001033818.
DR   EnsemblGenomes-Gn; EBG00001033819.
DR   EnsemblGenomes-Gn; EBG00001033820.
DR   EnsemblGenomes-Gn; EBG00001033821.
DR   EnsemblGenomes-Gn; EBG00001033822.
DR   EnsemblGenomes-Gn; EBG00001033823.
DR   EnsemblGenomes-Gn; EBG00001033824.
DR   EnsemblGenomes-Gn; EBG00001033825.
DR   EnsemblGenomes-Gn; EBG00001033826.
DR   EnsemblGenomes-Gn; EBG00001033827.
DR   EnsemblGenomes-Gn; EBG00001033828.
DR   EnsemblGenomes-Gn; EBG00001033829.
DR   EnsemblGenomes-Gn; EBG00001033830.
DR   EnsemblGenomes-Gn; EBG00001033831.
DR   EnsemblGenomes-Gn; EBG00001033832.
DR   EnsemblGenomes-Gn; EBG00001033833.
DR   EnsemblGenomes-Gn; EBG00001033834.
DR   EnsemblGenomes-Gn; EBG00001033835.
DR   EnsemblGenomes-Gn; EBG00001033836.
DR   EnsemblGenomes-Gn; EBG00001033837.
DR   EnsemblGenomes-Gn; EBG00001033838.
DR   EnsemblGenomes-Gn; EBG00001033839.
DR   EnsemblGenomes-Gn; EBG00001033840.
DR   EnsemblGenomes-Gn; EBG00001033841.
DR   EnsemblGenomes-Gn; EBG00001033842.
DR   EnsemblGenomes-Gn; EBG00001033843.
DR   EnsemblGenomes-Gn; EBG00001033844.
DR   EnsemblGenomes-Gn; EBG00001033845.
DR   EnsemblGenomes-Gn; EBG00001033846.
DR   EnsemblGenomes-Gn; EBG00001033847.
DR   EnsemblGenomes-Gn; EBG00001033848.
DR   EnsemblGenomes-Gn; EBG00001033849.
DR   EnsemblGenomes-Gn; EBG00001033850.
DR   EnsemblGenomes-Gn; EBG00001033851.
DR   EnsemblGenomes-Gn; EBG00001033852.
DR   EnsemblGenomes-Gn; EBG00001033853.
DR   EnsemblGenomes-Gn; EBG00001033854.
DR   EnsemblGenomes-Gn; EBG00001033855.
DR   EnsemblGenomes-Gn; EBG00001033856.
DR   EnsemblGenomes-Gn; EBG00001033857.
DR   EnsemblGenomes-Gn; EBG00001033858.
DR   EnsemblGenomes-Gn; EBG00001033859.
DR   EnsemblGenomes-Gn; EBG00001033860.
DR   EnsemblGenomes-Gn; EBG00001033861.
DR   EnsemblGenomes-Gn; EBG00001033862.
DR   EnsemblGenomes-Gn; EBG00001033863.
DR   EnsemblGenomes-Gn; EBG00001033864.
DR   EnsemblGenomes-Gn; EBG00001033865.
DR   EnsemblGenomes-Gn; EBG00001033866.
DR   EnsemblGenomes-Gn; EBG00001033867.
DR   EnsemblGenomes-Gn; EBG00001033868.
DR   EnsemblGenomes-Gn; EBG00001033869.
DR   EnsemblGenomes-Gn; EBG00001033870.
DR   EnsemblGenomes-Gn; EBG00001033871.
DR   EnsemblGenomes-Gn; EBG00001033872.
DR   EnsemblGenomes-Gn; EBG00001033873.
DR   EnsemblGenomes-Gn; EBG00001033874.
DR   EnsemblGenomes-Gn; EBG00001033875.
DR   EnsemblGenomes-Gn; EBG00001033876.
DR   EnsemblGenomes-Gn; EBG00001033877.
DR   EnsemblGenomes-Gn; EBG00001033878.
DR   EnsemblGenomes-Gn; EBG00001033879.
DR   EnsemblGenomes-Gn; EBG00001033880.
DR   EnsemblGenomes-Gn; EBG00001033881.
DR   EnsemblGenomes-Gn; EBG00001033882.
DR   EnsemblGenomes-Gn; EBG00001033883.
DR   EnsemblGenomes-Gn; EBG00001033884.
DR   EnsemblGenomes-Gn; EBG00001033885.
DR   EnsemblGenomes-Gn; EBG00001033886.
DR   EnsemblGenomes-Gn; EBG00001033887.
DR   EnsemblGenomes-Gn; EBG00001033888.
DR   EnsemblGenomes-Gn; EBG00001033889.
DR   EnsemblGenomes-Gn; EBG00001033890.
DR   EnsemblGenomes-Gn; EBG00001033891.
DR   EnsemblGenomes-Gn; EBG00001033892.
DR   EnsemblGenomes-Gn; EBG00001033893.
DR   EnsemblGenomes-Gn; LEGAS_R0001.
DR   EnsemblGenomes-Gn; LEGAS_R0002.
DR   EnsemblGenomes-Gn; LEGAS_R0003.
DR   EnsemblGenomes-Gn; LEGAS_R0004.
DR   EnsemblGenomes-Gn; LEGAS_R0005.
DR   EnsemblGenomes-Gn; LEGAS_R0006.
DR   EnsemblGenomes-Gn; LEGAS_R0007.
DR   EnsemblGenomes-Gn; LEGAS_R0008.
DR   EnsemblGenomes-Gn; LEGAS_R0009.
DR   EnsemblGenomes-Gn; LEGAS_R0010.
DR   EnsemblGenomes-Gn; LEGAS_R0011.
DR   EnsemblGenomes-Gn; LEGAS_R0012.
DR   EnsemblGenomes-Gn; LEGAS_R0013.
DR   EnsemblGenomes-Gn; LEGAS_R0014.
DR   EnsemblGenomes-Gn; LEGAS_R0015.
DR   EnsemblGenomes-Gn; LEGAS_R0016.
DR   EnsemblGenomes-Gn; LEGAS_R0017.
DR   EnsemblGenomes-Gn; LEGAS_R0018.
DR   EnsemblGenomes-Gn; LEGAS_R0019.
DR   EnsemblGenomes-Gn; LEGAS_R0020.
DR   EnsemblGenomes-Gn; LEGAS_R0021.
DR   EnsemblGenomes-Gn; LEGAS_R0022.
DR   EnsemblGenomes-Gn; LEGAS_R0023.
DR   EnsemblGenomes-Gn; LEGAS_R0024.
DR   EnsemblGenomes-Gn; LEGAS_R0025.
DR   EnsemblGenomes-Gn; LEGAS_R0026.
DR   EnsemblGenomes-Gn; LEGAS_R0027.
DR   EnsemblGenomes-Gn; LEGAS_R0028.
DR   EnsemblGenomes-Gn; LEGAS_R0029.
DR   EnsemblGenomes-Gn; LEGAS_R0030.
DR   EnsemblGenomes-Gn; LEGAS_R0031.
DR   EnsemblGenomes-Gn; LEGAS_R0032.
DR   EnsemblGenomes-Gn; LEGAS_R0033.
DR   EnsemblGenomes-Gn; LEGAS_R0034.
DR   EnsemblGenomes-Gn; LEGAS_R0035.
DR   EnsemblGenomes-Gn; LEGAS_R0036.
DR   EnsemblGenomes-Gn; LEGAS_R0037.
DR   EnsemblGenomes-Gn; LEGAS_R0038.
DR   EnsemblGenomes-Gn; LEGAS_R0039.
DR   EnsemblGenomes-Gn; LEGAS_R0040.
DR   EnsemblGenomes-Gn; LEGAS_R0041.
DR   EnsemblGenomes-Gn; LEGAS_R0042.
DR   EnsemblGenomes-Gn; LEGAS_R0043.
DR   EnsemblGenomes-Gn; LEGAS_R0044.
DR   EnsemblGenomes-Gn; LEGAS_R0045.
DR   EnsemblGenomes-Gn; LEGAS_R0046.
DR   EnsemblGenomes-Gn; LEGAS_R0047.
DR   EnsemblGenomes-Gn; LEGAS_R0048.
DR   EnsemblGenomes-Gn; LEGAS_R0049.
DR   EnsemblGenomes-Gn; LEGAS_R0050.
DR   EnsemblGenomes-Gn; LEGAS_R0051.
DR   EnsemblGenomes-Gn; LEGAS_R0052.
DR   EnsemblGenomes-Gn; LEGAS_R0053.
DR   EnsemblGenomes-Gn; LEGAS_R0054.
DR   EnsemblGenomes-Gn; LEGAS_R0055.
DR   EnsemblGenomes-Gn; LEGAS_R0056.
DR   EnsemblGenomes-Gn; LEGAS_R0057.
DR   EnsemblGenomes-Gn; LEGAS_R0058.
DR   EnsemblGenomes-Gn; LEGAS_R0059.
DR   EnsemblGenomes-Gn; LEGAS_R0060.
DR   EnsemblGenomes-Gn; LEGAS_R0061.
DR   EnsemblGenomes-Gn; LEGAS_R0062.
DR   EnsemblGenomes-Gn; LEGAS_R0063.
DR   EnsemblGenomes-Gn; LEGAS_R0064.
DR   EnsemblGenomes-Gn; LEGAS_R0065.
DR   EnsemblGenomes-Gn; LEGAS_R0066.
DR   EnsemblGenomes-Gn; LEGAS_R0067.
DR   EnsemblGenomes-Gn; LEGAS_R0068.
DR   EnsemblGenomes-Gn; LEGAS_R0069.
DR   EnsemblGenomes-Gn; LEGAS_R0070.
DR   EnsemblGenomes-Gn; LEGAS_R0071.
DR   EnsemblGenomes-Gn; LEGAS_R0072.
DR   EnsemblGenomes-Gn; LEGAS_R0073.
DR   EnsemblGenomes-Gn; LEGAS_R0074.
DR   EnsemblGenomes-Gn; LEGAS_R0075.
DR   EnsemblGenomes-Gn; LEGAS_R0076.
DR   EnsemblGenomes-Gn; LEGAS_R0077.
DR   EnsemblGenomes-Gn; LEGAS_R0078.
DR   EnsemblGenomes-Gn; LEGAS_R0079.
DR   EnsemblGenomes-Gn; LEGAS_R0080.
DR   EnsemblGenomes-Tr; EBT00001636919.
DR   EnsemblGenomes-Tr; EBT00001636920.
DR   EnsemblGenomes-Tr; EBT00001636921.
DR   EnsemblGenomes-Tr; EBT00001636922.
DR   EnsemblGenomes-Tr; EBT00001636923.
DR   EnsemblGenomes-Tr; EBT00001636924.
DR   EnsemblGenomes-Tr; EBT00001636925.
DR   EnsemblGenomes-Tr; EBT00001636926.
DR   EnsemblGenomes-Tr; EBT00001636927.
DR   EnsemblGenomes-Tr; EBT00001636928.
DR   EnsemblGenomes-Tr; EBT00001636929.
DR   EnsemblGenomes-Tr; EBT00001636930.
DR   EnsemblGenomes-Tr; EBT00001636931.
DR   EnsemblGenomes-Tr; EBT00001636932.
DR   EnsemblGenomes-Tr; EBT00001636933.
DR   EnsemblGenomes-Tr; EBT00001636934.
DR   EnsemblGenomes-Tr; EBT00001636935.
DR   EnsemblGenomes-Tr; EBT00001636936.
DR   EnsemblGenomes-Tr; EBT00001636937.
DR   EnsemblGenomes-Tr; EBT00001636938.
DR   EnsemblGenomes-Tr; EBT00001636939.
DR   EnsemblGenomes-Tr; EBT00001636940.
DR   EnsemblGenomes-Tr; EBT00001636941.
DR   EnsemblGenomes-Tr; EBT00001636942.
DR   EnsemblGenomes-Tr; EBT00001636943.
DR   EnsemblGenomes-Tr; EBT00001636944.
DR   EnsemblGenomes-Tr; EBT00001636945.
DR   EnsemblGenomes-Tr; EBT00001636947.
DR   EnsemblGenomes-Tr; EBT00001636948.
DR   EnsemblGenomes-Tr; EBT00001636950.
DR   EnsemblGenomes-Tr; EBT00001636952.
DR   EnsemblGenomes-Tr; EBT00001636954.
DR   EnsemblGenomes-Tr; EBT00001636956.
DR   EnsemblGenomes-Tr; EBT00001636959.
DR   EnsemblGenomes-Tr; EBT00001636960.
DR   EnsemblGenomes-Tr; EBT00001636964.
DR   EnsemblGenomes-Tr; EBT00001636968.
DR   EnsemblGenomes-Tr; EBT00001636970.
DR   EnsemblGenomes-Tr; EBT00001636972.
DR   EnsemblGenomes-Tr; EBT00001636974.
DR   EnsemblGenomes-Tr; EBT00001636975.
DR   EnsemblGenomes-Tr; EBT00001636976.
DR   EnsemblGenomes-Tr; EBT00001636977.
DR   EnsemblGenomes-Tr; EBT00001636978.
DR   EnsemblGenomes-Tr; EBT00001636980.
DR   EnsemblGenomes-Tr; EBT00001636981.
DR   EnsemblGenomes-Tr; EBT00001636982.
DR   EnsemblGenomes-Tr; EBT00001636983.
DR   EnsemblGenomes-Tr; EBT00001636984.
DR   EnsemblGenomes-Tr; EBT00001636985.
DR   EnsemblGenomes-Tr; EBT00001636986.
DR   EnsemblGenomes-Tr; EBT00001636987.
DR   EnsemblGenomes-Tr; EBT00001636988.
DR   EnsemblGenomes-Tr; EBT00001636989.
DR   EnsemblGenomes-Tr; EBT00001636990.
DR   EnsemblGenomes-Tr; EBT00001636991.
DR   EnsemblGenomes-Tr; EBT00001636992.
DR   EnsemblGenomes-Tr; EBT00001636993.
DR   EnsemblGenomes-Tr; EBT00001636994.
DR   EnsemblGenomes-Tr; EBT00001636995.
DR   EnsemblGenomes-Tr; EBT00001636996.
DR   EnsemblGenomes-Tr; EBT00001636997.
DR   EnsemblGenomes-Tr; EBT00001636998.
DR   EnsemblGenomes-Tr; EBT00001636999.
DR   EnsemblGenomes-Tr; EBT00001637000.
DR   EnsemblGenomes-Tr; EBT00001637001.
DR   EnsemblGenomes-Tr; EBT00001637002.
DR   EnsemblGenomes-Tr; EBT00001637003.
DR   EnsemblGenomes-Tr; EBT00001637004.
DR   EnsemblGenomes-Tr; EBT00001637005.
DR   EnsemblGenomes-Tr; EBT00001637006.
DR   EnsemblGenomes-Tr; EBT00001637007.
DR   EnsemblGenomes-Tr; EBT00001637008.
DR   EnsemblGenomes-Tr; EBT00001637009.
DR   EnsemblGenomes-Tr; EBT00001637010.
DR   EnsemblGenomes-Tr; EBT00001637011.
DR   EnsemblGenomes-Tr; EBT00001637012.
DR   EnsemblGenomes-Tr; EBT00001637013.
DR   EnsemblGenomes-Tr; EBT00001637014.
DR   EnsemblGenomes-Tr; EBT00001637015.
DR   EnsemblGenomes-Tr; EBT00001637016.
DR   EnsemblGenomes-Tr; EBT00001637017.
DR   EnsemblGenomes-Tr; EBT00001637018.
DR   EnsemblGenomes-Tr; EBT00001637019.
DR   EnsemblGenomes-Tr; EBT00001637020.
DR   EnsemblGenomes-Tr; EBT00001637021.
DR   EnsemblGenomes-Tr; EBT00001637022.
DR   EnsemblGenomes-Tr; LEGAS_R0001-1.
DR   EnsemblGenomes-Tr; LEGAS_R0002-1.
DR   EnsemblGenomes-Tr; LEGAS_R0003-1.
DR   EnsemblGenomes-Tr; LEGAS_R0004-1.
DR   EnsemblGenomes-Tr; LEGAS_R0005-1.
DR   EnsemblGenomes-Tr; LEGAS_R0006-1.
DR   EnsemblGenomes-Tr; LEGAS_R0007-1.
DR   EnsemblGenomes-Tr; LEGAS_R0008-1.
DR   EnsemblGenomes-Tr; LEGAS_R0009-1.
DR   EnsemblGenomes-Tr; LEGAS_R0010-1.
DR   EnsemblGenomes-Tr; LEGAS_R0011-1.
DR   EnsemblGenomes-Tr; LEGAS_R0012-1.
DR   EnsemblGenomes-Tr; LEGAS_R0013-1.
DR   EnsemblGenomes-Tr; LEGAS_R0014-1.
DR   EnsemblGenomes-Tr; LEGAS_R0015-1.
DR   EnsemblGenomes-Tr; LEGAS_R0016-1.
DR   EnsemblGenomes-Tr; LEGAS_R0017-1.
DR   EnsemblGenomes-Tr; LEGAS_R0018-1.
DR   EnsemblGenomes-Tr; LEGAS_R0019-1.
DR   EnsemblGenomes-Tr; LEGAS_R0020-1.
DR   EnsemblGenomes-Tr; LEGAS_R0021-1.
DR   EnsemblGenomes-Tr; LEGAS_R0022-1.
DR   EnsemblGenomes-Tr; LEGAS_R0023-1.
DR   EnsemblGenomes-Tr; LEGAS_R0024-1.
DR   EnsemblGenomes-Tr; LEGAS_R0025-1.
DR   EnsemblGenomes-Tr; LEGAS_R0026-1.
DR   EnsemblGenomes-Tr; LEGAS_R0027-1.
DR   EnsemblGenomes-Tr; LEGAS_R0028-1.
DR   EnsemblGenomes-Tr; LEGAS_R0029-1.
DR   EnsemblGenomes-Tr; LEGAS_R0030-1.
DR   EnsemblGenomes-Tr; LEGAS_R0031-1.
DR   EnsemblGenomes-Tr; LEGAS_R0032-1.
DR   EnsemblGenomes-Tr; LEGAS_R0033-1.
DR   EnsemblGenomes-Tr; LEGAS_R0034-1.
DR   EnsemblGenomes-Tr; LEGAS_R0035-1.
DR   EnsemblGenomes-Tr; LEGAS_R0036-1.
DR   EnsemblGenomes-Tr; LEGAS_R0037-1.
DR   EnsemblGenomes-Tr; LEGAS_R0038-1.
DR   EnsemblGenomes-Tr; LEGAS_R0039-1.
DR   EnsemblGenomes-Tr; LEGAS_R0040-1.
DR   EnsemblGenomes-Tr; LEGAS_R0041-1.
DR   EnsemblGenomes-Tr; LEGAS_R0042-1.
DR   EnsemblGenomes-Tr; LEGAS_R0043-1.
DR   EnsemblGenomes-Tr; LEGAS_R0044-1.
DR   EnsemblGenomes-Tr; LEGAS_R0045-1.
DR   EnsemblGenomes-Tr; LEGAS_R0046-1.
DR   EnsemblGenomes-Tr; LEGAS_R0047-1.
DR   EnsemblGenomes-Tr; LEGAS_R0048-1.
DR   EnsemblGenomes-Tr; LEGAS_R0049-1.
DR   EnsemblGenomes-Tr; LEGAS_R0050-1.
DR   EnsemblGenomes-Tr; LEGAS_R0051-1.
DR   EnsemblGenomes-Tr; LEGAS_R0052-1.
DR   EnsemblGenomes-Tr; LEGAS_R0053-1.
DR   EnsemblGenomes-Tr; LEGAS_R0054-1.
DR   EnsemblGenomes-Tr; LEGAS_R0055-1.
DR   EnsemblGenomes-Tr; LEGAS_R0056-1.
DR   EnsemblGenomes-Tr; LEGAS_R0057-1.
DR   EnsemblGenomes-Tr; LEGAS_R0058-1.
DR   EnsemblGenomes-Tr; LEGAS_R0059-1.
DR   EnsemblGenomes-Tr; LEGAS_R0060-1.
DR   EnsemblGenomes-Tr; LEGAS_R0061-1.
DR   EnsemblGenomes-Tr; LEGAS_R0062-1.
DR   EnsemblGenomes-Tr; LEGAS_R0063-1.
DR   EnsemblGenomes-Tr; LEGAS_R0064-1.
DR   EnsemblGenomes-Tr; LEGAS_R0065-1.
DR   EnsemblGenomes-Tr; LEGAS_R0066-1.
DR   EnsemblGenomes-Tr; LEGAS_R0067-1.
DR   EnsemblGenomes-Tr; LEGAS_R0068-1.
DR   EnsemblGenomes-Tr; LEGAS_R0069-1.
DR   EnsemblGenomes-Tr; LEGAS_R0070-1.
DR   EnsemblGenomes-Tr; LEGAS_R0071-1.
DR   EnsemblGenomes-Tr; LEGAS_R0072-1.
DR   EnsemblGenomes-Tr; LEGAS_R0073-1.
DR   EnsemblGenomes-Tr; LEGAS_R0074-1.
DR   EnsemblGenomes-Tr; LEGAS_R0075-1.
DR   EnsemblGenomes-Tr; LEGAS_R0076-1.
DR   EnsemblGenomes-Tr; LEGAS_R0077-1.
DR   EnsemblGenomes-Tr; LEGAS_R0078-1.
DR   EnsemblGenomes-Tr; LEGAS_R0079-1.
DR   EnsemblGenomes-Tr; LEGAS_R0080-1.
DR   EuropePMC; PMC3127722; 21571876.
DR   EuropePMC; PMC3568588; 23204416.
DR   EuropePMC; PMC4345393; 25548057.
DR   EuropePMC; PMC4357932; 25616799.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00011; RNaseP_bact_b.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF00522; PreQ1.
DR   RFAM; RF00555; L13_leader.
DR   RFAM; RF00557; L10_leader.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01764; yjdF.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FN822744.
DR   SILVA-SSU; FN822744.
DR   StrainInfo; 47182; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1954080
FT                   /organism="Leuconostoc gelidum subsp. gasicomitatum LMG
FT                   18811"
FT                   /strain="type strain: LMG 18811"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:762550"
FT   CDS_pept        46..1392
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="LEGAS_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90649"
FT                   /protein_id="CBL90649.1"
FT                   /translation="MTKPITKEELWNQVKAKFYQEIGPVSFDTYIEPLVPVTLTESSII
FT                   LEVPVDESSDIIDNWNKSYAMSFVQYAMEIAEGFIKPELRIAEAIQKSTLIQTENLTFT
FT                   RESDLNENFTFDKFVVGTGNENAYAIARAVAEDPGRVYNPYLIYGGVGLGKTHLMQAIG
FT                   NAYSKTTPSARIKYATAEDFLNDFTESLRAGEGATAVFKKEYRTVDLLLIDDIQFWSGK
FT                   EKVQEEFFNTFNVLTKTGKQIIMTSDKLPTEIVDLQSRLTSRFEAGISMDIQKPDLPTR
FT                   VAILKNLAETDNLEIPNDVLELIADKIDSNIRTLEGTFHRFEAMLRYRNKPATKETAQK
FT                   ILGDLNINQGFKITVERIQQVVADYYMQTIDDLKSTSRKKDLVTARHVAMYLTRTLTNE
FT                   SLPDIGRSFGGRDHSSVLHATNKITEKAESDARTKEMLEALTDEIKNGK"
FT   CDS_pept        1591..2724
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="LEGAS_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90650"
FT                   /protein_id="CBL90650.1"
FT                   /translation="MQFSINRQAFIKALNDVSRAISSRTTIPILTNIKIVLTQEELILT
FT                   GSNSDISIETRIDQSDTGAQLIIKQPGGITLLATFFSNIVKNLPADDMTLSVDGVRASI
FT                   TSGASDFTINGQDVHNYPQLPEMDDVQSLSVSAAQLVDIISQTKISASTQESRPILTGI
FT                   HLALNGNDVKAVTTDSHRLSQRIVTLTGTDAHVKADVIMPAKSFNELQSLLEGQDRVEI
FT                   KLAANQAVFDLGNTTFYSRLLEGNYPETDRLIPTESTTQLTIEASALLGAINRASLLSH
FT                   ESRNNVVQLTLKNGVVTLIGTSQEVGRVQEELVTKSVEGEDLEISFNPDYVRDALRVFN
FT                   GKSVDIKFTSNLRPFTLTPAGETDDKQLQLITPVRTF"
FT   CDS_pept        2865..3326
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0003"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90651"
FT                   /protein_id="CBL90651.1"
FT                   /translation="MTKNIKITTEYITLTQLLKEENIISSGGQAKYYLMDFPVLLNGET
FT                   ENRRGKKLYNHDEITVDGENYVISLADNADEMIAAAQEEKAERAAAAKKTVRNDRIKAQ
FT                   KAAVAKERKEARFAELRKKNGTRAGGFGRSNQGGRGTGPKGPSSWNSNR"
FT   CDS_pept        3308..4435
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="LEGAS_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90652"
FT                   /protein_id="CBL90652.1"
FT                   /translation="MELQSLRLVNYRNYTDLTLNFSDGVNVFLGENAQGKTNLLESIYV
FT                   LALARSHRTSSDKDLIRWQEKEATISGRVKKSISDTPLSLHFSNKGKKARVNHLEQSKL
FT                   SQYIGQLNVILFAPEDLELVKGAPSVRRRFIDMEFGQMNPLYLYNTTQYRRILKERNAY
FT                   LKRLQMKQTTDTIFLDVLTEQLVDIGSQVLLARQTFLERLEVAAQPIHAEISNKRETLT
FT                   LRYQTSLDFEKETDLATIKLVFEQTLKKQQSREIMQGSTLVGPHRDDIQFIVNDNDVAV
FT                   FGSQGQQRTTALAIKLAEIDLMQQETGEYPILLLDDVLSELDANRQTHLLLAIQDKVQT
FT                   FITAPTLSDVARQLIHAPRVFHVKQGEIVLEEQVE"
FT   CDS_pept        4461..6470
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="LEGAS_0005"
FT                   /product="DNA gyrase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90653"
FT                   /protein_id="CBL90653.1"
FT                   /translation="MSEEINNELENIDGIVTDDVEIRQASTVNASAGDYNADQIQVLEG
FT                   LEAVRKRPGMYIGTTTAQGLHHLVWEIVDNGIDEALAGFASHITVTIEKDNSITVTDDG
FT                   RGIPVDIQTKTGKSALETVFTVLHAGGKFGGGGYKVSGGLHGVGASVVNALSTNLDVRV
FT                   IRDNQVYYMDFKLGRVNTSIVKLDEKPTIDRGTIVHFNPDSDIFRETTTFNYNTLLTRV
FT                   RELAFLNKGLRISITDNRLEVPATESFHFEGGIKEYVGYLNSEKTVIFPEPVYVEGEEN
FT                   GIVVEAALQYTTDIKDSLRTFANNINTYEGGTHETGFKTALTRVINDYGRKNGQLKDNA
FT                   ESLTGEDVREGVTAIVSIKHPDPQFEGQTKTKLGNSDARQATDRMFSETFSRFMMENPI
FT                   VAKQIVDKGILAQKARLAAKRAREMTRKQSGLEIGNLPGKLADNTSNDPAISELFIVEG
FT                   DSAGGSAKQGRNRVTQAILPIRGKILNVEKATLDRVLGNEEIRSLFTAMGTGFGDDFNV
FT                   EKANYHKVIIMTDADVDGAHIRTLLLTLFYRYMRPLVDAGYIYIAQPPLYGVALGNSKT
FT                   REYLDTDEELEAYLTQLPSNIKPKVQRYKGLGEMDFDQLADTTMDPINRRLLRVDPSDA
FT                   EAADSIFDMLMGDDVAPRREFIEENAVFVENLDI"
FT   CDS_pept        6571..9126
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="LEGAS_0006"
FT                   /product="DNA gyrase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90654"
FT                   /protein_id="CBL90654.1"
FT                   /translation="MSEQNDSRIHNANLSEQMKTSFLSYAMSVIVARALPDVRDGMKPV
FT                   HRRILYSMIEQGNTPDKPHKKSARIVGDVMGKYHPHGDSAIYESMVRMAQPFSYRHMLV
FT                   DGHGNFGSVDGDSAAAMRYTEARLSKVAMEMVRDLNKDTVNFIPNYDGEEREPEVLPAR
FT                   FPNLLVNGATGIAVGMATNIPTHNLAEVISALHILMNNPEATTMDLMEALPGPDFPTGG
FT                   IVMGKSGIRRAYETGRGRVTVRAKVDIEQTKTGKEQIIVTELPYAVNKARLIERISELA
FT                   RDKRIEGITGIRDESDRDGLRVSIDVRRDASASVILNNLYKETLLQTNFSFNMLAINGG
FT                   KPQTMSLKEILVAYLIHQREVIRRRTAFDLQKAQARAHILEGLRIALDHIDEIISIIRS
FT                   SATSEEAKTRLIDGYLLSDKQAQAILDMRLVRLTGLERDKIEDEYQKLVALITDLKDIL
FT                   AHEERVDQIIYDELLEIQTKFGDARRTELQVGDVTNLEDEDLIEEEDVIVTLTRNGYIK
FT                   RVPQAEFKAQNRGGRGVQGINVNDEDFVDQMIATSTHDTLLFFTNKGKVYRMKGYEVPE
FT                   YGRQAKGIPVVNLLKFEGDEKIQTVINVRGEAGESKDYLFFVTRLGVVKRTAVSEFSNI
FT                   RTNGLKALTLRDDDEVLSVQITDGTQSIMIATKDGYSVRFTEEDVRIMGRAAAGVRGIR
FT                   LRDGDLVIGSDVVSLNDNVLVITEKGYGKQTPVSEYPIKGRGGKGIKTANITEKNGTLA
FT                   GMIIVHGDEDIMVTTTQGVMIRFTTESVSQTGRATLGVRLIRLEDGAKVATLAKVEHEE
FT                   SLVVDAKEDVSRETPLDNQQIEQVTELLDRAKSDETNAD"
FT   CDS_pept        complement(9321..9584)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0007"
FT                   /product="Stress-responsive transcription regulator
FT                   (Putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90655"
FT                   /protein_id="CBL90655.1"
FT                   /translation="MTKKKTFTRSRNNRMIAGVMGGVADYFGWNATWLRIIFVLISFFS
FT                   VAFPGILVYILAWIIIPDAPKKTNYYSTDSRKDVTPDNDDRP"
FT   CDS_pept        complement(9597..9722)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0008"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90656"
FT                   /protein_id="CBL90656.1"
FT                   /translation="MLAAGIEFATSHDWFSTLWHALLSWISVGYYIADTLQHIIK"
FT   CDS_pept        complement(9831..11174)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0009"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90657"
FT                   /protein_id="CBL90657.1"
FT                   /translation="MTSIEMEIRTRLDVIFSKYTPNTQLTEFKEELVADLMEAYQDFAK
FT                   QDKSHDEALDDAFAQLGDIDIVLRDLSQTDKTNGANHDDEPKKAPFIDISDDGFHVGNL
FT                   HIDGRGVRLGDDIVIDGKHDKVQFGDWLHVDHDGARVGKKYYKFDDDSNINQSHFDENE
FT                   ENASAPTWAAAHHNAQIPTSDKQFVFDYRDATVNFYTNDKTDLITVDEYFNRDNARYFA
FT                   RIEENDDRVLVSQGDHPLLFHVRTLINIGFPKNFDTGYITSINHSGRVTAQHLTLGTFN
FT                   LVIHSGSFNGQQIKATTAAWEVHSGAVKADGLTFEKAEIFDQSGSVKLLNAAISHAKIS
FT                   ATSGSVQVDNFVGGGQFSANSGSLRLRITELTDDLKLHAHSSSIRVTAPATQHFNFDLS
FT                   SNSGMVTIERDENIHFDKNTTNYKRGFYGTNPKFTIDANVNSGTIKVY"
FT   CDS_pept        complement(11171..11521)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0010"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90658"
FT                   /protein_id="CBL90658.1"
FT                   /translation="MAISKDLIRGHTDTIILNILNQGDSYGYQVAKSIRLLSNQQYDLN
FT                   EATLYTAFRRLEKGDDITSYWGDETQGARRKYYKITTSGQQHLASALQEWEFAKDIISN
FT                   LITGNINEGASL"
FT   CDS_pept        11870..12370
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90659"
FT                   /protein_id="CBL90659.1"
FT                   /translation="MSKKNKVMIAIVATLVIMGIGVMTALSITDVNGVKIDGKAAQMML
FT                   ITVTVSGIVGVIVGALFNKLFIWLSQLGQEEKQSVSFLTSWYATAISQIPFAIINIFLV
FT                   TVLSLYKSGNTVAAIISGVVNALIYTFILRQEKVITKRTQIIYLVIMIVLIIVMSAVPM
FT                   LMK"
FT   CDS_pept        12411..13454
FT                   /transl_table=11
FT                   /gene="bacG"
FT                   /locus_tag="LEGAS_0012"
FT                   /product="Accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90660"
FT                   /protein_id="CBL90660.1"
FT                   /translation="MKRRTKVTLIVTSCVVAVGLLAATGVTTYHKMTHKSGATVKTGYQ
FT                   SYTVTTSPALSMSGKVAASKTQMLNTPTGKLQQINVNNGQSVKSGDILLTVTNTDMQEA
FT                   IDNQNDVIAKSNRAINGATSALRNAQQSYNQADPEAKSALKDGVTQAQQAVTDANTDAQ
FT                   DAQNKLVDLQNKLNVNLTAPFDGIVSVDDNTKDGLPALTMNTTEKVLQATVSEYDYNKV
FT                   HSGDKVTVSGIDGTPNQTTAIDKIEQIPAEKSKGTTYYPFSAHVNENFLYGQSVKVKVP
FT                   QNDLKVPSTAVYKGNIYKIIDGKASRVNADVTKTGTSYIVKSGVAKDEKVVLNPDSHLK
FT                   NGEAIND"
FT   CDS_pept        13447..14136
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0013"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90661"
FT                   /protein_id="CBL90661.1"
FT                   /translation="MINLSAISKSYRQGNDDYQVLHDINLRIQAGEFVAIMGPSGSGKS
FT                   TLINIIGFLDQHFDGGYTFNDVVVSELNRKQHAQLRNQSVGFIFQNFKLITNQSVGENV
FT                   GLPLLYAGMKRRDIVARVNEVLSQVGLPGSYHKLPKNLSGGQQQRVAIARSIVTKPKFL
FT                   VADEPTGALDSVTSAEIIALFKDLNDNGTTVIMVTHDEHVARETNRLIKILDGRIQSDE
FT                   EVQHANT"
FT   CDS_pept        14123..15304
FT                   /transl_table=11
FT                   /gene="bacI"
FT                   /locus_tag="LEGAS_0014"
FT                   /product="ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90662"
FT                   /protein_id="CBL90662.1"
FT                   /translation="MQIRELFVSAFRSLLSNKRRSILTMIGIIIGIASVITILALGDGA
FT                   RVAMMKNLQASSSGQQSTEITFAPKDESKVAGFSDDDLNRIRENNKVSHVSVQSDDHGI
FT                   LSTEGLVNGKTISPVVYLSQSANNDHLISGHGISKRDSLVSNPVALVSQSMAKRGYQSA
FT                   NNALNAGIELNGTTYTIVGIISNDAMRGSYNNYDVVVPRQVFEANNANISANTLKLTFA
FT                   AGVNVSKETQKITDQLNSTGSQHNAGNYQFYDMAAMLKGVSAVIKGITYFIVAVAGISL
FT                   FIAGIGVMNMMYIAVSERTQEIGIRMAVGASQQQILWQFLIEAVMLTLSGGMIGYLAGL
FT                   GIAMGVSAFLPFKASVSISTFLLAFGTSTIVGLVFGILPAKTASNKNLIDILR"
FT   CDS_pept        complement(15472..15870)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90663"
FT                   /protein_id="CBL90663.1"
FT                   /translation="MIKAKKFIYFLVLLIVCALIVVLLIESQRNKKPVTTTMLPSQRSS
FT                   SADTSKNNESNLSSADIASEGNNNVSGGGDFTSYYGKERIVKIYHSDTKTVTLLNENDP
FT                   MTADQKEHLKQAIAPYQQNQAAIRATKK"
FT   CDS_pept        complement(16174..16515)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0016"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90664"
FT                   /protein_id="CBL90664.1"
FT                   /translation="MLKIMPMSPNHFQKYMDFAVNEYATEKIAAGTWTAETAQKNSQLT
FT                   YDRLLPNGLATPDTFFYSIFKNSEIIGYIWFGTDNENASTAFIFDFEIYKTYQKSGFNI
FT                   TDINMQKQL"
FT   CDS_pept        complement(16639..16977)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0017"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90665"
FT                   /protein_id="CBL90665.1"
FT                   /translation="MHVIWTSFSTLVYEDLSAAQQLLIIAEKYLIDHIDITEKITLMFN
FT                   KGWYDIEAGHIEKGEQRVRTAINIYTSLGYKKKASDLTRQLVHHIKRQEEKKQGYKSAD
FT                   SRVISIYV"
FT   CDS_pept        17297..18106
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0018"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90666"
FT                   /protein_id="CBL90666.1"
FT                   /translation="MSKRVLFYLITIFFVFGGIVTIETLLAIFEANTLPHNALNTSNTF
FT                   YMLQFGNVSEIVSILMLIMIPISGSLLFTYIKNNNYFYSFIQRHSYKKFLSKALIVTFL
FT                   TAFIFSLVILLYQLLLISLSIHPLDWGNIDAKNVISGVAMFDDGNLSSTVKFILLSSFG
FT                   WGIYANLVFSIGLFIKKNAINIISGGIIGSSLIIVPALVSHLFQGTLLKMVYIVSLPTL
FT                   IAPGQMNVQYFGNQNKLYLYFVLSTMVYMSLTLGIVYFWIKKKQKEG"
FT   CDS_pept        18111..18692
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0019"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90667"
FT                   /protein_id="CBL90667.1"
FT                   /translation="MKKMSFSKISWSLFFTIVMMSFLSASNALLHTSKDSDIIRTQLYS
FT                   NFSVIFTQSMLLLLMSWQVLNFRAINFLVAIRGQSEKIQKQMIKTIIFEVIIYFSFYYG
FT                   SFMLSGNIWFKDGYVLIGIMILLMRAFIILFLGMIITSLYRGQHIAIIIVAVQLSNFVY
FT                   HFFLETKILLVQYSPLYDPIYRALHHIYNI"
FT   CDS_pept        18713..19312
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0020"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90668"
FT                   /protein_id="CBL90668.1"
FT                   /translation="MLKVNHIAKSFKGKSVLNNVSFEVNEGQLVHISGANGSGKSTLFK
FT                   IIAKVLLPDSGAITIIESAKIGALIENPGFLEFETGLANLRFLAKLNHNYDEKKVCELM
FT                   ERFALDPNNRQPVSKYSVGMRQKLGIIQAVMEDQSIILLDEPTRGLDTDSIDQFIDLLK
FT                   ILQAKNKLVIVASHDYIEGIKYDTLFTLKNGTLSYG"
FT   CDS_pept        19449..19799
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0021"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90669"
FT                   /protein_id="CBL90669.1"
FT                   /translation="MVSILNLLFDYVSLIMPVMELLSIQIFLLVRKPSLRSQFKGYVPI
FT                   ILHYFVPYVLVKAFVLSTERSMSVLVWIGISIVTWVILLVFLINQRYSYAKVATIILTT
FT                   LIFSRILATIMF"
FT   CDS_pept        complement(19910..20869)
FT                   /transl_table=11
FT                   /gene="rihA1"
FT                   /locus_tag="LEGAS_0022"
FT                   /product="Pyrimidine-specific ribonucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90670"
FT                   /protein_id="CBL90670.1"
FT                   /translation="MASTKMILDLDTGVDDALALALAICDPRVDLIGVIASYGNTLVET
FT                   SAQNTLNLLHLLGENDVPVYLGESHSSTTDHFDVMPISKAIHGEHGVGNLSLATATRKI
FT                   EQTSGIQFLIDMAHKYQDELIYVPTGPLTNMAKALKIDPEISHLIGNTTLMGGALTVPG
FT                   NVTPFTEANINQDPEAADLVFTTQENLTMVGLDVTLRTLLTKKDTQQWRELGTQAGTAY
FT                   ADLMDFYIEAYDRLDIDHRGAALHDPLAVAVAIDPSYVVTIPLNMRVTYDKDTKDYGRT
FT                   IGDRERLLEPTTTNVAVSVNAKRFVRDFMDFMIAVLKA"
FT   CDS_pept        complement(20871..21803)
FT                   /transl_table=11
FT                   /gene="rihC"
FT                   /locus_tag="LEGAS_0023"
FT                   /product="Nonspecific ribonucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90671"
FT                   /protein_id="CBL90671.1"
FT                   /translation="MTPIILDMDPGIDDAVALSIALTNPEIDIKLLTSVAGNVSVDKTT
FT                   INLLKLTTFFKQTQVPVARGAAAPLKKAFVDASYIHGASGMPGYEFPTVTTQALPTDAV
FT                   SAMAKVLSEAPEPMTIVATGSYTNIALLIQNHPELISQIKEFVLMGGSLSGGNVSSVAE
FT                   FNIFTDPDAAAVVFKSGIPIVMIGLDVTLKALLSLDTIDAVANIGEAGNMLHKLMTAYG
FT                   DSEPGGKPMHDVNTICYLLNPEFYTTKDYWVDVITDGPAAGATVADTQNRWSNGKINAK
FT                   VAINIDTQAFEKWFIEQIPVMNQYCEGAI"
FT   CDS_pept        complement(21833..23056)
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="LEGAS_0024"
FT                   /product="Nucleoside transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90672"
FT                   /protein_id="CBL90672.1"
FT                   /translation="MFLFANVLGIFVFIAIAVLFSRDKKNIQWRSVGIVLAIELVLAWF
FT                   FTQFKAGQVAVQGAADGFNWLVSVASQGIAFALPEWLTSNHGGPNFVTSALLPILLVVP
FT                   LFDILTYIGILPWLIKWIGKALTFVTGQPKFEAFFSIEMMFLGNTEVLAVSKSQLDHMS
FT                   ASRNFTLAMMSMSCVTSAIIGAYTQMVPGKYVLTAIPLNILGAIVITSILNPNKVAPED
FT                   DIIVNINEKGTKKEPFFSFLGDSILGAGKLILIITATVIAFVSLAALINQLFSLTGLHW
FT                   LTLENIFGVIMFPFAWLLGFNVHDAFQLAQFMGTKLVTNEFVVMGEVSKSIMASKGLFA
FT                   NEHARIVLTVFLTSFANFGTIGMIIGAFKGLVNKEKNDYISARVPYMLLSGILVSLLSA
FT                   ATAGLFVW"
FT   CDS_pept        23212..24207
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="LEGAS_0025"
FT                   /product="LacI family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90673"
FT                   /protein_id="CBL90673.1"
FT                   /translation="MRKTSIKDVAKKADVSIAAVSQILNNKGQRFSKHTIEKVLQARDD
FT                   LGYVPNSAARNLKGTHNRLIGIIVPSFRMPFFADIIQSMQDNAPTDVNLVFLGSTDDNL
FT                   QNAIYSLVERGAQALIFGKPIPNRAEVNEFLKKRHIPYLVLDQNADINAQDMVQTNEFT
FT                   GGSLVASHLLSLGHRKIALILPNKLTDNMRQRRAGFLDTLSTANLSPTTIITATLSKHG
FT                   GLASVHQLIQSESTAAFVLNDEMAIGVLRGLAYQNIKVPADISIAGYDDTDYAEFMIPT
FT                   LTTVMQPVLEIGKAALNMILRRLDHPNLPFQTAFFDVKLIVRESTGSVKL"
FT   CDS_pept        24541..24939
FT                   /transl_table=11
FT                   /gene="rbsD"
FT                   /locus_tag="LEGAS_0026"
FT                   /product="high affinity ribose transport protein RbsD"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90674"
FT                   /protein_id="CBL90674.1"
FT                   /translation="MKKIGIMNSNISARVADMGHMDWLAVGDAGTPVPEGVDKIDLSVK
FT                   SGIPSFMEVLDVILLELEVQKIYLAEEIKVKNPDILEQINRRFDGDVSIEFISHNDLKK
FT                   NIKESKAFIRTGETTPYANIILESGVIF"
FT   CDS_pept        24968..26455
FT                   /transl_table=11
FT                   /gene="rbsA"
FT                   /locus_tag="LEGAS_0027"
FT                   /product="ribose transport ATP-binding protein RbsA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90675"
FT                   /protein_id="CBL90675.1"
FT                   /translation="MKIDMVGISKSFGKNHVLRDVDFHIGNAEVHALMGENGAGKSTLM
FT                   NIMTGLLKADAGQIMVDDKVVTFNGPKDAEEHGISFIHQEMNNFGEMTVLENMFLNKEL
FT                   KKKFGFLDESTMRSQANSIFHTLHINYDLDSPIGNLSVGAQQMIEISKAMMTDAKVIIM
FT                   DEPTAALTTSEIRSLFETVNNLKARGVSFIYISHRIEENMEIADKITIMRDGHTVSESR
FT                   ISDTSVDKIVTSMVGRDIGEFYPDRHKNYGDTMLSVSHLTRVDKFKDINFSVKSGEILG
FT                   FSGLMGSGRTEIMRAIFGVDPIDSGDIKIDGKIEKISDPSNAIKQGIGFVTENRKDEGL
FT                   ILDFSVAENIIMPSLQELVKNHMIDETTKESFVDLLIKRLTVKTDGQNISVGSLSGGNQ
FT                   QKVVLAKWIGAGSKILILDEPTRGVDVGAKREIYDLMNELTDRGVAIIMVSSDLPEVLA
FT                   MSDRIAVMYEGSLMGIVDNNEKVTESDIMTLATGGKI"
FT   CDS_pept        26455..27441
FT                   /transl_table=11
FT                   /gene="rbsC"
FT                   /locus_tag="LEGAS_0028"
FT                   /product="ribose transport system permease protein RbsC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90676"
FT                   /protein_id="CBL90676.1"
FT                   /translation="MASEKRVEKVQVVKDNKNLMSKVSGLGPVLALIVLALLTTAMNPS
FT                   FLDPNNLLNLLRQVSINGLIAFGMTFVILTGGIDLSVGAILALTSALSAMMITSGVPTL
FT                   IAMLVGIIIGGILGGVNGLIITKGGAAPFIASLATMTIFRGATYVFTNGNPITGKAMNN
FT                   SFVFQFIGRGYFFGIPVPVILMIIAFIILYVLLHKMTFGRKTYALGGNEKAAFVSGIKV
FT                   NITKTWIYVISGIMSSAAGMILISRLSSAQPDAGTGFEMDAIAAVVLGGTSLAGGRGRI
FT                   FGTLIGALIIGTLNNGMNLIGISSFYQQIVKGIVIIIAVLLDRRKKA"
FT   CDS_pept        27456..28412
FT                   /transl_table=11
FT                   /gene="rbsB"
FT                   /locus_tag="LEGAS_0029"
FT                   /product="D-ribose-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90677"
FT                   /protein_id="CBL90677.1"
FT                   /translation="MTKKIIGIIAAIGILIYGIFFVTSGRQVFSISNPFQNNVTVQHKK
FT                   PAELKIGVSLSTLNNPFFISIKDGVNEVAKSSGSKVQVYDGQNSTNKQSNDVEDLIQKK
FT                   VDVLIINPVDSSAITPEVKSANEAGIPVITIDRSSDGGKVLSLVASDSREGGKMAAEFM
FT                   IKTLGQNGKIAELQGTPGASATRERGAGFDNTAKGKLDTVTRQTANFDRTQGLNTAENI
FT                   AQAHPEIKGLFAQNDEMALGAVQALKSNPNVIIVGFDGSEDGISSVKKGQMAATVAQKP
FT                   KEMGKLAVQAAYDYFQGKKVSSNIKSPLELIVSDKYK"
FT   CDS_pept        28461..29408
FT                   /transl_table=11
FT                   /gene="rbsK1"
FT                   /locus_tag="LEGAS_0030"
FT                   /product="ribokinase RbsK"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90678"
FT                   /protein_id="CBL90678.1"
FT                   /translation="MNNVVVIGSLNIDLVTKIERLPLQGETISIIDQTTNFGGKGANQA
FT                   VAAARQGANVTFIGATGDDDNGELFNELLKKENINTDYIVKKDKPTGTATILLEANGHN
FT                   TILVHGGANMDLNKADVEKATKVLRDADVVVAQLEVPKEAVEAAFKIAKVGGAITVLNP
FT                   APITHNLGKELISNTDLIIPNETEAAALVNASKSTDLKTIEDTIYQQLRVQGLKNVIIT
FT                   LGDKGVYYNILNEPGFLPIFTVDTVDTTAAGDTFIGTVVASLRHDMLYMRELLLRSTMA
FT                   SSLAVSKAGAISSIPYKKAVDEKINQLGNYEASR"
FT   CDS_pept        29405..30091
FT                   /transl_table=11
FT                   /gene="rpiA2"
FT                   /locus_tag="LEGAS_0031"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90679"
FT                   /protein_id="CBL90679.1"
FT                   /translation="MITQDEKKKRAAEVAVNYIKDGMVVGLGTGSTVMYLLEAIARQGL
FT                   KISGVTTSKKTSKICASLGIKVNDIDNVDHIDVTIDGADEVDVYMNGIKGGGAALLMEK
FT                   IVAKNSKRNIWIVDDTKVHDILGTFPLPVEVVPYGSGRLLKKFNDKGLKPILRMDKNKL
FT                   PIVTDGGHYIIDLHLNAIDNPQNLAEYLERQVGVVEHGLFLDVADVIIIGGDKNIIKER
FT                   KNRMTE"
FT   CDS_pept        30922..31782
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0032"
FT                   /product="Amino acid ABC transporter, substrate binding
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90680"
FT                   /protein_id="CBL90680.1"
FT                   /translation="MLRKKIIIAVIIVIAVASTAIFVYQRPTDTNAKSEITVGAIGSDA
FT                   QTWQYIAKLSETKEKNIKIVVKNFTDGVSLNTATAEGQIDVNAFQSYAYYNAYNKSNKN
FT                   NQLAALGTTYLEPMGIYSNKYKDIRDIPNGATIAIANNAANTSRGLRLLEKSGLITLQS
FT                   DFGSLSGVNAIKNNPHHLKFKEIDDTTGPHVFKDPDIAAALIGNTIALEGKLNVLKDTI
FT                   FYERINQSTKDNINILATTAKEKNNKKFKQLVQLYHSQAAQKYISRKFDNTKTEVNKPI
FT                   SYLSN"
FT   CDS_pept        complement(31994..32848)
FT                   /transl_table=11
FT                   /gene="scrR2"
FT                   /locus_tag="LEGAS_0033"
FT                   /product="Sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90681"
FT                   /protein_id="CBL90681.1"
FT                   /translation="MTKLYVFNNSLSNPYLYLSSGGVDPATPGHHYGPGARSGYMLHLV
FT                   LSGKGTFISNGQKYHLQAGSMFYCQPGILVNMIADYNDPWTTMWVRFTGDYVKSLMDTV
FT                   SLTDENPVFTVTQAPIVKDEIENILKLSHLDHTQDLDYASQLISLINALRTTFNATKST
FT                   NSNPQKILILKATQYIQNNYDTPITITDVVNYLGIDRTYLFRIFKIYLQVSPKTYLTTT
FT                   RLRAAKEMLIKSDTSIKFVALSCGYTSYVHFSKAFRKYIGMAPSQFKNTHNTPSKNNLF
FT                   IRK"
FT   CDS_pept        32990..34447
FT                   /transl_table=11
FT                   /gene="scrA2"
FT                   /locus_tag="LEGAS_0034"
FT                   /product="PTS system sucrose-specific EIIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90682"
FT                   /protein_id="CBL90682.1"
FT                   /translation="MVDKKQQYDAFSDDVLKSIGGKENVIEAFHCATRLRINLKDTEKV
FT                   DKESLGDLDLVKGININRNQLQLIIGPGLVDEVTDEFISYTGITDLQAQTNNIAPNSAK
FT                   KENVSWISHFIDDLTGVFTEILPGILAAGILIGLNNLMTQKIVGNQSIVSAIPGLKGIS
FT                   TIVSYGSSGIFALLPLLVVYSATKRYGGRPVMGLAMGAVMMSASLPSLSDVSTGASKAV
FT                   IADIFGWQLSLYSFGGQIIVALIMGWIIAKIDNYFQKHLPGVIQFVLAPMLTILVSSFI
FT                   LFMVVGPIGMSLSSLVTNSLVWMSTTFGIVGYMIFGGIQQLIVITGLHNMFGAVEAQLI
FT                   ATKGTDFLNPLFSVALMGQGGGVLAYMFLNRHDAKAKEIGLSSFFSILFGISEPALFGI
FT                   NIKYRYPLIGGCFGGAIGAAYVYLTKLTAISFGTTGLPGIAIASPNNNGYVNYLIANLI
FT                   GMVSGLIITLLVAKFVRKHHTTNAVKQ"
FT   CDS_pept        34464..35966
FT                   /transl_table=11
FT                   /gene="scrB2"
FT                   /locus_tag="LEGAS_0035"
FT                   /product="Sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90683"
FT                   /protein_id="CBL90683.1"
FT                   /translation="MPKTTQNKKIQFQNMVTNLIDVDPSIVNQEEMLTSESPYREKYHI
FT                   EPHSGILNDPNGFTYFNNEYHLFYQWTPLAFTKNPHIWHHGWYHMASRDLIHWRDLGPA
FT                   IESDTNLDSHGTYSGSGLVVDNDLFLIYTGNTWNAKWQRVPYQVGAKMTSIGEITKLGK
FT                   PFISGHPMGYTSHFRDPKIWQSNGDYYAIFGIQRENLTGAAIIYQSKDLQNWQLKGEIK
FT                   TKYNHFGYMWECPDYFEIDNKGVLLISPQGLQAENDKYQNIYQTGYFVGTKLNLDTLAF
FT                   DHDDFQELDSGFDFYASQTTLAPDGRRILSAWLGISELHYPTEAYHYAGALVFPRELTL
FT                   HNGKLIQNPVREISELRHEEQNINLDITSAHMISHGVAQEIKLDVDMKNTGRVNIYLCA
FT                   NNTNKQYTCLTLDRIEQQIILDRTHSGMTLNVENGNIRKRHLGIEKSVQLDILIDRSSV
FT                   EIFVNNGELVFTARIFPDEGQDNVFIEAVSGITKIVGKKWSL"
FT   CDS_pept        36020..36511
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0036"
FT                   /product="PTS system sugar-specific EIIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90684"
FT                   /protein_id="CBL90684.1"
FT                   /translation="MFSLFKKQEIVMDNDLYSPIQGEFLNLEEVSDPVFSEKTMGDGFA
FT                   IQPDGDELLVSPVAGKVMMVAATKHAIGIHMANGLDVLLHLGLDTVNMDGSPFNINIKV
FT                   GDIVSARQHLGTMDLEKIISAGYDTTIMVVITNMNMLKTLSTNDGRYQAGDKVGVVTVK
FT                   "
FT   CDS_pept        complement(36668..37408)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0037"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90685"
FT                   /protein_id="CBL90685.1"
FT                   /translation="MTIGDQIKHLRTAHHLTQQEFATKIYISYQSVSNWENHRGYPSTE
FT                   IMLLIIDTFDLPLNYFIAKDIDATTDHEETLILSSFLKCMATSRDEAPNLKTIQQLSGV
FT                   SAERVQHHFPSYDDLVYTLINKVDQDIKIRVEKRLSDHEDVLSIFINDMAPLLYHKKET
FT                   LHILYTRPYIKGVWMHFINTKYQSLLIKYNPDIKKNDLDTAYLIEILTAFISIWLSQPE
FT                   IEPLEQFQARITYLVNHNIASWHA"
FT   CDS_pept        complement(37562..38329)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0038"
FT                   /product="Cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90686"
FT                   /protein_id="CBL90686.1"
FT                   /translation="MKIIDLSVSLKAGIPSDPKEAKPEIEYSDHTAGAKQMASVFKGLN
FT                   TKNLKNEEGWASENLKLTSHSGTHMDAPYHFNSTQDNGSPMPTIDEIPLENFIGKGVKF
FT                   DFRHFENGHVITASEVAQELNRINHILKPDDIVVVNTAAGARYGADDYLSSGVGMGREA
FT                   TLYLTERGVKVVGTDAWSWDAPFNFTAEKFAKTKDPSIIWEGHYSGTTIPYYQMEKMGN
FT                   LDLLPDDGFTIICQPINIYKASAGWVRPMAILK"
FT   CDS_pept        39029..39814
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0039"
FT                   /product="caax amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90687"
FT                   /protein_id="CBL90687.1"
FT                   /translation="MRIIRVFSISIFLLVATFIIQGMTQYALKPLLFSFLQVLFVAEIL
FT                   TIIFAFVVGKWLKINFYWQLPKFQNYHEYTVFVLPVLLVAAISTISIMTMPTISILQWL
FT                   EGILLVLSAAVAEELILRGVVLNLFVKLFSGTTKYAEVYMCIATSIVFSSAHLMNLVHQ
FT                   SLFQTLDQMIGVFGLGMVLGMLYIRSGSLILPILLHSFFNLPGVVKGNLIGNTTYASNI
FT                   GRTLNMLYIAIAASIYVICYLKPLNRDKFNLIKRVKSRN"
FT   CDS_pept        40306..40983
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0040"
FT                   /product="caax amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90688"
FT                   /protein_id="CBL90688.1"
FT                   /translation="MLLKNIILSIFKKVRQFFELILVTILIYMILAIPTFFLFIGNLNQ
FT                   YTWIRLVLNIIAGGLIAYFGYRYLVKQADVVFERLNSKKVGMSVIIFVITWLFLTFGLP
FT                   AIFGHNPLPGSNQHAIDTIFNHLTNWWTQLLFSFNIVVIAPIVEEVYFRGIMFEEAKPL
FT                   GRVVQILWPTLMFALVHSPSTLEQWAIYLTAGSVLMVVRVVTKKLQYTIMFHSLHNLVA
FT                   LLS"
FT   CDS_pept        41073..41312
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0041"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90689"
FT                   /protein_id="CBL90689.1"
FT                   /translation="MIQIINLILQIIIAIVTTAVFVDILIKGLKVNPFGFNATYLSYSL
FT                   LFLGLGLTLLQLNYFSVMIATLAAFDLWLSERKK"
FT   CDS_pept        complement(41533..42312)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0042"
FT                   /product="caax amino terminal protease family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90690"
FT                   /protein_id="CBL90690.1"
FT                   /translation="MKSKKKLLFLILSLWIGSDLLTIGFENLLAHFTHLPDNSIIILNS
FT                   LSITSILYLVNRKYKVVKIFIIPAHDTWLDKLVYVIPIMLYAVRALLPLLYDPAIWKMI
FT                   VHHLPHSLMLVLAMITAVFFEEYLSRGLIFGALLVYFKHHKWRVQLSILLSSLTFSLSH
FT                   AMNLFNQNAMQALNQMIYTFAFGCLVSMLYIRSGSLLIPFLAHCLLNLPSFLYSSSPLA
FT                   TAPVTLKTILMQIFMLSIFLVYTFIFINNDEKRHYQF"
FT   CDS_pept        complement(42623..42757)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0043"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90691"
FT                   /protein_id="CBL90691.1"
FT                   /translation="MLVTFVVYCGKNSFDNMFMNIKKYLLTLSFVLTNIFFNLINLFN"
FT   CDS_pept        42914..43141
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0044"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90692"
FT                   /protein_id="CBL90692.1"
FT                   /translation="MIIRKTLISKVAVRDTAIFVAAILPNMAVAISIQMFLVLAGFLFI
FT                   SAVILYILDMLFLSYTSIGKKRVDKYTEKL"
FT   CDS_pept        43757..44035
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0045"
FT                   /product="lactococcin A immunity protein (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90693"
FT                   /protein_id="CBL90693.1"
FT                   /translation="MKENNILSDINKLLADNISQDEREILSHAKKELEKKSSFPRIISD
FT                   LRGELTPLAVSQKLSKNVGTLYLKINSHEFQSKNFGGGLIMGWGQTF"
FT   CDS_pept        44170..44409
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0046"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90694"
FT                   /protein_id="CBL90694.1"
FT                   /translation="MKKAKKIYLPKYRATNIALISFILMATAFFKNRSLNIFLAIILSI
FT                   CVAGIIYFLYYMYLTKTKMGKRYIQKLKENVEKK"
FT   CDS_pept        44789..45535
FT                   /transl_table=11
FT                   /gene="tcyL"
FT                   /locus_tag="LEGAS_0047"
FT                   /product="L-cystine permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90695"
FT                   /protein_id="CBL90695.1"
FT                   /translation="MNSFFQPHLIWQYFPDVLSALPVTLLLTLVSTIIGVIVGAGIAYV
FT                   KMENTPFLKQIAAVFTSFIRGTPILIQMFLVYYGLPFFLGYVGIDADDVNALVYLFITY
FT                   GLNMAAFLSEIIRAALESVPATQREAALTSGYTKRQMYFKIIFPQAVIIAMPSFATMVI
FT                   SLLQDTSLAFTIGVIDVVGKAKALGTATFHTVEAYISAMIIFVILSFILERLFRWIEKR
FT                   SNYSSRQMPIVATNPVIPVIEAPKTS"
FT   CDS_pept        45590..46417
FT                   /transl_table=11
FT                   /gene="tcyK"
FT                   /locus_tag="LEGAS_0048"
FT                   /product="L-cystine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90696"
FT                   /protein_id="CBL90696.1"
FT                   /translation="MKDKTRSHKGLWIGLGVVIIAIIGVMFFRHTGTSTQSSSKVQIIK
FT                   VGSGNDGQPFAYLDKDGKPAGMDIALLQAIDKKLPQYKFKLTLSDFPTMITNLKAGKTT
FT                   MAMYQVEQNAERKENFKFGTVGYTVWDTLLATKKSAGVLDSFADAKGKKLYVTNSTNQA
FT                   TLTDAYLKKNADAYSVVRGTYTMEQVAQGLNSGQFNVYPAPKYSIDLLNRQFKTNLVYG
FT                   KAVNHSNAYPLFNKKADPKFIKAVNKAMAELKADGTLKKLSNQWLKGDYVPKD"
FT   CDS_pept        46430..47134
FT                   /transl_table=11
FT                   /gene="tcyM"
FT                   /locus_tag="LEGAS_0049"
FT                   /product="L-cystine permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90697"
FT                   /protein_id="CBL90697.1"
FT                   /translation="MNFDIGFIFQVMGQIIRYVPITIYMAVVSLIIGGMLGLVVALVRY
FT                   YKVPGLSQLFSIVITILKGVPLILVFLVIFLITSQNFNHFAKAVGWHVRYGDLPMSVLA
FT                   IIGLSLMATVGLSEAFRGAFESVKQVQFDAARSLGMTQLQTIRRVLIPQTMPVALPMII
FT                   NMFINLIKGTAIASLVSVVEIFSAATQAASSNYKYFEAYIAAALIYWMMTIVIERGAVF
FT                   LEVRMDKKIKRS"
FT   CDS_pept        47137..47874
FT                   /transl_table=11
FT                   /gene="tcyN"
FT                   /locus_tag="LEGAS_0050"
FT                   /product="L-cystine import ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90698"
FT                   /protein_id="CBL90698.1"
FT                   /translation="MIEVKDVHKSFNDNEVIKGVSLSLNEGEVVTILGPSGSGKTTFLR
FT                   CLNFLEEADSGSITVNDHEVVFGQASANDVLQLRRSMGMVFQNYALFLNKTAKQNIMEP
FT                   MVIVHGYSTQQAEARAEELLRVIGLPDHGDYYPSQLSGGQKQRIGIARALAVHPTVLLF
FT                   DEPTAALDPELVGEVLKVMKAVKDAGVAMIVVTHEMQFAYEVSNRVIFMADGVIVEEGT
FT                   PQQIFESPQEARTKSFLNRFTVN"
FT   CDS_pept        47905..49128
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0051"
FT                   /product="multiple substrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90699"
FT                   /protein_id="CBL90699.1"
FT                   /translation="MSELRYSFASRVSNLIPSPLREQAKHVQTADDYIKLTYGYPSNQA
FT                   FPIEKLAKLSDKIYRQHAVEFMQYGETEGIPKLREQLKSRLHQYQNLDVVSNDILITSG
FT                   STQGMDLVFKIFVNEGDTVLTEEQTFIGAVNAIKSYGGHAQGLPFDMTSGCIDTEALEA
FT                   TLSADTAHRIKLLYLIPTFQNPIGTSMSLEKRQEVYDICQKHQVMIYEDDPYGDLLYSD
FT                   IESIPKIKSLDTTGIVIYAGSFSKILAPGSRLGYLLAPKAVFDKLVLVKQVADSFANLY
FT                   WQYLASQLIDDYDFNEHIAYLRQLYKVKADAMVGALRKYATKDMTFVVPDGGYFISVKL
FT                   NDDIDSNAFYDALDQRHVGVIPGNVMSAAGQGYERYFRLNFTLPSVEEIETGIQRIAQA
FT                   AAVAKVKQ"
FT   CDS_pept        49159..50130
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0052"
FT                   /product="Lactate dehydrogenase related 2-hydroxyacid
FT                   dehydrogenase."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90700"
FT                   /protein_id="CBL90700.1"
FT                   /translation="MKILFYNVADIEKSFIDQWAKSNNVTVKTLSVSIDYNNIELTRDY
FT                   DAVVFYPGKAFLTDENLYVQLVQNGMKQISVKSTGYDNINFTFAEKYHLSITNVPNYSP
FT                   ESVAHFTIMSIVMLLRHIPIYLYQRQVAHRKDFIGQELTDLTIGIYGAGRLGSLVAKTL
FT                   KYMGARVLVHSRTNKPELEQLGIESVDFKTLLTASDVISIHVPLNEKTHHLFDFDNLSL
FT                   MKQDAMLVNTARGSIIDTNALIDHLQQGKFKGVALDALEDEEFFEITANPYYQALMAFD
FT                   NVLITPHIAYFTQAAVRDIAITALENARDIVMNGESENIVLN"
FT   CDS_pept        50141..50914
FT                   /transl_table=11
FT                   /gene="tcyC"
FT                   /locus_tag="LEGAS_0053"
FT                   /product="L-cystine import ATP-binding protein tcyC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90701"
FT                   /protein_id="CBL90701.1"
FT                   /translation="MSFIEIKDVHKSFYQKEILKGIDLTLHKGEVIVILGPSGSGKTTF
FT                   LRCLNTLEQADKGQIKINDVTKDFTKKDRRNTRDLILKTAMVFQGHALFNNMTVLQNVI
FT                   EGLVHVKKTPHQEAVKIGLAMLEKVGLSDRADYYPVQLSGGQQQRAGIARAMAMKPELL
FT                   LFDEPTSALDPELVGEVLSAMKELAQEGHTMIVVTHEMQFAYEVADRVLYMEGGIVVEE
FT                   GTPQAIFNTPQDERTKKFLARLSGKNFDDIELVEA"
FT   CDS_pept        50911..52143
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0054"
FT                   /product="Permease of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90702"
FT                   /protein_id="CBL90702.1"
FT                   /translation="MMQSKQGCVSETTDTEKVSENGQATRLFSKDMMLLMVINFLVMTA
FT                   VTTQMGTLPLYVTRLGGNAVMSGLVVGIWGLAALAARIPVGKLIDSYGRKQLVLIGIGI
FT                   LVIDFSMLIFVSTIVSLIILRAVQGIGNGTQSTAVATLVADKIPKEKLSIGLGYFSISQ
FT                   TLPAAIGPAIGLMIVENLGFQSLFYFSLLLVSLAFLLTLFIKDSYDGHTQVQKTKQVRT
FT                   GFKALIRLQSIWVPSLLIFIVSFANAAVAAFLIQFGEQKNLSPAVVGLSFTAQAVIGAL
FT                   ARIWFGRMYLYFKSFVLILAGIVMIAAAYICIAFGDTIELLLLAGALDGLGFALLMPLM
FT                   NAVVLRDVTSEQRGRATAIFSSGTDVAYGLGALVWGIVVSLIGFQGMYLCTTLVVLATL
FT                   GLVLTHRQLLS"
FT   CDS_pept        complement(52525..52653)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0055"
FT                   /product="conserved domain protein, possible pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90703"
FT                   /protein_id="CBL90703.1"
FT                   /translation="MSAGVYNIWREWLLTNQTEPLTTIHDLIAILQQSTMKALLSE"
FT   CDS_pept        complement(53530..54618)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0056"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90704"
FT                   /protein_id="CBL90704.1"
FT                   /translation="MSLEEFFLPLKINAELTLKNRFVMAPMTRNLTPEAIPDEELVEYF
FT                   ASRARGGVGLIITEPIAVSHPSANKDGFSPDFATEEKIQGWKAVVRAVHIEGAKIFAQI
FT                   WHMGCDRDATKAPNPEIRSVSPSKSGEDNYATVEEIQEIIDAFGETAKIVKEIGFDGVE
FT                   IHGAHGYLIDEFLWDKTNYRTDNFGGSIKNRVRFAKEIVEIVRKAVGSDFPIGFRISQW
FT                   KVQDFSAKLAKNPDELKQIVTPLSEAGVDMFHCSTRRFWENEFEGSPLNLAGWVKMMTG
FT                   KTTITVGSVGLTSMFTESLLSGKGADITSLSKLESKFRDGEFDLVALGRSLIANPDWVN
FT                   KVQENNLGDLQSFDAEMLKYLK"
FT   CDS_pept        complement(54608..55975)
FT                   /transl_table=11
FT                   /gene="mmr1"
FT                   /locus_tag="LEGAS_0057"
FT                   /product="Methylenomycin A resistance protein (MMR
FT                   peptide)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90705"
FT                   /protein_id="CBL90705.1"
FT                   /translation="MITKKVPNWLTLITLAIGFIMATLDASIMNVAVATVQKELSLSST
FT                   SGTWIIDSYLLSFASLLLLGGVLANKFGSKPIYLVGMFLFLIGSISGGFSESGAWLIGS
FT                   RFFQGVGAAFFMPSSLSLLVLSFEDKTERAKMLGIWSAVVSISSGVGPFVGGALIYGLG
FT                   WRSIFFINVPLGIIGLVLAYCFAINPKSDRSLKLTVLPNLLSMIMLASFAYTLIEGGTY
FT                   GIAYPPAIISFILFLITLFLFTSYERKSELPMIPLGLIKIKAFVFSNFTAVLLNSSMMG
FT                   GLFIFGLYLQSSNHSTTLEAGAQLIPMMIVFMIGNIIFSRTVKKFGTDKMLIFGLLLAA
FT                   IGTFVLTFSLHFTYLVYALIYAIANLGVGIVVPAMTMVAMQSATDKYSNFAGAIFNVAR
FT                   QIGSLFGVALLGVIFYQSSSPVIGAEISFAIMTIFYVLGIAFSIIGSKEKGKTIES"
FT   CDS_pept        complement(55965..56657)
FT                   /transl_table=11
FT                   /gene="mmyX"
FT                   /locus_tag="LEGAS_0058"
FT                   /product="Putative ATP/GTP-binding protein, MmyX"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90706"
FT                   /protein_id="CBL90706.1"
FT                   /translation="MKIAISGTYSTGKTTTTLALAYYTGLLSTHAKTMREILPKALPGK
FT                   RLEDATGPELVQLGFRRLMERAVRESHLEDFVSDGSSLHEWAYGMVRTELGMNPNEETD
FT                   KGNIVLTEDLKYLKEIMINFGAVAKDYAKDTYESFVHLPVEFPLVADGHRPVSELFRRR
FT                   SNDLLLETIQKLDIPYYVVGGTIAERLEKITEIYHLEPVMSVEEAIRLAKKEAEKFDIV
FT                   QEGRENDN"
FT   CDS_pept        complement(56659..57597)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0059"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90707"
FT                   /protein_id="CBL90707.1"
FT                   /translation="METINYFKNIEDVLGNANGRYFGTGYKQVHYLQREKQISFEEIRE
FT                   VFEIHYPTNWSTKVAEMAITPHFSTLDSVVLVVKLVTDFLREQLAVEENTINNALISKL
FT                   SVKAGKNLVENLKNVEAHLALSSDNELFFKGKVASFSVELTIKLFDDSKQIIVPNGEDY
FT                   YFSAFEAEENEVTDVSIMPDLSGISANVDFQYNKTFSGVESAYLLLHQLPSILDQIIVT
FT                   TELTEILHARLDNIPREKSKTLIMQKIEFSRTLLYDVDPNDNTIKIEVLKTKMVYLGRK
FT                   SLRTSDMISKFGNSTFTYSVAQEISETLEEN"
FT   CDS_pept        57703..58032
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0060"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90708"
FT                   /protein_id="CBL90708.1"
FT                   /translation="MEPGNETIITKSICPARKALNVLKGKFTLEILSEIIDGNLHYGSL
FT                   LRSIDGMNPRILAQRLHEFEKIGVLSRKVIPTNPPQVEYRMTEKGTSLRKIAKEMKSWG
FT                   EKFEE"
FT   CDS_pept        58043..58192
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0061"
FT                   /product="conserved domain protein, possible pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90709"
FT                   /protein_id="CBL90709.1"
FT                   /translation="MCCKVCNTTAETSNEKAKQLLNWYPRSAAESIIATAQAMIDLGIV
FT                   QIPE"
FT   CDS_pept        complement(58275..59210)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0062"
FT                   /product="transporter, EamA family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90710"
FT                   /protein_id="CBL90710.1"
FT                   /translation="MTKKYLLGIILCLIAVFSWGGMFPVMVPALKIMDPFYITLFRYGI
FT                   VAIIFTIILLFVEGKSAFKSDGHFLKLWLFGTSAFAGFSFLVFLGQKTAGPSGSIIASV
FT                   MMATQPLLGVLVGWVYRGVKPTIVSLISMIIAAVGVFMVVTKGDLSVLYKGDNTIFALV
FT                   LILVGALCWVIYTTGGGDFKQWSILRYSTLTSIYGVLSVIVILFVATLMGWLSVPSFEQ
FT                   ISGVSGALIYMISFAGVIAVFAWNLGNRIVGPINGILFMNLVPITSFVISIVNGYKISA
FT                   FELAGVSITILALIGNNIYNRFAQSKVLKS"
FT   CDS_pept        59389..60279
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0063"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90711"
FT                   /protein_id="CBL90711.1"
FT                   /translation="MIGNENISFDMLNVFIKVSETKSINQSSKVLLLSQPAISKKIHQL
FT                   ENYVGAQLFNRSAKGVDLTYDGHMFYVFATRMLNELTRTIDEINHKNFSFSNLTIGVLD
FT                   SISSFIFPNFFINKVYELQKLEVTNKGIDLIMPFNEGRLDAIIIDSAFGDDIVGPYVQK
FT                   KLFEEPYYIVYSQSNTKMSPLIKSATVRAIDLQKFNLILLPTHCPIHQQVVKTFNRLNV
FT                   ALPEIFENNYSELTISLVRNSDFIAVLPESIAVNKVAQDTNGLGMNKLEIAFNRSVSVF
FT                   GRSADIVEEIEKELA"
FT   CDS_pept        61305..61895
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0064"
FT                   /product="transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90712"
FT                   /protein_id="CBL90712.1"
FT                   /translation="MELGKQIKNYRTTFNYSQEQLAEKTFVSRQTISNWETNKSYPDIQ
FT                   SLLLLSSVFGTSLDELVKGDLQVMKNELQNNKSNRRMTVYSWIMVISFLVTAVSMGPIL
FT                   LADKIILLFIPFLLLVPACYFGIKVESLKKSADIKTYSEILAFSQGKSVDELRRYRNKV
FT                   SNFFEKFAIVFLFIIVFVSICSVSTWVARILMS"
FT   CDS_pept        61955..62098
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0065"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90713"
FT                   /protein_id="CBL90713.1"
FT                   /translation="MSVTGMIADLIEEARQDNEDYADAMKVINSQNREYVSAEEIRAKL
FT                   GL"
FT   CDS_pept        62252..62380
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0066"
FT                   /product="conserved hypothetical protein, probably a
FT                   pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90714"
FT                   /protein_id="CBL90714.1"
FT                   /translation="MWHYRVGKYRVGKYRVAADIVDDEFVVVVLKTSKRDDVYRNK"
FT   CDS_pept        complement(62500..62721)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0067"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90715"
FT                   /protein_id="CBL90715.1"
FT                   /translation="MDNDRKNNSNKIWHVIGIVVTFLIGLWLFIPALLSLLQVSSNEVD
FT                   FWINVIGLLVGILTIASAIKSLWHMKIS"
FT   CDS_pept        complement(63306..63461)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0068"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90716"
FT                   /protein_id="CBL90716.1"
FT                   /translation="MYLGLNWLSYFHFSINNTDPFVVEPINIFGYIQNQVGNRRKSELI
FT                   DHFVLE"
FT   CDS_pept        63681..64049
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90717"
FT                   /protein_id="CBL90717.1"
FT                   /translation="MFGDVRLQGKILMEMATFLGDSYVKPVSIALVIQDLGGTEETFSN
FT                   VLAKTSQLVNMNDISQYTLADFKAFYQKLEPEVFDGVNDVIIVKILNGLSIMYIDDLYP
FT                   IAKNITLTYQLDNKIPGI"
FT   CDS_pept        64352..64702
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90718"
FT                   /protein_id="CBL90718.1"
FT                   /translation="MVNWGMYNFKGKIENAYQELLGMGKTLKSLDEPKKIAQKMSNLEQ
FT                   DLKQSQQVNPADIDRISFDNYQKLVTRIGWLNTQPKKFEDEQELSLLVNAFDKWIDNAY
FT                   DILKVTRSNKKI"
FT   CDS_pept        65024..65275
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0071"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90719"
FT                   /protein_id="CBL90719.1"
FT                   /translation="MDNDKKDIQTVITYELEANYPVEITLVDGRKIIAINPDAGELADK
FT                   GVKEIAIDEVADYLTIYTSNFAFLYINKDAIVSVSEIR"
FT   CDS_pept        complement(67644..67940)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0072"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90720"
FT                   /protein_id="CBL90720.1"
FT                   /translation="MTPVLIRFFKGIKNKNAKSITVDRGREFAKYDDIEQKLGIPVYFA
FT                   HPYSPEERGSNEILNRYVRRFIPKERKIETVSNKELDQINHWINARPMKTRNW"
FT   CDS_pept        complement(67988..68266)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0073"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90721"
FT                   /protein_id="CBL90721.1"
FT                   /translation="MNKKAAARFINRSPSTVSIEIHQVTPYKDEIAHALALKKRQADGR
FT                   RQVFVHGRSIETRPKSVQTRQNFGHFEVDTMQSGKKRGEVFVQLLKD"
FT   CDS_pept        complement(68537..69541)
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="LEGAS_0074"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90722"
FT                   /protein_id="CBL90722.1"
FT                   /translation="MKENIIFGSYQRGIYMLKFDTDSGHLSEPFLLTDVDSATYFDISS
FT                   TGTVYTAIAEKSMGGVGVFDLENKTLHNITKHLSFSPAPVHINIQGALLLASNYNGGSL
FT                   NIYKLSSDNHLELSDTFINSGTGTLPQQNTSHIHFAGIMPDKRLIVLDLGTDEAIIFDI
FT                   SESGKLLNRVNVFKFPNGFGPRHLCVTNDNHHIIVLGELSSEVAVLSYVEGSLVLEQLV
FT                   STIPDQWMGENGCGGIKLSFDQKFLYVSNRGHNSISVFKLEFIASNLKLNMIQNISSFG
FT                   LFPRDISCDKSGDYLFSANQKSNSISMFKVLDGKLEYIKTKNNLDMPVCIKFI"
FT   CDS_pept        complement(69561..70835)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0075"
FT                   /product="Divalent ion symporter (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90723"
FT                   /protein_id="CBL90723.1"
FT                   /translation="MINTIIGILLILTFLGFVFFVMKGGNIMLGFLVMAILWTIIGGIP
FT                   LKTAIVEVFSKPALDYGSTIMVIIFGSWFGRILVDTGIAGSISYETVKVSYKHPVIASI
FT                   LICLVTSLIFTSSYGVGAVIALAVILIPVLTSLGLPKHIAIVAFSLSIGSAMYVNIVII
FT                   KQLQIFFPKVVYGAKYLAFGFSAMFIQLAVVTLFILLHSRTIHKNEVAQDASQSQNKFN
FT                   APKISYVMPVFPVFMNLVFGWEPIPALMLAIAIVLLITGNLKTYNQALNIINSSIKIAI
FT                   TDISGLIIMLLFLTMFSATAVKNAAKFSGVLNSIVPNSPTVLAIAIIILAPLALFRGPL
FT                   MVWGSGSATVAVLAGTGIFNQYFAFALMLIPSVSIAISTCITQSWNLWLVEDSKIPVKK
FT                   FLITGVPYGWLSAALNVILALYMFK"
FT   CDS_pept        71031..71777
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0076"
FT                   /product="putative epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90724"
FT                   /protein_id="CBL90724.1"
FT                   /translation="MNRKNIVLNTLLLKDEFEKGRSQSQLVNDLINQLSVSNIEIRREF
FT                   NADTFSELVAIRKIHLEQNTEFFYSVPDNLLLNQHINPKLFQYVGESQFMGVKHLKMTL
FT                   GDWHNSMFKELSYLSKILPANIELNIENDQTRANSDIELLNDFFETANQNNINIGFVND
FT                   IGNWIFTDQDVYTCSTSLSRYTRFVHLKNYKKIQDSVNTTPFYDGEINWEKIIKLFSND
FT                   LPIALEYPSSMENILNDINAFKTSKV"
FT   CDS_pept        71796..72581
FT                   /transl_table=11
FT                   /gene="kduD1"
FT                   /locus_tag="LEGAS_0077"
FT                   /product="2-deoxy-D-gluconate 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90725"
FT                   /protein_id="CBL90725.1"
FT                   /translation="MEKEEQYFSQKVFDLTEKVAIVTGGASGLGSYYTKALLSSGASVL
FT                   VVSYDDKGVREMASFASEFTGKIEFLQLDITKKDAAITVANEVIKRFGKVDILINNAGI
FT                   QIRNDWQVFKDADWEKVINLNLNAVYYLSHEIAKVMSKENGGKIINIGSMQSFRAGKYI
FT                   FPYTASKHGVIGLTKSYADALAPLNIQVNAIAPGYIDTPMTKSLQEDKERNTEILSHIP
FT                   AGHWADPSELMGAIIFLSSSASNYITGITLPVDGGYLLR"
FT   CDS_pept        72601..73542
FT                   /transl_table=11
FT                   /gene="serA2"
FT                   /locus_tag="LEGAS_0078"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90726"
FT                   /protein_id="CBL90726.1"
FT                   /translation="MNKTVAIPKGLAEIGKKYLKDNDINIVELASFSDDEILKKAKDVD
FT                   GIILMTDPFNNAIVQHLPNLKIVARHGVGYDNVDYSFLETKGIWVTITPNANADTVAEV
FT                   TIAEIFDMSKNITAIAEKMRLGDFNYKNNHLGFDLAGKTLGVAGYGRIGKKVAQKADAL
FT                   GMKVIIYDPFVTQTTVGTLVSKDELLSDADIITLHMAVTDDTNNFIDSVALKSMKTSSY
FT                   LVNLGRGALVDQEALINSLKNHEISGAALDVFDQEPLPLTNDLYTLDNVLLTPHIASNT
FT                   VNAMNRMALDSAKEVVKVLSNENPTWPVNRIN"
FT   CDS_pept        73692..74693
FT                   /transl_table=11
FT                   /gene="kdgR2"
FT                   /locus_tag="LEGAS_0079"
FT                   /product="HTH-type transcriptional regulator KdgR,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90727"
FT                   /protein_id="CBL90727.1"
FT                   /translation="MKNNKTMRDVADLAQVSKTTVSRYINGHTERMSAKTQQKIEETIL
FT                   AIGYRVNSHAQSLAQKRTFLIGMVVADMTNMFSSLLFNGADEIAHNKNYQIILMTSSNS
FT                   INREEQQINKLLDMRVDGIILQPINKDATQYNYLKSNGTHTIIVDRSIKPSIWPEVLTD
FT                   NYKYSHIMTEYIYRKGYKKILVISEQVDDNNSRITRIKAAQDVALKQNIDFDIIEMHHD
FT                   MKDSDIYDLLMEKTNLLQDKVAIYVIKGDLLLKIVKILISFDISFPEQLGIAAFDDWVI
FT                   SELINPPITTIRQDATTMGKVAVSNLIEMIEHDIYPQQQTNISSELIIKRSL"
FT   CDS_pept        74968..75240
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90728"
FT                   /protein_id="CBL90728.1"
FT                   /translation="MFKTDKRKYLLNFLEEHPNLNSEEKKIISDTVNKMNEPNSLWYKE
FT                   VKTITNALQKLSMYDKLSDDGKILLKQLNRSDWFYGLYDNIRFFG"
FT   CDS_pept        75499..75720
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0081"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90729"
FT                   /protein_id="CBL90729.1"
FT                   /translation="MQSIKLPDNIPSLSFISTLNVNDYLNFGNPYFNMSKNSVAVKMNG
FT                   HHFLHWIHPQIMSSIMINFIRSTRISSE"
FT   CDS_pept        complement(75774..76373)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0082"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90730"
FT                   /protein_id="CBL90730.1"
FT                   /translation="MNKGRVEAYTDAVIAIILTIMVLEFKTPETAQWEGITKQLPYFLA
FT                   YIVSFVFIGVAWYNHHYMFTLASRITKKVYWVNNLWLFSMSLLPVATGWVGKFPQNANP
FT                   EYFYLFIFTFWSLTYRWLSNALRKTSDHLNTTVSQKIEKMLTFRFLNSLFFPLFVGIIV
FT                   TGIYFYPLLGITITFIELIILGFLTSPDSDKIKNVS"
FT   CDS_pept        complement(76393..76770)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0083"
FT                   /product="Transcriptional regulator, MerR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90731"
FT                   /protein_id="CBL90731.1"
FT                   /translation="MTHPDEVVTFTIGQVANLKKISTYTLRYYDEKGLLPKVMRDQNGT
FT                   RHFTREDLQWLDMIKCLKNTGMSLEQIKYFVDSTYQGAKTLEQRIELLKNQVKKINLTI
FT                   LEQQSYIEQINKKIKVLTNEK"
FT   CDS_pept        complement(76773..77156)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90732"
FT                   /protein_id="CBL90732.1"
FT                   /translation="MTKTLVNYQTLKNSFNQEVSTQLQMVDSLSKNGKFLVIQTDPITV
FT                   EVEVTTNNIETITIKSKLLNTPLYDEIFIALEKSLNCSSVKFYNAYKSAIKNGTVVTAE
FT                   NNNIKVVHDARNGQLNVKITKEN"
FT   CDS_pept        77942..78664
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0085"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90733"
FT                   /protein_id="CBL90733.1"
FT                   /translation="MNTGENTMLSLKHISKTYRNGSEITHALNDVSFDIEANQLTVILG
FT                   PSGSGKSTALNILGGMDRPTTGTVSYNNYDINTESDAQLTQYRKDIVGFVFQFYNLISN
FT                   LTVFENVAISAQLKDKKYQDVSEYYLKKVDLLKRKNNFPDQLSGGEMQRVSIARALAKQ
FT                   PKILLCDEPTGALDTETSQKVFKILKDSTSKDTAVVIVTHNPLVAKIADCVIKIKDGQV
FT                   EKITNNINPLEVEEVDWG"
FT   CDS_pept        78661..80955
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0086"
FT                   /product="efflux ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90734"
FT                   /protein_id="CBL90734.1"
FT                   /translation="MRFLTKKLIRTVFKNWTQFFSVFLMAFLSILFYAGLEGTWNGMQQ
FT                   NINSYTIKTNLADTTLQTSSLTSNEVTKIKNLNNISQSSVQTNISTTTNLQSHKRYLSL
FT                   YTPGNQNVSQIHQLNGQKINSNSNGLYLNEKFAKKNNLNKGSFISINYNDRLVKLKIVG
FT                   LINSPDKMYYTGSNDFISPQEQNYGYGFISENTLTTQFHLPLLNNVINLKNRNNIQLEN
FT                   QIRKIVGNKYITLQTRQSDVGISTAVDRVGQIHNLSVLFSVIFILLAVLAMYTTIRKII
FT                   DQQQHDMSTLQSLGYSNVILSVYYSMYGLFVGIIGAIAGILSAPLLSNFVMQSQKPMFS
FT                   LPDWKIAYTMTPIYVALGVILICIVSALLAAQVNKGLMPAQAFSKGSTAKIGKRVWMEN
FT                   LPHVWHKIPFGNRWSIRDNLGNKVQMIMGLIGVIGGLALVMTGFGTKNAMLNQVNQTYG
FT                   NEYTYTKKVNLSHMASQSEINQITNQINGSKIEVVYTSLSPNAQFDRPLTILSPGSQIN
FT                   LKTLTHQKIDNGGVYVSEGIAKAAKIKLNDTIKLRPSFSNRTLELKVKGIVKSHAPQGI
FT                   YLTQQTWENQGMPFKATAILTNQTNLSQSIANSSTVTQVVSLTEQKQNAEAMVSNLNSI
FT                   FLMVQVFGILLTIVILYNLGSLSFTERSRSYATLEILGFSRKKIRNLTIIENLTITTIG
FT                   WLLGMPFGYWFLSKYVTTFNTSQIIYYPYITHTSIILASVIVIAASLSTIVMIGKRLQQ
FT                   LDMISSTKGVE"
FT   CDS_pept        81418..81858
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0087"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90735"
FT                   /protein_id="CBL90735.1"
FT                   /translation="MIEFNNSNAELERHLCFSIYELSRSIQRMYQPFLNELNLTYPQYL
FT                   VLVALYEHDNSKVSALGEILDLNYGTLSPLLSRMEKQKLIQRTRSLDDTRVVYIGLLPH
FT                   GKDIREQAFTLPQQLVSKSGLNDDEWHEFSMLSMKVFHNLSK"
FT   CDS_pept        81909..83246
FT                   /transl_table=11
FT                   /gene="gshR1"
FT                   /locus_tag="LEGAS_0088"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90736"
FT                   /protein_id="CBL90736.1"
FT                   /translation="MDFDVLFIGSGQAAWNGAVPMSNNGLKVAVVEEAQYGGVCSNRGC
FT                   NAKIILDHPIDLLEQVKSLQNRGLDGVPALNWQDLMAHKHELITNQNYHNKERLVANNI
FT                   TTIDGSAKFIDRHTVQVNGKQYTSEKIVIATGLRPNRVNIPGADLFNDSTNFLSINKMP
FT                   DHITILGAGFVALEFAAIASAAGAKVDVIARSNRILKDFPNKYVNKIVSIMKKQGIRFI
FT                   QSTVVEQATKENELIVLKGNNGFSLSTNYVLDATGRVPNVEKLNLEKIGITYTPQGIVV
FT                   NDLLQTSIDNVYAAGDIIDKKMPKLTPVAAFESRYLADQFIKNTTVSIDYPTVSTILFT
FT                   SPRLAQVGVNLDEALAHPDLFDVENFDYNKDWYRQKSNESNGELTLIFNKERQLVGAIE
FT                   LSVNAENTINTLVPYIELKLNTQQLNRLIYLFPSIEYTTQRRLSLV"
FT   CDS_pept        83449..84060
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0089"
FT                   /product="Transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90737"
FT                   /protein_id="CBL90737.1"
FT                   /translation="MDDREIFEELTTLVHQPAIWFVARSLYGQRGNQRPDNSRRLLRVL
FT                   AETDNDLTAGVIADILAIRPASVTQIIKKLENDGYIQRVKDTNDARVVRVKITSEGQKH
FT                   LQLLDNKQIDFQAELFEIFDDDEREQFGESLRKLNQHVMSDAYLTNMRSKMDKHLQHHF
FT                   DHFVDTTRLQKFRKDQTAYRKRIEEHQLRSFFNRDKHEDF"
FT   CDS_pept        complement(84057..84203)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90738"
FT                   /protein_id="CBL90738.1"
FT                   /translation="MAVLNVRFAIIFSPSISSKSIHPRHTDRKVNSIQFNSLLSIANTI
FT                   IFY"
FT   CDS_pept        84175..85956
FT                   /transl_table=11
FT                   /gene="LRMA"
FT                   /locus_tag="LEGAS_0091"
FT                   /product="Multidrug ABC transporter, ATP-binding and
FT                   permease protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90739"
FT                   /protein_id="CBL90739.1"
FT                   /translation="MAKRTFSTAKEKQKPKAKISGLWKIIKIAHPQFKLMIPGLLLSVI
FT                   GVAANLMTPKYSGQLINTFSGKDLQNVHIDQTIVVIVLALFIGGAIVSAIGNFLTGVAG
FT                   EQLVRNLREIIWQKLVVFKTPYFDNVKSGETTSRLTNDTSQVKTLVANTLPNFLTSMIS
FT                   MVGAVILMFTTDWHMAIWIFIAVPITALLITPVMILGSKVGRGTQDAMADFSGGSQETL
FT                   AEMRLVKSSGAEQYVLKNGIAQIEKLFKFGRREAIVDGVMGPIMTMVMMGLFALILVVG
FT                   SLRVAKGESTMGTLFSFIMYLFQIMPALANIGTFGSTFAKTQGATYRLMTLLDEPIEEL
FT                   DKGETVDIEGLTLKVKHIDFEYEIGKSILHDVSFETKPNTIVAFAGPSGGGKSTIFQLL
FT                   ERFYEPTGGNMSIGSYNIEDISLNSWRSQIGFVSQDSSIMAGTIRDNLTYGLPQQFSDE
FT                   RLWEVLRLAYADNFVDQLPEKLNTQVGERGVKVSGGQRQRLAIARAFLRDPKILMLDEA
FT                   TASLDSESEAMVQRALEQLMQGRTTLVIAHRLSTIVDADKIYFIEHGEVTGSGTHQELL
FT                   DNHKLYAEYVSEQFVTK"
FT   CDS_pept        86390..86689
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0092"
FT                   /product="Bacteriocin immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90740"
FT                   /protein_id="CBL90740.1"
FT                   /translation="MAQIKWYAGGQERGKVALELIIQLLKELDGTGTAYDDLKHVLAVY
FT                   FNEIKTESGSIPLIFSRMNLDVSNVMIKNHIVLPENAQQTMKKLSQLNQLRYGY"
FT   CDS_pept        86950..87201
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90741"
FT                   /protein_id="CBL90741.1"
FT                   /translation="MEKEQLLAVLMAFKDGEINEQQIVDHACNSIKKNVNTNKVQKEVV
FT                   RDLRGLLIKQTLSENGLLLWRQLENPDINIPSRFFFGL"
FT   CDS_pept        87235..87501
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0094"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90742"
FT                   /protein_id="CBL90742.1"
FT                   /translation="MNSQKQQLWDNMSVLVTDNTLSEMEKEILGIANKALRGGLDEEMI
FT                   AIDLKHELSFLSSNQPLSKNMGPFLTELSRLYLDYDRRDNMSI"
FT   CDS_pept        87566..88780
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0095"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90743"
FT                   /protein_id="CBL90743.1"
FT                   /translation="MINHIALNNFVKKSGTNKPLSLDPNELLSHHLMIVGATGNGKSTS
FT                   LLSLVESLQQSQQTSIIFDATGEYSQIPHAITYTLGEDANLDFAELEAKDVGNILGIKN
FT                   ANLVPKLAMAIESLKIQNNVIKNNGTYIKINKKLTTFDQEQQKLSVFGRDYDATLLMTQ
FT                   VIQEFAVPFGDSRANYDLLGQEIDHEAVRSQWGDLLSGQSRVRQPTLNRVFNMHHNHTV
FT                   PRVTQTDIFYILKLFSERRSQQRTLVIDVSQLKTGSDVSRLVLSLLLKKLLAIRMASTI
FT                   RFPITIFLDEAHRYMPENEQQLNDTGLFKILREGRKYGIYSVVSTQSPLDIPAQLSGQF
FT                   GSVLIHQLNHPDELQQIVSLKNIADYHNLSVGQAILKMYRNPNTMLVDVTKPTTKHDTA
FT                   SPKFR"
FT   CDS_pept        complement(88822..89805)
FT                   /transl_table=11
FT                   /gene="scrR3"
FT                   /locus_tag="LEGAS_0096"
FT                   /product="Sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90744"
FT                   /protein_id="CBL90744.1"
FT                   /translation="MSYKLEDVAKLAGVSKTTVSRVLNNRGYLSQKTIDNVYQAMSQLN
FT                   YQPNAAAQQLQKKKTHIIGLLFPAIAHPFFGELVELLEKKLYLKGYTVIVGDSMYDEKK
FT                   EEHYLRQLLSHQVDGLIVGTHNFNIQTYNKYSGLPIVSVERILNDEIPTISVDNYHGGV
FT                   LATQYLIDQGAKHIVHTSGHTYPNMPSSLRHQGYIDTIKKHHFTPHHWEVEFELSHGEK
FT                   DIIFSRLLDEHPNVDGIFAGNDVEAAQILSLIQRKYANANNQPLVIGFDGTNLIRTVLP
FT                   NMPTIVQPINDLADTAVTVLENRMMNVPTQSTYMLDVTLYEGINQS"
FT   CDS_pept        complement(89909..91333)
FT                   /transl_table=11
FT                   /gene="scrB3"
FT                   /locus_tag="LEGAS_0097"
FT                   /product="Sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90745"
FT                   /protein_id="CBL90745.1"
FT                   /translation="MTKQLTEENFIPITNTRYRPNYHVAPTNGWMNDPNGFVYFQGYYH
FT                   IFYQHYPYAAQWGPMHWGHKRSRDLIHWEGLPIALTPGDSEDTGGVFSGSAIVKDGRLW
FT                   LVYTGHHYYGDNDPEHFWQNQNLAYSDDGIHFTKYANNPIISQAPDDSSHHFRDPKIWE
FT                   HNGFYYIILGNQSNNGLGRAILYQSADLFEWQYLGVLDQSQSIAAEGDMWECPDFFTLN
FT                   GKEILLMSPMNIQPQAYQFKNLYQTGYFIGQFDYTTQKFERNHFQELDHGHDFYASQTL
FT                   LSPDGRRIVIGWADMWESKFNEKSDGWTGLLTLPRQLILNDDHLTMQPVAETSSLRQEI
FT                   LCQGPLSPTTMLSQHNSAIEIKATLATSNVSLYVKDVLNNDIISLYFDKDTHTFVLNHI
FT                   DHPNDPRYAFVNELDQLDFNIFVDHSVIEIFVQQGEAVFTERFYIAGTPAISLVSDANS
FT                   TISGQFTTYRLDSQTI"
FT   CDS_pept        complement(91381..92670)
FT                   /transl_table=11
FT                   /gene="scrA3"
FT                   /locus_tag="LEGAS_0098"
FT                   /product="PTS system sucrose-specific EIIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90746"
FT                   /protein_id="CBL90746.1"
FT                   /translation="MNSTKSRLRSFKNASYLQSSTSMLLFFASWGIWWSFYQLWLTSPT
FT                   SNGGLGLSGAQVGTIFSANSLFSLILMFVYGAIQDRLFIKRYLLIFNAIISTLIGPFFI
FT                   WVYAPLLTNHFVIGMWVGAIVLSTGFLSAVGILEAVTERFSRVFSFEYGQARAWGSFGY
FT                   AIVALLAGLLFVINPQLNFWFGSIFGILLLANLIFWVPKEERDAKQAISDLAREDSIPK
FT                   LSDMLHLLKLPELWQVIIFIIFSWTFYTIFDSQMFPDFYTKLFSSPALGQHAYGTLNSI
FT                   QVFFEAIMLGVVPIIMRKIGVKRTLMIGVVIMFMRIGLCGFNTNPYTVSAIKMLHSLEV
FT                   PMFTLSIFRYFTLHFNTKLSASLYMIGFQIAAQIGQVILSTPLGILRDHVGYQNTFHVI
FT                   SVMVLLAGIYAFFVLKKDSQDVNGTPLAKI"
FT   CDS_pept        92933..93823
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0099"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90747"
FT                   /protein_id="CBL90747.1"
FT                   /translation="MKNVFKSQLCLLRQKMSLSQDALAQKLYVSRQSVSKWEHGDAEPD
FT                   IDKLISLAEILAVDLNFLLSGQQSNEELIIRLQNISKKFKKTVLKDINLSVYGRDRIAL
FT                   LGANGSGKTTIINTIVGLVKPDGGRVRRFFNSSDDLSVMSQENVLIESLKVREHVMLSA
FT                   QIQRQYSPIFVTEMIKKFNLNEQAQVIISQLSGGQRRRLALLISLLKPSKLLILDEPTV
FT                   GMDLESIDFFWHYLDHVGGSVITITHDFNQIDKYFTRVILLKNGVIDKDVSVAAIHANN
FT                   QTIEQWYRISNQEVG"
FT   CDS_pept        93917..94585
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0100"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90748"
FT                   /protein_id="CBL90748.1"
FT                   /translation="MMISMAKSSGFFTMSNAYFWVSAACAIGIAGNAVVTFSKKISHTR
FT                   KFYQLQAHTSNYSMRRWLMDQMAVQIILNFAICVVIIVAGLLMKSLAFNLNIVIMLVLF
FT                   SLMGIYLSTIGFLLGIFVDSRTLDALSMPLSMVFGMLMVRLDTWLSGNVIVAITTVQKF
FT                   FPGYYLFGIVQKIILKQNFSNEFLKFLLSCSLMVIPFMIVVIVQHKKHVPSLSADEVTQ
FT                   "
FT   CDS_pept        94582..94839
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0101"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90749"
FT                   /protein_id="CBL90749.1"
FT                   /translation="MINLHAYIKKQYESGAYSNFGEQIKQQTNDYDLGCQQARQDFINH
FT                   RLRHYPNALLRFGNVILHDKLTEVTTFVQGYNDQMWILRH"
FT   CDS_pept        94948..95280
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0102"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90750"
FT                   /protein_id="CBL90750.1"
FT                   /translation="MSKYSNEFKLMVVKEWLSGQNSLPELVKKYAINNDHAIREWRDEY
FT                   LVTDSIGSKNHKSYSPEFKMTVLNYLETHSHSEAARHFAVFPSTTIGNWLRSYRIFGYQ
FT                   VGTAMG"
FT   CDS_pept        95398..96330
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0103"
FT                   /product="Integrase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90751"
FT                   /protein_id="CBL90751.1"
FT                   /translation="MLCYCGRQRVQKIKSLSGSTNREKQTAVTSLRRTKYFKLADLLAL
FT                   IGLKRSTYYYLEAHPPNTSLDNKIADVIRQIKSPQFQNEYGYRRVTTLLHDQGYLVNHK
FT                   RVLRIMRQNALLSTTYNTRKRRYNSYRGTVGRIAERVIKRDFQADAPYQKIVTDVTEMQ
FT                   LNDHNKAYLTAFVDLYAGEVLSYHLAKTPTMTLVMRPLKALSKHRGAIIHSDQGFHYQT
FT                   PMFINTLKDFGMTQSMSRKSTPVDNAPIESFFHILKANIVHHKQYESFHDFKVVVDDFI
FT                   NYYNNHRIKQKLNGLSPVQYRQLTTESVS"
FT   CDS_pept        complement(96381..97142)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0104"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90752"
FT                   /protein_id="CBL90752.1"
FT                   /translation="MLNNRQIKKIAWSRVTTHFKAAFLLSLVPMIFTVFGVMSDHNSRD
FT                   VTFSQNLNPTTQKVTDTASNMGHLFQDNWLTITIVSLIVLIIVIVIGILMTAISDFFTE
FT                   SSVSGFIDWHETDKTPESPIKAGFNLLTSTAFQIAFLRAVYTLLWTLLFIIPGIIKSFS
FT                   YSQALYLYRDDLRAGRDIQSTKYYIAQSQKLMTDYKGQLFMMYLSLIGWYFLGFFTFGL
FT                   ANLFTLPYTLAIQAEFYIALRGEQPSKTTVL"
FT   CDS_pept        97388..97531
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0105"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90753"
FT                   /protein_id="CBL90753.1"
FT                   /translation="MDGQGGMISSTLKRSTAIILLEHHRLLSINFSGVERGSYVELTPM
FT                   KD"
FT   CDS_pept        97841..99088
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="LEGAS_0106"
FT                   /product="Tyrosyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90754"
FT                   /protein_id="CBL90754.1"
FT                   /translation="MNFIEDLKWRGALNQITDEKGLLDAMASGKIGAYVGTDPTADSLH
FT                   LGHLIPFMVLKRFQNAGGKAVIIIGGATGAIGDPRPTTERQLLTQEQLVENEKGITAQV
FT                   TKLFGDNDTRIVNNNDWLGKLTLTDFLRDYGKLFSINVMLKKDVVASRLETGISFTEFT
FT                   YQVLQGIDFHELWRREDVKLQIGGSDQWGNITSGIDLIHSLEGNAAKAFGLTIPLMTDS
FT                   TGKKFGKSEGNAIWLDPEKTSPYTFYQFWLNQNDADVVKYLKYFTFLNSEEIDALAKAI
FT                   DTNPGAREAQRRLAQEVTKFVHGQAAVDDAEQLSKALFSGDVATLSAAQIADAFGGVPS
FT                   FDITAESKNIIDFLVDGGVDQSKRQAREDVNNGAITINGEKVTDVATEISPSAHYDGKF
FT                   VLVRRGKKRYFLGKVQ"
FT   CDS_pept        99157..100146
FT                   /transl_table=11
FT                   /gene="ldhD2"
FT                   /locus_tag="LEGAS_0107"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90755"
FT                   /protein_id="CBL90755.1"
FT                   /translation="MKILMYNSVDKEVPYVNAWAAKTGHEVVTLFEPLSVANVDRAQEF
FT                   DAVTTQQTTDMPDPIYQKLASYGIKQIALRQVGYDVFDLPAAFSNHIRLSNVAAYSPRA
FT                   IAEYTLTQLFNILRNNKKFDRAMATGDYTWAAGGQAREIYQLTVAVIGVGRIGTAFAQI
FT                   LHALGAKVLAVDPVYHAQNEAFVEYTTLDDALSRANVISFHTPLNAETQGLADQAFFAK
FT                   VQPGTIMLNMARGGIVDMAALEAALLSGQLYGAAFDVTPNENEFMDQKQTVTELPENIQ
FT                   RLIQLDNFYLSPHIAFYTNTAIKNMVEIALDDAVIMANGGHTENEILR"
FT   CDS_pept        100151..101014
FT                   /transl_table=11
FT                   /gene="MMSB"
FT                   /locus_tag="LEGAS_0108"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90756"
FT                   /protein_id="CBL90756.1"
FT                   /translation="MNIGFIGTGVMGTGIVNNLLHAGHQVTVYNRTQSKAANVISHGAV
FT                   WADTPANVARVSEITFTMVGYPKDVEDVWMREDGIFAGAKTGAILVDMTTSTPKLAEKL
FT                   AKKGEELGVQVIDAPVSGGDTGAKNGTLSIMVGGSSTTFDQVLPIFKDIGQQIVLAGSA
FT                   GKGQHMKMSNNIGVAATVITMAESMVYAKAAGLNMTDAYNVWRSGAAGSWSVTNYMPRV
FT                   MSGDFSAGFYVKHLLKDLRIALDSAADMQLDLPSAQLAEQLFAKLSQTHGDEGVQAIVK
FT                   LWSEFQ"
FT   CDS_pept        101076..101558
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0109"
FT                   /product="Histidine triad (HIT) protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90757"
FT                   /protein_id="CBL90757.1"
FT                   /translation="MKQWFEDRIGSAINGSNPMVMAELEGGYAVFGDVQFLPGYSVLLP
FT                   KRHVSSLNELNIDERQSFLRDMSILGDAILDVCHADRINYDILGNTDNFLHAHVFPRYA
FT                   TEKRERLEKPVWLYSSDHWTDVQYRYDPMKHDTLRKRITEYLTNDCQKNHIEHIIF"
FT   CDS_pept        101612..102817
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0110"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90758"
FT                   /protein_id="CBL90758.1"
FT                   /translation="MTEIKQRTTAEYQVNHFKVRLVIYLSYIVQGFALIILAQTVQQLS
FT                   TLWQSSIASTTAVVSSIGIGKLIAYPILGELSDHLDRKKLLSIAAITYILFFTLLPLTH
FT                   TIFLAVIVTTLAGLANAALDAVAYPTLLEINHGKSSGNVLIKAMISLGEGLLPIILVTL
FT                   INQKIWFGWLYWLATAILIVNLSTMLSIKSEKFYTLKNQTTSKVIKNKVKWQWDITKIL
FT                   FLIYGFSSMWLMLHFTQWVTRYFHVVQSFTTVNSHLLMTFYSIGSLVGVGLLFLITNQK
FT                   WIREARLLVLTAIGTIVGLAVIVSSQEMRLASLGCFIFGISAAGGSLQLGLSQLIAHNS
FT                   KFSGRLTGLYFFFGSVAFFLMPIVTGLFATKHLANMMTSLFIIAGLNLIIVVFNVFHER
FT                   NR"
FT   CDS_pept        complement(103051..103533)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0111"
FT                   /product="Glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90759"
FT                   /protein_id="CBL90759.1"
FT                   /translation="MTEPDTGFSIINHIGITVSNLENSIIFYEALTGRKIANKDEISGK
FT                   RMAETQGLENTLIKFANLHLGNVNIDILEYVEPKPSQAHYSNEQISAMHMCFEVDDIDA
FT                   AVARLKAIGIHPDGKPIFFEEQDGLKNGLGTGVAYFTDPDGTNLELIAPKGPFTRG"
FT   CDS_pept        103904..104260
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0112"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90760"
FT                   /protein_id="CBL90760.1"
FT                   /translation="MADKIYNIGVEATMAVIGGKWKPIILCNLRHSALRPSELRRKIPR
FT                   ISQKMLTQQLRELEEADIVDRKSYNQVPPKVEYALSEYGETLGELLDGLCAWGEMHVNT
FT                   LKVKGEHVVLLNEA"
FT   CDS_pept        104288..105145
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0113"
FT                   /product="cell surface hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90761"
FT                   /protein_id="CBL90761.1"
FT                   /translation="MLTKYKKIFILAVLVLLIFLIGYAHTNKRVTQSVENVTKSTIVPT
FT                   FFLHGYGSSYKAEQHMTHYLVEQGDSNTIIRANVSKSGAVKLSGVIDKKAKHPLVEVNY
FT                   ENNKNTNYHQDGQWLKNVIVALQKQYKIKEFNAVGHSMGNMSIVFYLLDHSSDSKLPKL
FT                   AKQVDIAGHFNGILGMDDQANQMVLNSQGKPQKMNANYKALLKLRTIYPKNQVKVLNIY
FT                   GDRDDGSHSDGSVSNTSSQSLRYLISDRTKSYKELKITGKDAQHSKLHENKVVDQALNT
FT                   FLFE"
FT   CDS_pept        105323..105811
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90762"
FT                   /protein_id="CBL90762.1"
FT                   /translation="MINTRIKMLSVVGFFLIGAFFNTQFQKSQIKQATASVAKLSATQS
FT                   LTTISGTLTKVIDNDNKMPDDSLPKDTVNALFNAGYVSDKQVLSKVANDKVRKFVKQFL
FT                   GQLESDPAQAKKWHVSDNQLQVSQQKDSLLFFGALKATNGSRTVNYQLLGQLMQRVMS"
FT   CDS_pept        105901..106137
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0115"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90763"
FT                   /protein_id="CBL90763.1"
FT                   /translation="MKQVVAKSTITKASDTSQQFFNLAYNWSSGFDYKKRIKKIKQAKL
FT                   VTNQVLANDYLFPEVGGTADYIDNNGLKSSSVV"
FT   CDS_pept        106198..106347
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90764"
FT                   /protein_id="CBL90764.1"
FT                   /translation="MNTKHDSDVGNGEIRYYYFDIDYQATSLDYVWRLAVNQSTDFNTF
FT                   NPYE"
FT   CDS_pept        106392..106739
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90765"
FT                   /protein_id="CBL90765.1"
FT                   /translation="MKNQVKQAVVMKIVLYCAPLLVILIPVLLIIALTMNNPSIVCQTD
FT                   TTTTSSDSGSSNGSLADKNSDVGKRVSYIANRFKQAGYFGDNISAIIAIGWRESNLNPK
FT                   AVNPAGSFKGI"
FT   CDS_pept        106851..107546
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90766"
FT                   /protein_id="CBL90766.1"
FT                   /translation="MLGLAVAKDIDSSTLAWDTGVEGVGASDPQRKVPEVKSWAETLKK
FT                   TYDLSFEGSLSSGNNADSNSNNQSSYCNTDDRMTPYLVQDLYEQIKQVERLVELLTTCD
FT                   QALENLDQTISLIEHKHDDEAAINGAMKTIRKQYQALLEKVGLDGSVMDRVNQAIDNIH
FT                   GQYRQLHVQNKALFFVQLENIHDQTIKYIRNYIEIAFIQKRIDYGFNQFNTFLRVVVDN
FT                   AVYRKNIKV"
FT   CDS_pept        107673..108842
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0119"
FT                   /product="putative permease, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90767"
FT                   /protein_id="CBL90767.1"
FT                   /translation="MPNKKQLLSYRIFDELGDWFYYFVIVLIVFKTSNDNAIYLGVLSA
FT                   SYTVPGLVFSRLLARTLRKHNIRSSLLSMATIRVFVLVAMFIFVTNTLFVIILVFLEQM
FT                   LSLGSKLAFQNMIVDIEEDEDVLKSFNRDVTIWSTAARLCVIPIYFLLTKQFSDEIFVL
FT                   LDAIFMVFALISIGLISNDTSFSKSIVNVKLERSQTVFEKNRFDGLTIWLIVLLSSIGV
FT                   ANAFTDAYGISAINFISNNTQIQYAIAVFVMTIAELISGMTSKLVDNQLSGHKRNYLIS
FT                   IMVLLSGVLMIGAGLFKTMIILLTSLVICRIFFIWIQLYALAYFQQKFKNQIMSVLAVQ
FT                   NMALDGVALGNSIIGGFLINQLGIISYMLMIGVNCIIFGLAFILMRKGN"
FT   CDS_pept        108844..109014
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90768"
FT                   /protein_id="CBL90768.1"
FT                   /translation="MYSVVLGLATNRSDNKILKWLQEVKQEIEELDVGQFKIEVVIYLN
FT                   GRTAGEERCHK"
FT   CDS_pept        108977..109243
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90769"
FT                   /protein_id="CBL90769.1"
FT                   /translation="MGERPGKNDAINKILSYARGNKKDIIHFFDDDIEFLKGSIVKNLN
FT                   TLIEYPRGEHVLIGSDFKVRENVLNVIQKILNAPFEIQRCNDY"
FT   CDS_pept        109341..109559
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0122"
FT                   /product="unknown fragment"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90770"
FT                   /protein_id="CBL90770.1"
FT                   /translation="MFFQNEYTRLQSYFSWRYAENPKYRKHIRRITIKAHIKLLLFRVF
FT                   QKAVFIAGKKELKKNRVVMWNKYRREK"
FT   CDS_pept        109565..109777
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0123"
FT                   /product="hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90771"
FT                   /protein_id="CBL90771.1"
FT                   /translation="MKCFIDFDGTLATDDGFINDENIKIIQERGNEFVLVTGRNVSQIT
FT                   KIFREYKISIPAIGGNGAFLLKKIG"
FT   CDS_pept        109822..110394
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0124"
FT                   /product="hydrolase, HAD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90772"
FT                   /protein_id="CBL90772.1"
FT                   /translation="MALQSYGLPTIIHTVLDNWLFFDFENNDDVYSNARIQKIADEYAT
FT                   KILKTKHASKDIYDLYWTTFFEECKGKVGIKESVELENVTGVEVFFSDIHEQYRLKKTF
FT                   SRKEGQCTESYYTSIEFNTNSSKGIAINDYIEKNNIKFSYSIGNGLNDESMFLVSDISY
FT                   KMIHSNPTLSAKEIPFSPKDPFLKYLF"
FT   CDS_pept        complement(110405..111052)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0125"
FT                   /product="Endonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90773"
FT                   /protein_id="CBL90773.1"
FT                   /translation="MIFKANYYETFQELLSKHGHQGWWPAESDWEMMIGAVLVQNTSWT
FT                   NVQKSITNLKEITDFNPALILNTPQKKLIDAIKPSGFYNAKSKTIKELFTLLSKHKFNL
FT                   IYLNKNHTTNELRNILLSVTGIGPETADDILLYVFNRPVFIPDSYTRKLVAFLENVEFK
FT                   SLSYQSLKRDLEPSIINQMTLSELQEFHALIDEYGTEFINKSQKYPNVNPFG"
FT   CDS_pept        111219..111713
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0126"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90774"
FT                   /protein_id="CBL90774.1"
FT                   /translation="MSISNVEKVKNIYDSLADTWDSKSKLIKQIRGGESNRSLVLLNSL
FT                   IKPDMKIADIGAGTGRATRNILKNSQEVQISAVDLSPKMLAILRKLVANEYPDDDRFIT
FT                   KVGDVETIVLPDSGNFDLVVMLYLLHHVENAKETLLHASIMIKDNGRSYTENPDCFISR
FT                   A"
FT   CDS_pept        111849..112004
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0127"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90775"
FT                   /protein_id="CBL90775.1"
FT                   /translation="MTVQTVTGWVKKAQIVGTDVKGQPVTRAEFNAMQKEVARLKEENE
FT                   ILSRLA"
FT   CDS_pept        112181..112357
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0128"
FT                   /product="transposase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90776"
FT                   /protein_id="CBL90776.1"
FT                   /translation="MRLALADLNFHHGTNRVRRLMREAGIYSVMSRQFNKPTTTVDYCQ
FT                   RPNLIRHLPEANA"
FT   CDS_pept        112361..112534
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0129"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90777"
FT                   /protein_id="CBL90777.1"
FT                   /translation="MDITYLKLSNGQWVYLASTLDLRTHQILAHQISATMDTKLVVTTL
FT                   QRALSTHKKPNY"
FT   CDS_pept        complement(112784..112993)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90778"
FT                   /protein_id="CBL90778.1"
FT                   /translation="MAHSGKSLKDIRTEYGVWTESVRSWLKKANYLDQYTPENVRLSAF
FT                   EKENKRLREELRILKVTAVLLAKN"
FT   CDS_pept        113239..113781
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0131"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90779"
FT                   /protein_id="CBL90779.1"
FT                   /translation="MTTCYIAENEIENLRLAYASIVKNVFQINAYFSFANVHVEEIMSF
FT                   EKTTQYTLAFAKYEDVKQNLLTSWNASVALDNNLDDFFKNLNAVQSDVDLSNDEVLILK
FT                   EMSLTNTKMSDLIYDLYNAYEVMPYEKLLMESQVHEYLRHGSITKLTEDIVGLLSQELV
FT                   FLKKYSVMTKEVELINS"
FT   CDS_pept        113856..114887
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0132"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90780"
FT                   /protein_id="CBL90780.1"
FT                   /translation="MSEINLMRVPNFGIEGFVTFKEKNNMSFRPSATHTTDNIAYSNAL
FT                   SELLEERDMTNYVPIEMRGEANSDFYRNLEIIGDTNWYNLEKQYVELKNVSDPSDVVLF
FT                   PKELVLFKSNYDLHEKNQLHWSSSEGYSHDINKITALNKGKSEIIEHHTKMFWWFGRSK
FT                   IIEKIRVKSSVFDKLKKQKIIKSVRVFEILESNQFSYSTIMAVLETTTFPFLSVGFGTN
FT                   TDEKNAMNHALLEAIHTFRGENWYNLSQVMIPHGFSKDFWNRVDNSLLNVRINSEEIKS
FT                   NSLQPTFYYLTVGNSPKGFTTRVYSPELQPLISNQFVPFYFPELCTTKNVALREKYRGT
FT                   PFI"
FT   CDS_pept        114884..116125
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0133"
FT                   /product="putative permease, membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90781"
FT                   /protein_id="CBL90781.1"
FT                   /translation="MNKNFIKIILNDGVVTVATQTFNLFLIWYFAVKLHRQDMVALLGM
FT                   LQIIEIGGGPIGGAVADMVNPAKILKWVSLIRICVTGILLFSLFQTRINGIILLLLIFS
FT                   TLNSLISVFYSSAVEVSTYKFAKNESERVKNNAGFSAVSGISSILSGSLLAVMITYLDL
FT                   KSSTILIIFLIILSAIGILNISTAKNVIPDVINDSDVNFKFNEAVSSTFKGLRNILHEP
FT                   IIQTVIPYALIMNFLYWTFWYIQPLYLNYKIPNIKYAFSLQQIVISVASVIATLVIQRK
FT                   HTLVMNYKGHYRLLLLIQSGALFLLSLLYAFINSEKILITGLICFWALYSLFNSFTGII
FT                   LITLLQEKIDNKILGTTLGTIFTLLMVTAPLAAIVSKTVPIKSISLIILTGLMVVSLLY
FT                   ALTDKRFLEVLHGD"
FT   CDS_pept        116115..117509
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0134"
FT                   /product="Putative drug resistance ABC transporter, two
FT                   ATP-binding subunits"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90782"
FT                   /protein_id="CBL90782.1"
FT                   /translation="MVIDVKNISFQFDQGNIVFDNINFRLSEGHIGIVGDNGVGKTTLI
FT                   NLISGRLLPQKGTISLEGKVKIVSQFNDWEDYHSPGELQLQRLKDAVFSNPDILLLDEP
FT                   TSNLDKNGIKVLSGLIRHFSGIVLLISHDFDFLDSTTDNILLIENRRAELYEQKFEDFQ
FT                   LEYEKKRHKEFQMYEVQKKQKNQQRKSVQRLQEKSQRSKKVRGISNSDKKAKGLAGKYD
FT                   KVQNRLATSAKNMRQALNDNHYDSKPFTKIGLKILNYYQNSGKISMQLSFSNVKVNENY
FT                   LVNSPFKINIKSGHVLSLLGDNGVGKTSLLDKLFQKLDEKNVHVNYFHQNINQDWCSSI
FT                   PLITQLMNKSGIREEIILEVAGALGVNREMLTRSPNKLSGGQLLKVQLILCLISAFDVL
FT                   ILDEPTNYLDYDGVVALTTYINDSKAALVIVSHDKRFIENVTTDVVVIENKKVVDYLTL
FT                   QDYFNS"
FT   CDS_pept        118467..119027
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0135"
FT                   /product="Zinc-containing alcohol dehydrogenase,N-terminal
FT                   half"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90783"
FT                   /protein_id="CBL90783.1"
FT                   /translation="MNSIKAVGFDQHLSIDNPDSFQDININVPEAYGHDLLVRVDGVSV
FT                   NPVDTFVRKSGRKNRLNKPKVIGWDAVGIVTSIGDEVTLFNKGDRVWYAGDFTRSGSNA
FT                   QLQLVDERIVGLSPNNLTDDQAAAIPLVGLTAYESLFEKLGINWTGNENKTVLIINGAG
FT                   GGWFHSHSISKISWFNSHCNSIP"
FT   CDS_pept        119053..119496
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0136"
FT                   /product="Zinc-containing alcohol dehydrogenase,C-terminal
FT                   half"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90784"
FT                   /protein_id="CBL90784.1"
FT                   /translation="MGADQVVNHHQDLVAQVRHLNKKYVDYILNLNNLDAHWNEIAELI
FT                   KPDGQIVATTENHRLIDLQKLTKKRATFAWEWMYSKSYFKTVTMTSQNQILNHLAKLYM
FT                   ENALLPINTINYSMISASNMRKAHADVETGSMIGKVVLTGWEK"
FT   CDS_pept        119540..120076
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0137"
FT                   /product="Raf kinase inhibitor homologous protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90785"
FT                   /protein_id="CBL90785.1"
FT                   /translation="MKNEDIVFNNLAKVPYLTVSVSGLTNDGFFQKKNYSGMFGIEGGQ
FT                   DVSPEVSWNDVPSGTKSFVVTMYDPDAPTESGFWHWSIKDIPADITTLSENAGDINSGS
FT                   LPEKAVAMPMDARMNRYVGAAPAKGDQPHPYHIVVTALDVDVLDVSPDSTPAFMNFNMI
FT                   GHELARGSKIVYAQL"
FT   CDS_pept        120185..121417
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0138"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90786"
FT                   /protein_id="CBL90786.1"
FT                   /translation="MNYIRILKNKVFRQLFTSIILTNLANSISSISLIWIAYNKFNSPV
FT                   VIAIVLGALQLPNIILGPFLGGLLDKFNKIKLMTFANIVNASVFLFLIFNPLASRIDIS
FT                   VFILLLVLSGSMKPLLVGGDSMVIQDIFESNGERMIANALVIMSFDTTYIFGSLLSGLI
FT                   LALGYGVKVYALVAILYIFIAVIFFRINIIFTPKHISYDKNKDVSYVNNTKSAFKTIFK
FT                   NKQLIAVLSMDFFWNMLLWAGLTVLLPVLVKTVLNSGSEQYGLLESMTSIGIIIGSFFV
FT                   GKIKLKEDWLIKSVVITIGIHGLLFSFIGLIKNIWLICILLILIGFIVSPALIYKTTFY
FT                   QKAFDEESKGALFTIAGSMTSSSYPLGIMVTSILATFRNGIAIPYVFLFYGLIIVILSI
FT                   IVYRNVLLKSK"
FT   CDS_pept        121643..122725
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="LEGAS_0139"
FT                   /product="sugar ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90787"
FT                   /protein_id="CBL90787.1"
FT                   /translation="MSIELQHLKKTYENGEEVLTDINTTIADGQFYILVGASGSGKSTI
FT                   LNAIAGFIPIDEGVITINGKDVTRLPPKDRNLSMVFQNYALMPNLTVSENIVFGLTARH
FT                   TAKTLRQKKLQEVLSLVHLETYKNKKPGNLSGGQRQRVSLARALVSDAKIILMDEPLSN
FT                   LDAKLRAEMRKEIRLLQQQLGITVIYVTHDQTEAMTMGDQVMLLNKGKIEQIGSPLELY
FT                   NVPANTFVADFFGSPAINLIDVNIENDILKMKNGVTIPFNWEHINGPFKLGVRPENIVM
FT                   TQSGGMTGTIVHIEPLGDGTNLEINLGLETAFRVKVSEQINLVIGDTINFDILLDKVLL
FT                   FTQDGQLIKVGQSELVAVGG"
FT   CDS_pept        122731..123639
FT                   /transl_table=11
FT                   /gene="ugpA"
FT                   /locus_tag="LEGAS_0140"
FT                   /product="glycerol-3-phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90788"
FT                   /protein_id="CBL90788.1"
FT                   /translation="MKKMTKTRSVQTSHQNLLALLLLLPSLIILGIFIFYPMIKTFYLS
FT                   TQLTNLVGNPIKFIGLKNFVNLIQSDSFSTSFTITLIFVLFSTILTLFISYIMAIVASQ
FT                   KMRGIAIFRTMFSSTMGVSVTVASILWLFMFNPQIGLFSKILTTLHLPQINWLSDPTWS
FT                   LVAIIGTTVWMNLGFAFLVLLGAIQAIPQDLYQVADLDGASWWLRLRKITMPATRSTIF
FT                   FVTVVTLINAFQTFGQVDILTSGGPDYHTNLLVYAIYQDAFVNHSVGRASAQSVILTLI
FT                   IMLFTIIQFYVKNKREGRNAK"
FT   CDS_pept        123629..124447
FT                   /transl_table=11
FT                   /gene="ugpE"
FT                   /locus_tag="LEGAS_0141"
FT                   /product="glycerol-3-phosphate ABC transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90789"
FT                   /protein_id="CBL90789.1"
FT                   /translation="MQSSRLQKNGRFIVLLLFAILLLLPLFLGISLSLSSSQSIAQGNL
FT                   LPRHLEFSNYIKVFTNTPMASFLLHSLIVSGMVMVGQIVLSIMAAYAFVFLNFRFKKTL
FT                   FILFLSTMMLPFEAQIIPNFATMRDLNLLNTYASIGLPFLASAFGTFMMKTSFEQVPIE
FT                   LKHLSDIEGLNHWQFATRVVIPYTKVNIITFALYSFLTNWNMYLWPLIATTNNNVRTVQ
FT                   IGLRQLRSQDTASNWGLIMAATIVSVIPTLLIIFLGQKYFKKGLTNGVIK"
FT   CDS_pept        124482..125810
FT                   /transl_table=11
FT                   /gene="ugpB"
FT                   /locus_tag="LEGAS_0142"
FT                   /product="glycerol-3-phosphate ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90790"
FT                   /protein_id="CBL90790.1"
FT                   /translation="MFKNTTKYIALATIGLGAVLPLTQVHAADNQRQNIVFWHSMTGQN
FT                   AQAIDRVVNDYNASQTKYKVIPEFQGQYVEALPKFLSVGGTSKAPDLFQSNEISTKQLS
FT                   TSGMIQPMQTLIKKYKFNTKNLRKNILNYYTINGKLYSMPFNSSAPVLYYNKDAFKDAG
FT                   IDDLPTSPTYEQVTAAAKKLKEKSGRAKLSILPYGWTFEELLANQNQTLVNHGNGRKKT
FT                   ATKATFDNKAGKNILNWLKTNADAGTLVDYGTGANAGDTELSAFTSNQIDMFINSSASL
FT                   GNIKKDAKFNVGVTYLPRPQDVKANGVVIGGASIWLSKGKSTKAQKGSFDFLKFATSAK
FT                   EQAQWSIDTGYFAINNKSYDTKILKDAFKNTPILAAPVEQLKATTINAASAGALITSMP
FT                   KERINTQNAMENVINGKNVDSELSKAVKQTTADIKDANEQSGE"
FT   CDS_pept        125817..126533
FT                   /transl_table=11
FT                   /gene="glpQ1"
FT                   /locus_tag="LEGAS_0143"
FT                   /product="glycerophosphoryldiester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90791"
FT                   /protein_id="CBL90791.1"
FT                   /translation="MTTTIFGHRGIPVKFVENSKTGFEYLAQNGEAVEFDVHLTKDNVP
FT                   VIMHDEKLDRTTSSNGYIKNFNIRDLKNVHLINDINRQQQPVSQYERIPTLEEVLEIFN
FT                   HTNIFLNVELKTDYLSYPGIEKIVLKLLEKYDLKPQVVLSSFNIFTLQRLYQLDHTQNL
FT                   AFLSSNKISKPHQFMTDNHLKALHLDRKAVSEAPILQRIWTVNSENDMNKAFKQQLGGL
FT                   FTDDFEKAKQLRDGVE"
FT   CDS_pept        126539..127192
FT                   /transl_table=11
FT                   /gene="gpmB1"
FT                   /locus_tag="LEGAS_0144"
FT                   /product="phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90792"
FT                   /protein_id="CBL90792.1"
FT                   /translation="MKKINLFFIRHGETYFNTCRKIQGWSDSLLTEKGELEATHTGQWI
FT                   ADNVQLDRVYSSDLGRTKATTRLILLENKQQKSLPITYSAQFREAFFGSFEGDRLNQLA
FT                   GLLCISVSAENDSELALVVNEDDMMNQVKKSDPTHDAEDATAFWRRVRKGLADIWDNSN
FT                   DGDNILVVTHGALIRKLASRTENRYHENPDNGSISLFEMTDELDLTLQKYNQCV"
FT   CDS_pept        complement(127424..127909)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0145"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90793"
FT                   /protein_id="CBL90793.1"
FT                   /translation="MEKYKQIEQLKQQLRKTRENGDFEREWFIKHAPSQTTRQFIQNQK
FT                   HVTHSELQILSELTYNDTATPFKKLQSMSPLSQGMLSRYVNRLTAQTLIEKYHPIDNKK
FT                   EIFLRLTKIGYELGMLHLTLHQTIRIQEERILSDYSDDDVTNLVQLATKLLDARKTL"
FT   CDS_pept        128007..128954
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0146"
FT                   /product="Putative zinc-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90794"
FT                   /protein_id="CBL90794.1"
FT                   /translation="MKAAVVRDFGLAPQYENNYPNPLPKVDEALIHVTASALSNRARSD
FT                   ANGSHYASTGKLPMVPGVDGVGLLPNGNKVFFVSNGSFAEQVVVEKGHWVAMPNDLKDE
FT                   KIAGMMNPALSSWVALKYRADFKEGQKVLILGATGSAGSMAVQIAKRLGASSIIAVGRN
FT                   SKQLTELRHLGATQTIVLGADVKAYQKELAQAGKDVDIILDYLWGDVTANAMQAIIPNR
FT                   LHDEQDLKWIEIGSSAGQTAPIIGAAFRAVRLQLIGSGQGSVGVHAILQSFEEILKAEK
FT                   NRPFVFNVQVVPLSQVESIWHQKSGNRLVFSPDM"
FT   CDS_pept        129350..130174
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0147"
FT                   /product="Choline binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90795"
FT                   /protein_id="CBL90795.1"
FT                   /translation="MKKIVTGLLTLGIVGGLTVNTASAAVLGDDYPITLKKSAPDSMVD
FT                   NWTMYNRECVSFVAWRLHAQNHFELPVGFGSAWQWGSQAKSRGYRVDNTPSVGSVAWFG
FT                   AGHVAWVAEVSGDNVVIEEYNYNYNHNYYRRTVNTRDVSGFIHFKDVGTKATTANTTPK
FT                   QASPNKRIAIGSNVRFSGVYQVNVVNVAKNSVASDKLSGGKPTTLNLIDAVPLDETNAN
FT                   GIKAGNQVLSVGDYFKVNGTYRVLAIDKASNGMKVKIGAYETWLDINQATVV"
FT   CDS_pept        complement(130240..131691)
FT                   /transl_table=11
FT                   /gene="gshA"
FT                   /locus_tag="LEGAS_0148"
FT                   /product="Gamma-glutamylcysteine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90796"
FT                   /protein_id="CBL90796.1"
FT                   /translation="MSHLQKKTATENLNNALYAGRFGIEIEEHRVQTSSKTLSRHPHPR
FT                   TLGDRRIQPYFQTDFSESLEEVVTAPKSSSSKALAHLHELQLMLNEELADDEIIWPLSM
FT                   PPHLTTDDIHFLNTHFDRPWYQEYRDQLLDRYGSFQHIMAGVHVNFSPADDVMAWYRQR
FT                   NNITSHSFAKNQLLFQIAQQVVGYRWILTYLFGASPVSENPADNVPTSRHALQPVRSWR
FT                   ASDFGFANRPEIAVDYTDFQTHVHQIQQHIANGDFYDKSEFYGAVRLKAPGNMNDLMIN
FT                   GAEYMEFRMFDIDPFTQNGISQNALSFLHLLIIDAIINPATWGKSTLDNARTRNHVVAL
FT                   QHPTEQLSDTAIAYANDLFLRLERIVQSAPISQKNEFQSALSFARSAVRQPKLTIGAQL
FT                   SESIKNESLMIFGLQQGAKISAQRRQSTWSQNLPDIPKQLQQSYVQAHKLGFQTLMNPT
FT                   ENTLKITYNGQVRTLTSDQDLTQYI"
FT   CDS_pept        131924..133231
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0149"
FT                   /product="Two-component sensor kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90797"
FT                   /protein_id="CBL90797.1"
FT                   /translation="MFRFLNIFNVITWPIFESIVMLIWFSTLLGHHHFSKRTVVITSIM
FT                   LYVINMIGNGFESPLLRASLASTVSIILLFYIGWRQNIIRSKCILLLYASVSSLLAYWV
FT                   VNFEMTMTSLVSVPVFVQASLDFLANILAVIFALVFRQLKYEWLTENFLKKHVVQLQVL
FT                   LMSSLFLRIMNDFLAYFFAVEQFTGSIWWDFFLLSIILAIIFVPVISNQHELLLDKINQ
FT                   HDAEMAASQNYTQQLETKYSEFRFFKHDYKNILASLEYGIQSENMSDIRSTYYSVIKKS
FT                   NDTLPDPKILNLKYIADLNLKSLILVKHQIAFEKSVSFNVEINEFFDVIAIENDVSFYR
FT                   VIGILLDNAIESAEKTVKKTVTMLLMNCKEIVIVNSCTQCTDLTKTAQFGYSSKKNHSG
FT                   FGLYFVQQYINQHDNIELTTIAEQHHFIQKMMFTVS"
FT   CDS_pept        133231..133932
FT                   /transl_table=11
FT                   /gene="silR"
FT                   /locus_tag="LEGAS_0150"
FT                   /product="Response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90798"
FT                   /protein_id="CBL90798.1"
FT                   /translation="MNYYLLEDNLVQQRRIQQIIENCQVFDQPTSLLEALKADKLAKVI
FT                   LLDLEIRTVDNVGLNVAKMIRQFDTMSQIIIVTTHSEMLEQGLKYHISMIDFIDKAQSE
FT                   TLFTKRLLSAVTEAEQQIRQQSGTQSEFITLPNGKKSESINLNDIIYMTSSQSQSHRLT
FT                   VCCEQKNIQVRTTVKSLPKLHQNFMQIHAAYVVNKSKVVAFDAHTNTVQLNNGVLLPCA
FT                   RKYLKSMRQLF"
FT   CDS_pept        134041..135897
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0151"
FT                   /product="Predicted FAD(NAD)-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90799"
FT                   /protein_id="CBL90799.1"
FT                   /translation="MQVAIIGAGPRGLAVAERLINLADDDTQIDVQIYDPYAIGGRVWD
FT                   PAISQNEQFLMNTVIDQITLFNDESIENGGTPYPGPTMIQWLKQEASAFLASHSEFTEH
FT                   YSIEASRLTKPDDFSSRGMMGVYAAWFFEWLTRRVRPNQTLNFTKQSVINVVKIGTMFQ
FT                   LELADGAQILADHVVMALGHSDDHLTEEETAFKAFAAQHHLKYVTPTHPSEADLSDFHE
FT                   NDTVIMRGLGLSFFDYVAALSLGKGGKFTRDGTGELVYEPSGHEPHVIAGSRGGFPLHA
FT                   RGVNEKLSGELYQPVFFTLSALNALRYAGNGHISYNSFENLIVKELTYKYWLNRLDSKD
FT                   TQLTHKQIEDFKKALLTGKHLNETAKQFGLTHVPEFDIELIRNPARDLPEKVDYAAWFL
FT                   DYLLADIKDARLGNKNAPYAGTFDIMRDIRDLVRDVIAQNYFSADDYEKFMTRFKPLDI
FT                   LVSVGPPLERVEQLKALIKAGIFEVTAANIKVTTVAGKFEAHDIRGQRFQGNALIEARL
FT                   GSTDMAISRNPLVTNLKNSGMFVQPLRTRDDGSTYKLGAINVDPKTFEVIDASGVIIPH
FT                   LYVYGIPLEGLKWFGTVIPRPGVNTVILREGAWIAKRILEQT"
FT   CDS_pept        135987..136790
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0152"
FT                   /product="Hydrolase, HAD superfamily, Cof subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90800"
FT                   /protein_id="CBL90800.1"
FT                   /translation="MANIQLIATDLDGTFLSDDKSFDKALFRVVLDKLKNKNIQLAIAT
FT                   GVHQERINVLLADFLDEGMAYVTNNGARVTNADGQLIYERTMALPILLRVQQLLIDFPV
FT                   KPSRGLVYSTDDTAYIPSEYAHITLQTHRRYFKKVIIFDDVSEIKAPILKVTMNWQNFD
FT                   ETQFYDVARQALGDSVHITETGTGAIDIVAAGVNKAIGLKMLADNLGISMANIAAFGDG
FT                   ENDLEMLMAVGQPFIMPDASITGPFNPVSADNNHAGVLKTILDMI"
FT   CDS_pept        complement(136851..137741)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0153"
FT                   /product="esterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90801"
FT                   /protein_id="CBL90801.1"
FT                   /translation="MLFKDKVDTFVPATIPAFANKLFLDVAYTSQPQLRLDIYLPAGKG
FT                   PFPIILDIYGGGLLRGKKSSFKLNSSLRFLANGFAVISVDYCLNTQFKSQFPNQVSDIR
FT                   SALEYLSINSAKYQLDMSHVTLIGESSGAQLAVLAAATFSAQYTLGRPSKATINHKFPK
FT                   VNRVIAMYGPYQVDQFQTQFEALGIKPQFSETGTAQSFEGIMLHDHAPRCVPNLVTQSN
FT                   PATYFTKNMPPLMLIAGKKDPVVPYLQSVQLAATYRTIVGNHIKTQWLPYGVHGPKDYN
FT                   NDAIHIQKLTFINQN"
FT   CDS_pept        137997..138854
FT                   /transl_table=11
FT                   /gene="licT"
FT                   /locus_tag="LEGAS_0154"
FT                   /product="transcription antiterminator LicT"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90802"
FT                   /protein_id="CBL90802.1"
FT                   /translation="MHVKKTFNNNVLLADNNGHEVVLIGKGIGFQKKVGQVIDESAVDK
FT                   MYTPTEDRWLTLFDELINDISPKYFEIASQIIKVAEKKLNTKFNAYLLIAITDHIHFAV
FT                   QRTRDKIVIRNELLWEIQHFYPTEYAVGQEALQMIDKLFGVQLADDEAGFIALKFVENR
FT                   TSSQYHTDKGAQMTKLLSDIITIVQYQLQTHLDENSMSYQRFLVHLRFFVERITGSKKV
FT                   NMSEETDDVLYAHVFKKYPQAFNCTQKITQFVKSTLNKNISLNEQVYVTIHIQRIINEM
FT                   SQQS"
FT   CDS_pept        138962..140848
FT                   /transl_table=11
FT                   /gene="bglP"
FT                   /locus_tag="LEGAS_0155"
FT                   /product="pts system beta-glucoside-specific eiibca
FT                   component (eiibca-bgl) (eii-bgl)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90803"
FT                   /protein_id="CBL90803.1"
FT                   /translation="MDYKALAENILNDVGGKDNIDTAWHCATRLRFKLKNEKLADTQKI
FT                   ENLDGVVTVVKSAGQYQVVIGNAVAKVFDPLAEMADLENTDSQNDDKKIETKDNLLNRF
FT                   ISFISSVFTPFLGAMAGAGILKGLLALFVALGWLTTKSGAYQIWYAAGDGFFYFLPILL
FT                   AFTAAKKLKVNQFVAVALATTLVYPTLVAITASSQTMNFFNIPVVPTTYTSSVVPILLA
FT                   VWVMSVIEPILDKIFPESIRNIFTPLFLLIIMAPLTLIVVGPLGASIGAILSSGVSAIY
FT                   NFAPALAGALLGAFWQVFVIFGVHWTFVPVMMNNISRLGYDPLLPILSVAVISQAGAAL
FT                   GVFLKSKDTKMKSLAGSSVATALLGITEPTIYGVTLKLKRPFILASIAGAIGGAIAGGG
FT                   QAHASSFTLPSLLALPTYLGKGFISVIIGLVVAFVLGTVLTYLFGFSKLENNNTTTAEP
FT                   VQKDGVQQLITPVTGTIIPLKNVKDEVFASEAMGQGVAIVPNDNTIKSPVAGTVSAVYP
FT                   TGHAIGIISQLGAEVLIHIGIDTVELNGQFFKTLVQQNQKVSVGDSLVEFDREAISEAG
FT                   FDTTVMLIITNTPNYNVVVTENTLATADEQILTLTSRQEENVPVYKGEVQHV"
FT   CDS_pept        140841..142295
FT                   /transl_table=11
FT                   /gene="bglH"
FT                   /locus_tag="LEGAS_0156"
FT                   /product="beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90804"
FT                   /protein_id="CBL90804.1"
FT                   /translation="MYKKTYPKTFPKGFLWGGATAANQVEGAWNIDGKGMSTAEVVQKA
FT                   DDRRQMSMSDVTQETLQVALADTTVERYPKRRGIDFYHHYKEDIALFAEMGFKVYRFSI
FT                   AWARIFPKGEDQVPNEAGLVFYDHVLAELAKYDIKPLVTLSHYEMPIALTQKYNGWAGR
FT                   ETITAFNRFTETVFNRYKKQVPYWLTFNEINTGTWGFHETGAIDKGLSKKEQLQIRYQA
FT                   LHHQFVASAIATKQLHEIDSTAKIGSMLARMQTYPATPNPKDVRAAQLVDEKNLFFTDV
FT                   QARGEYPEYMNRFFYENDIVIQMAENDQAILLANPVDFISFSYYMTNVTAHDQVGDGAG
FT                   NMAVGGRNPYLKESDWGWQIDPVGLRISLNTMWDRYRKPLFIVENGLGALDKLENGQVH
FT                   DQYRIDYLRQHIEQMKESIKDGVDLLGYTMWGPIDLISFSTSEMSKRYGFIYVDQDDNG
FT                   EGTLKRIKKDSFEWYKQVIKTNGEQL"
FT   CDS_pept        complement(142646..143185)
FT                   /transl_table=11
FT                   /gene="yagU1"
FT                   /locus_tag="LEGAS_0157"
FT                   /product="integral membrane protein, requirement for acid
FT                   resistance."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90805"
FT                   /protein_id="CBL90805.1"
FT                   /translation="MFTLQKPQAGLKEIIVKSIWFGFIAGMISGMVKIGWEALLPPRTI
FT                   ARNMTNPPQHMAEQLGFSDKLVHSFVYYSQDQKVFWFTLILHFSFAIAFSILYVFISQY
FT                   WSKISLWQGAAYGIVLWIVWHVILMPAFGTVPAPWNQPFSEHFSEFFGHIVWAWAIAAT
FT                   VYYLIAKDKNGHLTNV"
FT   CDS_pept        143624..144538
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="LEGAS_0158"
FT                   /product="O-acetylserine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90806"
FT                   /protein_id="CBL90806.1"
FT                   /translation="MLIKNISELIGQTPLIDLQLDIPNHSRIFAKLEMFNPGGSIKDRL
FT                   GQFLISDGIARQVINQDTVIIEPTAGNTGIGLALAAQQHHLRTILVVPEKFSYEKQQLM
FT                   QALGAEIVNTPSSAGIKGAIEKAKTLATDIDNSYIPMQFANPANPKTYYQTLAPELIVD
FT                   LNGEKITAFVAGAGSGGAFSGVAQYLNEYDSTIQNVVVEPEGSILNGGPAHAHRTEGIG
FT                   VEFIPPFFKNVRIDQTLTVSDADAFQQVRDVAAHLGLFIGSSSGAALAASLKLAETLPA
FT                   QSTIVTIFSDSSERYMSDKIYEK"
FT   CDS_pept        144549..145691
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="LEGAS_0159"
FT                   /product="cystathionine beta-lyase MetC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90807"
FT                   /protein_id="CBL90807.1"
FT                   /translation="MKFNTQLIHGGISFDQTTGDVSVPIHMASTFKQNKIGESKYEYSR
FT                   SGNPTREAVEKLIADLESGVAGFAFASGSAAISTIFTLFSSGDHIIVGNDVYGGTFRLI
FT                   DSVLKRQGLTFTIIDTRDLNAVENAIQNNTKAIYFETPTNPLLRITDVQAISNIAQKHQ
FT                   LLSIVDNTFASPYIQKPIVLGADIVVHSASKYLGGHSDLIAGLVITKAVALGEKIGYLQ
FT                   NAIGAILAPQESWLLQRGIKTLALRMQRHQSNAQTIFEYLDAHPQVARVYFPGDPNNSD
FT                   YALAKKQMNGFGAMISFELQAGLNPEVFVENLEIITLAESLGALESLIEVPAKMTHGAI
FT                   PRNIRLANGIQDELIRLSVGVEDINDLIADLEQSFDQLKG"
FT   CDS_pept        145704..146222
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="LEGAS_0160"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90808"
FT                   /protein_id="CBL90808.1"
FT                   /translation="MFATAKAILKQDPAAHSLMMVILTYPGLHALGYHRLSHWLHVHKH
FT                   YLLGAIIARFAAKRTGVVIAPGAQIGQRVFIDHGIGVVIGETAIIEDDVTILHGVTVGA
FT                   RNITNGRRHPHIEHHSFIGAHAQILGPITIASYSKVGANAVVLNDVPDHATVVGNPARI
FT                   VNFKLKASI"
FT   CDS_pept        complement(146521..147081)
FT                   /transl_table=11
FT                   /gene="pdxU"
FT                   /locus_tag="LEGAS_0161"
FT                   /product="Substrate-specific component PdxU of predicted
FT                   pyridoxine ECF transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90809"
FT                   /protein_id="CBL90809.1"
FT                   /translation="MRNQQTINTIVFVAFFTAITFIATSIQVPMPALIGKPFVHLGNAA
FT                   ALISVLLLGYKRGAIAGGMGLALFDVTHNYVLDAPYYFFEVFVVGGLATLVIQLLNYRA
FT                   KPQSFKLILIILAAIIAKFVTTTLHNFIMSLIRGLTLQPAIVATLSALVPTIVNCVTTM
FT                   IVVLIIYPILNGRLRNQLFSALN"
FT   CDS_pept        147366..147767
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0162"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90810"
FT                   /protein_id="CBL90810.1"
FT                   /translation="MAQIQRNQPLYEQLMWRIKAQVASGVLIIGEKLPSVREMALIEGL
FT                   NPNTVAKAYRALENQNVIETVTGRGTFIRANDEFTADEQMIASLQEQLGEVVIEAKRAS
FT                   ISVQELHQWLDSCYSGKLDSPRRMHDISH"
FT   CDS_pept        147751..148656
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0163"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90811"
FT                   /protein_id="CBL90811.1"
FT                   /translation="MTLVIENISKKIQDKQVLENVCFELHQGEIVGLVGRNGAGKTTLF
FT                   GTIAGELLPDFGHIGLDDLDYNKTTRLHDQLCYVDMPENWLHYYSPKKIKTIFKLAYEN
FT                   FDESWYDAEIKRFGLNNSKRIRTYSKGMRALFAIIVSFASRAQYVLLDEPLDGLDVLIR
FT                   DQVKQLIVNQVTQHNTTILIASHNLIELDTLVDRILLLKNQTIDRTFAIEDNKNIKKYQ
FT                   LAFTGEELPRFLRESGTIIAQTGHIVTIVFNDFSEELGIKLAGPEFKFVEELQISSEDV
FT                   FRASFAEEAFSWQQELEVDA"
FT   CDS_pept        148653..149507
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0164"
FT                   /product="membrane protein, putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90812"
FT                   /protein_id="CBL90812.1"
FT                   /translation="MRQALKLYTTIRKNQFIMAAVIGMILIILSVGSFMLIPGMPNQDI
FT                   VDALGPELIVIWLIIAIIVFLNDQSRRLDTWLYTQNISRGQLFVTRVILLVVLPIMVAN
FT                   VVDIGLTAALQPHTLLDALNVDITVSANIFFMSSLFVIIATIIGPNWLKAAGTIFTLGL
FT                   LALAGPTIKLFFKSISSSMTSHFEGVIQPIITMVVALFIFAVGHYLAQNISDDTVDEAV
FT                   RVHYLKWPIVIFVFIATLMKTMSSPGRSSFDGFLLGLVLPIILAIVTFIFVFKPTFKVT
FT                   WDK"
FT   CDS_pept        149573..150478
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0165"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90813"
FT                   /protein_id="CBL90813.1"
FT                   /translation="MALLEVKNIDKNFGKKKAMTNVSFNVEAGHIVGLIGPNGAGKSTT
FT                   MRAITGLMSYSSGTILFDDKPITFSDHQALDKVGNLIEYPAIYPNMTALEHLNLYAMDT
FT                   QDSADFKDLMHKTQIDGDNFGKRKAKNFSLGMKQRLGIAIALIRNPKLVILDEPMNGLD
FT                   PQSVHDLRELIRDLADQGVAFLISSHLLDELQKLVDDVVIINHGKIIETATMTEFFSHD
FT                   KVRWVMDTSDNDATVQLAQDNKWTVTVDEGHVQISGADNLQNVITAMNHADIQIQTLNT
FT                   VTGNLEKSLLDMLANDDKGE"
FT   CDS_pept        150482..151249
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0166"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90814"
FT                   /protein_id="CBL90814.1"
FT                   /translation="MLTLMKQEYYKTFKQNRLYIWLGLSVIFPLAIMGIFKSQRGAGSI
FT                   TDLGHATFYVYLVGIIITALSVSQEFSFGTIRPLLSRRFSRGMIFTSKLLLNLSIYITL
FT                   FIGAFIGTMIGQLIFAPKFDFSERVSYAGNGWQTMGITVIDTLFQMIFVAALVLLITNL
FT                   VKSSGAAIGLGVVMIVGTPILSSISMLLINMAPILKWNPFNIFIGMAAYGQASPSMIKS
FT                   MVHMSQGTVVIAYLVYILAMYVIAYLIFKKRSV"
FT   CDS_pept        complement(151299..152159)
FT                   /transl_table=11
FT                   /gene="dkgA"
FT                   /locus_tag="LEGAS_0167"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90815"
FT                   /protein_id="CBL90815.1"
FT                   /translation="MSLTDTYTLANGTKIPVLGFGTWQSADGDIAYQSVKWALDAGYRH
FT                   IDTAAIYGNEASVGRAIKDSGIPRESLFVTSKLWNDARTYETVTNALDVSLDKLGLDYL
FT                   DLYLIHWPNPAGVQIKGENAWQSANAETWHAFEDAYTAGKTKAIGVSNFQIHHLEALTK
FT                   TQTIAPMVNQNFLNPSDQQVELVAYNNAHNILNEAYSPLGTGKLIDLPQVSSLAEKYNK
FT                   SIPQILIRWSLDKGFLPLPKSTHESYIKANADVFDFVLTGDDIASLDKLQAVGELHTNA
FT                   DQVSF"
FT   CDS_pept        complement(152273..153154)
FT                   /transl_table=11
FT                   /gene="mtsA2"
FT                   /locus_tag="LEGAS_0168"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90816"
FT                   /protein_id="CBL90816.1"
FT                   /translation="MKKIIAIMAVIIIVIVGFAAFKGNSPKQNTAKINIVASTDFYAEL
FT                   AQTVVGNHGTATAIINNPNVSPEDYEPTTAVAKKVSGADIALANGLGYDSWLDKLAQTS
FT                   KHTQLIRIGENVLKEKSGVNPHLWNNPETMIKTAQYLADKLSKQDPSHKKEYQANAQKY
FT                   ITSLKPVTDLVSQLKKHANNQSVAQTEPVFEYMLTALGYKVMDTDFSEAIEEGNDPSPA
FT                   TLTNLRAAITNHKIAFLVNNKQTTSSTVSTIVNLAKDNNVPVINVTETIPRNEHYVSWK
FT                   VAELKQIQKITQ"
FT   CDS_pept        complement(153151..153591)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0169"
FT                   /product="Zinc transport transcriptional regulator."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90817"
FT                   /protein_id="CBL90817.1"
FT                   /translation="MSESDNIIQELNTFVQTYAANSEVIRTATTQQINATQAHLLMLLQ
FT                   SQSATNTVLADTMKLTKPAITKAIKNLTTHGYVTSSKDATDKRSIHYSLTPEGVKLALQ
FT                   HEQLHQNLHHDISATVSDFTSEQQATIMTFLKHINHLKDNHS"
FT   CDS_pept        153766..154521
FT                   /transl_table=11
FT                   /gene="mbrA"
FT                   /locus_tag="LEGAS_0170"
FT                   /product="Bacitracin export ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90818"
FT                   /protein_id="CBL90818.1"
FT                   /translation="MMLLEVNHLEKIFKTRFSKETTAALRDIDFSVEKGEYIAIMGESG
FT                   SGKTTLLNILATLEHPTNGTVALNGNNITNIKANDLAKFRREHLGFVFQDFNLLDTLNV
FT                   RDNIYLPLVLNRKPVQMMKERIGTLAPLLNISELLNKQPFELSGGQKQRVAIARALMTQ
FT                   PDLILGDEPTAALDSKNSDRLLNLFEQINDEGQTILMVTHSSVVASHAKRVLFIKDGMI
FT                   YHQLYRAERSTSDFNKEINLAMGSVLGGN"
FT   CDS_pept        154523..155578
FT                   /transl_table=11
FT                   /gene="mbrB1"
FT                   /locus_tag="LEGAS_0171"
FT                   /product="ABC transporter bacitracin export permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90819"
FT                   /protein_id="CBL90819.1"
FT                   /translation="MFYLKLAQRNIRKSFKNFAPFLLATMMMFVLNFILASIALSPQLD
FT                   KLGIKSVSVVLIIGQIILIPFSIGIEIYAYRFLLKKRSREFGLYDILGLGKAQIIVVAL
FT                   LELLFLLLATVTLGTISGVILSKFLFLVFIALIGGNYFNLTFSTLSFTIPIIVALVAFI
FT                   LLAVIGTWTIHHHSSLSLLHSESQGEREPKSRGFLAFLGVLLLVVGYYMAITVKIGPMI
FT                   VTTFAVAVLFVIVGTYLFYVAFTIWYLKRQKRGRRYYQPEKFITTNALLYRMKQNAIGL
FT                   GNITILVTMAIVTLVTTVMLQTGLKQNMMVNMPFTTELSAMNTGDTHVGNVSEEQFKSI
FT                   LSQTEKSHKLV"
FT   CDS_pept        155575..156510
FT                   /transl_table=11
FT                   /gene="mbrB2"
FT                   /locus_tag="LEGAS_0172"
FT                   /product="ABC transporter bacitracin export permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90820"
FT                   /protein_id="CBL90820.1"
FT                   /translation="MKNGVQYVDYGTSMMILPSGKHVTINHLTDNYNKAGIAVVQVVSR
FT                   DTLIKLGNKLPKLAPNDVLIHNYSGHFNAETINWFGQLLRVKGQTTDVKNYPTQSSIGN
FT                   SMMIVAQNDAQAERLYQRIKFDANSYTIPRRTLIINLSKRDSKQVAKAFKAEGKSNVSP
FT                   ISTFAVDRFARLHEAQAYTGGFLFIGFTLGLTFIIGAALIIYYKQIAEGEQDKEAFRIL
FT                   QEVGLSKKEVSQTINSQIRLLFFMPIVVAIVHFAGAYMMVSKIINAFGITNKTLMLSVS
FT                   GGVILLIAVLYYIIYKMTSRSYVNIVQRHV"
FT   CDS_pept        156518..157171
FT                   /transl_table=11
FT                   /gene="mbrC"
FT                   /locus_tag="LEGAS_0173"
FT                   /product="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90821"
FT                   /protein_id="CBL90821.1"
FT                   /translation="MQKIFIVEDDTSIVDSLKKVLSSEFSVVSTLNFRAVVQEITEVHA
FT                   DLVLMDITLPYFNGFYWTTELRKISKVPIIFISSANDEMNQVMALSMGADDFVAKPFNL
FT                   MVLRAKVQALLRRSYNFSASELTFEEYQLVDNQLIGNAGKVELTSTETKILQILFEYGT
FT                   TVVPKDLLLTKLWENNDFIDANTLHVNMTRLRKKVGIINFDKIHTVRGVGYVLG"
FT   CDS_pept        157158..158024
FT                   /transl_table=11
FT                   /gene="mbrD"
FT                   /locus_tag="LEGAS_0174"
FT                   /product="Histidine protein kinase, sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90822"
FT                   /protein_id="CBL90822.1"
FT                   /translation="MFWDKYLKRRAGLFLTIIIGFTLFLLTFSLWQLPMIPLLNASLLF
FT                   LLIFSVYTIIDYQKFYKYQQQLSNLKIDNAQLTAKLSAQLQRDKDFMDIMRVWTHQMKV
FT                   PLASIDLVAQTQLPELQKQTFALENYLTILLEYLRVQNTATDFRFDVVNVRELVNTIIK
FT                   KYAPQFIHKELQVTIVGEASIKTDPKWLTVAIEQIINNAVKYTEIGGVTIHITDQQLMI
FT                   VDSGIGILASDLPRLFSHGFTGYNGRLDKKSSGLGLYLTKLVLDKLSFDILITSEIGTG
FT                   TTVIIHF"
FT   CDS_pept        158130..158885
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0175"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90823"
FT                   /protein_id="CBL90823.1"
FT                   /translation="MNEIKALCKVYLVNTLSNKFVFLFNLVLPTIYFLYKNIKYLSQPK
FT                   VAFSHQTMMVISYFWAYIIMVTLLNNVIVAIISQRENGFYKQLFFIVGSKWKILIANFL
FT                   VQLVILNGELLIFNLVVIGVTHNVHISLLIAGMIATLSVAVPVTFISSLLFLLKVKIES
FT                   INVLVSILLFVLFITMNLPKSYAMGDLLTLLNPITYIVDTSYQLLSFFFNHVIQGAVTA
FT                   RLGIVTIIYLVIGWFAISKLTVHSIVDRV"
FT   CDS_pept        158902..159495
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0176"
FT                   /product="putative ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90824"
FT                   /protein_id="CBL90824.1"
FT                   /translation="MQIKKYSLCYGDRVLAQDFEVDFFNHVVNVLTGANGAGKTTLLDF
FT                   IAGVGPKQAKGQKINVPKQQNIAYQLQHIHFFPTLSVGQTINMYRQIGNRSLEKSGSTF
FT                   QTIKRQALDKIWSVKMGQLSGGERQMVLTYGQCLLEKELYIFDEPTSGVDVTNSKVILK
FT                   MIASLVQEREKLVIMTSHNIEQLADLPVKMINIG"
FT   CDS_pept        159626..161428
FT                   /transl_table=11
FT                   /gene="glpQ4"
FT                   /locus_tag="LEGAS_0177"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90825"
FT                   /protein_id="CBL90825.1"
FT                   /translation="MQYIRLKIKDSVEFLWHSKSYLKSVFAIHALFIFILLPILGESSQ
FT                   FILKISQINYLSLNNLGTMMRQQPLVFLALISIVILSILLSFFEFAFLLISVYFIQTRQ
FT                   PVSVRQLLVITLRQLRKVGISTGLFFLFYLVLILPLGGVSYSSNLLSKVKIPAFLMDYI
FT                   FDHRFIVVGAFILVYILLTYIGVRLIFVLPNLILNDLSIGEAIKSSLTITRRKFVTILL
FT                   KLAAIGFGMLLFSSVSIAGLIGIQKLVEQYSHSYTVVSAAVIMTLLQIIILINIAITTV
FT                   GMFLVIIDFMSKNNVLSAIKKPDSLFSSAYRKNFANRLSAPLYIVLGIMSAVIVGGYNF
FT                   DYLKSVDISKPISVSHRGVSEKNGVQNSISAMNRTAQYHPDYVEMDVQLTKDNQFVVFH
FT                   DFNLKQLTSVNNTPENMNLNALTKLKVHENNQVQPIESFDDYLKAAKAIHQKLLIELKT
FT                   PNKDNTQLVARFMRKYQKDIQENDYMIQSLNFELIEDVKKIAPTVKAGYILPFNLIGPP
FT                   ISHSDFYTVEFSTVNKHFIQTAHNERKKVFVWTPNDKKSILRMMYFGADGVITDNMPAV
FT                   GRAMTDANHITYSDKLLYYVAGLG"
FT   CDS_pept        161648..162643
FT                   /transl_table=11
FT                   /gene="oppD"
FT                   /locus_tag="LEGAS_0178"
FT                   /product="oligopeptide transport ATP-binding protein OppD"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90826"
FT                   /protein_id="CBL90826.1"
FT                   /translation="MDGKLLEAENVSVDFRIDGQYQTAIHKINISIKHGEVVALVGESG
FT                   SGKSTFAMSVMGLHNSDQTRVTGSIKLNDNELIGLSERQFDAYRGVSVGMIFQDPLSSL
FT                   NPLMKIGDQIAEAITVHDKQSKKVKQRVQKLISDVGIVDVQRVSQQYPHELSGGMRQRV
FT                   MIAIALANEPDLIIADEPTTALDATIQAQILDLIKEIQQKKNAGILLITHDLGVVAEMA
FT                   DTVTVMYAGQIVEQARVADLFNHPKHPYTRSLLRADPSEVNSGDELYAIPGTVPALKDM
FT                   DHSKDLFLKRIPWLDKAEVEATVDEKLQKVSDEHYVRGNAWQNFEFLEDL"
FT   CDS_pept        162659..163648
FT                   /transl_table=11
FT                   /gene="oppF"
FT                   /locus_tag="LEGAS_0179"
FT                   /product="oligopeptide transport ATP-binding protein OppF"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90827"
FT                   /protein_id="CBL90827.1"
FT                   /translation="MSELVRIENLKVYYPIRTGFFNRVTDNIKAVDNISFTIESGQTYG
FT                   LVGESGSGKTTIGKSLVGLEDPTSGKILFEGHEVTTNRQKKAINYNKDVQMVFQDSQSS
FT                   LNPRKTIGEIIAEPLKNFGVPNVIGAGYDGERSFDQTKINERVLALLKIVGLPAQTVAQ
FT                   YPFQFSGGQRQRIGVARALATNPRLIVADEPVSALDLSVQAQVLNFMKKIQREYGISFL
FT                   FISHDLGVVKYMTDNIAIMHNGRFVEMGTTNDIFNDAQHIYTKRLLSAIPSLDVSKRDE
FT                   KRAYRKRIESEFTQNKGAYYQQDGLRDRAYDLEPITKTHYVALKKEGA"
FT   CDS_pept        163651..164616
FT                   /transl_table=11
FT                   /gene="oppB"
FT                   /locus_tag="LEGAS_0180"
FT                   /product="oligopeptide transport system permease protein
FT                   OppB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90828"
FT                   /protein_id="CBL90828.1"
FT                   /translation="MWRTILRRVLIMIPQLILVSILIFMLAQLMPGDPFYGSLNPNSDP
FT                   ATIARMRHAAGLDLPWYQQYVKWVGNVLHGDLGTSYVVNKGWTVTRIIGQRIWPTLSMG
FT                   IIAAVLTYVLSISQALLAARNENKIIDRILIVWNTMTSAVPSFVFYFVMMVLFVYIIPI
FT                   FPSSGTGIDDTQSFTTNFFSNLRYAFLPALTIALFSTNSIFQYLRSNLLDQQAQDYVRT
FT                   ARAKGVQIKDVFRKHILRNAFLPIASAIGYSITGILGGAIFAETVFGYPGLGALFVQAL
FT                   SGRDYTVITALMLLQGVLALLGGLLSDIISAWVDPRVRVK"
FT   CDS_pept        164629..165519
FT                   /transl_table=11
FT                   /gene="oppC"
FT                   /locus_tag="LEGAS_0181"
FT                   /product="Oligopeptide transport system permease protein
FT                   oppC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90829"
FT                   /protein_id="CBL90829.1"
FT                   /translation="MEIKKQRFGSKFIKNFWRELEKDNLALLATILLIVLFLFIIIGQI
FT                   FVPTDIGTMSNILSANLPPLTNGHILGTTNSGADFVLTLIASASNSLIIGFGVAILITI
FT                   ISVTFGMIIGYFGGWIDWIAMRLIDFWLVMPLLMILAIIFSTAKGLSIWSLILILAVLS
FT                   WPPNVRLIRTLTLSEVNRDYVQAAKISGTPWYKILFTGIFPNISSTVISDFALTLAGSI
FT                   GIETSLTYLGFGLKHGTSSLGTMLTVLSGSSASSVYTQWWLWIPVTLVLIILTFGIVVL
FT                   GQVARRAIDQRQSVS"
FT   CDS_pept        165654..167519
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="LEGAS_0182"
FT                   /product="oligopeptide binding protein OppA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90830"
FT                   /protein_id="CBL90830.1"
FT                   /translation="MVSTGKKIGFGVGGLVIVAGATWALVATTSNHTSTTKAVDVGSFK
FT                   GDYKNSKSAIKNGSLTVSYPGNASDPVSFAGYSELAQWSAAQEQLDPAGKNTLFYVDKD
FT                   GKLTNDGPAKVTVDKDAKTVTIKLRDDLKWSDGKDVTAQDVLFSLQTLATNKVASGNFT
FT                   QAYTAIKGLSDYQNGKAKDISGVKLDDGKAGKQLTVSYTTLPAAVDWGDGVPAYALPYH
FT                   DLKDVKSKDLATSEKVTKNPLSFGPFKVASVSSDSTVKYVKNSDYWGKKPKLNTITYYV
FT                   NQDQTKLENDLSKQKFDIVTKAPASLWKDGTNNPVLSKYNNDKGYASTGYYDSGYWELY
FT                   FNLGHLNSKTSENVQDRQTPLQDVNVRKAVGYAENVGDVVKKYGNGLSVTADTLVSKNE
FT                   SKKMFYNNNVQGYQQKSSGDIKKAGGLLEKSGYKKDSAGYYAKDGKRLSLVYLARSGNT
FT                   TSEASTKAYIEAWKKAGIEVKLYQDKLVDPSTWQSIVVDGNNNNWDITDGGWSEGTVPT
FT                   FDQLWSKSAPYNFGHVVSKELTQNLSDTQTATSEASLVKNIKQFQKLVVDEQAYTIPTT
FT                   TNIKVQLVNGRVTGWTTNFAAQQNDLYAQLGVSQSKPVTSGNPRK"
FT   CDS_pept        complement(167669..169129)
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="LEGAS_0183"
FT                   /product="glucose-6-phosphate 1-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90831"
FT                   /protein_id="CBL90831.1"
FT                   /translation="MVSEIKTLVTFFGGTGDLAKRKLYPSVFNLYKKGYLQEHFAIVGT
FT                   ARQDLTDEEFKQLVRESIADFTEDQDQAEAFIAHFSYRAHDVTDAASYAILKEAIEEAA
FT                   TKFDIDGNRIFYMSVAPRFFGTIAKYLKSEALLAPTGYNRLMIEKPFGTSYTTAEELQN
FT                   DLENAFSDDQLFRIDHYLGKEMVQNIAALRFGNPIFDAAWNKDYIKNVQVTLAEVLGVE
FT                   ERAGYYDTTGALLDMIQNHTMQIVGWLAMEKPDSFNDKDIRAAKNAAFNALKIYDEEEV
FT                   NKYFVRAQYGAGDSSDFKPYLEELDVPADSKNNTFIAGELQFDLPRWEGVPFYVRSGKR
FT                   LAAKQTRVDIVFKAGTFDFGTAQEAQESVLSILIDPKGGIEFKINSKSVEDSFNTRTID
FT                   LGWTISDEDKQNTPEPYERMIHDTMNGDGSNFADWNGVAIAWKFVDAISAVYTADKAPL
FT                   ETYKSGSMGPEASDKLLADNGDTWVFKG"
FT   CDS_pept        169235..169558
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90832"
FT                   /protein_id="CBL90832.1"
FT                   /translation="MLINDFNPKQQQILRQLDIGQYAGQTLIAHAPTKKDSKNYYVIHV
FT                   DLKTNHWRYQPDEPIKPVEVAELLKAGGLRTTTVRHQYVLNSAVFSKPIRRLFKKLLVD
FT                   KNI"
FT   CDS_pept        169659..170879
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0185"
FT                   /product="Multidrug transport protein, major facilitator
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90833"
FT                   /protein_id="CBL90833.1"
FT                   /translation="MQTNLADKPRQLNEKWLLLGTLLSSTGNSMIWPVMTLYITGVLNQ
FT                   SFTTAGVVLMIGAMVSLFGSFVGGKLFDHWRPYVAMVMTSIIILAAVASLIFFNKWPVF
FT                   AILIWIANFGMGVEQTLVNSFATTVPGQKTRVIFNNMYIVLNIGVVLGTLAVGYLFDYG
FT                   FSLLMMISTAIYFGLTLIIITKFNVSLDTDNLIDVRANDKEEQFNKPEVTRKKFKLTPV
FT                   LIAIGALLFITYLSYMLWETVMAPHMKTLGMPTRNYADLWMINGITIIVLQKFVSNWAN
FT                   KHPYHVSVILGSVIFALSFFFLIFVNTFWQIVLVFELLTLGEMLQSPQVPAWVAQITPK
FT                   EVAGQAQGFVSMMISSGRVVGPIYSGVMMDHGWTNMLFLSVFIVMIIITGLLALTMSRR
FT                   IDKNPVA"
FT   CDS_pept        171158..172519
FT                   /transl_table=11
FT                   /gene="nhaC"
FT                   /locus_tag="LEGAS_0186"
FT                   /product="Na /H antiporter NhaC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90834"
FT                   /protein_id="CBL90834.1"
FT                   /translation="MNNKLSTGTSVLLVVATITILAIGVIGFGLAPIAPILLAIGMIMI
FT                   VARFSGVSWQDSQKALIKGVESGLTPLFLFLLIGSLIALWLATGVIPTMIWVGFKVLTP
FT                   AFFLPTAFVTTSIIGTLIGSAFTTISTVGVALMGVGTLMGINPALVAGIILSGAIFGDK
FT                   NSPLSDSTNLASAISETDLFAHIKNLMWTTVPAWILTFIVTILLGFGHHVDAAATHQIT
FT                   ALLPQLEPTWWTIVPLGLLVVTAWFKMPAIPALMINVLVSSVMFLTQHAITTWAKLLVD
FT                   GFQTTSTNPTLMALLNRGGMSAMMTTIMMVMLALALGGLLSGLGILNRVMAPIVSHLRT
FT                   QRSIVLATLVTGIGANFLVGEQYLATILPGQLFKESFKKAKLSPLALGRTIEDSGTVIN
FT                   YLVPWGVAGSFAAQTLGVPVLEFAPFTLFALLSPIMSFLSAMTGIGLKQDNPDV"
FT   CDS_pept        172589..173038
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0187"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90835"
FT                   /protein_id="CBL90835.1"
FT                   /translation="MLIRDMVRAKPVSWLLFIIGSDIMMTYGLLLYHGVSHFSPARDYL
FT                   SIVKFVSFDLISFVFIMLFFDWVHVKFLSDGPENVIDKILRIGGNTMAAYFGWFTLGFI
FT                   ILQMTTNFQRQQFWLLTIVTGIVAILNWLLRHKSPIKFQLNPLIK"
FT   CDS_pept        173118..174926
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="LEGAS_0188"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90836"
FT                   /protein_id="CBL90836.1"
FT                   /translation="MQNLTPQTILKEKFGYDNFRTGQLDVIEKVLAHKHALAIMPTGGG
FT                   KSITYQLPAMLFDGITLVISPLISLMKDQVDGLDAMGIDATFLNSTLSGQVQAQRMSDL
FT                   RSGYYKMLYVSPERLEISSFFDFIQQLPIELVAIDEAHVMSQWGHDFRPSYLNILPLLA
FT                   KIPGNPAVLGLTATATDRVRQNLQQLLGVSDEDTILTGFARDNLALKIAHNVDKRQYVQ
FT                   EYLRENKDQSGIIYAATRKQVDELYEFLNKKGVKAGHYHAGLPERERQTMQEAFLFDEV
FT                   QVMVATNAFGMGINKPNVRFVIHYSVPGNIEAYYQEIGRAGRDGLPAEAVLLYAPQDIH
FT                   LQEFFVQKSEGTEEHKQNEYNKIREMNAFANTQSCLPRYLLGYFGEIVDHDCGHCSNCL
FT                   DAREMVDVTTDSQRVLANVVRMNQSFGKTMVAKVLKGSQDATVKKYDYLMKLPTYGLMK
FT                   DRTLKDLSSFIDYLTADGYLRIEGGEFPVLKVTETGARVLKGKLVVEKRVNRRVIAQQK
FT                   VTSAAKGLKLSESDNKLFAELKSKRLDLAREAGIPPFLIFSDKTLMNMAILRPQTDEEF
FT                   LAISGVGEKKFDIYHKDFASVIVNQH"
FT   CDS_pept        175241..176710
FT                   /transl_table=11
FT                   /gene="xynT"
FT                   /locus_tag="LEGAS_0189"
FT                   /product="xyloside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90837"
FT                   /protein_id="CBL90837.1"
FT                   /translation="MDVRVQKNDEFAKLSTWDRVSYGLGDFAQNLVFGTVGGFLLFYLT
FT                   NINGISAGVGATIFLVVRWINVIWDPWVGTVVDKAKITKNGKYRPFLINFGIPLVILAA
FT                   LLFLPVAKVLGAGTLATTIYATVSYMATALVYSFVNIPYGSLNASLTRDETEIGKLTST
FT                   RMMLANIGNLLVYTLFPLFVQLASPNAKLTDTGLFGLKLKLGNYAAPSAAGAWFKVYGV
FT                   YMILGAVLLFLTYRNTKERVLASEEATDQVKYTDLFAELKRNKALQILGLFFLVGFTLM
FT                   FFGNTVWPYFMQYNFGVEGGKSALMASIGLIGSIPGIFLVVIWPRLRATLGKKGFFYTF
FT                   LGIFVVGQLLLLAWSKNPSADWLGFTGRFLQQWGLTSATGFMWALVPEVVSNGEYISGK
FT                   RVAGIINAIMGLFFKIGLALGGIIPGYLLQFMNFKSGALTQSASAQTGIEWSMIWLPMI
FT                   MAFLAMFVISRYPLSDAYVDKMNHTLKEKNS"
FT   CDS_pept        176745..178433
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="LEGAS_0190"
FT                   /product="beta-xylosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90838"
FT                   /protein_id="CBL90838.1"
FT                   /translation="MQIQNPVLPGFNSDPSIIRVEDTYYIATSTFEWFPGVRIHASKDL
FT                   VHWNLVKNVLDTTAMLDMKGNPSSGGIWAPDLSYADGKFWLIFTDVKITDGNFKDMKNY
FT                   LTTAETIEGPWSEPVFVNGVGFDASLFHDEDGRKYLVQQTWDHREYHHPFDGITLTEFD
FT                   TNTMKLKPETARTIFSGTAVKLVEGPHLYKINGEYFLFAAEGGTIFTHQEVVARSKSLN
FT                   SMSFVVEPDGPFITNFDTPNSYLQKQGHGALVSTPGGEWYYASLTARPWNHDNESATDP
FT                   RGWSTLGRETSIQKVEWDDAGWPRVVGGHGGQTFVEAPQDAILTDAPVDHSQHDEFNDT
FT                   ILDINWNTLRVPFTEKMGSTGTGKLTLVGQGSLSNTFDLSLIARRWQAFYFDAETKVKF
FT                   NPYSYQSMAGLTNYYNHSHWSWIFITKNDDGQNVIEVGENKGGLRNGSYTSYLRDNAPV
FT                   IPEGIEYVYFKSENRKESYTYYYSFDSENWLSTGVTLDAAILSDDYVVREYGGFFTGAY
FT                   VGLAAVDYSGYDSTAEFDYFDYKELGDHKDINGTISWQKSESRFY"
FT   CDS_pept        178756..178893
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0191"
FT                   /product="conserved domain protein, possibly a psudogene"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90839"
FT                   /protein_id="CBL90839.1"
FT                   /translation="MVLELQNLPNSDIIPDFLDVTLKANKTRQKVITYQYHQSFKLERR
FT                   "
FT   CDS_pept        178903..180072
FT                   /transl_table=11
FT                   /gene="xylR"
FT                   /locus_tag="LEGAS_0192"
FT                   /product="xylose repressor, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90840"
FT                   /protein_id="CBL90840.1"
FT                   /translation="MNKSDQITMRDHNQRLVLQALFNAKETSRAKLAVDLNLHKSTISS
FT                   IYRDLDKLEFIEDLGEGVTTETGGRKAKMIRFNRNYGYVMSFDMGRHHLRVALVRLSGE
FT                   VILESSEAVDDMSVADVIALMGQHIKDNKHKKHGTKEGLMGIAVGIHGVVDNNHVVYSP
FT                   FFDYSQVDVAEKLEELSGVHVMLENEANSAAVYIRDYHDYLSTDQYDSLVALNIHYGIG
FT                   AGIIIQGQLYRGMQGRAGEVGRSIVAMADQEPVRVEDLYSEDAMLERLAALTGQPVANR
FT                   DAFVTFANQKSAVVTQLLDDWVMGVAQVAYNIIQTAAPQVLFIHSRFIAEMPELLGRVV
FT                   VAYQQMNPTNESEILFANRSVYEATLLGGAASVTRRILDLDNLDLKFTH"
FT   CDS_pept        180330..181676
FT                   /transl_table=11
FT                   /gene="xylA"
FT                   /locus_tag="LEGAS_0193"
FT                   /product="xylose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90841"
FT                   /protein_id="CBL90841.1"
FT                   /translation="MSELFSFPKVAFVGNQSLQAGDGYHYYNADEVVAGKKMSEWLKFS
FT                   VAYWHTMDQRLTDPFGEGTATRPWDIEGDPNTMAAALAKVDYLFEFLDKTGVEYFAFHD
FT                   RDLAPEGKTLAETNANLDQVIDKIEQKMQETGKKLLWNTSSLFTNRRFLAGGATTPFAE
FT                   VFAYVAGQIKHSLDIAKRLGSESYVFWGGREGYDFLVNTDTKRELDHIAAFFKLAKNYA
FT                   DEIGYTGQFLIEPKPKEPTQHQYDFDAQTTIAFLKTYSLEDTFKLNLEGNHAYLGGHTY
FT                   EHEVRFAREAGLLGSLDANMGDKLTGWDIDEFPNDVYEATLVMYEFLKNGGLPTGGLNF
FT                   DSKPRRQSFEFEDLFYAHIAGMDTYAAGLKVASKLIEDQVIENILKNRYASFDSGIGAD
FT                   FEAGKVTLKDLAAYAENKTDDEINATLQSGRQEQIKSTLNNYIFSVLGR"
FT   CDS_pept        181881..183392
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="LEGAS_0194"
FT                   /product="xylulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90842"
FT                   /protein_id="CBL90842.1"
FT                   /translation="MTQVVLGVDLGTSSVKVSAVDRQGQIVAQQSFDYPLTQPHPGWSE
FT                   QNPEDWVNGTTVAIVNLILKDGLNPADIAGISYSGQMHGLVLLDDNNQVLRPAILWNDT
FT                   RTTSQTQEIAEKMSEEFVAITRNLALEGFTLPKILWVKENEPEIFKQAKMFLLPKDYLR
FT                   YRMTGNLAMDYSDAAGTVALDVVHKVWSKAVQKTFDLPASFFPELIESTDFAGYISESY
FT                   ATFSGLHTSTKVFGGAADNAAGAVGAGLLNANMVMSSIGTSGVVAKFEDRADVDYKGDI
FT                   HFFNHAIPNKFYSMGVTLAAGDANAWFKSVFGEDIPFGDWVNEAAQSLVGANGLIFTPY
FT                   ISGERTPYPDADIRASFTGIDRTHQRADFIRAVLEGIIFSFKDIMMIYDREGANFDTVV
FT                   AIGGGAKSSLWLQIQADIFNKKVTTLVNEQGPGLGAAMLAATGLGWYDSVQDAANKIIK
FT                   FGTTYYPNPEAVANYDQVYAIYQTIYAATKEISHELLTYRRQLKH"
FT   tRNA            183487..183577
FT                   /locus_tag="LEGAS_R0001"
FT                   /product="tRNA-Ser"
FT   CDS_pept        184120..184530
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="LEGAS_0195"
FT                   /product="Arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90843"
FT                   /protein_id="CBL90843.1"
FT                   /translation="MKIYFLCTGNSCRSQIAEGFAKDIMPDDWIIKSAGTEQHGLNPLA
FT                   VDTMDEIGIDISNHTSDLIDENFLFSCDYAITLCGDANDKCPVTPASITRLHWPLVDPA
FT                   GIIGTKEVVKNQFRKTRDQIKSLVYELKSDIV"
FT   CDS_pept        complement(184612..185718)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0196"
FT                   /product="Cation transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90844"
FT                   /protein_id="CBL90844.1"
FT                   /translation="MPNLIKKILVDKTFLVTFILSIISLVAGNVRITDIDFKTIYSLAS
FT                   LLIIVAIYQDLGILKHIANYIVSKCHSSRSVFLVLLLCSFVGSMLFTNDVAILTLVPIF
FT                   FNIKKYINLPSIATISLLAIYANLGSSITPFGNPQNIYIVSFYKLSISQFLGMSLIIGS
FT                   IALVALFISCLFIDNEEVTTNFDNNQVIDRKKTTLLIVSSLVVLLGVLSVIPILFSLII
FT                   SILSGLFLSKKVFLHVDYAIILTFVNFFIIVGAVSKIALVHHLATITTQNSIATFISAC
FT                   ITSQFISNVPTAVLLSKFTDNVYPLFLGVSVGGLGTLIASLANLLALRQYSAYSQNHTN
FT                   FTFFKIFTFLNILFLSIFVLIGLLLLFL"
FT   CDS_pept        185954..186367
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0197"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90845"
FT                   /protein_id="CBL90845.1"
FT                   /translation="MMDKDTFSDFEREAMRERAEELRKTKNTEADVLDKISEMTDSEAQ
FT                   IAIEIHHLVKKIASELKPKTWYSMPAYANRNGKVVLFFQPATKFKARYSTLGFNDAATL
FT                   DEGDFWPVTFAIKQITPTIRQQISLLIEKSIQK"
FT   CDS_pept        186512..187477
FT                   /transl_table=11
FT                   /gene="napA"
FT                   /locus_tag="LEGAS_0198"
FT                   /product="Na /H antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90846"
FT                   /protein_id="CBL90846.1"
FT                   /translation="MSYIIIALLIVVTIIFGKIAPKLGFSEVVGQLLSGIILGSSVLNI
FT                   VHPTSLIHLLSEIGIFILMLNSGMESDIKEMRKYIKASTLIAIMGVIVPAVSFPIAFML
FT                   LGYTLKVSLFAGVVFSATSISITLAVLAEQKKLATPMGAIILSAAVLDDIIALIAVTLF
FT                   SVFIGGGALGVGSLLPLIAFAMGILLRKVSFSEQLAQGLNWMGSWLFYPIFFGSIGLGI
FT                   ALQDLNNKLLPIMLFSILAIITKFFGSLIGAKLSGLNKTVAQAIGAGMISRGEMALVIT
FT                   QIGISSHLIGDAASAEFIVAIIISTIVAPILMKPLFSKVN"
FT   CDS_pept        complement(187550..189037)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0199"
FT                   /product="M protein trans-acting positive regulator (MGA)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90847"
FT                   /protein_id="CBL90847.1"
FT                   /translation="MLINFLSKKKQRQLAILQSLFTNTTNGFPYLVKEFDITEVQLTHD
FT                   IEDINKTVQTIAHQKLVDTSNKHNYTVNIDDIHLYQQLEFHYLNDSLTFQICSEIITHR
FT                   HLPFNNLCDKLAISTSHCYRVLKQLNSILDQFNIVITIDQHTVPVFTGNEINIRVFIFS
FT                   FVKYCFPRTNWPFPTISRAETISDFNLLSPNNKLAPSFAEEITLLLAVMKIRLSKSYFA
FT                   EPMSEYVQTLLQKFVVSDYNTFKSLFFQKKMTDNNIIKVEFFYLNFFAHLLLPNLIEEN
FT                   HAISLGTIISHSHLSADIFVNKLTAKWQERFNLDLASDDLAKVKYFCLIFYVLAFHIHL
FT                   NIIEILKSDATFLNDKRTINTAAMHDIRSFLTTTLPTIGHNNPCRDLPQDFAIDYFSNL
FT                   FFFSTQTYKQQQVTIYMHFADYSVREFLKTKLKTIYTPLAVKTVDNINTADIILTDTFD
FT                   IIVPNKKCIVIRNVFNPQELQTMLTAIDNSLFLSAKR"
FT   CDS_pept        189486..190283
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0200"
FT                   /product="Extracellular
FT                   protein,gamma-D-glutamate-meso-diaminopimelate
FT                   muropeptidase (Putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90848"
FT                   /protein_id="CBL90848.1"
FT                   /translation="MKPSTIIKFVTAAAGTFAIAGVASVSADTITVKAGDTLNTIAAAN
FT                   STTVAELAKANNIQNTNLIFVGQQLVTSGSTNPNQTDTTGTYTVEAGDTLYRIAAAHDI
FT                   SVTDLANANNIKNVNYIAVGQVLTLVASDNNSNNDDNNTPNQNTSNWHDLAMSLVGTPY
FT                   VWGGKTPAGFDCSGFVAYVLNNSGRTSNFPSYTVYQEALVQQKSVSAAQAGDLLFWGGH
FT                   GETYHVGIYLGNNQFIAAPQPGDVVRVQTLYSGWMPSFAGSVD"
FT   CDS_pept        190619..192292
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0201"
FT                   /product="putative cell surface protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90849"
FT                   /protein_id="CBL90849.1"
FT                   /translation="MRGVRTARQNNWGKLNMKVSSRIISIRYFFGRVQTNGAFLKTMGV
FT                   IFLATFMINFNHITAHADTISQPPLNVKDGVLYGFSDDQTQHIGATVVVPNNVTSIANT
FT                   AFYNQGIGRVDFSAATKLKSIGDFAFAKNHLSTVNYPNLNDNNLGWYIFYDNDINVVTF
FT                   ADGVTHINDGAFAKNPNLTAVNLPSTITAIGDWSFAGDRLSTIDLTTIKHTNDLNVGSG
FT                   AFYGNQASRVAVLPNNELNNSGNRPIRWYGYETFGQNTGQANRIASQYALKHQNYSTGT
FT                   TGNINTADSFTYDSQNLSTITGVKSGITTLGKTIVIPDNVTKIADNAFKSLGIVAVDFS
FT                   KAVGLKQIGNFAFYDNQISNTLTLPNCLNTDISSIGWYAFASNNISKINWPNNGITALN
FT                   DFAFSSNQLTDINLPNTLQSIGDGTFLDNHIKDVELPSSLQRVGSGCFASNSFDQQRSI
FT                   VLTNAVNQMDSEKNLSAVLYPFGVTIAQSNSQIKNRFMEMPNGEWQYLDSSGLPLTGQQ
FT                   IIDGHKYYFNTDGTQVKGYSVTFKDGSVHQFDINSGDELN"
FT   CDS_pept        complement(192385..193383)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0202"
FT                   /product="UPF0324 membrane protein l"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90850"
FT                   /protein_id="CBL90850.1"
FT                   /translation="MRIKANMLNGIIATVILSIIAKVLAIWLPFLGAEAIAMLLGILLG
FT                   NTVLAGATWAPGIKWAEKFPIEIGIALMGLTVTLRTIEKLGINGLLFILIQMTLTIVIV
FT                   LWLGGRIFKVSKQSAMLMGAGNAVCGSSAIASVSPAIGATDDQRRTTVATVSLTGVVLL
FT                   LVIPVIGPYLVGNNNLLLGALVGGVVQSVGQVVGTAALINPTVVTYATLFKMLRIILLT
FT                   VVVLIFAKMAQKDDTNNQITTPSKGVKIPWFIIAFVILLCVNSFISLPHLINNSAKTIS
FT                   SFTGVVNLAGIGLNLKFATIKKSGGKFLTYGLVTGAVQVILAVILIHFLFN"
FT   CDS_pept        193503..194336
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0203"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90851"
FT                   /protein_id="CBL90851.1"
FT                   /translation="MMLKLIKTFIAVYETRSFSKAADQLFISQPTVSVHIKQLEEQLNV
FT                   KLFDRNGRMFLSPTLNARRFYQHATQLLDDWQEATASLDLTTENTRTSISIGASQTTAT
FT                   VLLPKIIAQLSKSTLNSMNLKVEMHNSEEILAGVLNKQFDLGFIEKPITNDFIVRHTLA
FT                   KDQLVLAGNLASDMWLVREKGSGVYHYMQQYFKQQNIVPEHFLTITNNDIIVKMLSENI
FT                   GKSIVSSQTLPKNMSFIKLPDSFNRDFYLINHQHNNRPEIQDFIVMVEKIAKTLL"
FT   CDS_pept        complement(194328..195494)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0204"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90852"
FT                   /protein_id="CBL90852.1"
FT                   /translation="MMDNSKRFLLIIGTAWMIDALDVALLSFIMPLLKTEWALNATQLG
FT                   VVAAITSAGMMVGALLCGRLSDVFGRKKVLIGTLILFSLSNLALVFAPNVTWFIIIRFI
FT                   TGIGLGGELPVAATIIADRYTGKKRSQMLVLSDSFWAYGWILASLIAFFVIPHFGWRIA
FT                   VMLTVIFASYALVLRKHLPPDPSVKNKPTTQPFQELLFPKNKRPFIMISIVWLIVMLTY
FT                   YGIFLWLPSVLVLRGFPIVNSIGYTLIMSIAQLPGYYLAAHLLSKINPKKLLITYLLGT
FT                   IASSLVFILSTSLPMVLLSGAFLSFFDLGAWGILIALTPSLFQTNIRGTAMGTAQSIGR
FT                   FGATIGPFLVGWLLDMKTGIAFIFSLFVALLLIAVIIINFGISEQPSQ"
FT   CDS_pept        complement(195561..196301)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0205"
FT                   /product="MutT/Nudix-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90853"
FT                   /protein_id="CBL90853.1"
FT                   /translation="MTHNLLEKPLITITNVIWSFDAQTHDIKLLLIKRSDSPFKDFWAL
FT                   PETWLRINESAHDATLRLVKEKLGLDLPDVHAEQLATFTDPSRSPEERALSLSYMTFLP
FT                   QQPLLNPGPGATDAQWFTLQKQKSGLFRFKNLDFVFTTLADDDYINHKNQMADKHLAFD
FT                   HNWILTVATKRIMNKLNYQPTILLILGPSFTLKMARHVFGVFGKTEPDNSNFLRNHQDL
FT                   LQPLGASIQNKPGRPAKQYRLLIN"
FT   CDS_pept        196593..197171
FT                   /transl_table=11
FT                   /gene="folT"
FT                   /locus_tag="LEGAS_0206"
FT                   /product="Substrate-specific component FolT of folate ECF
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90854"
FT                   /protein_id="CBL90854.1"
FT                   /translation="MAVQNTTPVKGTWSLPKLDVSQFVVLALLVGLDIVLGKLTVGTNV
FT                   LKISFVFVAMSLIAKWYGPVWTMMIATILDVVGATIINPSGTFFLGFTLSAITAGLIYA
FT                   LFYYNQVHVSWLRILGAVGLVTFVVNAGMNTLWLFIMYSQVHTWDSFVTLLIPRLIKSI
FT                   MMYPIQVIVTYAFLNNAAVKQATKKIFNK"
FT   CDS_pept        197256..197732
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90855"
FT                   /protein_id="CBL90855.1"
FT                   /translation="MTAWGALTDFFKQYKRFIGTSSRSAFNWMTWFWSIIYWIIAILIV
FT                   CVAGLGAFFGKHGASMTDETPLFGTIMLVAVISVILSIIIIVPNLALYARRLHDMGHSG
FT                   WWQLIVIIVNTILIGGAVFFGINENILYGIQTVISLGFNLWLSFGQTKFNNKYS"
FT   CDS_pept        complement(197773..198453)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0208"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90856"
FT                   /protein_id="CBL90856.1"
FT                   /translation="MYYIDGQFYQLGLKQKISFFVISLIVNSFGNGLSVASSMGSAPWT
FT                   ASAANLSNASGLPIGIFLAVVAITVAFLNMFLAMNFNWPRLIGNIIFGLSFSFLVSFFA
FT                   NYFVSIGIHSLAWWLRIPIDFFGIWTIGVAISIYQRVNWILHPLDDLTNILRFDYFHGN
FT                   ASTAQMSNFAAAIGLSIFAFIFSHQFVALGIGTVLSFFFQGRNIAWSDKHIFKHLVHGD
FT                   VRGN"
FT   CDS_pept        198617..199387
FT                   /transl_table=11
FT                   /gene="butA1"
FT                   /locus_tag="LEGAS_0209"
FT                   /product="acetoin(diacetyl) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90857"
FT                   /protein_id="CBL90857.1"
FT                   /translation="MSKVALVTGAGQGIGEAIAHRLVKDGFQVSLIGRHLEKVQRVAND
FT                   INANGGEAIAIRADVAKRDEVFEAVKATKEAFGDLNVIVNNAGVAPTTPIMAVTEDDMN
FT                   WTWGINVNGVVWGTQAATEAFKELGHGGKIINATSQAGVEGNENLTVYGSTKFAIRGIT
FT                   QTTAKELAQFGITVNAFAPGIVKTPMMWDIAHEVGQNAGKDDEWGMAQFSDGIALGRLS
FT                   EPEEIASVVSFLSSDDSNYVTGQTIIVDGGMVFH"
FT   CDS_pept        199510..200001
FT                   /transl_table=11
FT                   /gene="mesH"
FT                   /locus_tag="LEGAS_0210"
FT                   /product="Mesentericin B105 immunity protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90858"
FT                   /protein_id="CBL90858.1"
FT                   /translation="MAERYLKSEKIKYLFWGVITTLVYFLVRFLTMALLNQAMLPVLIA
FT                   QVVTVLFAFVVNKFFVFADNQSRHVVVQLIRFSVGRLFVAGIDFLLTYIMIERYSDLFI
FT                   RLLRLKTINFQTFPFELSWSWLHGWVYDSISFNAVIAVFVIQVIAIVVNYFISKFMIFD
FT                   "
FT   CDS_pept        complement(200113..201057)
FT                   /transl_table=11
FT                   /gene="citI"
FT                   /locus_tag="LEGAS_0211"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90859"
FT                   /protein_id="CBL90859.1"
FT                   /translation="MTDRALLSQISQDYYLNKLPFGDISKKYNISRYLINKYLNEAVKN
FT                   GIVKIEITENSHRNSQLEHILQDKFSNVNFYVVQDDINNITTSTHLSNFAAEFVGELLQ
FT                   TNNKVVGLTWGETIYSMIDSLKSTPLERVKFTQFLGENMKYNSTAGSIRMVERAAKKVS
FT                   GEFLTLPAPLYILNDIVRGGLYSEPSLQNTLALASHMDFLITGVGTIRSLDSIPIWHNN
FT                   LNGIFPSINVKSVVGMIFGRPYDINGRFLNQGDDKIVGLPVSQILQVPKRICLVRGKSK
FT                   YQAVIGALRGQLITDIILSEAMAYRILNEHTLK"
FT   CDS_pept        201318..202475
FT                   /transl_table=11
FT                   /gene="citM"
FT                   /locus_tag="LEGAS_0212"
FT                   /product="Oxaloacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90860"
FT                   /protein_id="CBL90860.1"
FT                   /translation="MVDMKEVLSIHEAHTGVLDIESQFDIKTPSALSEAYTPGVAGLAK
FT                   LIANDESKKNIYTMSGKLIPVITDGSAVLGLGNIGPAAGLPIVEGKALIYKNFANVNAL
FT                   PMALNQVSVDEFVNAIKAMAPSFAGIHLEDIGAPRVFEIERRLSEELDIPVYHDDQTGT
FT                   AIVVLAGLINAAKVVGKNLQQLKVLVNGIGAAGVATTKILLAVGLKNITLVDIDGVVRS
FT                   DNQKYNSYQRELTTQVNQSVGATLDEVIVNQDVFVGLSDANVLTDSQVRRMAKKPIIFA
FT                   LANPVPEISPEEAINAGAAVVATGSSQWPNQVNNVLVFPGLFKGLLSSGLKHVDMPLQI
FT                   RVAHALADMIENPDATHVVPGVFGKGNVHAVEQSILDYAKQLSGN"
FT   CDS_pept        202480..203541
FT                   /transl_table=11
FT                   /gene="citC"
FT                   /locus_tag="LEGAS_0213"
FT                   /product="citrate lyase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90861"
FT                   /protein_id="CBL90861.1"
FT                   /translation="MTSTVQDIYMSNATQKKNWQAFLIKLGITQFDDQELDVIEQTIGI
FT                   YDGDQLVATGSIAGNIIKYVGTCVIGEMIKGARFNQLMTVLENRMALLGRFHQFVYTKP
FT                   LYVQSFEHIGFKLLANSNEGALLEKGAPDVQDFLNTIPKAPQGVQKIGSVVVNANPFTI
FT                   GHRYLIEKAASENNLVYVFVVNQDVSLFHTDERFELVKQGVKDLKNVVVVAGGDYIISY
FT                   LTFPSYFITNTQQVIDYQTTIDARIFKNIIALSLSIQTRYVGSEPLSYTTSLYNQTLVR
FT                   ELKPEINVIIVPRIAQYNQTEIISARKVRQAIADDDFETWSEIVPETTKKFISQHLAEL
FT                   QMRIRKGQKINGN"
FT   CDS_pept        203531..203824
FT                   /transl_table=11
FT                   /gene="citD"
FT                   /locus_tag="LEGAS_0214"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90862"
FT                   /protein_id="CBL90862.1"
FT                   /translation="MEIKKTAIAGTLESSDVQIMLTPGTDGIVFDLVSDVAKQFDEAIK
FT                   ETINQVLSEYDVQNAIVKVVDKGALDMVIKARTVAVVQRALDIIDEPKWEVL"
FT   CDS_pept        203824..204735
FT                   /transl_table=11
FT                   /gene="citE"
FT                   /locus_tag="LEGAS_0215"
FT                   /product="citrate lyase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90863"
FT                   /protein_id="CBL90863.1"
FT                   /translation="MAIEEKLRRTMMFVPGNNPAMVKDAGIFGADSIMFDLEDAVSLSE
FT                   KDAARYLVYEALKTVDYGRSELVVRINGLDTPFYRNDIKAMVKAGIDVIRLPKVETADM
FT                   IRDLEGLVAEAEIEFGREIGTTHLMAAIESARGVVNANEIARSSERMIGIALSAEDYTT
FT                   DMKTHRYPDGQELLYARNVILHAARAAGIAAFDTVFTDLNDEAGFKRETELIHQLGFDG
FT                   KSLINPRQIDMVNQVYQPLKKEIIVAQNVIAAIENAKQKGSGVISMNGQMVDRPVVLRA
FT                   ERVMRLAKANNLVDEEGNYIEK"
FT   CDS_pept        204725..206260
FT                   /transl_table=11
FT                   /gene="citF"
FT                   /locus_tag="LEGAS_0216"
FT                   /product="citrate lyase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90864"
FT                   /protein_id="CBL90864.1"
FT                   /translation="MKNKVERDIPDDILKQSDSQIFRGVDYGQPTIQRVAPKVKATTGQ
FT                   NKILDSVDEVVTQTVRDGMTISFHHHFREGDYVFNKIMRSIIDHGYKNLTLAPSSLTNV
FT                   MNDIVVEAIQKGVVTDITSSGMRGSLGDAVSHGILKNPVIFRSHGNRARAIESGDIKID
FT                   VAFLGVPNTDDMGNANGMNGVAAFGSLGYALIDAQYAHTLVLITDNIKPYPNTPASIKQ
FT                   TQVDYIVQVDEVGNPDKIGSGATRFTKDPKELKIAKTVNDVIVNSEYFKNGFSFQTGSG
FT                   GAALAVTRFLRTAMIEKNIKAAFALGGITKPTVDLLNEGLVAKVMDVQDFDKGAAESMK
FT                   DNPYQQEIDASWYADPANKGAMVDKLDVAILSALEIDTKFNVNVMSGSDGIIRGAIGGH
FT                   QDAAMAKLTIISAPLVRGRIATIVPEVTTVITPGDSIDVIVTEVGIAINPKRQDLMAQL
FT                   KNVPGLPLYTIEALQEKAAKIVGTPKPLQFTDRVVAVAEYRDGTLIDVIKQVK"
FT   CDS_pept        206325..207722
FT                   /transl_table=11
FT                   /gene="citXG"
FT                   /locus_tag="LEGAS_0217"
FT                   /product="CitXG protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90865"
FT                   /protein_id="CBL90865.1"
FT                   /translation="MNVFENGRSIDLMSVLDNKEWRSHYQERLKIKYPTAIIVSIKLNI
FT                   PGPIKSSPLLKDSYNFGLRDIKQYLKQFKIVYERFFIENTTGPEGFLAVLGDLKAVKLA
FT                   TISFEETSPIGRLFDIDIMAEQNEQQLSRRSLGYRARTCFICDKDAKTCIKQGVHTLES
FT                   GYDAINKICTIYMKKQITISKQSQDQIVRAAMTALLYEVSLNPKPGLVDPVSNGAHSDM
FT                   TVFTFIDSSLSLQQYFNEAYAISHDFSGDDLTVMFETLRQLGVRAEAKMCGATHGVNTH
FT                   KGAIFSLGILISAIAYGTKIGGVTVNDLQKIITKMTVNLVQHDFKNLYKKKQKLTAGEQ
FT                   QYQQYRLPGIRGEAAAGFPIVMDMALPFLLKSVGSTSQRLLDTLMKIASSIVDTNLIKR
FT                   AGSPDILTELKQWSATYFELGGSQTSAGITYLKKLDVEFVQRHLSIGGTADNLISTVFL
FT                   ARLVGGI"
FT   CDS_pept        207719..208507
FT                   /transl_table=11
FT                   /gene="citR"
FT                   /locus_tag="LEGAS_0218"
FT                   /product="CitR protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90866"
FT                   /protein_id="CBL90866.1"
FT                   /translation="MTSFITSDKVKLSYTDQGDGQAVILLTGYAGVKEEWYYQSACLLE
FT                   LGFRVIALDWRCHGASTHTAKNLKIMRLAADLHELILNLKLRGVRLIGHSMGGSVIWAY
FT                   TVLFGYQNIDCIIIIDESPKLFNDEGWSGGLVNLKWDNLLMISEQIPFLKMNKQPIDNE
FT                   LRVILNGVKKLNPFDFDLGHELLIDHLLQDWCQVVRDIKVPQLFVKGACTSIWGKGYLD
FT                   YCEQLNNEFTTLVTLNNVGHMPQVEDYKSFNSNIISFIKG"
FT   CDS_pept        208615..209940
FT                   /transl_table=11
FT                   /gene="citP"
FT                   /locus_tag="LEGAS_0219"
FT                   /product="citrate permease P"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90867"
FT                   /protein_id="CBL90867.1"
FT                   /translation="MLDNNDSKNTMHNWRSRLAKMDAIQISGIGLVAYILMAILLVVAI
FT                   QTHTLPNTMIGAILVLVLMGHIFYYLGAHLPIFKSYLGGGSVFTILATAILVTTGIMPQ
FT                   SVVHTASGFINGMDFLGLYIVSLIGSSIFKMNRKMLLSAAIRFLPVAFISMAITFFGVG
FT                   LMGMLIGEGFAHAVLYISLPIMAGGVGAGIVPLSGIYAHAFGRPAAAILSQLFPAVIFG
FT                   NLLAIISAGLVSKIFMTSKYNGHGELLHSKNSSEKVAKELKPDYIQMGVGLVISVSFFV
FT                   FGTMLSALFPNINAYAFIILTIVLIKALGLLPVYYEESVIMFGQLVVKNMTHALLAGVG
FT                   LSLLNIKLLLSALSWQFVVLCVTSIIIISLASAFLGKMFGLYPVESVITAGLANNSMGG
FT                   TGNVAVLAASNRMHLIAFAQMGNRIGGALVLVIAGILVSFMR"
FT   CDS_pept        210200..212902
FT                   /transl_table=11
FT                   /gene="adhE"
FT                   /locus_tag="LEGAS_0220"
FT                   /product="Aldehyde-alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90868"
FT                   /protein_id="CBL90868.1"
FT                   /translation="MADTIVKKPVKKVLTPEEKAELQIQAEAMTAALVEKSKIALATFS
FT                   TYTQKQVDKIVAAMALAGSENSLVLAHAAYDETGRGVVEDKDTKNRFASESVYNAIKFD
FT                   KTVGVISEDKIQGKVELAAPLGVLAGIVPTTNPTSTTIFKSMLTAKTRNTIIFAFHPQA
FT                   QKSSALAAKIVYDAAVKAGAPENFIQWIEKPSLYGTSALIQNHSIASILATGGPAMVNA
FT                   ALKSGNPSMGVGAGNGAIYLDATVDTDRAVSDLLLSKRFDNGMICATENSAVIQAPIYD
FT                   EVLQKMQDQGAYLVPKKDYKKIADYVFKPNAEGFGIAGPVAGMSGRWIAEQAGVKIPEG
FT                   KDVLLFELDQKNIGEALSSEKLSPLLSIYKVEKREEAIKTVQSLLNYQGAGHNAAIQIG
FT                   SQDDPFIKEYADAIGASRILVNQPDSIGGVGDIYTDAMRPSLTLGTGSWGKNSLSHNLS
FT                   TYDLLNIKTVARRRNRPQWIRLPKEVYYEANAITYLQELPSIKRAFIVADPGMVQFGFV
FT                   GKVLSQLELRQEQVETNIYGSVKPDPTLSQAVDIARQMAAFKPDTVILLGGGSALDAGK
FT                   IARFLYEYSTRHEGILEDEDGIKELFMELQQKFMDIRKRIVKFYHARLTQMVAIPTTSG
FT                   TGSEVTPFAVITDDQTHVKYPLADYELTPEVAIVDPEFVMTVPKRTVAFSGLDALSHAF
FT                   ESYVSVMASEFTRPWALQAIKLIFDNLTTSYQYDPKNPTKEGQNARTKMHYASTLAGMS
FT                   FANAFLGINHSLAHKTGGEFGLPHGLAIAIAMPHVIKFNAVTGNVKRTPYPRYETYTAQ
FT                   KDYADIARYLGLKGNTDAEMVDALIAAVKTLAKSVEVDQTLTGNGVKKADLESNIDQLT
FT                   DLVYNDQCTPGNPRQPSLEEIKQLLRDQL"
FT   CDS_pept        213022..215382
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0221"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90869"
FT                   /protein_id="CBL90869.1"
FT                   /translation="MKFWKSAEWQRIGKLRGLKLLLIGITLIPSIYAVIFLSSLWDAYG
FT                   NVSHLPVAVVNQDKAAKINGKTQHLGSDLSDKLIKDQPLKISEVSYKKAQDGLKQGKYY
FT                   MTITIPSDFTSNAGTLLSGKPNASKITIAHNAGQSFIAEKMTSSAAAKIQTSVTKSLQK
FT                   VYNETILSATKSSQKGLQAGANGANQLNNGLGQLADGTKKLNDGASSLTSGSSTLAGGL
FT                   NQYTNGVSQANNGSNQLTSGANSAANGANQLASGTSQLAKNAPQLEAGSQQLATGAQEL
FT                   SKKLQEVSDSITKGQQDKQTVDKLNQLENLMTELTTAVNKIQIPNSTIDTDAMTQAGTD
FT                   LQSGVQGAGIDAQKINDLAKNPKFQAFMATNPDIAQQFGQTASDLKGNLEKSGQAATTL
FT                   QGQLGQIRDLLPQLTRLQSVLPNLKAGLAAAQTGNKQAIDQLNGSLTQISQLLAQQFVP
FT                   AANQLASGAATLNAGQKQVTVASSQLNNGASQLASGNSQLAIGANQLNNGLGQLHNKSG
FT                   ALNSGASQLNSGAQQLTTGTSQAMSALGQAQNGAQTLASKMADGAVKLEAVHGNKDNVN
FT                   ALTNPVKSAQTNLSTVQNNGTGMAPYMMSVGLFVGMITLSTIYDFMTVAKKPRSGIAWW
FT                   ADKQTVNFPVWIGQALVMTTLLVLIDGLNAARPVMVFVVALVAAFSFNQLVLFFNVLFG
FT                   KLGSGIMLVLMVLQLSASAGSYPIELSNEFFRTIHPWVPMTYSVHAFRETISIGGSVAN
FT                   DLTILLIIGLVSMVLTWGVYHWKLRHNQMIWSA"
FT   CDS_pept        215414..215920
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0222"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90870"
FT                   /protein_id="CBL90870.1"
FT                   /translation="MKMSHAVEQSLVVLVMLALQKDDLPVKSYLLSDRLEVSESYLKKT
FT                   MRKLVVAGIVQAIASKEGGFRLARPISKITLLDVYQAIEGIGSFIHSTQLADRIFLSQQ
FT                   SNKRIEDVQQALEVATNDVLTVFNEAEQDFKNRLQNYTIAKLLGHINVDGFDKIDWRQV
FT                   HFTVN"
FT   CDS_pept        216070..216525
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0223"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90871"
FT                   /protein_id="CBL90871.1"
FT                   /translation="MVQEELLYDELCLSVYNTNRYFHRLYDRVLDQYDLSYLQYMSLLI
FT                   IHQRDALKMMDIGTVLELSSNTLTPVIDKLVQKGWVLKVQSVTDKRVKVLAMADDKQQL
FT                   FQKILGEIDDIRDALLQRSGRPLADVLRENQALNHVLESMLAEKEEK"
FT   CDS_pept        216526..217866
FT                   /transl_table=11
FT                   /gene="gshR2"
FT                   /locus_tag="LEGAS_0224"
FT                   /product="glutathione reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90872"
FT                   /protein_id="CBL90872.1"
FT                   /translation="MMYDVIFIGSGHAAWHGAQTLARAGKKVALVEENKVAGTCTNFGC
FT                   NAKILLDGPAEMIHHLNHYHGIGINETPDIVWPELMAYKHEVIDPLSDGLAHMLSVDGI
FT                   DIISGHAKFVDANTVKVTGESYTAEQFVIATGQRPAKLPITGAELTHDSTDFLDLPDMP
FT                   KSMVFIGAGYIAMEFASIAHAAGSKVTLIEYGNRALNGFDADYAQTVVADMTEKGITFA
FT                   FNHAVSEVSQLENGQYLVTTAQGDTYQVDYVMDTTGRVANISDLGLNEIGVDSDRQGVL
FT                   VDNHLQTTVANIYASGDVISKSIARLTPTATFESHYIARVLLGDQTPITYPVVPTVAFT
FT                   LPRVAQVGVTTAEADKRPDLTIIEIPYGQMMRFQTLNDVHAAIKIVINQDKQLVGAALI
FT                   GDFAPEVINALVPVINKQYTSDDIKSQVFAFPTHTGVVLPMIANYLS"
FT   CDS_pept        217885..218841
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0225"
FT                   /product="Putative zinc-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90873"
FT                   /protein_id="CBL90873.1"
FT                   /translation="MKAAVIHQYGDSSQLEVSDIAVPAIKADEVLVENMATSINPIDYK
FT                   ARQGLLQGMFQWQFPVVLGWDIAGRIIAVGDDVHDFHVGDAIFARPDIDPIGKNGTYAE
FT                   YTAVKADKLARKPDNISFEAAAAVPLAGLTALQILRQLQVKAGQKVLIQAGAGGVGIYA
FT                   IQLAKKLGAYVATTASQSNRDFVTSLGADRVIDYHQGTIAEVLSDYDAVFDMVGDIDNG
FT                   IAILKPGGHFVTISATLTEAQKQTANKTVSEGWLETNGQDLAILADAITDGTLEIVVDS
FT                   VYPLTTDGIRAAHERSETHHARGKIVVKVKVTELEGE"
FT   CDS_pept        218842..219201
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0226"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90874"
FT                   /protein_id="CBL90874.1"
FT                   /translation="MFAYIITGLVAIEAIVIMVVEMFGSSKQQAEAFELEESFVKIPEV
FT                   KSLLGNQGVYNGLFGALIFATMFLLTGPQQILMLQLEMLFILIAAIYGSLTAARKIILV
FT                   QGLPAAIALLVLYLK"
FT   CDS_pept        220615..224301
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0227"
FT                   /product="levansucrase/Inulosucrase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90875"
FT                   /protein_id="CBL90875.1"
FT                   /translation="MKENISRKKLYKSGKVWVTAATVSAIIGMVGGATTKVSADTVAAK
FT                   VDNNVKIVTKMEPITKNSVKAGETDKAVADTTKAGETDKAVADTTKAGETDKAVADTTK
FT                   AGETDKAVADTTKAGETDKAVADTTKAGETDKAVVNTTKAAETDKIADELNIKSQKSKL
FT                   TDLGNKLLLDAAIDNQTLQNLTDQQITALNAAALKYYDNPNKKADINAITYKHFDDLIN
FT                   QLNEQPVSLAVPKFNSGNIKNLPAVTTKSAQTGEVANLDIWDSWMVQDAKTQRVAEIKG
FT                   SQVMFALAGLPSNPSDTHLYMLSAPYKATALSDWKMIGPVFGYEAVPWNQEWSGSATLN
FT                   DNESIQLFYTRVQWNNDLRQNMQKLHTVNIIVKEDKNKTLYIEGIKNDHLIFEGDGTNY
FT                   QQIEQTFNVDRDNFTLRDPHVIEGDGTRYLAFESNTGTDKNSGYDNITDLSNYGGSLNY
FT                   NVIKLLEVSGNEETSRVASLANGALGLVRLTNVQDNPTVDHVYSPLITSNIVTDEIERA
FT                   NIVPMNGKYYLFTDTRVSKSSLESSGRRTNVSDIAMLGYVSDTIFGSYKPLNGNGAVLL
FT                   GNTDYGDRTDTYSYYAVPVNGYSDRLLVTSYMSNRNYAAGKNLNATTAPSFIIKINDND
FT                   TTSVEQTITTQNDWVDPYNAIDSAMYGFPGQNVNFKKYINSSFRKDGMYLNAPYGANVT
FT                   NEQGYNLNPINVGNTTQYNGENVIITKQYVTSDTVTWYLTSLNNQSVWIDSRAFTSVPL
FT                   KVTDMMSFVTYDGRKDGMYINAPYGMENAQYVGQINNYNGTAFVIKAQYNTRGVTWNLL
FT                   QVNGQEVWIDNRSFATNFTREVNNRMFVNSANRTDGLYINGTYGQGNALWVGNTKKYNS
FT                   QIATVTKQYYDDKGIVWNQVMLGGQTVWVDNRAFTQLQTQDIKQQLYINSNQRTDSLYA
FT                   NMPYRGDGSRWVDRTTSFNGQRVDAIKQGKDAYGVTWNLIKLNGQELWVDKNALTTTYT
FT                   QNLNMNMYVNSSQRTDGLYISAPYGVKNAKWIGNTKSVNGQYVKISQQYANEFGITFYL
FT                   VNLHGQNTWIDNRAFSATFDQIVALNATINTRQRADGMYLNSSYGETNSKYTGNVSQYN
FT                   NQKVTVTKEHSDTKGVVWYLANVNNQQVWIDKRSFSPIVTRSVAYSATITLRASSDGMY
FT                   LNAPYGETNSKFFDKTSNNRYKNTKVQVTEEYTNLKGVVWNLIKLNGNDGQQVWIDQRA
FT                   LKV"
FT   CDS_pept        224503..225750
FT                   /transl_table=11
FT                   /gene="clcA2"
FT                   /locus_tag="LEGAS_0228"
FT                   /product="Chloride channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90876"
FT                   /protein_id="CBL90876.1"
FT                   /translation="MAFNQYKENIVLAVSTVVLGVIVGLSSLLLSLFLEVIEHFFLHYE
FT                   ETAKFPAPVGATPIDRLLSVAVGGVIAAVIWWFLRTKTTPTISIKRALAGERMPFWQTV
FT                   VHVVTQIFYVGTGGSVGRELAPREAGALLAQKWEDLCDRYHVPKLTAEDKRLLITAAAG
FT                   AGFAGIYIAPITGMFFSVEVLFKKLTLRTVGVSLTMSIIAMFVGSLVKGFKPYYILTDV
FT                   KFSLVSFVFVLILAPLSGLAGSWFRKFFQWAEKHQTKDNHILWQLPVAAILTGIVAYFF
FT                   PEIMGNGRSLAQLAINSHQLTMLVILVVGALLKVVVTVLTIRAGASGGTLTPSIAVGGA
FT                   LGAVLSLILAIWIPGMSIGQGAILGAGTLLAASQQAPFMAMFMLIEICHLESSALLPMG
FT                   FGILIATAVSKKILSD"
FT   CDS_pept        225968..226366
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0229"
FT                   /product="Transcriptional regulator, helix-turn-helix
FT                   XRE-family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90877"
FT                   /protein_id="CBL90877.1"
FT                   /translation="MANVLPNQLKKYRSDLNMSQEDVADKLFVSRQAVSRWESGDATPD
FT                   LTNLIKLTEIFKCSLDSLVLGIEETPSKSGTPEIDSSEFTFDPRRGEYVRRRKNMNFWD
FT                   FAASYWWLIFPVGGFLSWIIPEIVGVFR"
FT   CDS_pept        complement(226412..226744)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0230"
FT                   /product="Lactoylglutathione lyase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90878"
FT                   /protein_id="CBL90878.1"
FT                   /translation="MKPRKLNIKIIPATDINRAYRFWRDVFDLPQSGHESGRHLVLDGE
FT                   DITFVNGKPTDTLEILVRDHQEELLKHLRNNFITIVGNPEERFGNKIAFQINDSEGNTI
FT                   ILEANK"
FT   CDS_pept        226845..228401
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0231"
FT                   /product="Putative drug resistance ABC transporter, two
FT                   ATP-binding subunits."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90879"
FT                   /protein_id="CBL90879.1"
FT                   /translation="MALLEISGLSMAYAEKTLYEDAAFELQQGEHMGIVGQNGAGKSTL
FT                   IKIVTGQELPLSGKIEWQKGLKIGYLDQYAEIPDGMNLIAFLHTAYQDLYDKQDRITDL
FT                   YNEYAESMNDKLLERAGRMQEELDAAGFYDVDTKIERVISGLGLEAIGRDRELDQMSGG
FT                   QRAKVILAKLLLENDDVIILDEPTNYLDVAHIEWLEDFLQNYEGSAMIISHDFDFLDKV
FT                   TNAIIDLSFGKITKFRGSFKKAMRQKDERSEQQLRQYEKQQGEIEKAQKFIAKNKARAS
FT                   TSKQAKSREKMLARMDKVDPPSEALQAKFNFPYVNSQSANALAVNNLSVGYVTPVLEPV
FT                   TFSITTGQKLVFKGFNGAGKSTLIKSILGVIPALHGEAEFSPSAVVNYFDQDLEWDDDT
FT                   KTPLREMQDRFPKLEPKALRTRLAAAGINAENAQKQMQLLSGGEQTKVKLAIMEMKPSN
FT                   FLILDEPTNHLDEGTKNALRSAIDKFPGNVIIVSHEVSFTKGLGDRELNVAALSFKKES
FT                   E"
FT   CDS_pept        228534..229514
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="LEGAS_0232"
FT                   /product="Biotin operon repressor /
FT                   Biotin--[acetyl-CoA-carboxylase] synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90880"
FT                   /protein_id="CBL90880.1"
FT                   /translation="MKTDERILHFFAEHEGEYLSGETLAKNLDISRAAVWKVIKKLTEQ
FT                   GHTIDSQHHVGYRYQSGKVLSVPMIRQLAHSDWQIKLFDVIDSTNTYAKEALTRGDITK
FT                   PTMIIANQQIGGRGRLGRTFVSPADTGLYISFALPLPVGTSVVPGLLTTGTAVAVSRAI
FT                   KKTIGIELDFKWVNDLLFKNRKVGGILTEAVMDFESQQVSAIVVGIGLNLQQPQNLDAT
FT                   LTNKVGGMVEHLTVSRNVIVATLFDEFVKLYAEYTDGSFLKAYRQRNIVINQTVTVKYG
FT                   KELVTGIAKAIDEQGQLLVDTGDVIRTINSGEVLKVQLPNNSYHG"
FT   CDS_pept        229543..230079
FT                   /transl_table=11
FT                   /gene="bioY1"
FT                   /locus_tag="LEGAS_0233"
FT                   /product="BioY, a putative biotin permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90881"
FT                   /protein_id="CBL90881.1"
FT                   /translation="MNSNTQRIVITAVLTALLIAVGPLAVNIGPIPMTLQTLIIALVAS
FT                   VSSTRVSLTAIGLYLLLGAFGLPVFAGFKGGFVLLAGPTAGYLWSFLLFAPIIGLSFKR
FT                   WNNVWGLIVTNILASVVNLTIGTIWLIISMQLPVEAGIAAGITPFILSSTLKITVVVIV
FT                   ALAIRQVQARTALAF"
FT   CDS_pept        230333..230635
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0234"
FT                   /product="Putative Phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90882"
FT                   /protein_id="CBL90882.1"
FT                   /translation="MLRSVLIFPQLNDMFTINRIRQRYDDLYEHIAPHISLVFPFDNEL
FT                   TDETIIQVVADIIKKQQQFKLRLTATITEVAIEHILENSDSAVFTTICLGERDEN"
FT   CDS_pept        230625..231089
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0235"
FT                   /product="putative DNA topology modulation kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90883"
FT                   /protein_id="CBL90883.1"
FT                   /translation="MKIRIIGPVGSGKTTFAHKIARIKPYPVTSLDDLNWVRQATGDRH
FT                   RTPSERQALLQVIIQQNDWIIEGAQFREGQDCFALADVIYVLDLPYYKNVYYILKRWFN
FT                   NRLHGGSKQYRNLWLFLKWQNKWRTNNRDDVYRLLKPYHKKVIIIRKNKV"
FT   CDS_pept        231371..232483
FT                   /transl_table=11
FT                   /gene="alr1"
FT                   /locus_tag="LEGAS_0236"
FT                   /product="alanine racemase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90884"
FT                   /protein_id="CBL90884.1"
FT                   /translation="MVEAITRPTQIEISKKALKHNVAVVKQTSGADKIFLAVKSNAYGL
FT                   GLVPTSKAAVAGGVYGLAVAVIDEALALRHERITEPILVLGISQAKYAELMAVQHIMAT
FT                   VVSLSWLKEAAQSLTGEQRLQVSLGVDTGMGRIGFRTRESLAQAITYLQAHKDIFDYVG
FT                   LATHFAESDSVQTDYFYMQLKRWHDITDGLPEPKYYHVANSGAAMYHADEVPHEVIRVG
FT                   TVLYGVEPSRGELADGKNLQPVMSLRSEMNFVKQLPAGEGISYSHKYTTSSDEWIGTVP
FT                   IGYGDGWLRKMSGFSVIVDGQYAPIVGQVAMDQLMIKLPHEYPVGTKVTLIGKDGDLEN
FT                   TLEDVAQHANLAPWEIMTGMQDRVHRILVD"
FT   CDS_pept        232536..233630
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="LEGAS_0237"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90885"
FT                   /protein_id="CBL90885.1"
FT                   /translation="MTERTYNIAILGATGAVGTRLMSQLEESTIPVNSLKLLASSRSAG
FT                   KKLTFKGQELTVEEATADSFSGVDLVLASGGGSVSQRFAPEAVKRGAVVVDNSSYWRMN
FT                   DNVPLVVPEVNEADLQGHNGIIANPNCSTTQMVVALEPIRRAFGLRRVIVSTYQAASGA
FT                   GQTAWDELVAQTEAHNAGEKMVANILPVKGSDKHYPLAYNLLPQIDVFEDDGYTHEEWK
FT                   MIHETKKIMFGDKNSKSVKVTGTAVRVPVPVGHGETVYFETESNTGATSAGIQQALSQA
FT                   PGVILEDNPKKQLYPQPINAEGKRETFVGRVRPDLENDDSFHMWVVSDNLLKGAAWNTV
FT                   QIAERLVELDLVRVPVGAAGKFEA"
FT   CDS_pept        233651..234601
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0238"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90886"
FT                   /protein_id="CBL90886.1"
FT                   /translation="MEIFLFLTIIVLGILLYYQVQQNPATMRIGTLGVFIVIGVVIFMY
FT                   HFLNVTPKVLKLTVHIGYSMAVFFGILLLLSMVRHSWKKSHQWGLPLLVGVYLMCLLLF
FT                   SQWSLWWLSAPWLMLYFVWQFCRFIVSSVIYGYQSKAPTRGPLVVLGGGLAEGYRVGNI
FT                   VDKRIQAAVTDANKMSEYPMIVFSGGQGEDQLISEAEAMRDWSVSRYDVPFEKTQLEKR
FT                   SRNTYQNLKYTSQLLSQQPFTFYTSGYHVFRGVLLAKKQNIDAQGRGGFVPLFYRIPAF
FT                   FREFAGVMSMNIRRQILWALVWGIIAFVINQIMTY"
FT   CDS_pept        234697..236475
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0239"
FT                   /product="ABC transporter, ATP-binding and permease
FT                   protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90887"
FT                   /protein_id="CBL90887.1"
FT                   /translation="MNIFGKLMWFFRQNKRLYIVGLFFLFLTEISQMVSPALIGRFTDQ
FT                   VVSRTLTVENLVFYAGGIFLFALLMYVFRYAWITHIFQGSALLEKTLRQQLFDHYMKMD
FT                   TTFYQRHRTGDLMAHATNDLSAIQRVASGGILMLVDSVVVIIFTVISMVIVVDWRLTLI
FT                   GVLPLPLLVLGVRYLSPKMRQAFTSAQEAFSRLSNKSQESIAGVKAIKTLGQEMADVAV
FT                   FESQVKDTIQINKRVALIDSLFGPMATVIMTISFVIMMTYGGSLVLNDQITIGQLVSFS
FT                   TYLGLLVWPMFGLGQLFNVLERGNASYIRVQNILSEKSAIIEDEEGVVEQAKGDLNINI
FT                   NQFTYPDGDPTKPALHNVEITVKAGETLGIVGRVGAGKTTLIKLLLRQFDGYTGDIRVG
FT                   DVNIKAYTFNAYLKSIGYVAQENFLFSTTVRDNIRFSDINKNQRDVMLAAKKADFNEDV
FT                   WSLPDGYDTEVGEQGVSLSGGQKQRLAIARALITDPEILILDDALSAVDALTEKHILGT
FT                   LKSERREKTTIIAAHRISSVMNADEIIVFDHGEIKERGTHASLIARNGWYAEMYHQQQL
FT                   ATELEDKLSGKGVSDV"
FT   CDS_pept        236468..238264
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0240"
FT                   /product="ABC transporter, ATP-binding and permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90888"
FT                   /protein_id="CBL90888.1"
FT                   /translation="MSEKNSSVWAKSIPIKEQIRVIVTLVRMAKPFRKMFFGALAIGAA
FT                   FALLQAAAPRIIAYYMTTYLQQRDNVTLQVMISFAVLVAVVRVSQAVTDALNAYYFTVA
FT                   AEYALEDIRVQVFRKLHTLGMRFFDQVPAGSLVTRVNNDTASLADFWRFFMQLTFVIMS
FT                   MIGAYIGMLTVSVKATLLMLIVVPFIVGSVILYQRFSSSLFRHMRERLSHLNAKIAESI
FT                   TGIDVIQEFYQEDRFKKSFAKVNGEYFNARFRMVKADALLLEPMVDMLLGAAMVLVFWY
FT                   FGTLSMSTAVSAGVIYAFTTYLNNIFSPLESVMNLFSPFQEGLVSGYRILGILADDTYA
FT                   PAQNVAAKQDITAGKIAFQHVDFSYDGQHQILKDLNFIANPGDTVALVGHTGSGKSSTI
FT                   NALMRFYEFQSGNILIDDHDIRDIALKNIRQKMGLVLQDPFMFFGDISSNIRMYDDTIT
FT                   DEQVKAAAEFVGADKFISALPGNYHAKVQEGGSGFSAGEKQLISFARAIVRDPKILILD
FT                   EATANVDTETEALIQKSLLKMRQNRTTIAIAHRLSTIKDADLILVLDKGEVVEHGTHEE
FT                   LLQLQGQYYDLYRLQGINNDSN"
FT   CDS_pept        238484..239221
FT                   /transl_table=11
FT                   /gene="glnQ1"
FT                   /locus_tag="LEGAS_0241"
FT                   /product="glutamine transport ATP-binding protein GlnQ"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90889"
FT                   /protein_id="CBL90889.1"
FT                   /translation="MSMIEFKNVEKYYGNFHALKNVNLTIDEGETVVLIGPSGSGKSTL
FT                   IRTVNGLEEIEEGQLLVNGFDLHDPKTDMNRIRKNVGMVFQHFNLYDNKTTLENVMLAP
FT                   RLVLKRDEAENKKLAMELLEKVGLADKAANMPSELSGGQKQRAAIARSLAMQPKALLFD
FT                   EPTSALDPEMVGDVLDVMRDIAKDSSMTMLVVTHEMSFAKAVADRVIFMAEGEILEDST
FT                   TKEFFEKPKEVRAQKFLSQVEHH"
FT   CDS_pept        239309..240175
FT                   /transl_table=11
FT                   /gene="glnH"
FT                   /locus_tag="LEGAS_0242"
FT                   /product="glutamine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90890"
FT                   /protein_id="CBL90890.1"
FT                   /translation="MEKAKKRQFGIIATIVLVAVIVLGLMWATATANRNAEHQDTLARV
FT                   EKLGRIVWGVKADTRLFGLMDTKTGISQGFDIDIARALTVQISKQTGVPMSAEFVPVST
FT                   ASKMQLLKNTNIDGSVSTMTITPEREKIIDFTNQYFDAGQSILVKKDSGINSIKDMNSS
FT                   KYTIIVVVGTTAATETAKFAPKAKLLAVQDYATGMQALKSGQGQAMSTDNAILYGFATE
FT                   NPDYHIAGGTFTHGPYGIAFDNNQKPMIKETNAALATIKQNGIYNQLIKKWFSNVPGLD
FT                   WHSLEAK"
FT   CDS_pept        240175..240816
FT                   /transl_table=11
FT                   /gene="glnM"
FT                   /locus_tag="LEGAS_0243"
FT                   /product="glutamine ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90891"
FT                   /protein_id="CBL90891.1"
FT                   /translation="MALLQNNFPTFLQGFGYTLLSSIIALIGSMILGTGFAIMQIVPQK
FT                   WAQVIGNVYVQVFRNIPLLIITFFFFLVVSKYVKMSGFTSGTVALMLYTSAFIAETVRA
FT                   GILSVNGGQMEGARANGLSFAQAMQYIILPQAFRIALPSLGNQFINLVKNSSILAFVGG
FT                   LDLMYQGNMVAANTFDTFSTYIIVAIFYLILTLPLSYYIQHLERKLKRAL"
FT   CDS_pept        240826..241485
FT                   /transl_table=11
FT                   /gene="glnP"
FT                   /locus_tag="LEGAS_0244"
FT                   /product="glutamine ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90892"
FT                   /protein_id="CBL90892.1"
FT                   /translation="MVTLGIFSAFTPQNVLYLLGGLGITVGVSVISVILSLIFGSIVGI
FT                   IQFERLPYFSKFVGTINNIIRNLPLLLIIFFVYFALPKIGIHLPIFWATVIAMSTFESA
FT                   MLAEIVRGGLESVDNGQFEGARANGLSNMQTMIYIVLPQAYKKMIPPIISQLISLVKDT
FT                   SLALGIVLSEMTYRGQIVYAQNSTYIVPVLIAITLVYFLLNYGLSLLAKWADHKLA"
FT   CDS_pept        241667..243304
FT                   /transl_table=11
FT                   /gene="oppA2II"
FT                   /locus_tag="LEGAS_0245"
FT                   /product="oligopeptide ABC transporter, substrate-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90893"
FT                   /protein_id="CBL90893.1"
FT                   /translation="MDTWKKVAIGAAAVVVVGGGTRAAGLWGGSSSENSKNLSFQLPTP
FT                   IQTLDISKNTDTYSGTIIGNSGANLMRVDSKGKAQLELAKSVKVSDDGLKYTVVLKNGL
FT                   KWSDGSKLTAQDFVYSWQRIVDPKTASQYAYLASGVKNADKIAAGKADVDTLGVTAKGN
FT                   TITFDLERPLPQFEYLLTFSNFMPQKQNFVTKEGKKYATTAATSLYSGPYKVEGWNGTN
FT                   NSFKLIKNDNYWDAKNIKTKQIDVQVVQKPETAVQLYKQGKIDRVLISNTPELYKANKN
FT                   DKNVSKAPEATTAYLQYNQTGKNKFLANAKIREALNLATNRKELTDQVTAGISTPATGL
FT                   APEGLAKTDSGEDLAKFVAPGYKFDPKKAATLFQEGLKEVGESQATFTVTSDADSPAAK
FT                   TTLDYLQGSWEKALPGLKINQKFVPFSQRIKDSQTQNFDIVVSLWGGDYPEGSTYYDIF
FT                   KTGASNNNGQFKNEVYDAAVNKAESTDALKASARDNDYKMAEEALLKDSNFNPLYFRAG
FT                   YALQNPKVTGIVLNSTGLNQDWKLAVKK"
FT   CDS_pept        243498..245135
FT                   /transl_table=11
FT                   /gene="oppA1II"
FT                   /locus_tag="LEGAS_0246"
FT                   /product="oligopeptide ABC transporter, substrate-binding
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90894"
FT                   /protein_id="CBL90894.1"
FT                   /translation="MDTWKKVAIGAVAVVVVVGGGTRAAGLWGGKKAAEKGTLNYSLPT
FT                   DIQTLDISKNTDQYSNQIIGNSGSNLLRVDAKGKAIPDLAKSIKVSSDGLTYTAQLRSG
FT                   LKWSDGSKLTAQDFVYSWQRIVDPKTASQYAYLASGVKNADEIVAGKEKVSQLGVTSKG
FT                   NTVTFNLAHPMPHFEYLLTFSNFMPQKESFVAKQGKSYGTTSEKQLYSGPYTFKGWNGT
FT                   NGKFELVKNKNYWDAKNVKTQTLTYQVVKKPETAVELYKQGKLDEAPLTTTDLYSANKG
FT                   SKDSVKVPEARTDYIEYNQTGTNKFLANTKIREALNLATNRDELVKEVTGGVSTAGTAL
FT                   VPTGLAKTASGEDLAKYVAPGYTYDKNKAAKLFAEGLKEIGETKATLTIEAASDQPANK
FT                   VVVDYLQGSWQKALPGLTINQKFVPFKQRLQDAQTQNFEILLTAWGGDYPEGSTFYDLF
FT                   KNNGSYNDGKFINDAYTDAVNKAETKDALDQSSRDMDYKNAEAALFKNANYSPLMFRAH
FT                   YALQNPDVKGVVANTTGLLQDFKYAYRK"
FT   CDS_pept        245205..246122
FT                   /transl_table=11
FT                   /gene="oppBII"
FT                   /locus_tag="LEGAS_0247"
FT                   /product="oligopeptide transport system permease protein
FT                   OppB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90895"
FT                   /protein_id="CBL90895.1"
FT                   /translation="MWKYILKRLLLLIFTLFLVVTATFFLMQIMPGTPFTNPKLTPEAI
FT                   AQLKSTYGLDLPLWQQYLNYLIGAAHGNFGISFQYQNQPVSMLIGQRLPISAQLGAQAL
FT                   VVGVIAGLFMGAASARNKNNKIDGTLGIISTLGISIPSFILGIILVYLFGFKWPLFPVS
FT                   GWGDSFSQTVLPTLALAMSPAAITTRFVRSEMIESLSSDYVQLAKAKGLSAKEVVNQHA
FT                   YRNSMIPVLTLIGPMAAGLLTGSTLIEQIFSIPGIGQQFVLSIPSKDFPVIMGTTIVYS
FT                   AMLMVMILITDILTAIIDPRVRLQ"
FT   CDS_pept        246134..247165
FT                   /transl_table=11
FT                   /gene="oppCII"
FT                   /locus_tag="LEGAS_0248"
FT                   /product="oligopeptide transport system permease protein
FT                   OppC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90896"
FT                   /protein_id="CBL90896.1"
FT                   /translation="MAANTEDFVIVGAQNSKANEHISKPALSFWQDAWRRLKLNKLAVI
FT                   SLWFLIFILAFAVLSNIFVPQKNANAFNSDKVGVYKNLPPNSGLPIPGWNGKIKAPGDT
FT                   TATNVYESQGVPENKKFILGTDNIGRSVAKRVTVGLRISLLVAIVATLIDLLIGVAYGV
FT                   FSGWKGGWIDNVMQRIIEILSSIPNLIIVTMLGLLLGGGVLSIILAIAMTGWLGMARQV
FT                   RNMTLTLKERDYVLAAKSLGESSLKIAIKHLIPNMAGTIIVQIMMTVPNAIMFEAVLSA
FT                   INLGVKPPTASLGSLISDAQAMLQFYPYQILIPSAVLVLVSLAFILLGDGLRDAFDPRA
FT                   SED"
FT   CDS_pept        247180..248235
FT                   /transl_table=11
FT                   /gene="oppDII"
FT                   /locus_tag="LEGAS_0249"
FT                   /product="oligopeptide transport ATP-binding protein OppD"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90897"
FT                   /protein_id="CBL90897.1"
FT                   /translation="MSNPILKVENLHVNFNTYAGTVQAIRDVSFDLNKGETLAIVGESG
FT                   SGKSVTTKTLMGLNAKNALIPDNSRLIFKDRNLLDLKEEEWQSVRGNEIAMIFQDPMTS
FT                   LDPTMRIGMQIAEPLMKHRKMKKVAALARALELMKGVGIPNAEEHINDYPHQWSGGMRQ
FT                   RAVIAIALAVDPEILIADEPTTALDVTIQAQILKLMKELQKDTGSSIIFITHDLGVVAG
FT                   MANRVAVMYAGKIVEYGTVDEIFFNPQHPYTWGLLNSMPTTDTKVGSLVAIPGTPPDLL
FT                   EPPTGDAFASRNEYALAIDLKEEPPFFRVSDTHYAATWLLDERAPKVTPPEQIQKRWER
FT                   WREIQGQEAQS"
FT   CDS_pept        248232..249170
FT                   /transl_table=11
FT                   /gene="oppFII"
FT                   /locus_tag="LEGAS_0250"
FT                   /product="oligopeptide transport ATP-binding protein OppF"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90898"
FT                   /protein_id="CBL90898.1"
FT                   /translation="MTEETPKKLVELKDLQLYFNKGKANEVRAIDHVTFDIYEGEIFGL
FT                   VGESGSGKTTIGRTILKLHEPTAGKILFNGEDVTHLKGKALLEFRKNAQMIFQDPQASL
FT                   NGRMKVRDIIAEGIDINKLAKDRTDRDNKVQQLLKLVGLNEDHATRYPHEFSGGQRQRI
FT                   GIARALAVDPQFIIADEPISALDVSIQAQVVNLMKELQKRHSLTYLFIAHDLSMVKYIS
FT                   DRIGVMHWGKLLEIGTADAVYNHPLHPYTKSLLSAIPVPDPEVESLRQHVEYDTTVETD
FT                   GKERHMIEANPGHFVLATDEEVALYKLQQNK"
FT   CDS_pept        249292..251184
FT                   /transl_table=11
FT                   /gene="pepO"
FT                   /locus_tag="LEGAS_0251"
FT                   /product="Oligoendopeptidase O"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90899"
FT                   /protein_id="CBL90899.1"
FT                   /translation="MVRLQDDFFEAINGDWEKTAVIPNDKPRTGGFSDLSDEIEQWLMT
FT                   TTAKWQNGDMIPESPILKNFVAYHRLTIDTKTRDELGTSPVQPLIKKYQSYTSFADFAS
FT                   HIVELEKSGFPNALPLGVEPDFKDAQTNVLWAGALSILLPDTTYYEKDHAQGKILLAKF
FT                   REEQESLLPHFGFSKSETTELIDQYLALDARAANVVLSQEENHEYAKLYHPYDWQQFTN
FT                   LAPELPLNDILTELIGQKPDKIIVPEERFWAAADQFYSEKAWPLLKAYLIVTVANQFTS
FT                   YLSDELRVLGGQYQRELTGLPEAMASQKAAVYLAAQPFNQAIGVYYAQDNFSPAAKIDV
FT                   EHKVATMIDVFKQRLQSNQWLDDATRQKAIIKLNTIVPHIGYPEKLPERLYKKIVHPGM
FT                   TLFDTATQFRQIEIAHTWAQWHQPVDRSEWHMPAHLVNAYYDPQQNQIVFPAAILQAPF
FT                   YSLKQSSSANYGGIGAVIAHEISHAFDTNGASFDEYGSLNNWWTTADFSAFKLRTDKIV
FT                   KQFDGLDSYGAKVNGKLTVSENVADLGGLAAALAAAKLDSDFSATAFFESWATIWRMKA
FT                   RPEYMRLLAASDPHGPAALRVNVQVKNFDEFFDAFDVRPDDKMWLASNDRVQIW"
FT   CDS_pept        251305..253041
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0252"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90900"
FT                   /protein_id="CBL90900.1"
FT                   /translation="MRWIKKITWWQLLLIFLILAIASMGPQIVKQTMYMNSWDVPFHLS
FT                   RMYELTKGFENGKWLPDISAYTFGQNGYGVNLFYGYSFTYLVALIYFWTHQAITAVLAG
FT                   YIILLTTAMGLNYYAGSLFFTGGRSKLKSFAFSTLYVLAPVTFGQIKVRGLPGELIGIL
FT                   LFPAVLAAFYAIMFTARKSWVFASIVSTITVTNHVLSALLLLIVLTIMFIVFLYKKQAT
FT                   TGKLWQLVKAGILTLLLSAFYVMPFIQQILSDKIAGANVFFQATSVWDSISSSISNQAT
FT                   LNWTAIPVGVFVFVMSIVVVLGLLYTRSFSNHVQIIGGWLAISLIAIFYTPIEILTKTP
FT                   LHVFQMMGRFYPIIMLLGLLFVIEGLEKFSEIGLLKQKTVGWLFVTGIVLAIFSAWKMQ
FT                   VTTYYNGGSANIANYQVGKKQLPKTVSNADFDYQIQHYYQLPLGSKDYLGQGRVKFVNN
FT                   YQVGSWGDNRDAKRIYIDGKLSSLQLTHKGYVFTVANVPTSAKQVLLPMTNYKGWQVIG
FT                   ANNKILPITTIKGKMAVDPKGNRTLHLTYHKTLLHRVAIMVSAISVVVLLVVGLMTYFK
FT                   RR"
FT   tRNA            253266..253348
FT                   /locus_tag="LEGAS_R0002"
FT                   /product="tRNA-Tyr"
FT   tRNA            253388..253459
FT                   /locus_tag="LEGAS_R0003"
FT                   /product="tRNA-Gln"
FT   CDS_pept        complement(253588..253974)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0253"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90901"
FT                   /protein_id="CBL90901.1"
FT                   /translation="MVNQTVTKRIKHFQDFGNSLAHAKAYFRDDWKIIYFDLSGKMFGL
FT                   LSPTASETSIITLKGDPESNVALREIYSDITAGYYANKKHWNTIKLSTSELSDQEIEKM
FT                   ITHSYKLVYENLPLYVRKAFAASD"
FT   CDS_pept        254558..255400
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0254"
FT                   /product="Transcriptional regulator, XRE family,putative."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90902"
FT                   /protein_id="CBL90902.1"
FT                   /translation="MINVEKFIHTRKRLKMSQMSLCINICTQATLSKFEKHRQVPAVDI
FT                   MILLCERLGLTLNDIFPIHVTLKTTSNEQVLALAMKALFYQNLVKYHQLMTQVDIDNLL
FT                   DSEQSTYQLLQYFSLVFFQKNDVKATKLLKKIDVSQFSQLQQLLFYAITIHYYYQQGFF
FT                   NEAEKIFDDVWRHQKNLMVADRSGFQAAIIYLLAQYQMSLKNYKYAMMLATYGINFTND
FT                   SDSTYFLENLFWLLIEAGDIWHNQHFIVNEMINNVRMIAKFHKNESMLNKINQRKKDI"
FT   CDS_pept        255402..256202
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="LEGAS_0255"
FT                   /product="FeS assembly ATPase SufC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90903"
FT                   /protein_id="CBL90903.1"
FT                   /translation="MTTLKVDNLHVSVAGKEILKGLDLIVNTGEIHAIMGPNGTGKSTL
FT                   SQTIMGHPAYQVTQGNIYIDGQNLAEMSVDARARAGLFLAMQYPSEIQGVTNTEFMRAA
FT                   INARRPEDDQISVMSFIEKLDEKREFLAMTEEMAERYLNEGFSGGEKKRNEILQMMMIQ
FT                   PQIAILDEIDSGLDIDALKVVSRGVNSMRSNEFGALMITHYQRLLDYIVPDFVHVMMDG
FT                   KIVKTGDANLAKKLEAEGYAGLRDELGLDVHLTDEETNSYFVEG"
FT   CDS_pept        256204..257388
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="LEGAS_0256"
FT                   /product="FeS assembly protein SufD"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90904"
FT                   /protein_id="CBL90904.1"
FT                   /translation="MVDNIAIASLPLPEFAKVRYSGWQLDELTPATENTKTTYFLKNTI
FT                   SGIEVSGQSTTYQHLSENMIAQGVIVMGMKQAQMVYGPLVNKLIGSVISKRADRLSAQN
FT                   YEQFNTGIFVYIPDQVKFDDVLHLALNHLAMSGQDFVARIFVCVGAHAKVTILQEMHTI
FT                   GSEKTKASVVIEVLANVGAQVTYANIDSLGEQTTAFINREVLVKDHATVDWQNAEFNDG
FT                   NVVMRVASQLNGEGATSHANVIGLTIKKQTQGLVTTVLNKGRHTVGHIFQRGVILNRST
FT                   LVFNGIGQIIKGAKGSDAQQESRVLMLSRRARGDANPLLLIDENDVTAGHAASVGRVDD
FT                   EQMYYLMSRGISERVARKLVIRGFMGEVLMKMPTRAAQQKVMSEIERKLQYEDD"
FT   CDS_pept        257375..258610
FT                   /transl_table=11
FT                   /gene="sufS"
FT                   /locus_tag="LEGAS_0257"
FT                   /product="selenocysteine lyase, cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90905"
FT                   /protein_id="CBL90905.1"
FT                   /translation="MKTIRSDFPILNQKINGQQMIYLDSAATSQKPQVMMDALVDYYQN
FT                   NNSNVHRGIYELSQRATEQYEQVRDKVQMFIHAKKRTEILFTRGTTESLNWLASTYGVD
FT                   QLKPGDEILLSYMEHHSNIVPWQQLAQRVGARLKYITLNNDGTLNLTDAKQKMTNKTKI
FT                   VTLTHVSNVLGVVNPIKLLAQMAHEHGAIMIVDGAQSVPHMAVDVQDMAVDFLVFSGHK
FT                   MLGPTGIGVLYGKSELLEKMTPAQYGGEMIERVNLQEATFQPIPWRFEAGTPNIAGAIG
FT                   LGAAIDYLTHIGMADVTKHEHELVGYALSQLTKMPRITIYGPQNSEHHTGVIAFNMAGV
FT                   HAHDLATALDQLGIEVRAGHHCAQPLMNYLGVAATVRVSFYLYNTREEIDRLIDALKKI
FT                   KEYFNREFAQFR"
FT   CDS_pept        258588..259049
FT                   /transl_table=11
FT                   /gene="nifU"
FT                   /locus_tag="LEGAS_0258"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90906"
FT                   /protein_id="CBL90906.1"
FT                   /translation="MSLHNLDNLYRQTIMSYAQYPHHFRPMLGQETYHIQKYNPTCGDI
FT                   IDLAFDIVDDKVTDIHFYGDGCVISKASASMMSDLVSGKTRAQATFLVTEFSKMMRGEA
FT                   ADVKSLGEPQILAGVTKFPARIKCATLAWHALDELLVIKDDRRCDDGNR"
FT   CDS_pept        259036..260466
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="LEGAS_0259"
FT                   /product="FeS assembly protein SufB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90907"
FT                   /protein_id="CBL90907.1"
FT                   /translation="MEIDRQEAIDKTRAAIAVDKAKALGFQDDYKAVFSTGKGLDEGII
FT                   RQISAKKNEPEWMLNYRLQAYQTYLNMPMHSWGPDLSDIRFEDIYYYNKPTNDKYRDWN
FT                   DVPIELKETFERLGVPEAERKWLAGSSAQYESEVVYHRMKDEFAKTGIIFTDTDTAVQE
FT                   YPELMKEYFGSLVKPTNNKLAALNAAVWSGGTFIYVPKGVHVNTPIQSYFRINTENEGQ
FT                   FERTLIIVDEGAHVDYVEGCSAPMYSGDALHAAVVEVIVKKDGYCRYTTIQNWSNNVYS
FT                   LETKRASAHENATMEWVDGNFGSKTTMKYPSVYLNGEGAKGTMLSIAVAGEGVNLDSGA
FT                   QMIHNAKNTSSSIISKSIAHDGGKTDYRGTVKFGRESDGSFAHVECDTILVDDQSSADT
FT                   IPYNTILNGNVSMEHEAKVSRVSEEQLYYLMTRGISAEKATEMIIMGFIEPFTKELPME
FT                   YAVELNRLMKFEMIGSVG"
FT   CDS_pept        260469..260774
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0260"
FT                   /product="Predicted metal-sulfur cluster biosynthetic
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90908"
FT                   /protein_id="CBL90908.1"
FT                   /translation="MPEKIENDIMAILETVIDPELRIDIVNLGLINCVDINDTGDVIIN
FT                   MTLTTMGCPLSSVLEEMIDAALTILPEVKTTKVVLTWEPAWKIDRMSRYAKMALGL"
FT   CDS_pept        261080..262252
FT                   /transl_table=11
FT                   /gene="lauA"
FT                   /locus_tag="LEGAS_0261"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90909"
FT                   /protein_id="CBL90909.1"
FT                   /translation="MTNKVTFYDTTMRDGEQTIGVNFSVEEKIAIAKGLDDYGVSAIEA
FT                   GFPAASQKDFEAVKSIAEVVNKAKVVGLARLVRNDINAVIEATKGAKHPMIHVFIATSP
FT                   IHREFKLHLTKEEILDKIKADVAFTKQYIQDIVFSPEDATRTEPDFLVASVQTAIDAGA
FT                   TMINIPDTVGYDTPEEYGEVFENLRRNIVGFDTVGWSTHTHNDLGMATANALAGIAHGA
FT                   TEIQGTINGIGERAGNVDMIEAAAAIYVRHEKFNVETDIVLSHSKAISDIVARATQMPV
FT                   ASNKPIMGRNAFAHESGIHQDGYLKNPETYEILKPGMVGATASLPLGKLSGSHAVMSKL
FT                   NSLGYDVTRDDMKNIFPIFKSVAEESNLVTNEQLKIIMQVVEEKEMVSYQ"
FT   CDS_pept        262249..263325
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="LEGAS_0262"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90910"
FT                   /protein_id="CBL90910.1"
FT                   /translation="MMTSVKKIVVLRGDYIGPEIMTAGLAVLEAATRNEAFAYKLIDAP
FT                   FGGDGIDRAGDPLPQSTINIAKQADAVLLSAIGGPKWDNMSRRPEQGLLEIRSQLNLFA
FT                   NIRPTKVTSAQIDRSPLKPEYVKNTDFVIVRELTSGAYFGKPRKLEEHQAIDTIYYNEE
FT                   EVTRIMHQGFKMAQKRKKHVTIVDKSNVLATSKFWRKIANEVGKNYPDVAIDYYYVDAM
FT                   TMAIMSKPAIFDVVIMPNLFGDILSDEAAQITGSIGQIPSMSIGENGPNLYEPIHGSAP
FT                   DIAGQGIANPISMVNTIAMMLTESFDEKSIADKMTAAVNYIIENHYVTPDMGGVMTTNE
FT                   VTQKMVDYIKKHELAATK"
FT   CDS_pept        263322..264704
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="LEGAS_0263"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90911"
FT                   /protein_id="CBL90911.1"
FT                   /translation="MSKTLFDKIWEKHVITGEIGEAQLIYVDLHLIHEVTSPQPFDGLR
FT                   NTNRRVRRPDLTFATMDHNVSTKDIFNVQDHMSRLQMDTLVKNTKEFGVPLASIGDDKQ
FT                   GIVHVVGPERGLTQPAKLIVCGDSHTATHGAFGAIAFGIGTSEVEHVLATQTIWQVKPK
FT                   TMGIKVTGKLLKNTYAKDIIMGIIAKYGVSFGVGYAIEFYGETVENLSMEARMTMCNMS
FT                   IEAGSRTGMVQPDQTTFDYIEGREQAPKDFEAAKNYWLQFYTDDESDFDETLTFDVSNL
FT                   KPMVTWGTNPGMATPVDQSLPAIKDDNDANANAYEYIGLHPHMKATDINLDYIFIGSCT
FT                   NSRYEDLEIAANMMKGHHLAPNVTAWIVPGSRAIRNRAIKSGIAKIFEDAGCEWREPGC
FT                   SACLAMNPDKIPAGKHVASTSNRNFIGRQGAGSRTHLASPAMVAAAGIAGYFVDITVDE
FT                   FV"
FT   CDS_pept        264717..265301
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="LEGAS_0264"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90912"
FT                   /protein_id="CBL90912.1"
FT                   /translation="MEAFVRETGRAVVIPNDNINTDIILPKQFLKNILKTGFGKDLFYD
FT                   WRYNADGSLNEAFELNKPEHKCASILVTGNDFGSGSSREHAVWALTDYGFRAVIGGGFS
FT                   DIFYMNATKNGLLPIVLPEENRRILRSIQADEYIQIDLPKQTVTYNDDIFHFNINSQWK
FT                   EKFINGEDDIDNTMKYEKLITAFEKQRSIFL"
FT   CDS_pept        265392..266180
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0265"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90913"
FT                   /protein_id="CBL90913.1"
FT                   /translation="MTEATTTKIHWNGGIQSEAISILKEDGGMIVSPTKVGYIIMTSDD
FT                   KGLERKFAAKNRKRNKPGVVLCGSIEQVKELAQMTPEIEQMYQKHWDEDILLGCILPWK
FT                   EEAKSKLPNDGTKDLMMDKRETSCFVIKFGTPSENIAKEMWGKYGKFSFASSANPSGKG
FT                   NRGVVAGIGDQIENAADLIIEANDYVASIQSDKNSDTRYDQGVMVSMVDESGQLIPEQN
FT                   GIVGVQPAPILIRKGLDVDKIMKIMSDIFPSWDYRHGFYY"
FT   CDS_pept        266395..267447
FT                   /transl_table=11
FT                   /gene="nixA"
FT                   /locus_tag="LEGAS_0266"
FT                   /product="High-affinity nickel-transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90914"
FT                   /protein_id="CBL90914.1"
FT                   /translation="MMLMTKKHATIQADALRYGSVILIFLIAGILLLLTRAAQYPEMIA
FT                   MAYLSFTMGLHHAFDVDHIAAIDNMTRKMLNDGKNTRGVGFSFSFGHSMVVVLMALLTV
FT                   VFVEWAKDTMPVFEQIGGAIGTLIAGIMLLILASVNSVILHDIWLKFKQMSHQHPEHIE
FT                   IDKQIVTSKIYRLFLKLLGMIKHNWQVAFVGFLFGLGFDTATQIAVLATSATAANAGVP
FT                   WYATMAFPLLFTAGMCLMDTVDGFFMSTTYNWVFSSPYRKVYYNLTITGISILAAGFIG
FT                   FIDLVQSFSAMFDWHNVLTHWVAALDFNKMGLILVMMFVVTWIIAITFWHIFKLADKED
FT                   VGIITENRGK"
FT   CDS_pept        267664..268743
FT                   /transl_table=11
FT                   /gene="araR"
FT                   /locus_tag="LEGAS_0267"
FT                   /product="Arabinose metabolism transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90915"
FT                   /protein_id="CBL90915.1"
FT                   /translation="MANKYEIIKKSILDKILRGTYQKDQQLPTESDMMSDFSVSRYTVR
FT                   RAISDLENEKFVYRVQGGGSFVADWSVTKKFEDAPKVIGILSTHVASYIFPAIIDGADQ
FT                   VLSENGFSLVLANTHNDPVRERTALTNLMGQNLGGLIIEPTQSALDTTNIDLYQKLDQM
FT                   NIPMVFINAAYNNFEGTKLVSDDKLAFDRATNYLIKRGHKKIVGVFQVSDSQGVHRMAG
FT                   YLKAYQDHPNILPYCTPIMYKSDEVNDALRAISELLAKKPEQRPTAIIAYNDQLAIRTI
FT                   DLIHDVGLKVPEDISVIGFDDFQLSQYLSPRLTTMTHAKEDMGKDAAQLLLQKIKHHKT
FT                   NSVVYSSKLIERESVRDIG"
FT   CDS_pept        268827..269555
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0268"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90916"
FT                   /protein_id="CBL90916.1"
FT                   /translation="MMSEFNNGLSCLVDGASKSITEGVLLQELDLDLQNTIYHDYPNST
FT                   ENDFICLDHLLKYRLAKIDKMIVLKHRESMHVNNRLTHILTDKNFKIVNVNKHQKESYT
FT                   FGQKVADKVAHFGGSWRFIIISICAMVVWITINVFHLFNMHFDSYPFILLNLFLSMVAA
FT                   LQAPLILMSQNRSSDYDRLHADNDFHINLKTEEEMRVLHAKIDRIIQKDNPDLFEVQKL
FT                   QTKMLGELQQQMSALARKNK"
FT   CDS_pept        complement(269629..270516)
FT                   /transl_table=11
FT                   /gene="fba"
FT                   /locus_tag="LEGAS_0269"
FT                   /product="fructose-1,6-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90917"
FT                   /protein_id="CBL90917.1"
FT                   /translation="MTIVSGKEIIQQARTNHYAVGAFNTNNLEWTKAILHMAATQKAPT
FT                   FVAASMGAIKYMGGYKTVAHLIQDLDDALDVSVPIAIHLDHGDYDASLAAIDAGFTSIM
FT                   FDGSHLPLNENLARTREIVQIAHEKGISVEAEIGSIGGEEDGIIGNGEIAPIADAIAMV
FT                   NTKIDFLAAGIGNIHGAYPDNWQGLNLGHLQKLTAAVNDVAGYNVPIVLHGGSGVPDDQ
FT                   ILKAIALGVAKINVNTEAQLAFHQAVRDFVLSGQDLQGKNYDPRKFLAPGVVAIEKSLT
FT                   ERMSIFGSIGKATY"
FT   CDS_pept        271013..272437
FT                   /transl_table=11
FT                   /gene="araA"
FT                   /locus_tag="LEGAS_0270"
FT                   /product="L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90918"
FT                   /protein_id="CBL90918.1"
FT                   /translation="MADIKDYKFWFVTGSQFLYGPEVLTQVEEDSKKLINKLNESGKLP
FT                   YPIEFKTVGVTAENITKTMMEANYDDSVAGIITWAHTFSPAKNWIRGTQLLNKPLMHLA
FT                   TQMLNTIPYDTIDFDYMNLNQSAHGDREYAFINARLRLNNKIIFGHWADDDIQTQIGKW
FT                   MDVAVAYNESFKIKIVTFADKMRNVAVTDGDKIEAQIKLGWTVDYWGVGDLVAYVNAVN
FT                   DDDIDQLYEDLQSKYDFIEGKNTPEKFEHNVKYQLREYIALKKFMTDKGYSGFTTNFED
FT                   LVGLEQLPGLAVQLLMADGYGFAGEGDWKTAALTRLLKIVSHNQATAFMEDYTLDLRKG
FT                   HEAILGSHMLEVDPTIASDKPRIEVHPLDIGGKEDPARLVFTGRPGDAIDVTLADFGDE
FT                   FKLISYEVTGNKPESETPFLPVAKQLWTPKSGLKAGAEGWLTVGGGHHTTLSFAVDTEQ
FT                   LTDLAKLFDLTFVDIK"
FT   CDS_pept        272448..273827
FT                   /transl_table=11
FT                   /gene="araE"
FT                   /locus_tag="LEGAS_0271"
FT                   /product="Arabinose-proton symporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90919"
FT                   /protein_id="CBL90919.1"
FT                   /translation="MENRATKKIGSAFIYFFGAFGGILFGYDIGVMTGALPFLQRDWHL
FT                   TDAGTIGWITSTLMLGAIVGGALAGQLSDKLGRRRMILASSFVFAIGAIMAGFSPNNGV
FT                   AWLLCARVLLGLAVGAASALVPSYMSEMAPAKTRGRLSGLNQLMIVSGMLLSYIVDYLL
FT                   QGLPHTIAWRLMLGLAAVPAIILFFGVLRLPESPRFLVKTNKLKEARQVLTYIRPDREV
FT                   DPELKDIQKTVALEAGAQKNITLGTLFSSKYRYLVTAGIGVAAFQQFMGANAIFYYIPL
FT                   IVERASGQAASSALLWPIIQGVILVLGALLYIVIADRFKRRTLLMLGGTIMALSFLMPA
FT                   ALNALLGADKFPPMLIVVFLSIFVAFYSFTWAPLTWVLVGEVFPLAIRGRASGLASSFN
FT                   WLGSFAVGLLFPIMTAAMPQASVFAIFGVISIIAVLFIKFAVPETYGKTLEEIEAQGTN
FT                   H"
FT   CDS_pept        273924..275546
FT                   /transl_table=11
FT                   /gene="araB"
FT                   /locus_tag="LEGAS_0272"
FT                   /product="L-ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90920"
FT                   /protein_id="CBL90920.1"
FT                   /translation="MMTHEETMQAIKAGNIALGVEFGSTTVKAVLTTEDFKTIASGSYE
FT                   WDNNFQDGLWTYAVADIWLGLQTAYANLQKQIHDNYSVAITSIKTMGFSAMMHGYLAFD
FT                   KNNQLLVPFRTWRNAITGESASELTKLFNFNIPQRWSVAHLYQAILNQETHVKNIDFLT
FT                   TLAGYVHWQLTDEKVIGIGDASGMFPIDEKTGAYNQLMLDQFNSLKSVQQYNWQIDNIL
FT                   PKPLKAGGNAGHLTEKGAKLLDPTGHLTAGAIIAPPEGDAGTGMVATNSVKKRTGNISV
FT                   GTSIFSMIVLEKNLEHVYSNIDIVTTPTGLPVAMVHANNSASDLNAWSKLFAQFAKLIG
FT                   CDISTSQLYQTLFDAALNDAEPDAGGLSGYGYYSGENITAIPEGRPLLVRQPDSNFTIG
FT                   NLMRMHLFTAFGAIKIGMRILEDEQVLTDNIVAQGGVFKTPIVAQKLLSAALNTDITVM
FT                   KTAGEGGPWGMAILSLYVANKRTDETLDDFLSQVVFANEKSETLSPDPIDVAGFESFMT
FT                   RYVAGLDIELAAIKTLPSQKRKE"
FT   CDS_pept        275552..276256
FT                   /transl_table=11
FT                   /gene="araD1"
FT                   /locus_tag="LEGAS_0273"
FT                   /product="L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90921"
FT                   /protein_id="CBL90921.1"
FT                   /translation="MLENLKKIVYEANMALPANNLVTLTWGNVSQIDREKGLFVIKPSG
FT                   VDYKTLRPEDMVVVDLDGHVVEGDMNPSSDTPTHAFLYRHWHDLGGIVHTHSKWAVAFA
FT                   QAGIPVPAAGTTHADTFYGDVPVADRLTQAEVTDDYELNTGKSIVRVFERENLDPMAIP
FT                   GVLTNDHGPFTWGKDAMDAVHNAIVLDVVADMDYHTMQLNPAQDIHVPQYLLDKHYYRK
FT                   HGVNAYYGQSKD"
FT   CDS_pept        complement(276405..277829)
FT                   /transl_table=11
FT                   /gene="aspA"
FT                   /locus_tag="LEGAS_0274"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90922"
FT                   /protein_id="CBL90922.1"
FT                   /translation="MRTESDSLGQLNIPKTAYYGIHTQRALHNFPISSQPTHPELIRAF
FT                   LEIKQAAAKTNATSGNLDRSVAKHIVSATKTLLNNPIDLSMFPISDIQGGAGTSANMNV
FT                   NEVIANVALEQTGRARGDYAYINPNDDVNMAQSTNDTYPSAGKIALLRLLDPLLLELQN
FT                   LIDALGNKADEFSTTYKMGRTQLQDAVPMTLGNSFHAWLKPLLRDDLRIKTARDALYML
FT                   NLGGSAIGSGINVSYHYQVHIVPNLAGITKLPLTQAHDLFDATQNLDGLVALSGTLKTL
FT                   AMSLSKISNDLRLLSSGPRSGLLEINLPAKQAGSSIMPGKVNPVIPEVVNQVAFEMFGF
FT                   DATITAAAEAGQLELNAFEPIIFRSLFAGIEHLTSAMTTLRLNAIDGITSNKSRLAQDI
FT                   DLSVSFATAMTPIIGYQEAAKLAKESIRTGKSLRQLAEKKSCFTPDQLTHIFKIEDIVI
FT                   NARTPEHGLVLHAPTQ"
FT   CDS_pept        complement(278013..278696)
FT                   /transl_table=11
FT                   /gene="rpiA1"
FT                   /locus_tag="LEGAS_0275"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90923"
FT                   /protein_id="CBL90923.1"
FT                   /translation="MSTDLQKIIAGRRATEFVQNDMVVGIGSGSTIAHVIDSLGERVAQ
FT                   ENLKIVGVATSERTRRHAAQLGIPMYNVDDVDKIDLTIDGADQIADDFSAIKGGGAALL
FT                   WEKIVAFNSRENIWVVDATKRVSKLNQYLPVEVIPYGSNQLFKRFQADGFHPSWRLDQN
FT                   GNPVRTDSANFLIDLHLPIIENPRELGDELIRMVGVVEHGLFTDVVNRVVIGEDDHTAK
FT                   VVSVK"
FT   CDS_pept        complement(278693..278974)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0276"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90924"
FT                   /protein_id="CBL90924.1"
FT                   /translation="MDFQHEPGRYFLQQNDKTVAEITYTTINNGQTYAINATNVDPSLR
FT                   GQGIAAKLLDTVVAEAHDKHISIKAVCPYVQKAFANNPAKYQKIEYKP"
FT   CDS_pept        complement(279246..280052)
FT                   /transl_table=11
FT                   /gene="znuB1"
FT                   /locus_tag="LEGAS_0277"
FT                   /product="Zinc/iron ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90925"
FT                   /protein_id="CBL90925.1"
FT                   /translation="MFTYSFMQYAFIASFFISIICAIMGVFVVARKTAFYTHTLSEISF
FT                   SGASFAIFAGISPITGMLLFTITSSIFVSLTGRNMNQRESSVSVFSAIFIGLGVLFLSL
FT                   SNKQSSYATNILFGSIVGISRANVTELLLLIATILCITGIMFRKLKYISFDTIGAQYNA
FT                   KNTAWISSLFLILVACTVSVTAQIVGSLLIFSLLTIPASSAKYLAHSVHSMMLLSFVFA
FT                   LFGTWMGLYLSYITNWPVSFFITFIEGIIYGLALAYAKIPNSSNNR"
FT   CDS_pept        complement(280071..280730)
FT                   /transl_table=11
FT                   /gene="znuC1"
FT                   /locus_tag="LEGAS_0278"
FT                   /product="Zinc/iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90926"
FT                   /protein_id="CBL90926.1"
FT                   /translation="MLSKILEVAELNIQVAGKPLIERLSFTIYTNTLLCITGDNGVGKT
FT                   TLINHLLKAAKSTQEHQSHINFNTSFEAIQVIPQFRNIDDDYPLSIQNFVTLNLIKQWR
FT                   PWLTALEKEKLSKILSLVNLTAIKNRPLGEASGGEKQRAYLAQALIAHPKLLILDESTS
FT                   NLDRESRINLLHLVKTIINQENIAVIFITHDPELVKLFGDVELHISNRHGVMTKLR"
FT   CDS_pept        complement(280735..281655)
FT                   /transl_table=11
FT                   /gene="znuA1"
FT                   /locus_tag="LEGAS_0279"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90927"
FT                   /protein_id="CBL90927.1"
FT                   /translation="MGIKNMKRRYTIGTIVIVILAAIVLIFIGTHHSQTSSANSDKGIK
FT                   VVSSVDFYGEAAQKVLGNYGSVQSVITNPNIDPHDYEPSAKIAKEVANANLVVYNGIGY
FT                   DSWMTKLAKNANVKSVRVGEDVLGKKDGDNPHLWYQSQTMPKLVNYLATKFSKIDPKHK
FT                   SEFKANAEKYIAQLQPIQTKITALKKNSDNKTVDVSEPVFDYALEELGYTENNTHFAKS
FT                   VEDGTDPSPKDIKTMQDDIKSKKISFFVQNTQATDKTVTELVTLANKYSVPVLKVTETM
FT                   PKGKTYEQWMISQYNQLEKIQQTEK"
FT   CDS_pept        282027..282566
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="LEGAS_0280"
FT                   /product="Deoxyuridine 5'-triphosphate nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90928"
FT                   /protein_id="CBL90928.1"
FT                   /translation="MRGFEIVSTKANDGLNLPKRSTQAAAGYDFEASEDIIIPSALSNQ
FT                   FFKGLSILSLGKLKGVRDNADLQNILKPILIPTGIKAYMADGEYLQLVSRSSGPIKKRI
FT                   MMPNGVGIVDADYYNNSSNEGEIFFQFINFGINDVKIKKGERIGQGIFLPYLLADGDDK
FT                   VAKASRQGGFGSTGQN"
FT   CDS_pept        282808..284031
FT                   /transl_table=11
FT                   /gene="radA"
FT                   /locus_tag="LEGAS_0281"
FT                   /product="DNA repair protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90929"
FT                   /protein_id="CBL90929.1"
FT                   /translation="MSLDGRAAKVEKINEITSEETPRVATNLKELNRVLGGGVVPGSMV
FT                   LIGGDPGIGKSTLLLQVSGQLAHEGRVLYVTGEESATQVKLRADRLGVGNDEFYLYPET
FT                   DMTAIKKQIDELQPDFVVIDSVQTMQEPDVTSAIGSVSQIREVTADLLQIAKTNNISIF
FT                   IVGHVTKDGAIAGPKILEHMVDTVLYFEGDSNYKYRILRAVKNRFGATNELGIFEMRDG
FT                   GLIEVANPSEIFLEERLTGATGSAIVVALEGSRPILVELQALVTPTVFGNAQRTASGLD
FT                   RSRVSLIMAVLEKRANLLLQNQDAYLKAAGGVKLDEPAIDLAIAVAIASSYHDKESRPS
FT                   DVFVGEIGLTGEVRSVADIEGRLKEARKLGFKRAIVPKNNLNGIVFPDGIQVIGVTTLS
FT                   EALKLALD"
FT   CDS_pept        complement(284266..285504)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0282"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90930"
FT                   /protein_id="CBL90930.1"
FT                   /translation="MYFKKFLQSKGVVGSLIIILFYGLLMVGVYFSGYKAIPSKINQLP
FT                   VAIVNQDNASRPLANQLKNKLPFKHIKTNLTFTEAKNQLQDRKVYLIINVPKNFNDDIK
FT                   DITHSSTATLKFYINYSNPTTVTTTMESASKALGSQIQKSVLLKQGQSILTIAELNQLQ
FT                   KQVTTAIAANPKQRDIILKQATTTKNDATQQIKKTYQNIAKTYDYHIIKVNQVPSGMHH
FT                   SMAPFFLTLSFYIGSMIAAMLIVTSYKSFSPLIGRWRAYLYTEITIGVLSVFAPLVIIG
FT                   LSKYMLNFNTNIYWQLWLTHSIELFSALNINLIFSLILGQLGIMINMPFMLVQVISGAG
FT                   MIPQCLLPKFFKIMSYISPSFYTIQSDFNILYGGNHTQILLLKLLTIGLVAVALHLIIV
FT                   ACQKNKSAIIKPA"
FT   CDS_pept        285646..286233
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0283"
FT                   /product="Transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90931"
FT                   /protein_id="CBL90931.1"
FT                   /translation="MSKENEDSNYELILNAFISLLIRVGYQATTINKIAETANVNPSTV
FT                   FRKFKDKEGLLNVVIDRHLQDLSTIFDDFTATGNIENDLVTMSKIYQEFQISHQQIVVV
FT                   GFQESFKRPDIAKAVEDIPIKFRAILLAYFDDMKRQEKIASTIDTDSATMNFVLLNFGY
FT                   FISTIRFNNPKLVVTSNDFYNKQIRFFAKSLQ"
FT   CDS_pept        286334..287830
FT                   /transl_table=11
FT                   /gene="gltX"
FT                   /locus_tag="LEGAS_0284"
FT                   /product="Glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90932"
FT                   /protein_id="CBL90932.1"
FT                   /translation="MTEEIRVRYAPSPTGHLHIGNARTAIFNWLFARHYNGKFIIRIED
FT                   TDTARNIADGEKSQLDNLAWLGLDWDESPENPGEYGPYRQSERNEQGLYQPFIDELLAK
FT                   GLAYKSYKTTETIAAEREAQQAAKQAPHYVYEYEGLTSEEREAKYAEFEAQGLKAVVRF
FT                   RVPEEKVYAWDDIVKGHIEIGAKEVGGDWVIQKTDGMPTYNFAVVVDDHLMKISHVLRG
FT                   DDHVSNTPKQIMIFEALGWNVPKFGHMALIINGETGKKLSKRDENLLQFVEQYHELGYQ
FT                   PQAMVNFIGLLGWSPKGEDEIFSLESFKQMFDETRLSKANAKFDQKKLEWINNQWMRRD
FT                   LDQVMPQLIQELVNANLVSEADAETKKDWLAEVIKVAGVEGISYTREVVALVRQPFFEL
FT                   GDMTDEMVDYLTSDDGRKVFSAWESAYTALPESATAEDYMNTIRSIQNTLEIKGRNLWN
FT                   PIRIATTHEIQGPNLPEMLVVMDKKTILSTMADIKATYLN"
FT   CDS_pept        287983..288885
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0285"
FT                   /product="Putative zinc-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90933"
FT                   /protein_id="CBL90933.1"
FT                   /translation="MYAIEMIDYGDVDVLVATKTAVQPIIKPTQVLVKQHATAIDPYDV
FT                   KFRQGLMGQEKTVPLIPGSSVAGEIIALGEEVTGFTIGDRVAASPHLNSYAEFVALGRK
FT                   TVAKIPDNVSYAQAAALALGAQTGYQIITEDLNVQADESVLILGGAGSVGLTALQMAKL
FT                   RGVNEIFTTAVGEGISFLKQFDSNLHVIDARADQLVKIIPEGVDVILDTIGHDTLKQAL
FT                   SVLKPTGRLVSLVGDDSDVRVTHGYLKSNGEQLRDLLQLVSEDKIKVIISDIKPFNVEN
FT                   LKTFQTLKHVIGKLVLTFE"
FT   CDS_pept        289056..290111
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="LEGAS_0286"
FT                   /product="alcohol dehydrogenase, propanol-preferring"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90934"
FT                   /protein_id="CBL90934.1"
FT                   /translation="MKAAVVRETPNGYVDLIDDWTPRPLTFGEALVDMEYVGLCHTDLH
FT                   VAGADFGNPNEIGQRNGQFRRVIGHEGVGRVSKLAEGAGDYLKIGDRVSVAWFYDACGV
FT                   CDYCVSGNETFCRKVRNSGYTVDGAMSQQTVVNAKYAVKVPEGLDPVEATSITCAGVTM
FT                   YKSLKVGETKPGQWVSVHGAGGLGNLAVQYAHNVFGAHVAVIDGNDDKLAAAKANGAEV
FT                   LINRKKVADVAAEVQKATGGVHNAQVTAVNAAAFDQAVSSLRPMGKLVAVALPQGDMAL
FT                   NIAKTVLDGIEVRGSLVGTRADLKEAFQFGAEGKVKPIVEKVNFNDMNEVIDEMKAGSI
FT                   TGRKVFDLTAL"
FT   CDS_pept        290296..290838
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0287"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90935"
FT                   /protein_id="CBL90935.1"
FT                   /translation="MPYFTQQLFNGQRDRILRVVDEANEGQETAGFIHIFDERRVFDFD
FT                   YALELTDGNITQEAFDEEGEANNTFSVNFMPLTQSDQEEVPNEVFEAWSALIGRDYALM
FT                   PHVHINMYQQPLKQEIEQIDKDSFEERLLELVTRILGSSVVGFEEKALTLFPSYLVQEQ
FT                   QEIQTQQGPSTQIILPD"
FT   CDS_pept        291083..291202
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0288"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90936"
FT                   /protein_id="CBL90936.1"
FT                   /translation="MGGTTFIASQLIIMINWDFFINLKLETIMPMIVKDMLVK"
FT   CDS_pept        291324..291890
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0289"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90937"
FT                   /protein_id="CBL90937.1"
FT                   /translation="MNTKKKSEGFSVRSVVATGIGAAVFFVLMKFIAIPTGVPNTTINV
FT                   AEGWLALIAGLFGPVVGLLVGFIGHTLNDAVTYGSPWWSWVIADGIFGFLLGLGKKYLA
FT                   LEYGNLSNKKLIQFNIWQVVSNIIAWFIIAPIGDILIYKEAAQKVFLQGAVTAVVNSLS
FT                   VAIIGSLLLVAYVKSRPKKNSLRNE"
FT   CDS_pept        291944..293629
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0290"
FT                   /product="ABC transporter ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90938"
FT                   /protein_id="CBL90938.1"
FT                   /translation="MPAPIIDFQHVTFKYHAQAEPTLHDVSFQIYPGEKVLIAGASGSG
FT                   KTTLLRLLNGLIPQAYAGDITGKLTLNGENIIEQTLFDLSLQAGTVLQDSDAQFVGLTV
FT                   AEDIAFALENDNQPVSHIKAEVSKWANRFGLGERLGLAPQALSGGQKQRTAMAGVLVDD
FT                   GKLLLFDEPLASLDPAAGVVAMEMIDKLQTERELTVVIIEHRIEEVLSAHVDRVIVMAD
FT                   GRIVANGTPTEMIQSGILPENGLDEPLYVKLLRRANVDVASLANVADVQRVVVDENKLA
FT                   IEKLKIPVKKGLHHTPKLVIKNIDFSYDKNQQLFKQFNTVIHQGEVLGIVGKNGSGKTT
FT                   LSHLLTGFLMPDAGDILLDGESVLQQSIKERADNIGYVLQNPNHMITKATVFEEVASGL
FT                   ILRHVPTDDVEARTRAVLKLIDLDNMRHWPISALSFGQKKRLTIAAVLVLAPQILILDE
FT                   PTAGQDATHTGDLLNFLATINQQEKTTIVIITHDMHLLANFVERALVVVDGQLLADTTP
FT                   AELLANEKLVTAASLRTTSIYQLANRLGISNPEELNAAIVHGQV"
FT   CDS_pept        293712..294548
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0291"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90939"
FT                   /protein_id="CBL90939.1"
FT                   /translation="MTMNNLFGYKERDTWLNHTTGTAKLVGFLAISTMGMISYDTRFLL
FT                   ALGILAIILMKMAQIKYHEYALMLKLVLFFAVINLVMVTVLAPQYGAQLYGTHHALFGS
FT                   GYWTITEEQVFYEFNLLLKYLFSLPLAIILLFTTNPSEFAAGLNKIGVPYKIAYSFAIT
FT                   LRYIPDVQSDYHTISLAQQARGYEISKKESLLARSKGAVQIIIPLIFTSLDRIETISQA
FT                   MELRRFGRGKKRSWYQEQAFSKRDMLVFIGSIVVIVTGIGLLISNGGRLYNPFQNR"
FT   CDS_pept        294563..296008
FT                   /transl_table=11
FT                   /gene="pepV2"
FT                   /locus_tag="LEGAS_0292"
FT                   /product="Xaa-His dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90940"
FT                   /protein_id="CBL90940.1"
FT                   /translation="MQKTAREWQEEAKKYQPSLQQDLLQFLAIPSVLDTTTATFQQPFG
FT                   IGIETALQFLFDLATRDGFTVTRVADNMVVVVDYGPNDADETVGVLSHVDVVPGNASAW
FT                   RMTLPFSPKIVGNRLYGRGTHDMKADLIASYYALLQLKNNGFLPKRSIRLIFGSDEESD
FT                   WRDMKTYLAQVGEPTLGFSPDGAFPVVPGEKGVQTITIKFQGETRLDSDWQLLKFEAGE
FT                   RDNVVPGVAKAIVSLPNNFDINQFLAIYEQYLTQTPLITGIGQYDDGHILLTLYGKAVH
FT                   GAYPEDGLNAGTYLAHFLNRFAFEGQAHAFLEFLGDDNHQNVFGEKVGLVFHDAIMGDL
FT                   TMNIGKMTYRQAQPSQIRIQFRFPIGITETAILTQVQRHIGDLNAKIFKETQFGNQPHM
FT                   VNLDDPIVQTLESVYAQHTNTAKTYKISNGGSYARLLKRGVAFGGQFPNVEVMSHQPDE
FT                   YVLLENIPRAQAIFAQALYELSK"
FT   CDS_pept        296058..296363
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0293"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90941"
FT                   /protein_id="CBL90941.1"
FT                   /translation="MQLPEFRKALEQALSTQIVDNVLMKAYVFQETKNNARKERAQYGT
FT                   VKLERNADAMWENIVANLLVSMQGKKDEAILKQLEDSDFIDTITDMLEEVEFNNES"
FT   CDS_pept        296530..296826
FT                   /transl_table=11
FT                   /gene="rpsF"
FT                   /locus_tag="LEGAS_0294"
FT                   /product="30S ribosomal protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90942"
FT                   /protein_id="CBL90942.1"
FT                   /translation="MATSYEMTYIVRPDLESDAKKALVERFDSILTDNGATITKSADWA
FT                   TRRFAYEIAGYREGVYHIINFTAEDDAAINEFDRLAKISQDILRHMIIKRDAE"
FT   CDS_pept        296860..297402
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="LEGAS_0295"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90943"
FT                   /protein_id="CBL90943.1"
FT                   /translation="MINRVVLIGRLTRDVELRYTQSGTAVGTFSLAVNRQFTNQAGERE
FT                   ADFINAVIWRKAAENFANFTGKGALVAVEGRLQTRNYENNQGQRVYVTEVVVDNFSLLE
FT                   SRAESDKRRAQNGTSEPSNNGGGFSAPSDNSFSGVDPFASANQNSNTQSTATNEAANPF
FT                   AASGKTEIDISDDDLPF"
FT   CDS_pept        297440..297724
FT                   /transl_table=11
FT                   /gene="rpsR"
FT                   /locus_tag="LEGAS_0296"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90944"
FT                   /protein_id="CBL90944.1"
FT                   /translation="MPEQNSRPQNSERPQRSRRPQGGPRRRRKVDFIAANHIEHIDYKN
FT                   TELLERFISERGKILPRRVTGTSAKNQRKVTIAIKRARIMALLPFVTED"
FT   CDS_pept        297870..299900
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0297"
FT                   /product="Phosphoesterase, DHH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90945"
FT                   /protein_id="CBL90945.1"
FT                   /translation="MKKLFNFKTLPIFFQNSKLGTVTLLLLFVSVMSGIFALMNNLVFG
FT                   LIWVIVVVVGLVYSTQALKEVNENAQEYLSGLGYRISRSEQEALIRMPIGIILLNDTEK
FT                   IDWINPYMQAYLDKRDVLGMTLADLDQSLATDVKNYSDAKETNTITWQNKQFSLYVQQN
FT                   LRVIYMMDISEYAAIATEYEDHQLFSGLISVDNYEEVTEGMGESETSTLRTYVTGALGD
FT                   WAAKHHIYLRRLNTLHYVMFGYQTSLSAAEKDKFSILKAIREATAQQNSPVTLSMGIAY
FT                   GEQDIISLAKMAQTNLDLALGRGGDQVVVNSNQTAARFYGGATNPMEKRTRVRARMISQ
FT                   TVAELMEQSDNVMIVGHATPDLDAIGAGLGIWRMAQTKNKAAFLIIDEKTVYSDITSLL
FT                   AEIRKNPPDIVAPGSNINDSIVDESRALKLVRDNTLLILVDHASAAITSAPHLLEKMAN
FT                   RVVAIDHHRLAEKGLAEKPLLSYVEPYASSTSELVVEMLQYQDQSHAPITKLEATAMLG
FT                   GIQIDTKNFTLRTGTRTFDAASYLRANGADSNLIQSFMKEKFTDFKARTHLINLAVIHT
FT                   GSAIVTGENNMTYSGLITAQAADELLQISGVEASYVITKRVDGRVGISARSTGQHNVQR
FT                   VMESMGGGGHLSNAATQISDMTTEEVTEQLQHILTENIEEQ"
FT   CDS_pept        299967..300419
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="LEGAS_0298"
FT                   /product="50S ribosomal protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90946"
FT                   /protein_id="CBL90946.1"
FT                   /translation="MKVVFLEDVKGRGKKGEIKEVPDGYANNFLIKNKKAEPATGKNLG
FT                   AVKGRQKAEDKAAAESLAEAQTLKSKIEDEKFVVELKGKSGTDGRLFGAVSTKQIVTAL
FT                   ADQKQLKVDKRKLVLNQPIHSLGYTDVPLKLHREVTANLRVHVSEG"
FT   CDS_pept        300422..301888
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="LEGAS_0299"
FT                   /product="Replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90947"
FT                   /protein_id="CBL90947.1"
FT                   /translation="MDNPGSYEYRQVPQDVDAERAVLGAIFFDVKSDNAMVEANAIIES
FT                   DDFYRQANQTIFKAMQQLIDEQRPIDMLTLQDKLNSMQQLDNVGGMAYLAEISESSASS
FT                   ANLKHYANIVREKAILRRMIDTLTRSMSLAYDASEPSEDILDALNRNLDGLAENRGDDD
FT                   FQKIKDVLQEFQANLDNAVENDNDVVGLATGYPELDKLTHGFREDQMVVLGARPAVGKT
FT                   AFVLNIAKNVAKSEQVPVVVFSLEMGAVDLVTRLVAAEGAIDSNHLTTGKMTQEDWQSL
FT                   TLAMQSLANMQIYLDDTPGIKINQISAKLRKLEKDIVNDMTSDQRVNNPHPIGMVIIDY
FT                   LGLIESNNKESRQQAVSEVSRSIKKLAKELHTPILALAQLSRGVEQRTDKRPVLSDLRE
FT                   SGSIEQDADIVAFLYRDDYYRNEGGEDEGNSDPRDEEEAVPIEIILEKNRAGARGTATL
FT                   MFNKPTFKFSPMAPLFRDDPNAGPNGSTGW"
FT   CDS_pept        complement(301941..302489)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0300"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90948"
FT                   /protein_id="CBL90948.1"
FT                   /translation="MINILISHIIWWFIVPVMSAYLMSLVSSFFTNLAIRHTSYKLVAI
FT                   IGFWGVVIHELSHLLVALIFHHKITHFKLWQITDDGVLGYVNHTYNTQSFYQRLGNVFI
FT                   GLAPIFVLTIIFFILTQLTYDSFWSIFGIMFFLPSFILGFNLSKADWLNFWYGVPFYLI
FT                   SIIIVSAIEFAIKNIPILF"
FT   CDS_pept        complement(302482..302982)
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="LEGAS_0301"
FT                   /product="Recognition/discrimination or editing of
FT                   prolyl-tRNA (Putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90949"
FT                   /protein_id="CBL90949.1"
FT                   /translation="MAKKKIKKTLPEQIMDKHGVTYEPLTLNILDKSEKERDTILNTYN
FT                   VKHDDIYKTLAASGDRTGPLIAVLPITKHLSMKKLAAVSGNKKVTMLSLKDLQKTTGYV
FT                   HGANNPIGIWQNKHFPIYIDTTAKNAEYFLVSGGELDRSDKINPNDIAELINAPFVDLL
FT                   EHD"
FT   CDS_pept        303062..303790
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0302"
FT                   /product="Transcription regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90950"
FT                   /protein_id="CBL90950.1"
FT                   /translation="MSEAIYVTVQADLKQKIYQGEFPNLKLPDERSLAEQYGVSRSSIK
FT                   RALNVLVQQGVIFKKRGSGTFVNPLYLKNNAIFQHEGSNLGVTDSFRVDGQAPSIELLD
FT                   FQVVAATPEQQQALFLNDGDFVYEIKRLRRLAGEPFMIERGYVPIAVVPGLNREIVSGS
FT                   VYEYIEKTKHRTVTKSFMTIMAEPSTSEDRELLELKVNEPVGIMEGIFFMDDGTPLEFS
FT                   TMRLHYKYLRYNAFVSLDAE"
FT   CDS_pept        304112..306565
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="LEGAS_0303"
FT                   /product="Xylulose-5-phosphate/fructose-6-phosphate
FT                   phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90951"
FT                   /protein_id="CBL90951.1"
FT                   /translation="MVDFNSKEYLGLVDKWWRATNYLSAGMIFLKSNPLFSVTNTPIEA
FT                   EDVKVKPIGHWGTISGQTFLYAHANRLINKYDLNMFYIGGPGHGGQVMVTNAYLDGEYT
FT                   EDYPEITQDLEGMSRLFKRFSFPGGIGSHMTAQTPGSLHEGGELGYSLSHAFGAVLDNP
FT                   KQIAFAVVGDGEAETGPSMTSWHSTKFLSAKNDGAVLPILDLNGFKISNPTIFSRMSHE
FT                   EITKFFEGLGYSPRFIENDDIHDYAAYHELAANVFDQAIEDIQAIQKDARENGKYEDGT
FT                   IPAWPVIIARLPKGWGGPTHDQKGNPIENSFRAHQVPLSLEQNDLSTLKQFEDWMNSYK
FT                   PEELFNADGSLKDELKAIAPKGDKRMSANPIANGGRARGAKAQDLTLPDWRQFTNEITN
FT                   ENRGHEFAAVTQNMDMTTLSNYLEEVMKLNPTSFRVFGPDETMSNRLWSLFNTTNRQWM
FT                   EEVKEPNDQYVGPEGRIIDSQLSEHQAEGWLEGYTLTGRVGIFASYESFLRVVDTMITQ
FT                   HFKWLRHASEQSWRNDYPSLNLIATSTAFQQDHNGYTHQDPGMLTHLAEKKSNFIREYL
FT                   PADGNSLLAVQDRAFSERHKVNLIIASKQPRQQWFTADEADVLANEGLKIIDWASTAPS
FT                   GDVDITFASAGTEPTIETLAALWLINQAFPEVKFRYVNVVELLRLQKKSEPNMNDEREL
FT                   SAEEFNKYFQADKPVIFGFHAYENLVESFFFERKFKGDVYVHGYREDGDITTTYDMRVY
FT                   SQLDRFHQAKEAAEILSANGAINQAAADTFIAKMDETLAKHFEVTRNEGRDIAEFTDWN
FT                   WSALK"
FT   CDS_pept        306689..307216
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0304"
FT                   /product="NUDIX hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90952"
FT                   /protein_id="CBL90952.1"
FT                   /translation="MLNKDKRADKLGELWDIYDEKNELTGRTHHRGEKLNVGDYHLVVN
FT                   ALIFNIQGNVLLQQRSFQKITDPGMWTIATGGSALTGETSESAVIRELHEELNLIVTKN
FT                   QLQFLKKCRYVVCIDESLDNMTRQISEVEAIKWATLSEVFQISRSNDFNDDHILIQAKT
FT                   KLLDTDNGQFYT"
FT   CDS_pept        307398..308216
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0305"
FT                   /product="Hydrolase, HAD superfamily, Cof subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90953"
FT                   /protein_id="CBL90953.1"
FT                   /translation="MSKIKIVSIDIDGTLLNDQREITSEVKSSIQQALANDVKIVITTG
FT                   RPLPGVRDILSELGIEGNNQYVITYNGGLVQTASGEKTLFRQPLSVKEFQKINAFMLIQ
FT                   NTYVQVETQDAAYTTNHRIHHWASFENSLVNLPLFVLDTESALEKVEFIKAIANAESDE
FT                   LDTIQAIVPADIADNVNVIRSTANNLEFIDRHASKGHALLALAEKLGIEQAETMAIGDQ
FT                   ANDYSMIEQAGIGVAMGNAIADIKHIANAQTATNNESGVAQAIEKFVLSK"
FT   CDS_pept        308274..308771
FT                   /transl_table=11
FT                   /gene="tpx"
FT                   /locus_tag="LEGAS_0306"
FT                   /product="Thioredoxin peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90954"
FT                   /protein_id="CBL90954.1"
FT                   /translation="MNVLLSGEVTELVGEPLKIGDTLPHFKLEDENGDKVKTADLVGKL
FT                   TLISVVPDLNTGTCSLQTRHFNQAVGQFQDVQFLTVSTNSVSEQRDWCAAEGVHNLRML
FT                   SDEQESFGYATKLYIPSQGFDTRSVYIIDAQGVVRYAQIVPEVSEEPDYDDALKALQTL
FT                   SA"
FT   CDS_pept        308857..309837
FT                   /transl_table=11
FT                   /gene="prs1"
FT                   /locus_tag="LEGAS_0307"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90955"
FT                   /protein_id="CBL90955.1"
FT                   /translation="MPEPKLKLFSLSSNEPLAKKIAESVGVPLSEISVKRFADGEVQIN
FT                   IEESIRGDNVFVIQSTSAPVNDNLMELLIMIDALRRASANQINVVLPYYGYARQDRKAR
FT                   SREPITAKLVANMLERAGTTRVLALDLHAAQIQGFFDIPMDHLQAAPLLADYLIESGIA
FT                   DKQNAVIVSPDHGGMTRARNLNNMLALESPVAVIDKRRPKPNVAEIGSIVGDVQGKTAI
FT                   MIDDMIDTAGTITQGAQLIMAHGAKEVYVVASHAVFSGPAIERLQNSVFTKVILTDSID
FT                   LPDEKKFDKLEIVSVGELIGEAIRRVNNNEAISSLFKNRFHRRSH"
FT   CDS_pept        309979..310686
FT                   /transl_table=11
FT                   /gene="yycF"
FT                   /locus_tag="LEGAS_0308"
FT                   /product="Two-component response regulator yycF"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90956"
FT                   /protein_id="CBL90956.1"
FT                   /translation="MSKILVVDDEKPISDIIKFNLTKEGYEVVTAADGQEALTVFNEEK
FT                   PDLVLLDQMLPEIDGVEVLRQIRSKSETPVIMVTAKDSEIDKVLGLEMGADDYVTKPFS
FT                   NRELVARVKANLRSRKAVAQHIDESVVNTDDIELGDLTIHPQAYMVSKAGQDIELTHRE
FT                   FELLYYLAQHISQVMTREHLLQQVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPNWLAT
FT                   RRGVGYYLRPDAE"
FT   CDS_pept        310793..312664
FT                   /transl_table=11
FT                   /gene="yycG"
FT                   /locus_tag="LEGAS_0309"
FT                   /product="Two-component sensor kinase yycG"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90957"
FT                   /protein_id="CBL90957.1"
FT                   /translation="MNIKTNFFKSIRFRITLVFVLLMIIALELLGAFFVRQIEQQNLAT
FT                   FQQQMTLPKYVTDQITTALRNRDVDAGNHAIQDVLIGLNNTNLQEAQVIDKTGTIRGTL
FT                   SVSGQQTIGQKTTDLNAQRAVAGEQSFLTSRTISEGGERKELMTTTLGVTTGRVRDIIG
FT                   VVVVKASLLPVYRNVNSVMRLFVIASLVALFVSIALALFLARTLTRPIAQIDEQTTKIA
FT                   GGDYSMVNHIYGSDELGHLAQSVNELSTRVEESTETVNAERNRLDSVLTHMADGVLAAN
FT                   RRGEITIINQAAANFVGVDREAAIGQNVIDLLRLQGKRTLRDMLENLDDFRVDLSDDST
FT                   DILLQAYVSLIKRQSGFISGLVVVLHNITEQQRIDSERRMFVSNVSHELRTPLTSVRSY
FT                   VDALAEGAIDDPEMAQNFLGVVQDETQRMIRMINDLLALSRLDQGTMDVRLEVVNLNSL
FT                   FNFVLNRFDMIIESDAKNTDTPNKNYNIQREFTNEDVWVEVDPDKFTQVLDNIMNNAVK
FT                   YSPDGGTITARLIKTKTRAILSISDQGLGIPRKDLDSIFNRFFRVDKSRSRAQGGTGLG
FT                   LAISKEVVERFNGRIWVDSVENRGSTFYISLAYVDDDVIEEGDWDAE"
FT   CDS_pept        312654..313952
FT                   /transl_table=11
FT                   /gene="yycH"
FT                   /locus_tag="LEGAS_0310"
FT                   /product="Two-component system yycF/yycG regulatory protein
FT                   yycH"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90958"
FT                   /protein_id="CBL90958.1"
FT                   /translation="MRNKQKFLQNVLLNGLLVLSLVISVVLTAFIFSSFGKNEAPDQST
FT                   AQQPEKQLLEIFRPTQYIVNQTDGSQQLVMNATDAKLKKMRHALTDAQLTDAQTKTVNI
FT                   AGIKKVLATKKAQIFHYSDVVPISYFNIRYDQRVSTRKNLNFDYFVLALDRSNNGYFVN
FT                   TKTNQITTVKVNKLNHHDAWQLAQQLPKSLNINFQNYHNRVGLNYLQKIKLPVYSYLVN
FT                   NRDPKTYVSALLGTINQLNVTQDGDKTVYSNKLNNQTIVYDPNWATVTFEDHNKKNKLP
FT                   EFYVDRLNTGLSQINLLQSDFTDTRFYESQQNGQKITFRTYVEGFPVYFQSEIGAIHMT
FT                   MDKHGNLTSTYSLNEIGVPVPNNQPDVVLPSTREIIKQLSDAGVQEKDYNFIAPGYQWL
FT                   LDQGSQAAVNMEPTWMIETASGWQSVSSFLKTR"
FT   CDS_pept        313986..314750
FT                   /transl_table=11
FT                   /gene="yycI"
FT                   /locus_tag="LEGAS_0311"
FT                   /product="Two-component system yycF/yycG regulatory protein
FT                   yycI"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90959"
FT                   /protein_id="CBL90959.1"
FT                   /translation="MQFKRIKILMLILFFLLDIFLLNWWRSGEVSQERVTDANTDIISE
FT                   MKKQKIKLPKFGTSLHYSSYVAAQYGDRREMSLPAGLDVSTGAKTNTVFAKFKRDLFKK
FT                   NGTGSDESVLSTYSAGYQFNPVLTANKTNRDRVYSQRVEGLPVIADSGIMTFQYNKSGK
FT                   PVGFTKRQLVNIERLRDDRATITEEEAIISLYRYNEIDSGDSLSKGYLSYDRTLTVNGY
FT                   DIFLPVWAFEAYSGNEKYVLKINAFTGDNLSE"
FT   CDS_pept        314813..315952
FT                   /transl_table=11
FT                   /gene="htrA1"
FT                   /locus_tag="LEGAS_0312"
FT                   /product="Serine protease HtrA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90960"
FT                   /protein_id="CBL90960.1"
FT                   /translation="MAQQSVTKIILTGAIAGIIGGGAILYGQRGVENLQATTQKVNTKA
FT                   TKTTTISQNATATSAYGKISDAVVSVLNFSKSGINSYQESSEGSGVIYKKAGDAAYVVT
FT                   NNHVIHGAAQIQVMLHDGKKVTATLVGKDAMTDLAVLKIDPSVVTTTADFGDSSKIQVG
FT                   QKVLAIGSPLGSEYASSVTEGIISAKKRLVASTSENGQNYGGSTVIQTDAAINPGNSGG
FT                   PLVNFQGQVVGINSMKLSSSASGTSVEGMGFAIPSDQVVDVVNKLVRDGKITRPAIGIG
FT                   LVELSAVTVDDQKTLLKIPTSVNGGVVVMSTTQNGPADKAGLKKYDVITAIDGKEVTGQ
FT                   ADLREELYKHNLNDTVTITYYHQEDKKTVKVKLTQKLES"
FT   CDS_pept        316592..317071
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0313"
FT                   /product="UPF0247 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90961"
FT                   /protein_id="CBL90961.1"
FT                   /translation="MNIKLITVGKLKEKYLKDGIAEYTKRLSRFAKMEIIELIDEKTPE
FT                   KASIAQNNQIIAKEGGRIAEKIGPRDFVIVLAIEGKQLASEAFSKKLADVTVSGYSDIT
FT                   FVIGGSLGIDPLIKQRANMKMSFGLLTLPHQLMRLVLIEQIYRAFMIQQGSPYHK"
FT   CDS_pept        317177..317983
FT                   /transl_table=11
FT                   /gene="thiD2"
FT                   /locus_tag="LEGAS_0314"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90962"
FT                   /protein_id="CBL90962.1"
FT                   /translation="MNEFPQVLTIAGSDSDGSAGMQADLHTFFIRKTYGMSVLVAAVAG
FT                   NSFGIHAAETLPLPFIEKQFEVLADDFQIRASKTGMLSDANLIATVVTAYKTYNFGPLV
FT                   VDPVITTKHGAQLLADSAFQALKTQLLPLAEVATPNFFEAQLLTGRTINSEAEQREAAR
FT                   DIQKFGVKNVVIKGWHNQENQSEVADYVLLANGSDFWLRHSYFDTTHINGTGDTLSATI
FT                   AAEIAKGTDVATAIKIGHDVTTAAIEHEIAVGHQFGPINHWAAADI"
FT   CDS_pept        complement(318078..319481)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0315"
FT                   /product="Multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90963"
FT                   /protein_id="CBL90963.1"
FT                   /translation="MNISKKQKSVLIILVIGTFLGFLNQTLMNVALPNIMHEFNIGPGL
FT                   GQWITNGYMLVNGVMVPLTAFLIQRLTTRRLYLTAVGLFAIGTLIAGFAPNFTVLITGR
FT                   MIQAMGAGVFGPLMNVIVMNLFAPDKRGGAMGLIGLALNFAPTLGPTLSGFIVTNLSWR
FT                   FLFFIVAPLIIADFILAYFLLQNIGEQKMLKFDFIGVVLSSIGLGSLLYGFSNAGATPW
FT                   SEFTVWGFIVIGLIVTALFIWRQFSTKTPLLNMAVLKQREFVIAMLINIVLMIAMYGGA
FT                   LMLPLYMQTIRGASAFISGLVLFPGALVTAFLSPWSGRLYDQYGVKYLTLIGILITAAG
FT                   TIVLASLTLTTPLWFAVIGQFIRQLGLVLVLMPIQTEAFNALPLALMPDGSAMFTTVRQ
FT                   IAASFGTAALVTIMTRSSLSYGKTHASTLDVLIQLHGIKITFLTAAALMLVGAALTLLF
FT                   KNKAPRDFI"
FT   CDS_pept        complement(319597..319740)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0316"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90964"
FT                   /protein_id="CBL90964.1"
FT                   /translation="MALKKPLNSFARARKVGHNSAKKQRQTAIAKLQQWAKGKSEELPV
FT                   TK"
FT   CDS_pept        319868..320890
FT                   /transl_table=11
FT                   /gene="mutY"
FT                   /locus_tag="LEGAS_0317"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90965"
FT                   /protein_id="CBL90965.1"
FT                   /translation="MEIWSEQTIKDFRRTLLDWYNQEGRANLPWRVNHEPYRVLVSEIM
FT                   LQQTQVDTVLPYYERFMSDLPTVQDLAYAPEAQVLKLWEGLGYYSRARNLQKAAKFIVE
FT                   ELHGHWPESSDDLQELPGVGPYTSAAIASISFDEVVPAVDGNAYRVFSRLLKIDADIAN
FT                   TKSRHIFYDAILPIVDPVHPGDFNQAIMDLGSSYMTAKNPDSSHSPVRSFNAAFRDNVE
FT                   ANFPVKTKKQKPIKQQYIAIISEKNGQLLFEQRPDTGLLAGFWTFPLMPINSIDDIEGQ
FT                   QLNIKPIIHVFTHRRWEIWLVKQKVDHMPNQKYLSPNDWQTLSLPTVQHKLLKALEDLK
FT                   "
FT   CDS_pept        320890..322008
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0318"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90966"
FT                   /protein_id="CBL90966.1"
FT                   /translation="MFPNMKLKKLFFWTLELLAGAVLILIVSGFDFLMRPISVFISTVF
FT                   VPLLVAGFLYYVLKPILKLVTKIKIFGKSIPHQFAVIITFVLFLAVIATALIVLVPTLI
FT                   REITNLITAMPSFAQDMQRFATETINSRWFENLHLSVNADQIRSAVGQYAASFLNITAG
FT                   TLGTVVSTVTSVTINLVTIPVVLFYMLSDGDRLVPAIKKAFPDRHAQKISELTTKMDNT
FT                   IEKYISGQAIEMLFVGVTMAIGYLIIGQPYAWLLAVVAGITNIVPYIGPWIGVIPALIV
FT                   ASTQSWKQMIFVFIVMTVVQQLDGNFIYPNVIGKSLAIHPLTIMLLLMVAGNLWGIVGM
FT                   IVIVPVYAVLRVIISFVLELFALTKSQDILRE"
FT   tRNA            322232..322313
FT                   /locus_tag="LEGAS_R0004"
FT                   /product="tRNA-Leu"
FT   tRNA            322377..322449
FT                   /locus_tag="LEGAS_R0005"
FT                   /product="tRNA-Thr"
FT   CDS_pept        322587..322943
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0319"
FT                   /product="Transcriptional regulator, PadR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90967"
FT                   /protein_id="CBL90967.1"
FT                   /translation="MKPNISSQMLKGILQGVMLMILVKKPDYGYGISKQINQYGLDDIP
FT                   KGTIYPLLTMMEKRGLVEGKIQPSAAGPDRKYYFITSDGIVAKQQFIKEWQFLESAVNQ
FT                   LIDEGTNDENKRND"
FT   CDS_pept        322921..323769
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0320"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90968"
FT                   /protein_id="CBL90968.1"
FT                   /translation="MKTKEMIEMNNELRKNLNDENKIFYENLLLYLRIEGFSRDENKIE
FT                   THLLMILQDILEAQNDGITAETYFGKNPKTIADELLAEMPRSPLEVIKTGLYAVMGYMG
FT                   VSFLPDLMTAGKPVDIGALGLSGLYLFGIVLILFKYIGRTIYNVNIMIQNKILKFLAAF
FT                   VAVSIGIAPVTLIEILVKTPVRFQLDGWFGIIVIILGLLIGAFFFIRQKDKTFGWPFVI
FT                   YLCGAGVLGIMTRLPKIGHFLMATQNGRYIVVGIIIVLLMVFWLWNVIIAKKLKKLDES
FT                   K"
FT   CDS_pept        complement(323812..325308)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0321"
FT                   /product="RNA m5u methyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90969"
FT                   /protein_id="CBL90969.1"
FT                   /translation="MTENSPKKRAYAQKNSNSSGKKPFYGKKFDPRKSGQRQDTHFDGV
FT                   DVHVDQNFPLTIKRLGINGEGIGYFKRKIVFVPGALPDEVAVVRVTEVEPKYIAARVLK
FT                   IREKSPNRVKPMDEFATEVGGFELEHMTYPAQLAFKKDVLVQSLEKFQPRGWSDYDLRD
FT                   TIGMENPYEYRNKAQFPVRKIGKKLSIGMYKRGSHDLVDLPVVHTQDPITMKVLRTIRE
FT                   LLDKLSVSIYNEDKNHGTVKTIVVRVSHTTGEVQLTFVTNTDGFPGDTALITAINQALP
FT                   EVTGIFQNFNPGRTSLVWGDETIKLWGKDYIEETVMGKTFQLSPRAFMQLNYTQMAVVY
FT                   KEALLALDLTHADKLVDAYAGVGTIGLSLADKVGEVRGMEIIPEAVDDANINAKINHIE
FT                   NAQYEVGTAEELFPKWQSEGWLADALVVDPPRTGLDTALRREILRTKPEKFVYISCNAS
FT                   TLARDLVDLTKAYKVDYIQSIDMFPQTARWEGVVKLTRRD"
FT   CDS_pept        325592..325825
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0322"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90970"
FT                   /protein_id="CBL90970.1"
FT                   /translation="MRFDIKAYLDDNSLTIYRVAKDSGYGYTTIHKSFNKTQSDATSLN
FT                   MRDLDALAKAQHQAMWEVLRDLEKLYFNSDER"
FT   CDS_pept        325880..328003
FT                   /transl_table=11
FT                   /gene="clpL"
FT                   /locus_tag="LEGAS_0323"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   ClpL"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90971"
FT                   /protein_id="CBL90971.1"
FT                   /translation="MANDNFLNDPFGSDMNNIFNNMMGNMNGYNSENRRYLINGQEVTP
FT                   EQFAQYRQSGQLPQGQQAIINGDSTGRQGAQSQGQPQPEGILAKLGRNLTQEARDGLLD
FT                   PVIGRNKEIQETAEILGRRTKNNPVLVGDAGVGKTAVVEGLAQAIVTGDVPAAIKDKEI
FT                   YSIDISSLEAGTQFRGAFEENIQNLMKEVKSAGNVILFFDEIHQILGAGSTGGEDGGKG
FT                   LADIIKPALSRGEISVIGATTQDEYRNTIMKNAALARRFNEVTVNAPSAKDTLQILKGI
FT                   AALYETHHHVSLPEDVLKAAVDYAVQYIPQRSLPDKAIDLLDMTAAHLSAKNPVTDKVS
FT                   LEKQLHDTKAKQEKAVADEDFEAALKHKNTIAELEKKIAGADEATKVVATANDVAESVE
FT                   RLTGIPVAQMGASDIERLKTIGDRLAGKVIGQEDAVNMVARAIRRNRAGFDEGNRPIGS
FT                   FLFVGPTGVGKTELAKQLALDMFGSKDNIVRLDMSEYSDLTAVSKLIGTTAGYVGYDDN
FT                   SNTLTEKVRRNPYSIVLLDEIEKANPQILTLLLQVMDDGRLTDGQGNVVNFKNTVIIAT
FT                   SNAGFSDKSDGELMSRLAPYFRPEFLNRFNGVIEFSTLSKDDLKQIVDLMLADVNQTLA
FT                   KKELTLQVSDDVKNHLIEDGYDEAMGARPLRRVIEQQIRDQVTDFYLDNPGEKKLSADL
FT                   VDGQVVISAIIQK"
FT   CDS_pept        328252..328953
FT                   /transl_table=11
FT                   /gene="treR"
FT                   /locus_tag="LEGAS_0324"
FT                   /product="trehalose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90972"
FT                   /protein_id="CBL90972.1"
FT                   /translation="MNKYQIIHDELLKKINDGKYPEDAKLPSDFALMNRYHVARETSRK
FT                   AVAMLVDEGYVMRIKGRGTFVINQNRYSFPISHVESYRELAARLNLNERTQLDAISDKD
FT                   VPLVFDYGEQVPLPATEIVRIRYLDNEPVIIDRDYVLKDVVPEIKSLSASLSLFELFEQ
FT                   KLGLVISYAKKTITIETANTLDRQLMSLTEPMSIVVIRSETFLNDGRIISFTESRHRGD
FT                   RFKSVEFSRRH"
FT   CDS_pept        328991..331039
FT                   /transl_table=11
FT                   /gene="treB"
FT                   /locus_tag="LEGAS_0325"
FT                   /product="PTS system, trehalose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90973"
FT                   /protein_id="CBL90973.1"
FT                   /translation="MTNTKILAPLAGKLIPLIEVDDPIFSKKTMGEGFGLIPAGHDIVA
FT                   PVSGEVIALQGHAFGVHTSDGLDILTHIGLETVSLDGKPFSWTIKKGDHVNAGDEVGSV
FT                   GLAQITAANLSTTTMVVVTNTAERVDSLKVIDYKTVTAGEVVADVAIKQEITETAKMSR
FT                   SVKGSGNQYEGLAADIIAGVGGAQNVDKVIHCITRLRFYLKDHNIADNQAIESLDGIAG
FT                   VNYADSLGQYQVVIGPAVTDVYDEVITQLGDSVVDSDATDQAVAETKGSNGSKNPIVHA
FT                   FQAIIGTITGSMMPIIGLLAAGGMLNGFLSLVSNQASFSAIYFIDPSSSTFTILQSMAM
FT                   APFYFLPILVGFSAAQQLKSDPFVVAVIGAFLVKPEFINLTNAHVVNNAIVQPGKIMGT
FT                   LFGVSLNSSFFGLPINIPSYAYSIFPIIFAAWLARPVGNWLKKKLPLVLRSIFQPLLTL
FT                   VVVASVVLILVGPAITLTSQGISTVINWLLHLNYPLSGLIIGGLYQALVIFGLHWMVVP
FT                   LIANEIAQTGHSTLNAIVNFTMIAQGAGALAVWAKTKIPSLKGLAGAGFLSAMAGITEP
FT                   AMYGINLKYGRVFWMANIGGAVGGFIAGLFNLNMYGFTGSLIGFPSFAVPKGQVGAGNN
FT                   MLIFWIASAATIIVSFAMVYFFGFKDSDASEIKTVEKKNAFKDAVGK"
FT   CDS_pept        331065..333437
FT                   /transl_table=11
FT                   /gene="trepP"
FT                   /locus_tag="LEGAS_0326"
FT                   /product="trehalose 6-phosphate phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90974"
FT                   /protein_id="CBL90974.1"
FT                   /translation="MAENTWSLTYDDIVDGVKNYGRESLLSLGNGFLGWRGALVTNTYD
FT                   DDFYPGLYVAGVFNQTSTPVAGRDVINEDLVNLPNVQLMTVSIAGQPLVINNDTMTNLT
FT                   RRLDFKTGELIDRYRVLVDDNREHFVDIETIKIVDPINWHCLALKFKVTPSYDVDLTVE
FT                   AKIDGSVENKNVARYRDFDSKEFVIQSITDTTMTTCTRTTHVTVALASQSSGENVQSKT
FT                   TQITGDSIIDQYAAHGRTGQAVVITRVMALASDLETKTDPTVFVQNAVDQTTFSEIQQN
FT                   SHDYWDELWQTKDVQITGDDAMQKLIRMGIFHLNQMGNHHANPNLDVSVGSRGLTGEGY
FT                   RGHIFWDELFALPYYSANEPTVARSILKYRTNRLSVAEKNALSENETGAMYPWQSGMYG
FT                   DEQSQLIHLNTVDNTWIPDNSRLQRHVSLAIAYNMWVYQKMTGKLDHLNDNGLEMLMQI
FT                   ARFWINKAQSTGDRFIIAGVMGPNEFHEEIPGAHKGGLLNNAYTNIMLVWLLNYLHELS
FT                   QNPAINFSQVAKQVGYTDVEQEKAEMIRHLLKLSINSDGIVEQYEGFFQLKQLDFPAYQ
FT                   AKYGDIHRIDRLLKSEGKAPDDYQVIKQADFLMLIYNLGAAHTHELITQLGYQLPDDWL
FT                   AKNTAYYLKRTTHGSTTSRPVFAGIYVELARHGNTTLEAQAYDFLTDAIGSDYYDIQGG
FT                   TTAEGVHMGVMGETLAVIQNDYAGVDMLHDMFVLNPRLPKQWSKLCFTQFYQGVQLDIE
FT                   ITTKEVKITSNRDISIMVVDQIVALIAQKERKVVYNG"
FT   CDS_pept        333430..334110
FT                   /transl_table=11
FT                   /gene="pgmB1"
FT                   /locus_tag="LEGAS_0327"
FT                   /product="beta-phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90975"
FT                   /protein_id="CBL90975.1"
FT                   /translation="MVEFSDIKGFTFDLDGVITDTAKFHEQAWHDLALQIGVNWSDELG
FT                   NQLKGISRMDSLNMILSAAGQQDKYSDEEKEAFTIQKNTHYVELIQGITPKDILPGMTA
FT                   FLSEIKSGGYVASIASASKNAPKILEKLGIIDDFVGIVDPATLSHGKPDPEIFTKAGDI
FT                   LKLKPSQIIGLEDASAGVEAITAAGQTALGIGLAAKSASPKLWVASTADISLANIAAGM
FT                   QNSN"
FT   CDS_pept        334376..335440
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0328"
FT                   /product="permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90976"
FT                   /protein_id="CBL90976.1"
FT                   /translation="MDFFNALERTFTNASIVSAITSTVFIILIGYAMRKREVFTDMFAK
FT                   TLTKVVLSVALPALAFTSFMQPIDPKTLSQSTNVLIWGIVMYVVLIFVMNPFFAMYKTQ
FT                   GDRQMTLKVLSIFGSTTFFGLPIVGAVWGAKGILYGSIFNIGYRIFLYSYAYIKMSGLK
FT                   METANIKKMFLNPIVIATFAGLILWLVQGFMPTITVTDLTGKMQNVAFYRIDLTALWLM
FT                   KPLTYLSGLASPLAWLAIGSTLGSISFTKAFSDKTSWYYTFIKIVVVPIINIILLMILS
FT                   MTHILPVDQTALSVIVIMMATPPATVAVSYAISFDREALLASNTSLLATLGAVVMTPIW
FT                   IVVLNIIAHIGLFN"
FT   CDS_pept        335457..336464
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0329"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90977"
FT                   /protein_id="CBL90977.1"
FT                   /translation="MFRITAYGVRKNEIDYFKKLNIFDYELNLVTDNLKKSNIITAKGS
FT                   DGVLLRANNDGSEPILRQLRAWGIKYVFTRTVGYDHIDLKAAQTLGITVARVPSYSPYA
FT                   VADLAMNLGITLVRRTAIATSRAAVADFKVEPDLFGREIHDLTVGIIGTGRIGLAEAKL
FT                   YKGMGAKIIGYDIYESDTAKSILKFVSQEELLSMSDVVSLHVPHFPGKNDHFFDTKLIN
FT                   QMKRGAILINTSRAEITDQLAIITAIKTGQLGGFGADVILHEKEIFGQQFDDSHLLNDK
FT                   EVTSLIDLYPKVLLTPHIGSYTEEALTDMINTSYQNFNDMLVKGSTTNDVVTTL"
FT   CDS_pept        336522..338156
FT                   /transl_table=11
FT                   /gene="hpk2"
FT                   /locus_tag="LEGAS_0330"
FT                   /product="Histidine protein kinase, sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90978"
FT                   /protein_id="CBL90978.1"
FT                   /translation="MMYKRGEFGVKQIKNIPLYVIIIGIVVMATVISLGTTGILLQQVI
FT                   EKNERENINLRLKSTAQIAASDPIIIRGLSLNASKSDKSSVQIYAQRLANTANIDFVVV
FT                   VNDDLYRLSHPNDKQIGKKFSSPQDARQTLQGKAHFSTKVGVLGLGYRYFDPVYDANHD
FT                   IIGLVSVGLTEDTIARSIKTARRPIFVGLTVGLLIGIVGAIFLAKWIKKILLDMEPYVI
FT                   AKKLVEKNTIENSMMEGLLAIDDQQTIIAKNMAADQLLPGIGNIGDHLPVEIFQTFFVV
FT                   PEKNSDTHPNRVLFKTRAYLYSVAQLVSPAVGSLLLFRDITDFKEIVAELDGTKQYAQA
FT                   LRAQTHEFMNKLQAITGLIELKKYDEVNKLIPQLTSDYQQNIGYIMARVKMPVIAGFLI
FT                   GKVNYAHEHEIILNIGESSCLPKLDILRREVTNIIKILGNIIDNAVDALSDSDIAQKKI
FT                   DLLLRYDDEGETLVITIEDNGAGIASDQFSNILTIGFSTKGHGRGFGLTTVNAIITDHQ
FT                   GVFDIQSTLNIGTKVYIEYPLRSRRSM"
FT   CDS_pept        338157..338876
FT                   /transl_table=11
FT                   /gene="rrp2"
FT                   /locus_tag="LEGAS_0331"
FT                   /product="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90979"
FT                   /protein_id="CBL90979.1"
FT                   /translation="MSYSVLIVEDDPMVADIISQFLNRLSDVLFEPIIVVGCIEDAQVK
FT                   MNMVIIDLLLVDVYLPDGKGTDFLTEQRKKHNSVATIMITAADDRETVRQAMINGVVDY
FT                   LIKPFQMERFNQAIQKFLMLEDMALGKEKLSQQDINEYFQGESRLEHLDMRLPKGISDA
FT                   TLKLIITTIYTLSDAFSNRMLSQSVALSRVTTKKYLDYLVENDLLQVKITYLEVGRPLT
FT                   QYTVNNLKSDKLHHLMQ"
FT   CDS_pept        338955..339947
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0332"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90980"
FT                   /protein_id="CBL90980.1"
FT                   /translation="MIIQHAILHILDTNTGNLIASQGEMPVTDIGVHDYIEKLVNKIYA
FT                   GDVKTGTITGNDYLQTILAEKDFPKMTTELAMKLFEVVTGSDNIQAGDLLSFQATTDDG
FT                   PIFGMIKLNFSPRYAHAVAYVSEKMVNNLVLNQAVLPAATQTVDEAILINMTTSKYHLI
FT                   EKKHLIDGHRVAYFSEKFLDIIPDVSIKENLQTIKRTIKNVAEKYDDLPEHEAFATTQT
FT                   AIYEALESGSINTEMIAEKVFYDNESAKSLYREQISKKIADKEIPVENTQKYEKKYRVQ
FT                   KFKLDSGIEISIPMAIYQDKTKVEFVNQPNGTTSLIIKDIETVLNKFTI"
FT   CDS_pept        340004..340936
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0333"
FT                   /product="hydrolase, nudix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90981"
FT                   /protein_id="CBL90981.1"
FT                   /translation="MPYKDSYVAKIRKIIGHDFELVMPTTDVVIENKKGELLMIYNRDF
FT                   AGWAFPGGYIEPEMSWQENAAREVLEEAGIHADPDKLKLMGAISGRNFVARYPNGDTAK
FT                   LYTNVFLLNDWLSEDNNVDETEIDAKKWVSPQTIDHMHLTFSGQAVYRIYRQYKKTNSV
FT                   QVLTLNSELQRFIDAQNGEIVGVSSYEDAVIELENGQKKTHWMWFVVPQLSGLGRSERA
FT                   IYYGIHDQKEAYAYLNDAILKKRLEKIITITLTLETNDPVLVFGAVDAEKFQASLTLFS
FT                   QISSSMLYKQALDKYFNGQKHVKTLALLQ"
FT   CDS_pept        complement(340971..341966)
FT                   /transl_table=11
FT                   /gene="panE1"
FT                   /locus_tag="LEGAS_0334"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90982"
FT                   /protein_id="CBL90982.1"
FT                   /translation="MKYAVVGAGAMGLRYGILLQENADVQVDFIEPTQASLDKIIAQGN
FT                   KVWKSRDHKERHEIKINIFSPESYEGTPDVWIFFMKQMQLQDTLDRLATKFKSGQTALG
FT                   AMNGMGHIEKLQKYFDDDHIIGGTAMIATILNDFGDVDFMGDEGAGSSVYANLTEKPSE
FT                   TMTALQTDFKAAHLNPSYTENFMGTLLTKVFFNAVENSIATMFQSRMGQLMAYDGFLEG
FT                   IARPLINEAYDAAEAAGIELIETRDDMVDQVDYVSNVSNPLHFPSMYQDFVKGRPTEVD
FT                   YINGWIANLADENGTQAPNHHLVTNFVHLAESMRKFTPPVNKLAPDYTGA"
FT   CDS_pept        342115..343131
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="LEGAS_0335"
FT                   /product="Tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90983"
FT                   /protein_id="CBL90983.1"
FT                   /translation="MSKEIYLTGDRPTGKLHIGHYIGSLKNRVQMQNSGQFDPFVMIAD
FT                   TQAFTDNARNPEKIHQALTEVALDYLAVGIDPKKTTIFVQSQIKGLFELTEYFMNLVSV
FT                   ARLQRNPTVKSEISQKGFGEGIPAGFLTYPVSQAADIAIFRATKVPVGDDQEPMLEQTR
FT                   ELVRSFNHAYHSDVLVEPVGVFPPKGQGRLPGIDGNAKMSKSLGNGIYISDDTDTMAKK
FT                   VKAMYTDPLHINISDPGHVEGNIVFTYLDIFDTDKQHVQDLKDQYTAGGLGDMKLKKYL
FT                   IEVMEAEMAPIRVRRQEYAQDIPAVLRMLQEGSNRANVIAEETMKDVRHAMGIDYFG"
FT   CDS_pept        complement(343230..344396)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0336"
FT                   /product="Transcription regulator, LytR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90984"
FT                   /protein_id="CBL90984.1"
FT                   /translation="MEPKPNSRLNRHQSPSHKLRNSILFLMAILLIVVSFFIWRTISST
FT                   KGVVDKSYAGAGLTKSRNVSNVIKSGRPISILLYGTDTGELGRTYRGRTDSMMLLLINP
FT                   KTKQTTMVSLPRDAMVSIVGYEDTFPQKLNAAYAYGSTATSIKTVEAFLNIPIDFYALV
FT                   NMGGLANMVNQVGGISVDSPLDFTYSQETAHDYGPNLYRFHKNSDKYEHSDDNGKTWSK
FT                   SKTKMNGDAALAFSRMRYDDPEGDYGRQKRQRIVLEGLIKKSANVSTLLNKEFMSTISS
FT                   NVRTDLTFGDMTTMASKYIDAKNDIITEHMQGVSTSYPDSEGNNVSYEVIPQKEKQRAT
FT                   NLIREALGLKYEQTGLPYGGEIPAGLSTTATSLRPVGDNSTATSTSDK"
FT   CDS_pept        344581..345237
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0337"
FT                   /product="Membrane-associated phospholipid phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90985"
FT                   /protein_id="CBL90985.1"
FT                   /translation="MLIQPDKLRKLLILVFSALFLFLAIQIRFDMLFMHVIDNGASLVI
FT                   QNLIPHGVQNWINFGGLFAHYWILVPAMVLVSSLLYFMNYKIAMWWFIITQVLSMLLAL
FT                   TISFILQIHWLSGPKLGPAIPNILLLWWLQLLATIAVIIMPNLVKNRRMRQGLTMVTIF
FT                   LWWLMLMACIQRNDMPFSSGLGSLFFGYFWWQLSEYQYRKRAKHWRHVLEIDTLI"
FT   CDS_pept        345505..346944
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0338"
FT                   /product="Amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90986"
FT                   /protein_id="CBL90986.1"
FT                   /translation="MSEQQDGMKRNLKTRHVSMIALGGSIGTGLFVASGATVAQAGPFG
FT                   AIVAYLAIGVMVYFLMTSLGEMATYAPTSGSFSDYAGKYVDPALGFAMGWNYWFNWAIT
FT                   LAVDIVAVGLVSKFWFPDVPGWIFSAVALVFIFLINLFSVGAFGEAEFWLSMIKVITII
FT                   AFLIVGLATIFGVIHSDVNVMKNLSVGNHGFVGGPQAILSVFVVAGFSFQGTELIGITA
FT                   GEAENPDKSVPKAINQVFWRILLFYILAIFVISALVYYRDPRLLSSSTENIAVSPFTIV
FT                   FKNAGIAFAASLMNAVILTSIVSSANSGSYASTRMLYAMARKGEAPKIFAKLSKRGVPV
FT                   AALILTTIIGLLAFISNTKGGSVAYTWLVNASGLTGFIAWVGIAISHYRFRRAYIAQGK
FT                   QLSDLKYKAKWFPFGPIFALIISMGVIIGQDPASFTNLNWEKIAVTYLSVPLFIILFVT
FT                   YKIRYKTKKIKLEDVDLTKHR"
FT   CDS_pept        347129..347350
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0339"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90987"
FT                   /protein_id="CBL90987.1"
FT                   /translation="MSPIFMLSINILAVYFVFWLIRPINFAKFMPYTPTQAMFLKIVMA
FT                   IVVGYLLASFFISLTNWILAMPSAVFGK"
FT   CDS_pept        347451..348443
FT                   /transl_table=11
FT                   /gene="mbl"
FT                   /locus_tag="LEGAS_0340"
FT                   /product="Rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90988"
FT                   /protein_id="CBL90988.1"
FT                   /translation="MAKDIGIDLGTANVLIYVEGKGIVLNEPSVVAVDDKTDRVLAVGS
FT                   EAYRMVGRTPGNIRAVRPLKDGVISDFDVTEAMLTYFVDKLNVKGFMSKPNIMICAPTN
FT                   ITEIERKAIIQAAEKAGGAKVYLEYEPKVAAVGAGLDIFKPIGSMVIDMGGGTSDIAVL
FT                   SLGDIVVSESIRVAGDKMNFDIVAYLKKHHNLIVGERTAETIKIQIGSALPVDEPLTME
FT                   VRGRDNFEGMPKTITIHSNEVEEALHDTLQQIVRAAHSVLSKLPPELAADIIDRGIMLT
FT                   GGGALLHGMDQLLADALEVPVVVSDSPLDNVAKGAGALLEHMKSNRKGL"
FT   CDS_pept        348445..348654
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0341"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90989"
FT                   /protein_id="CBL90989.1"
FT                   /translation="MRKKNQNFSVDLVVVTDQTQVMIDNKQVGYIEKADRGFVGYFGQQ
FT                   AVINQAKTQDDALQAILASFNLYQ"
FT   CDS_pept        348719..349939
FT                   /transl_table=11
FT                   /gene="rodA"
FT                   /locus_tag="LEGAS_0342"
FT                   /product="Rod-shape determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90990"
FT                   /protein_id="CBL90990.1"
FT                   /translation="MQRTPSRQMSSRTSGSELDWGIILALLLFMIIGLSSIFQAALHSQ
FT                   YGTMQMALRTTIVQGVFWIIGTLIIIFLLRFDASQLWRLAPIAYGLGIFLLVAVLVLYD
FT                   RQMANLTGAKSWFVLGPISFQPSEVVKPAFILMLSRVVAQHNRLYEHHTTRSDGLLLGK
FT                   MALWFLPIAVLIALQNDLGTLLVFIAIFGGVALVSGITWRILAPVIGIVATIGVTLLAL
FT                   VTSATGKIILDALGFKLYQFDRIQTWLHPDQDTSASGYQTFQSLKAIGSGQLTGNGFGN
FT                   LKVYVPVRESDMIFSVIGESFGFIGGAILIALYFGLIYRLIRATFKAQNAFYAYIATGV
FT                   VMMVLFHVFENIGMSIGLLPLTGIPLPFISQGGSSLLGNLIGVGLILTIGYQQQNDTFK
FT                   EATGFSI"
FT   CDS_pept        349939..350940
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0343"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90991"
FT                   /protein_id="CBL90991.1"
FT                   /translation="MDELKEIKKKFSVLRQKTRKGDIFQSLGPLMSDNLMTLPSQGTTP
FT                   VVLPKNGEHALERFQTYDHQLDIRTEGMLDNIKVTTISDEDIQLAITQLANPLPKYRDT
FT                   GAFLFLSDIIQNELISEDQLRLLTQRLVSDEQLFSHILEPENDGIYGRSFSILVLSLLL
FT                   FTQRTKIHFMSADQMDLVINQVALYVALERDTRGFIGTNGWAHAFTHIGNVLAELFMMP
FT                   QLMRADKLFLLASMLAGYRELKQPLMMGETERLVEVVIYAANAHELYADYILLTLKLWR
FT                   KDLVTQRDLKTEAQWHQLYNRSRFFHEIILRGSQNVPKKLYDYAEQTKDYLT"
FT   CDS_pept        351001..352134
FT                   /transl_table=11
FT                   /gene="ddl"
FT                   /locus_tag="LEGAS_0344"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90992"
FT                   /protein_id="CBL90992.1"
FT                   /translation="MTKKHVALLFGGNSSEHDVSKRSAQNFYDAIKATGKYEITVFAIA
FT                   QNGYFLDPESSNRVLALEDEQPIVDAYMAKIDTTDPLARISALSEGGDFDIFFPVVHGN
FT                   LGEDGTLQGLFKLLNKPYVGAPLRGHAVSFDKAMTKELLTVNGIRNTKYVVLDPKTAKE
FT                   WTWEKVVAALGDIVFVKAANQGSSVGISRAKNAVEFEAALSDSFQYDYKVLVEQAVKGS
FT                   RELEVGVIGNEEPIVSEIGAHTLPNQGSGDAWYDYNNKFVDNSDVLFEIPAKLPESVTN
FT                   EVKDMAIQAYKVLNLRGEARMDFLLDENNVPYLGEPNTLPGFTNMSLFKRLWDYSDIDN
FT                   VKLVDMLITYGFAEFEKNAQLSYQFVTLGEEKIGKFN"
FT   CDS_pept        352134..353000
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0345"
FT                   /product="helix-turn-helix domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90993"
FT                   /protein_id="CBL90993.1"
FT                   /translation="MVKNSRKDSFDGKAIRTARKKMRLSQVELAEGITTQATISLVENQ
FT                   NRVPNADVLLAILDRLNLEISEFVSGDFLTQKAKELLGKVVLQMKHDALAEFSEFEKAL
FT                   SQNSPTIQAYYILKATDECYNKKDFAKVIYYANLAVDKKTPSLGDFYSFYAYRQMGTNY
FT                   YLQGDIETAKEKFSLAYELEPNLLTANELEFHGALQGRQYYAEFLIEQNELDKAAQILE
FT                   EGLLALRKRVDLFWVPDLSEMLANVEKKRGNDLSAKRYLHDARMAAFLSNRKTTEERLS
FT                   ALDTVAF"
FT   CDS_pept        complement(353117..353560)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0346"
FT                   /product="Universal stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90994"
FT                   /protein_id="CBL90994.1"
FT                   /translation="MTANYNNILVPMDGSKESEAALVRAIELTNDAGDNGILSILNVID
FT                   TRAFQNVASFDDTMVEAVSDETRKTLDKYKQQAIDAGVKNVDYLIEYGSPKALIAKDVP
FT                   NEVNADIIVIGATGLNAVERLVIGSVTEFVTRTANIDVLVVRG"
FT   CDS_pept        complement(353969..355255)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0347"
FT                   /product="Chromosome segregation helicase (Putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90995"
FT                   /protein_id="CBL90995.1"
FT                   /translation="MQQPLAYRMRPTQIEEIVGQPHLVGSGKIIRRMVDAKRLSSMILY
FT                   GPPGTGKTSIASAIAGSSKYAFRMLNAATDSQKDLQIVAEEAKMSGTVVLLLDEIHRLN
FT                   KIKQDFLLPHLESGAIILIGATTENPYINVTPAIRSRTQIFQVMPLTENDIKIAVKRAL
FT                   EDKEKGLGNYNVMLDDNAMVQLSRATNGDLRSALNGLELAVLSTPPNKKDNIINITLPI
FT                   IEETVQRKAMSADKDGDAHYDVISALQKSIRGSDVDAALHYAARIVESGDLPILTRRLT
FT                   VIAYEDIGLANPSAVQHAVIAIQAAQTLGFPEARIPLANAIIELALSPKSNAAYQALDM
FT                   AINDIHSGKVSDIPNHLKDSHYQGAADLDHGTSYIYPHDFDNDWVPQQYLPDSIRDVSY
FT                   FQPKGNSKIEQSFYDVYHSLKLQQKKGLQ"
FT   CDS_pept        complement(355302..355673)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0348"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90996"
FT                   /protein_id="CBL90996.1"
FT                   /translation="MDINERLQKEQLGGQSQINPDEQKHYLGTFRERVVVAVKYSQLRS
FT                   LDVQSQFETTLKSHSMGKVLIDQNIAGDNFAPYVAIATRTKHPFTLLSHTTESIHQNDP
FT                   IAVLLAADTAVNIDNIYLN"
FT   CDS_pept        complement(355791..356402)
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="LEGAS_0349"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90997"
FT                   /protein_id="CBL90997.1"
FT                   /translation="MSRYTGPKWRISRRLGVSLSGTGKELSRRAYAPGDHGAGRRAKIS
FT                   EYGTQLREKQKLRFTYGLTERQFHSLFNKAGKIRKGTHGTNFMILLEQRLDSLVYRLGL
FT                   ATTRQQARQLVNHGHIMVDSKRVDIPSFSVTPGQVISVRDKSKTIVPIQVAVESVVGHP
FT                   QFVSFDAEKLEGSLVRLPEREELDADINESLIVEYYNRLG"
FT   CDS_pept        356718..358430
FT                   /transl_table=11
FT                   /gene="ezrA"
FT                   /locus_tag="LEGAS_0350"
FT                   /product="Septation ring formation regulator ezrA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90998"
FT                   /protein_id="CBL90998.1"
FT                   /translation="MNLTILAIILGIVVIAYLAIFIMQRTTVKRVSAYQTKKEQLASLK
FT                   VRDELVEGRKLALTGQSLKQYQSLEGSFNDVKNNKFLKIDQQANLVLFEARGINFIKTR
FT                   HELSRLEAMVDDTESTINTVRSGLTELKKIDEAHREAINDLKKKYDDLRKRLLAENFKF
FT                   GPANKGLDNFLKQLEGDYDEFTRLTENGDHATASDIYEQLAMETTQMENMMADIPALFE
FT                   KLDTVYVEQLNELVQGHTDLIAQGYVFPNDTLVEELEAIDAQRQQVLQLLGELKLKEVS
FT                   EQNGYIDRRIDTLYDMMETEVTARKEVTKNADQLSSDLLRLREQNSQLSMTLDRLGQRF
FT                   QFNHKELETRRTLLEQINATEEQVNHNDDLLEASEMSFSELRAKQDSQLKRFSEIESQQ
FT                   VEIWEKISGLEKAQHSARQFGGQYQQEIENIKQAVERMNLPGLPASYLEYFFAVSNELN
FT                   RLAKSLQAHLIDMDEVQRQLNIVSADIDTLKEKTETLVDQASLTEQLLQYANRYRTSSD
FT                   RVAAASEQARMFYERDYSFDKAMDVLGPALDSVEPGVYEKLVDSYMKRKTPLL"
FT   CDS_pept        358482..359027
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0351"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBL90999"
FT                   /protein_id="CBL90999.1"
FT                   /translation="MKTIDDYNEILTDRLLLRRVLLTDASQMYQWLSDENTVQWLSGTL
FT                   NTSIENVENQAIKSYFWQDVVNTKKYGIALKETNELIGSIDFRQNILKNNAEIGYVLTP
FT                   LQRGKGFMHEAVSNLLKIGFTELNLVDIWISHDIENISSRHIPERLGFEQAKISDTSDH
FT                   IVWHMSSEQYRGKSQMDF"
FT   CDS_pept        359134..360678
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0352"
FT                   /product="Integral membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91000"
FT                   /protein_id="CBL91000.1"
FT                   /translation="MLSWQYLLKNKRQLAKWLVAATIPVVFVAGFLGTMGHATQQASRL
FT                   KVAVVNLDDGGQYHDKQQNIGADFSRRLRNEKAFAAVSYTTEKQAKLALRDGKISAVVV
FT                   MPSALTSQLSDFQKSGKTINLQQIIASGQSQFASQYIQRQLTQALNHENALLMIGKANS
FT                   SMLKNLANQSQNLSQEANDLQTNLQAVGNGIDAQTASDLQETAQEETAKLANYSSRLND
FT                   AISAGDTSKISEMASAINDVSYTMQTSIVGGISNMAANLNSTKALSDESGIIQSSAKKI
FT                   QQGQSSIAGKLKDTLGEQESSKNVSPLSQMMAFDMTDIQPIKQDGQFILPNLLVIGVTL
FT                   LSILFGLVLPIKSTKQEMLALEQWWLNFQVGGALSIVTVLLMTISALFWQISVKQFFAI
FT                   TVVTLLASWAMMSIVWYLKQVLGQSGWWLSIVLMILQVIFTITSVPSSMSTTAFNIIRN
FT                   MFPLAALNRAISQLIFGGNVQQNVVIIVLWLLISTILLVTYYRIKQRQNLEEILID"
FT   CDS_pept        360777..361367
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0353"
FT                   /product="Transcription regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91001"
FT                   /protein_id="CBL91001.1"
FT                   /translation="MITKKSTSEVTRERILLAATELFLAKGYEQTTTREITKVLNITQP
FT                   ALYHYFGDKEALFVEVIKRVGKQVSDSMHFILSQTYEQPIDQLAAMTQVIVTRHPRDVF
FT                   TLIHGSFNVLSLENQRELGIVFGRDYVRPIAKFFDQEALKLRQNVDSRVASSFYITSLA
FT                   PLFSDFHRLNGTLDMTERIQQLLDLILYGVSER"
FT   CDS_pept        361422..361571
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="LEGAS_0354"
FT                   /product="50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91002"
FT                   /protein_id="CBL91002.1"
FT                   /translation="MASQKVSLACTICGSRNYTVALSKDRTERLAVKKFCAFCGKHTLH
FT                   QQTK"
FT   CDS_pept        361583..361756
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="LEGAS_0355"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91003"
FT                   /protein_id="CBL91003.1"
FT                   /translation="MLKYFRNVAAEMKRVTWLSQEQASKETVTVITVSVVFALFLGGVD
FT                   WLLQSGFNFILN"
FT   CDS_pept        361909..362538
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="LEGAS_0356"
FT                   /product="Transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91004"
FT                   /protein_id="CBL91004.1"
FT                   /translation="MSENNELPQENKNEAITNNDNIEKSWFVVHTYSGYEHKVKANLES
FT                   RTQTMGMSEQIFRILVPEQEVTTIQDGEAKTSVENDFPGYVLVEMATPHDYNMTDEAWY
FT                   VVRNTPGVTGFLGSHGAGSKPNSLMPEEVDLLMKRMGMVTREVVDLAVEVGQTVKIITG
FT                   PFSGMEATVTMVDVEKQTLEATVEVFGRETPTELDFADVDTVLDEA"
FT   CDS_pept        362666..363130
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="LEGAS_0357"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91005"
FT                   /protein_id="CBL91005.1"
FT                   /translation="MAKKVTTVVKLQIAAAKATPAPPVGPALGQAGINIAQFTKEFNAR
FT                   TAEQAGSIIPVEISVFDDRSFEFVTKTPPAADQLRKIVGKGSGEPNTKKVGNVTLDQIR
FT                   AIAENKMADLNANDVTAAMRMIEGTARSMGVTVEGVDLTVDGTAIKEDAE"
FT   CDS_pept        363130..363822
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="LEGAS_0358"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91006"
FT                   /protein_id="CBL91006.1"
FT                   /translation="MTQKHGKKYTAALAKVEAEKNYNLNEAVALVKEIDYANYDASVEV
FT                   VFKLNVDTRQADQQLRGAVVLPNGTGKDKKVIVFAQGDKAKEAEAAGADVVGAADLVAQ
FT                   IQGGWMDFDTAIATPDMMAQVGRVARILGPKGLMPNPKTGTVTMDVTKAVSDAKGGQVT
FT                   YRTDRDGNVAVPVGRVSFDEAKLAENIKMIADTVLKSRPAAVKGAYVEHVSISSTVSPA
FT                   VTLDVNAL"
FT   CDS_pept        364006..364566
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="LEGAS_0359"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91007"
FT                   /protein_id="CBL91007.1"
FT                   /translation="MSEKAIAVKAQKVEEIADQFKNAASAVVVDARGLTVAQSTDLRHQ
FT                   LRQEGVVLEVIKNKILTRAAEKAGFAELNDIFAGPSAVAFSNDDAIAPSRILKKFADAN
FT                   EKLEIKGGVVDGNIANLDDINKYASLPSREGLFGQLLAEFQFPIRSFAYVVKALQEKLE
FT                   EKNGGEATTTEETPVAETATDAE"
FT   CDS_pept        364605..364970
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="LEGAS_0360"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91008"
FT                   /protein_id="CBL91008.1"
FT                   /translation="MAFDKDAIIASLKDATILDLADLVSAIEEEFDVSAAAPVAAAGAA
FT                   DGGAAEKTDFDVELTSAGTAKVKVIKAVREATGLGLKEAKDLVDNAPSIVKEGLDEAAA
FT                   NELKETLEATGASVALK"
FT   CDS_pept        365102..365743
FT                   /transl_table=11
FT                   /gene="rsmC"
FT                   /locus_tag="LEGAS_0361"
FT                   /product="Ribosomal RNA small subunit methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91009"
FT                   /protein_id="CBL91009.1"
FT                   /translation="MDTSKEKIAGEMYFTANPNSEHHYQDFDFDLLGNHLRFTTDSGVF
FT                   SKSTVDFGTRTMLNALNKTTIISGKILDLGTGYGPVGVAVAKYLQQPVDMTDVNERALA
FT                   LARKNAEQNGVIGLVNVFQSDIYANVSDKYALILANPPIRAGKSVVTAMLQESIHYLLP
FT                   GGKLIAVLQKKQGAPSAQKNMATVFGNVKVIHKDKGYYILESTYDPTTNV"
FT   CDS_pept        365721..366218
FT                   /transl_table=11
FT                   /gene="tadA"
FT                   /locus_tag="LEGAS_0362"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91010"
FT                   /protein_id="CBL91010.1"
FT                   /translation="MIQQPTFSSEQIDYFMQVALNEAKFAENDGEVPIGAVIVKDNVII
FT                   ARAHNHREAEQMATAHAELLAIESANRLLSSWRLEDTALFVTLEPCIMCAGAIINARIP
FT                   SVYYGAEDSKGGGTRSLYQLLEDDRLNHRADVHTNIRGDEGGALLQHFFKKIRLQRKLG
FT                   KK"
FT   CDS_pept        366292..366810
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0363"
FT                   /product="Hydrolase, HD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91011"
FT                   /protein_id="CBL91011.1"
FT                   /translation="MQNPNAWRNDQEYLNIVDDLLQHDEVQQLAQYTQHHFSNRLRHSI
FT                   SVSYRSYLIAKRIGADEVATARAGLLHDMFYYDWRVTKFEEGSHAYVHPRIALKNAQKI
FT                   THINSKEADIILKHMFGATIALPKYRESWIVSIVDDFAAVNEYLIPKTYLTYFKWHTKW
FT                   TKKIAEVFA"
FT   CDS_pept        367032..368789
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="LEGAS_0364"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91012"
FT                   /protein_id="CBL91012.1"
FT                   /translation="MAYQALYRVYRPRTFDDMVGQEVITQTLRNAIETHQTGHAYLFSG
FT                   PRGTGKTSAAKIFAREINGIDPTTDDSQIPDIVEFDAASNSRVEDMRDILSNVDYAPIE
FT                   AEFKVYIIDEVHMLSNSAFNALLKTLEEPPANVKFILATTEPQKVPVTILSRTQRFEFK
FT                   RIDSLIIKARLVDVLNKQQIAYEDDALRIIANVAEGGMRDALSILDQVIAFGTDNVTVD
FT                   NALQVTGSTTTTELLSYVEAVSAGDTPKSLRVLHDILMAGKDAQRFVVDVLGLLRDIML
FT                   VDVAEELIKSTIQFSELQLLSKKLGITRIEKMMLALDDIQKQLMQTMQSDVYLELLTVK
FT                   LSMIVEPKATAPKTPSVSDESRMSSVAINEADIKDQTINVTPLVTEKSQNVTPIVSEQE
FT                   QVINPASSEQINQNTDTNTIVWTGQQAVFAVLQMAKREALSRVKNNWSTLITQFDVAQQ
FT                   AMLTIAEPVAASDEAIVLAFDYPALLEQALNDAQMQNSLEAALREQHLPLSMVLISQDD
FT                   WHQERAAYVTKLKSGETNRIVLTDLPRVSSQKALTNKEEPKTVVKATEPAVVMAAKKMF
FT                   GSDIVTVID"
FT   CDS_pept        368829..369434
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="LEGAS_0365"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91013"
FT                   /protein_id="CBL91013.1"
FT                   /translation="MDYPEPIAKLIDSYTKLPGIGSKTATRLAFYTLGMDEKDVLDFSK
FT                   SLVSAKKDLTFCSVCGNITENSINPCVICRDVTRDQDTVFVVENSRDVMAMENTRDYHG
FT                   LYHVLNGVISPSAGTGPEDINLPSLIRRLSEHQEIDEVIVGTNVTAEGEATAMYLARLL
FT                   KPAGIKVTRLAHGLAVGSDIDYADQLTLIKAVQGRTEL"
FT   CDS_pept        369431..369697
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0366"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91014"
FT                   /protein_id="CBL91014.1"
FT                   /translation="MIFGKKKRDLRHEYDQALVFQVDKAKIDWDMAKNSEEALLDGQVN
FT                   VRLIQSQTALNKAKFNYLYREARRRKTVGHMQTHVLKTDRNQF"
FT   CDS_pept        369773..370417
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="LEGAS_0367"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91015"
FT                   /protein_id="CBL91015.1"
FT                   /translation="MTKPLFITFEGPEGAGKTSVLEILISELKPLLGDELITTREPGGN
FT                   PISEAIRAILQPAEDNGMDERTEALLYTAARRQHLVEIILPALKSGKVVISDRYIDSSL
FT                   AYQGGGRGLGVDNIWQINQFATEGLMPDLTIYFDVPPELGLARVKANRQGKIDRLDKEN
FT                   LSFHQTVRQTYLQLQHDFSDRIKIIDAAQSLDQVVADTRELLLKTLKTRKG"
FT   CDS_pept        370423..370752
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0368"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91016"
FT                   /protein_id="CBL91016.1"
FT                   /translation="MKLVTAIVQDKDTTKLSNAFVKANVRATRLTTSGGFLRSGNTTFL
FT                   IAIEDERVQAVLDIIQSVSQKRKQYMVPPVSLDAGGAHVGAYPVEVEVGGATVYTQSIE
FT                   SFHQF"
FT   CDS_pept        370752..371672
FT                   /transl_table=11
FT                   /gene="holB"
FT                   /locus_tag="LEGAS_0369"
FT                   /product="DNA polymerase III, delta' subunit, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91017"
FT                   /protein_id="CBL91017.1"
FT                   /translation="MKSNFATITQMVYPTQTSHFVSLISKSQLSHFYLFIGPSQPEKLA
FT                   FSQYLAWQIVGATERNLVRVMENDHPDVKIVRPSLPKSGTGTNRTWKVDQIRALKPEFV
FT                   TVAQESTRKVFVFDAVETLHAESGNALLKFIEEPTGPQLIVMLAENINEVMTTIQSRAQ
FT                   IVHLLPETTIAADDSVDDEWRQATQTILFKWFELMMQRRIEAFVYVQTQLVNQLKDSQQ
FT                   QQLFFNWLHQLSRDTVVFGQISDDKLVFPRLVGLYKTLIQHYTKKQLLRASDAVLIDDR
FT                   IRQNNVSLQTRLEKIVLDVTIALGE"
FT   CDS_pept        371674..372549
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0370"
FT                   /product="Methyltransferase (Putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91018"
FT                   /protein_id="CBL91018.1"
FT                   /translation="MQQQKSFEKKQTGTLFLVPTPIGNLQDMTPRAIDTLKNVDLIAAE
FT                   DTRHTQHLLNHFDIGTKQTSFHEHNWQMKIPGLILDLQSGKNVAQVSDAGMPSISDPGK
FT                   ELVAAAIENNVTVVPIPGATAGITALIASGLVPQPFYFYGFLQRKNNEQLAELQQLSSI
FT                   RDTIIFYESPHRIKKTLENIQKVMGDDRRVVLARELTKRYEEFLRGTTQELVEWAKDNE
FT                   IRGEFVVMIAGYQGVVEEQKKSDDRDLSVHDAVETLISRGLKPNAAIKQIAKSRDLDRQ
FT                   AVYSDYHGID"
FT   CDS_pept        372595..373332
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0371"
FT                   /product="oleoyl-[acyl-carrier protein] thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91019"
FT                   /protein_id="CBL91019.1"
FT                   /translation="MHTFEIKRHVEYYEADTTGKLTLPMILNWAVLASKKQSDALGVGQ
FT                   KIYLGRGLGWIILQYEVHITRRPKINEEITIKTYAAKYNPFFVSRPFVFFDTNGNEIIR
FT                   VDSIWAMIDIENRRMARLPQDIIDKYQAERVKQIPRIAKPAQFGIDDVFEENDYHVRYL
FT                   DIDANKHVNNSKYFEWMQDVITPEFLATHEVTDINLKFENEVRLGHTIQSQVILQEHTS
FT                   KHRIMLGDVVSAEAEFQWRDVSF"
FT   CDS_pept        373373..374365
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="LEGAS_0372"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91020"
FT                   /protein_id="CBL91020.1"
FT                   /translation="MSVLVLGGAGYIGSHMVKTLVESGRDVVVVDALFTGHRDAVNPAA
FT                   KFYQVDIRNKTALSDVFDKENIEQVVHFAAFSIVPESVANPLKYFDNNTSGMITLLEVM
FT                   KDHDVKQIVFSSTAATYGNPVNIPIKETDPQNPINPYGESKLMMEKIMAWSDKSDGVKW
FT                   VALRYFNVAGAAEDGSIGEDHTPETHLVPIILQAGLGQREYIEMFGDDYKTPDGFNVRD
FT                   YVHVLDLADAHIRALKYLADGHESNQFNLGSATGFSVKEMVEAAREATGVDIPSKIGPR
FT                   RAGDPDILIANSDKARDVLGWAPKYDNVQDIIKTAWHWHQNHPTGYDDK"
FT   tRNA            374526..374601
FT                   /locus_tag="LEGAS_R0006"
FT                   /product="tRNA-Lys"
FT   CDS_pept        374712..375485
FT                   /transl_table=11
FT                   /gene="dacB"
FT                   /locus_tag="LEGAS_0373"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91021"
FT                   /protein_id="CBL91021.1"
FT                   /translation="MKVHSKKFGGLILGLVIIIFVIISVICYVNHSNGLIKKQQEMQKS
FT                   PVKSLRYTLPKHTKVSDWQLILVNKQHPRTSEIQFNKVTVDGKQMDQRIEKPLNDFRAG
FT                   AKIAGYDTTLVSAYRSIADQSEVYQNSLRQNEANGMDEKAATKLTQSVIQTPGSSEHQT
FT                   GLAVDVAGNDALAKYPALMAQMDEFKSQRWLIKHASDYGFVLRYLNDSKSISQTGIDYE
FT                   SWHFRYVGIANARYMVQHHLTLEAYRNMLRKAAQN"
FT   CDS_pept        375555..376199
FT                   /transl_table=11
FT                   /gene="dgk2"
FT                   /locus_tag="LEGAS_0374"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91022"
FT                   /protein_id="CBL91022.1"
FT                   /translation="MIVLSGTIGAGKTSLTEMLANHLDSKAFYESVDDNPILPLFYENP
FT                   KKYGFLLQIYFLNKRLAQIKVAQTTGKNNIVDRSIYEDALLFQLTADLNRATQTEVDIY
FT                   KSLVDNMMADITGVDDIKNPDLLIHVRVSFETMLERIEKRGRSFEQIAANPDLYEYYKE
FT                   LNKRYDAWFESYDRSPKVQIDGDRFDFVMNDEARYKVLDMIDTKLSEVDTK"
FT   CDS_pept        376287..377054
FT                   /transl_table=11
FT                   /gene="proC"
FT                   /locus_tag="LEGAS_0375"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91023"
FT                   /protein_id="CBL91023.1"
FT                   /translation="MIKYGFIGTGNMAQAMIKGLLGKGVSANNIAVSSPRSAAKLTEKW
FT                   GVISLSAQKLIDESSLIVLAFLPNQLENVTAKLDFQDKLVVSVLAGITLEQLISATHTT
FT                   QIVRTLPNVNVAINQGVTAFSKTELTTTNSTTFKIFSDYLGSSVVLAESQFAIFSAVAG
FT                   SGPAYVFKYIDALAQAGIANGLEAKLATDIATQTVLGSAKTLALSTQTAKELQNAVTSP
FT                   GGSTRAGLDDFDTHNFDDVIAHAIKATVEHKHL"
FT   CDS_pept        377133..377879
FT                   /transl_table=11
FT                   /gene="lyc"
FT                   /locus_tag="LEGAS_0376"
FT                   /product="Lyzozyme (1,4-beta-N-acetylmuramidase)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91024"
FT                   /protein_id="CBL91024.1"
FT                   /translation="MDIMTNNAGKTKQIRTKKTLTSMTWVLIVGGLIATLAVWLFAKPI
FT                   VLTTNTIPTGFSVQGVAINQASGYVDYSNLASNGVDYVYLRATTGTSFVDDSYQSSYNR
FT                   ARSAQLKVGSIQVYDASVDALTQAQYFIDNVGNRVGQLPIAFYVTDNQIDTQASIDRLA
FT                   KLIQILNTHYNKSTVIYTTPSVKSKLSSTISEAKYWLIDTDTTNKSHVNQFIQYSEDHT
FT                   IGSGLKAIKMPTSVFNGTEKEFEGIK"
FT   CDS_pept        377876..378877
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0377"
FT                   /product="oxidoreductase YgjR"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91025"
FT                   /protein_id="CBL91025.1"
FT                   /translation="MIKFGVIGTNWITKMFIAAAIETGEYELSKIYSRTQERGESFLRT
FT                   LTVDDVDIVTTLSDLYTGIDLVYIASPNSLHFEQSKVAIEAGVHVIVEKPTTSNPAEFS
FT                   EIEKLLTLYPEVRYFEAARHVHQPNFKVIQQTMGELTQLQGATLVYQKYSSRYDAYLAG
FT                   EEPNVLSRNFSAGALYDLGVYPIYAAIALFGAPRAVQYLPILLTNGADGKGTASLFYDD
FT                   FNVTLLFGKTANSYLSSEIYGLKETIAISNIAELDTITYHDGDGHADNIGQKTDDNPMI
FT                   HEAQDFADIINDPVENHTKYNQWFQLAKQVNQTLFDLRSSADIEFLADKKEY"
FT   CDS_pept        378882..380198
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0378"
FT                   /product="ATP-dependent RNA
FT                   helicase/Autoaggregation-mediating protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91026"
FT                   /protein_id="CBL91026.1"
FT                   /translation="MAIKPELQDKFNNQFEQPTPIQDAVWERFSTGENIFGLAPTGTGK
FT                   TLAFILPMLSRIDVKVKRTQVLILAPSQELAMQTTAVAREWGALVGVSVASLIGGANGR
FT                   RQSDKLKKEKPHIVIGTLGRVLTMVDGGALKLNGIQTVIFDEADAMLTEERHDSLQELA
FT                   DQLPETVQLGLFSATSGVDLKYVADTFHQEVRPISVGTDAPASIRHEFQYVDQKARANM
FT                   LIQLARHDKQALVFFNTISGLVNMQATLRHAHVSVMSIGSNDKRQVQRADALRLFKKGE
FT                   VTLLLVTDVAARGLDIEDLPLVVNAQLPQSKKIYVHRTGRTGRMGKPGRVLNLGNDHDI
FT                   RDLKRELGDDFELIKAANAFADKKDALTKNKPSERERSNGNDREKTDTTLSVTQNTQNV
FT                   TPKMKQKSTSEIIDKPKKKKRLKVSKDKGKPKWANKREN"
FT   CDS_pept        380438..381127
FT                   /transl_table=11
FT                   /gene="rrp3"
FT                   /locus_tag="LEGAS_0379"
FT                   /product="Two-component response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91027"
FT                   /protein_id="CBL91027.1"
FT                   /translation="MAKAIRILLIEDDVNLADNIVGFLEDFADVNVVNNGLDGEFEGQE
FT                   SPYDLIISDLMLPGENGFEVIKYLRKNGIETPVLILTAKSSLDDKIEGFNVGADDYLTK
FT                   PFYREELLVRVKALLRRAGVYSEDNMIAVGDVLINLENRGVQVHGQQIKLVGKEFDILT
FT                   YLAQNKNIIVTRDQIFDRVWGIDSDTTINVVNIYLNNLRRKLESVGQNDLIKTLRNIGF
FT                   ILEVKDA"
FT   CDS_pept        381120..382403
FT                   /transl_table=11
FT                   /gene="hpk3"
FT                   /locus_tag="LEGAS_0380"
FT                   /product="Histidine protein kinase, sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91028"
FT                   /protein_id="CBL91028.1"
FT                   /translation="MPNVINKQQQIRGFLLLIASFFVIFSVLGSVIYWSYTRTIFQNSD
FT                   TAITQQIKQYDLAGALQNSADANRKSPLLLQSNMLADVWVYDKDKKLVVDDRIPEPMQS
FT                   TYKKKFKYTSKFILSRPKTVQIGNDYYRGVKVNFINGAKNNDGKSVKYGVITVNVTDTI
FT                   FNLNQFKKVILWSFGTFGLLALMVSYWISLKNMKPILKAWQQQQDFVNNAAHELRTPMA
FT                   VIQGKLENMLTRPESTVREQSDAIILSLSEVRRLTSLTNNMLTLAKSGSNMTRIEKEST
FT                   DIAEFLSRIVAPYQEMAEFEGKQVLLSTQVNQPVFIDQKRIHQLLVLLVDNAMKYSESG
FT                   ATVSISAMIEKRKFVLSVADTGRGISDKAKKHVFDRFYREDKTGSRQTGGTGLGLSIAE
FT                   WIVHAHGGKIIVLDNQPKGTIIKVTLPL"
FT   CDS_pept        382458..383327
FT                   /transl_table=11
FT                   /gene="htrA2"
FT                   /locus_tag="LEGAS_0381"
FT                   /product="Serine protease HtrA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91029"
FT                   /protein_id="CBL91029.1"
FT                   /translation="MKHSLITVAVVAAVVGGGVVYSGTQTNSWFQQQAATKKVAHISGQ
FT                   TSIAQTAYTSNDSATTAYNKVKNAVVTVQNLKNNSAQQSDGFAGLFGQAQQEGGQSSPK
FT                   IETASEGSGVIYKITNGTAYIITNNHVVANSDALQVITAGGTKIKATVVGTDVEKDLAL
FT                   IKVQTTVIKSAASFGKIDGLQSGQQVLAIGSPLGSDYATSVTSGIISAPRRELSSQQTG
FT                   FSTAKVIQTDAAINPGNSGGPLINLAGEVIGINSSKIASSNDGVSVEGMGFAIPADIVQ
FT                   SFIAKTEK"
FT   CDS_pept        complement(383397..383723)
FT                   /transl_table=11
FT                   /gene="trxA2"
FT                   /locus_tag="LEGAS_0382"
FT                   /product="thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91030"
FT                   /protein_id="CBL91030.1"
FT                   /translation="MYQPTHNTNTVVEENIQHSGRNVMFLSADWCGDCRAIKPFVQNIK
FT                   DTISKTANWFDADRDENLDVATKYNMRGIPSFVLFENGTEISRIGHGERLTPDQVLDWY
FT                   QKTL"
FT   CDS_pept        384240..384695
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0383"
FT                   /product="conserved domain protein, possible pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91031"
FT                   /protein_id="CBL91031.1"
FT                   /translation="MSVILQNGLLKRERLTFGVRMAHVSRYAQKIAEYLSAHIKVTRVL
FT                   YPALVNHDGHDIQMKQANSGDAILSFDVNSAAHARPVVQFFKLPVFSVCLGAVDIIISF
FT                   LSKMSHAALNAKLLANVGISPGLLRFSVGLEDTDDLIADLEQSLVQI"
FT   CDS_pept        384746..385870
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0384"
FT                   /product="vitamin-B12 independent methionine synthase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91032"
FT                   /protein_id="CBL91032.1"
FT                   /translation="MITTTTKLHYRFDQVGSYLRPDRLKKAREQFANGQIDKQALLIIQ
FT                   HEEIKKVVDEQVKVGLSAVTDGEFNRSWWHLDFLGQLGGFEFYEQENSYKFHGANTRTT
FT                   NVRLNGKVHANFAHPFFEDFTYLQSIVPAGIEVKQTIPSPTLVIKRDHRSDLWSNYYAT
FT                   WTGFLDDVAQAYHDTLQHFYDLGARYIQLDDTTWAYLITQLNANRDNLKEREKYEQLAE
FT                   DNVYVINKALSNLPDDLKLSTHICRGNFKSTYLFEGGYEPVAKYLGQLNYDGFFLEYDD
FT                   ARSGDFKPLSDIWHNRQNVEIVLGLLTSKSADLEDEKTIISRIIAAQKYVPKSNLALST
FT                   QCGFSSTEEGNVLTIPDQWQKLALVKKIADEQLS"
FT   CDS_pept        385979..386455
FT                   /transl_table=11
FT                   /gene="luxS"
FT                   /locus_tag="LEGAS_0385"
FT                   /product="S-ribosylhomocysteine lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91033"
FT                   /protein_id="CBL91033.1"
FT                   /translation="MAETVVESFTLDHTKVKAPYVRVIESQNGPQGGHITNYDLRLTQP
FT                   NETAIETGGLHTLEHLFAGLVRDEIDGIIDMSPFGCRTGFHVISWVDYDAETLAKVFKK
FT                   VLEKIVSDEITEVPAAEIESCGNFKDHSLHSAKEWAKIILAQGISSDAFERKVV"
FT   CDS_pept        386830..388428
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0386"
FT                   /product="Lipoprotein, peptide binding protein OppA
FT                   homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91034"
FT                   /protein_id="CBL91034.1"
FT                   /translation="MNNKIIIGLVATGVIIGGIVVATKSQQSTDGKVLRIATQNNISTL
FT                   DPNYADEIGANWAEVQTLEGLYTTGKNGEIVAGVAQKVVKPTENNTIYTLHLRKNAKWS
FT                   DGTRVTAQDFVSSVKRQVDPKTKSTRANHFKDIAGYDAVYNHHANLDQLGIQAVDQYTV
FT                   KIQLSHPVPYFDFILANQLYPINRAKVKEYGKKYGQTAATTVSNGAYTIKKWNQASTTW
FT                   EFAKNKYYSDSKDVHYDTIKATQVTDTTLAAKQFQTKKVDEATVSGSVLSNLKKTNADD
FT                   IKATAAGRVAFIVWNANDKVASNSNLKKAVSLAINRQTLADEALGDGSKPAKSIIPSGE
FT                   IKIAGKDLNDGLSLPYNKIQAQQYLKKAQLELGQKKIDMTLNTADTDAYKAVGVFLKQS
FT                   IESALPDVTINLNRLPLNAEISAFNNHNFQAGTLSWSTDYDDPIDFLDIAYSKGAINFT
FT                   KWKNDAYDKVYEQINSQNTANDARYQLEREAAKINNEENGVTPLYQTSNVHLQSKTVKN
FT                   LNYPLVGYQNYKYAK"
FT   CDS_pept        388491..389210
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0387"
FT                   /product="Glutamine amidotransferase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91035"
FT                   /protein_id="CBL91035.1"
FT                   /translation="MIKKIGIPSNNVLHANPRFGTNYVDYVQKNYIDGLTNAGALPVIL
FT                   PIAQPELAKAYVDIVDALVFVGGQDVSPEYFGEEPHLKLAEIDRGRDAFEIALVAEAIR
FT                   QEKPIFGICRGLQIINVALGGTLYQDLPSQYHTLTVKHDQYPTKWYMPTHHLVVKSDSW
FT                   LNGVINENTLVNSFHHQAAKNLAAGLTLDATSTDGVVEAFSDENRRIYAVQWHPEMLLM
FT                   GQVPEAQALFNAFVGKI"
FT   CDS_pept        389356..391200
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0388"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91036"
FT                   /protein_id="CBL91036.1"
FT                   /translation="MFQNMKRILIGKPLKTLDEGGQQLSKTKALALLSSDALSSVAYGT
FT                   ESITTALLAAGAVALWLQLPIALLVLILLAAIVMSYRQIIHAYPSGGGAYAVASENWGP
FT                   KAGLIAGGSLLVDYMLTVAVSASAAADAITAAVPAVLPFAVPLAIIVVILLTGMNLRGL
FT                   RESANFLMFPVYFFVAVIALMIIWGLFQAITGQLPYHAAAKVGTSFSGLSFVLFMRAFS
FT                   SGSSSLTGVEAISNAVPNFKVPKERHAAATLTTMALILATFFGGITFLSYWYGIRPDAH
FT                   STVLSQIAAMTFGGHGVGFYVVQLATAMILAVAANTGFSAFPMLALNLARDKYLPHLYM
FT                   DKGDRLGYSNGILSLAFGAVVLLLIFHGSTDALIPLYAVGVFVPFTLSQSGMIIHWWRK
FT                   RPKNWLIKAIINFIGAFISAVLVITLFATRIEHVWPYLLIMPIVMYMFLKIKGHYTSIA
FT                   RQLRLAYAKNDHAVRHHYDGSTVIVLISNVTKVTTEAVDYALSIGDNVVAMHVSFDVNP
FT                   KKELETSNQFKVDFPDVRYVDIHSSYRSIIKPAVSFVDAVVKQAEKRNHSVTVLVPQFV
FT                   PKKPWQNILHNQNSLRLRTAFALRKDISVSTYYYHLSE"
FT   CDS_pept        391272..391436
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0389"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91037"
FT                   /protein_id="CBL91037.1"
FT                   /translation="MSQDTKLMLFFIWVVIAMLISTIGLIIIMRWYHREVNKVKQAKRD
FT                   EKMKQHDNE"
FT   CDS_pept        complement(391577..392308)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0390"
FT                   /product="Putative glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91038"
FT                   /protein_id="CBL91038.1"
FT                   /translation="MANFEISVAHLYGNLMNTYGDYGNIIALTYYAKQIGVAVNYHLVS
FT                   LGDDFDADSFDFALFGGGQDYEETIVAKDLKNKADQLRHYIENDGPLLAVCGGFQLLGH
FT                   YMVMADGTRVDGIGVMDHYTINMHEPKLTTLNNKRLTGNIVIKNNDTDETYHGFENHQG
FT                   RTFLGKNERALGTVISGNGNNGMDQTEGVIYRNVYGSYFHGPIFTRNGNLAKRVLATAL
FT                   SRKYPEVDWTEKLDQIETETF"
FT   CDS_pept        complement(392308..393666)
FT                   /transl_table=11
FT                   /gene="murE2"
FT                   /locus_tag="LEGAS_0391"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91039"
FT                   /protein_id="CBL91039.1"
FT                   /translation="MTLKSTLARITAKSSYWLLHDILHRGGTSLPGKLAVSIDPNILTK
FT                   IQQDFELIIVTGTNGKTLTTALITRVLQAGGYTVITNPSGSNMIQGITGTLVTAKVKPS
FT                   PNGQKPVAVLEVDEANVEKIAAAIKPKMFVLTNIFRDQLDRYGEIYTTYDKIIAGIKHA
FT                   PEAIVLANGDSPIFTRGDFTNERKYFGFNHIQPADYNPTVAPINTDGILSPTDHSVLNY
FT                   DFITYANLGKYFSTTDSFVRPKLNYQVTSITDLTPKYSTFSIDNTPLRIEIGGLYNIYN
FT                   ALTAFAVGREFNVDPEKIKTAFESNAQIFGRQEALHVDGKDVIIVLIKNPVGTNSVIDM
FT                   MVTEKDDFSLLALLNANYADGIDTSWIWDAEFEKLHDTNIKAVATGGERYKDLRVRLKM
FT                   AGFPDQAVYEDLTQIVTAIKSLPTDKVYIAATYTAMLQLREQLGAAGYIKGGF"
FT   CDS_pept        393843..394703
FT                   /transl_table=11
FT                   /gene="clwO"
FT                   /locus_tag="LEGAS_0392"
FT                   /product="Peptidoglycan DL-endopeptidase cwlO precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91040"
FT                   /protein_id="CBL91040.1"
FT                   /translation="MGMLPNKKRKNQRLWLNITIVGGLTGVLLIANVSNLSQLIEPVQA
FT                   MAINALPTQTTATGQKVTFTRTFTKRYLVANATQKRLVGFQTIGSKTYYFEPKTGEMVY
FT                   GLKTIAGNSYYFDENGVSNTQLAYKKTVASVDGNNKIVEKAIADGMKLVGKSPYVYGGG
FT                   RTSKSIANNEFDCSSFIAWLYRQAGQPLVVQSAASTTILNQIGTTVAWSDMRRGDILVT
FT                   PDTYTEERLHTAIYLGNGFILHDSAPTHGVAISRLVDLVNSKTSQTLTWSGLFKPGAVR
FT                   QVVDN"
FT   CDS_pept        394895..395515
FT                   /transl_table=11
FT                   /gene="tdk"
FT                   /locus_tag="LEGAS_0393"
FT                   /product="thymidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91041"
FT                   /protein_id="CBL91041.1"
FT                   /translation="MAQLFFEYGAMSSGKSIEILKVAHNYESQGRQVLLMTPITDTRAG
FT                   IGVVASRIGLSREALAVKPADDLYVLIKSMAANDLAVVLVDEAQFLTPEQVDQLAYTVD
FT                   NLHIPVMAFGLKQDAFNNLFAGSKRLIELADKLEEMKTICSFCGKKATTQLRIVNGKPQ
FT                   RQGAQVFIGGDEAYIPTCRRHWFNPDLDKIATMFPYEATEHAK"
FT   CDS_pept        395612..396685
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="LEGAS_0394"
FT                   /product="Peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91042"
FT                   /protein_id="CBL91042.1"
FT                   /translation="MDPIFQSLQTVVDRYDELNEQLADPDVAGDGQQYMALLKEAGEMR
FT                   ETVEVYTHYQQVMQGISDAEDMLDDAEMAPLAKEDLNTLKPEKIVLEDQLKILMLPKDP
FT                   NDDKNIIMEIRGAAGGDESSLFAADLLDMYRRYAEKQRWVVSIIDETITEVGGYKEVAI
FT                   MITGDNVYSKLKFESGAHRVQRVPSTETQGRVHTSTATVGVMPEFEEIDFELAESDLEE
FT                   EFFRSGGAGGQNVNKVSTAVRLVHKPTGIMVKMQEERTQIKNRDKARKLLASRVYDFYA
FT                   QQNEAEYAEKRKSAVGTGDRSERIRTYNYPQNRVTDHRIGLTLNKLDRIMNGELGEIVD
FT                   ALVIADQTAKLAELNQA"
FT   CDS_pept        396688..397695
FT                   /transl_table=11
FT                   /gene="prmC"
FT                   /locus_tag="LEGAS_0395"
FT                   /product="Protein methyltransferase prmC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91043"
FT                   /protein_id="CBL91043.1"
FT                   /translation="MTEKQFETPKQFKQVGNYEPTRQIMPDKLTAPKWYDWDDIKKPTK
FT                   PSQVKISLLEGRKWAIAELTSVGMPKEDAQDNVDFLLSGALNINYAYLRANITRTMPSD
FT                   LAAIWPKWLAKLMNNEPVQYILGHAPFYGREFMVDSRVLIPRPETEQLVEWILKDAGSK
FT                   NGKPVSVLDIGTGTGAIIETLMLENPRVRGFAADISSGALAVAEMNAQRFGLNYLHLVQ
FT                   SDVYSAVEGLEFDIIVSNPPYIATTDEDEMADNVLEYEPHTALFADHDGLAIYEKIAAD
FT                   LALYLSDNGRAYFEIGYKQGQQVVSMMQHALPQAEVTLKKDFSGLDRMVRVVKG"
FT   CDS_pept        397737..398744
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0396"
FT                   /product="Putative translation factor (Sua5 family)."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91044"
FT                   /protein_id="CBL91044.1"
FT                   /translation="MKTELLTSNDIKRAGELLRAGEVVAFPTETVYGLGADATNETAVK
FT                   KVFTAKGRPADNPLIMTIADEKQLDEFVLISQAARQLMTAFWPGSLTIILPIKPKKVAM
FT                   IVTGGLQTVAFRLPDNDVARVVIRDAGVPIVGPSANTSGKPSPTTAQHVWHDMNGKIAA
FT                   IVDDGPTQIGVESTVIDMSANVPTILRPGAVTQQQLQDVLGVTVIDATSTTSVASDVTP
FT                   KAPGMKYRHYAPDKKVVMFDRLDAIDLMHSLQTHDVVMAQDTTIEVMQLSLEQSWSLGE
FT                   TLETATEQLFAGLRFYDDEAQVATIYVEKMSPIGIGKAFNNRLAKAAGNQEFNL"
FT   CDS_pept        398955..399224
FT                   /transl_table=11
FT                   /gene="ptsH"
FT                   /locus_tag="LEGAS_0397"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91045"
FT                   /protein_id="CBL91045.1"
FT                   /translation="MTQSKDFHIVAETGIHARPATLLVQAASKFTSDVTLSYQGKDVNL
FT                   KSIMGVMSLGVGQGADVTIKTDGDDEEAAMAAIVEAMETEGLAE"
FT   CDS_pept        399227..400942
FT                   /transl_table=11
FT                   /gene="ptsI"
FT                   /locus_tag="LEGAS_0398"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91046"
FT                   /protein_id="CBL91046.1"
FT                   /translation="MSNNFKGIAASNGIAIAKAYLLVDPDLSFTKTTITDVTAEQARVD
FT                   DALKAASADVEIIKSRAEKNLGADEAQVFEAHLMVLSDPEMSGAFKQKIADDKVNAEQA
FT                   VKEVTDMYIGMFEAMTDNAYMQERAADIRDVTKRILSHLLNVALPNPALIDEEVVLVSK
FT                   DLTPSDTSQLDRQFVKGILTDLGGRTAHASIMARTLEIPAVVGSEVATQKITAGVTVIV
FT                   DGLTGDVIVDPDSETLATYQQKAANYLAQRAEWALLKDQQSVSADGKNFVLGANIGSPK
FT                   DMDAVLENGSEGVGLYRTEFLYMESDHLPTEDEQFVAYKAVVEKMAGKPVTVRTMDIGG
FT                   DKNLSYWKLPKEENPFLGYRAIRISLDQTEIFRTQLRALLRASAYGNLWIMFPMIATLG
FT                   EFRAAKKVYLEERAKLEEAGVSMGEIKLGIMIEIPAAAVLADKFAKEVDFFSIGTNDLI
FT                   GYTMAADRGNDKVAYLYQPYNPSILRLISNVITAAHNEGKFVAMCGEMAGDPIAVPVLM
FT                   GMGLDEFSMSAPSVLQTRSLMKKLNTVDMKLLAEKALDAETNDDVIALVEAATK"
FT   CDS_pept        401090..401572
FT                   /transl_table=11
FT                   /gene="sigM"
FT                   /locus_tag="LEGAS_0399"
FT                   /product="RNA polymerase ECF sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91047"
FT                   /protein_id="CBL91047.1"
FT                   /translation="MKINHYEKELINIANEIIGFLINNGAKKNDAQDIMQDVFVKLLQA
FT                   DILLAPDKLRPWLYRVALSRFYDIYRRQKRYRDILLEQYAQYSEVEPILADYSGLQRAL
FT                   EKLNDYQSALIVLYYDDRKHINDIAMIYDVSSSKIKVDLYRTRQQLKDIMMGYENE"
FT   CDS_pept        401565..402590
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0400"
FT                   /product="Probable anti-sigma-M factor yhdL"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91048"
FT                   /protein_id="CBL91048.1"
FT                   /translation="MSDNVNFEKIIKTEKRKKWLKTIAVSGAATVIIGGSVFYAIHKQV
FT                   GIQMAKQASKQQRQFNIDDLISSPNIISTSQYFSMTKTTQSTLKSDREKNIDGYRVAYP
FT                   EKNVTFNTHGVESASAQTPNIYNKNPATKEIIATNRQSQQKEPLFFNVKYEHAYQSEKD
FT                   KKELLASSIPTHEAETLSQLSNTLGEVAITFDKRYSYDDIRQMMPENVMINYYWLGIHS
FT                   DKLDTMSAAGSYIGLNASDDGTGKLTEGAEVKAGKNDFSGYQGLKSALEQQSGQRTVND
FT                   IDIAKDGQRQMSKNLKTAKFAGVIVTGRTQNLAKLDNQKYTFATNVGVTTPIMPYQAPI
FT                   K"
FT   CDS_pept        402642..403352
FT                   /transl_table=11
FT                   /gene="yeaZ"
FT                   /locus_tag="LEGAS_0401"
FT                   /product="Glycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91049"
FT                   /protein_id="CBL91049.1"
FT                   /translation="MKILAFDTSNQPLTVSLAEDNQVKRVFSTNEARNHSIQLLPAIQE
FT                   TIAAQNWTLTDIDRIVVAQGPGSFTGLRIGITVAKVLADTLKIDLVGVSSLAVLAEQVT
FT                   TQGLIVPLFNARNENVFAGVYREGNNILADAHQPIANLFNWLQTFDEPIIFLGDTDVFS
FT                   ALIIETFGTRAHMLTPSESLPDGHGIVSLGIQASPVTSIADFNPQYLRKTQAELNWLAA
FT                   HPGEDNPENYVFEV"
FT   CDS_pept        403336..403893
FT                   /transl_table=11
FT                   /gene="rimI1"
FT                   /locus_tag="LEGAS_0402"
FT                   /product="Ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91050"
FT                   /protein_id="CBL91050.1"
FT                   /translation="MFLKFNRNNKLPKILFKFEQKSVDSKGYSFTLRRANVEDIDILVH
FT                   IEEAVYAGTAPWLLRDFLSELSRPNVRLYLVMERKGQVIGFAGVAYQRDQRDMHITNIA
FT                   IVPVWQNKGLGTLMINELLDFSRKLGVDSMSLEARASNRSAIMLYSRLGFEQSGIKKSY
FT                   YIGDHEDAISMVNNLDSKTRNN"
FT   CDS_pept        403868..404290
FT                   /transl_table=11
FT                   /gene="rimI2"
FT                   /locus_tag="LEGAS_0403"
FT                   /product="Ribosomal-protein-alanine N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91051"
FT                   /protein_id="CBL91051.1"
FT                   /translation="MIVKRATIEDSNRIFNLANAAFVPSPWPKSVFEHELKSPRSQYFI
FT                   LDGGFLGMTQILDEVEINSLAVHPDNQNQGIAQQLLTTVLALPNVTRFLLEVDESNVAA
FT                   ICLYEKMGFSVYYHREKYYKNGHAAIMMERKVSVTN"
FT   CDS_pept        404315..405331
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="LEGAS_0404"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91052"
FT                   /protein_id="CBL91052.1"
FT                   /translation="MTKIISFESSADETSVAIVEDGCTILSNAVATQINSHQRFGGIVP
FT                   EVASRHHIEWITRVLDDALQTAHVKPTELDAVAVTYGPGLVGSLLVGLMGAKTFALAHN
FT                   LPIIPVNHLAGHIAAANFNTPIIYPALALMVSGGHTELVLMREENSFLVLGETRDDAAG
FT                   ESFDKVGRLLKLPYPAGKTIDDMAHLGQATIKFPTAMAHEDNYDFSFSGLKSAVINYVH
FT                   HAEQKGETINRNDLATSFQNAVVDALLGRTRRALQDFPVKSFVLAGGVAANSQLRQTLS
FT                   ELLEQFPNTQFIPVPRQYTGDNAAMIGAAGYWNYKEKKFAGLDLNTNPGLDFELLES"
FT   CDS_pept        405494..406144
FT                   /transl_table=11
FT                   /gene="rex"
FT                   /locus_tag="LEGAS_0405"
FT                   /product="redox-sensing transcriptional repressor rex"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91053"
FT                   /protein_id="CBL91053.1"
FT                   /translation="MTQQPKIPRATAKRLPIYYRYLTFLHDAGTNRISSAELSDAIKFD
FT                   AATIRRDFSYFGALGKRGYGYDVKALLDFFANVLDQDSLINVALIGAGNLGQALMNFNF
FT                   HQSSNMRISAAFDVDESRAGTILAGVPIYAMTDLKEQMTAQRINIAILTVPQEVAQDIT
FT                   NQLVDAGVKGILNFTPLRVTVPTGVRVQNVDLTNELQTLVYFIDNYGSITTGL"
FT   CDS_pept        406150..407187
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0406"
FT                   /product="FemX"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91054"
FT                   /protein_id="CBL91054.1"
FT                   /translation="MTILNLNDTEKVNAYQSFVREDPRGQVTQDPLWGELKANWGHVYV
FT                   YHETDGQIDAVLTVLTVEAVPGKLLGYAGRGPIGDVTNIALIKSLLEEALAALPENVFL
FT                   IRLDPEVAYSDILNDAYQAAGFVTRNRDIKNMHGNIQPRKNVVLYYDGRGEGAVPITND
FT                   TELMTHFKRDYRNQIRRAAKDGVTVTSGDTQDDVRAFFDTYVMMAAAQNITHRPIDYFL
FT                   HMQKLWQNTGLFKVFLAHFEGQVIASGIGFSYGDEIWYMYAGSNRQYAKHYGPYAVQWE
FT                   MLKWGLSLGKVEYDFGGVGDFVPEDGLYKFKHGFAYHDPHAEYIGELDWVVDEMGYQEY
FT                   LKQFD"
FT   CDS_pept        407256..407684
FT                   /transl_table=11
FT                   /gene="gtcA"
FT                   /locus_tag="LEGAS_0407"
FT                   /product="Teichoic acid glycosylation protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91055"
FT                   /protein_id="CBL91055.1"
FT                   /translation="MLNLKNIFIKYQSFLLYVIFGVLTTIVNIIVFFILYNMLHTGHNI
FT                   AYVVAWFWAVLFAYLTNRVWVFHSTSTTTASIIKEVWQFYLARVLTGIIGYFILTFGVD
FT                   LLRQDANIWNIIQNIFVIVSNFVLSKLIIFKKDNEHDN"
FT   CDS_pept        407674..408492
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0408"
FT                   /product="Hydrolase, HAD superfamily, Cof subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91056"
FT                   /protein_id="CBL91056.1"
FT                   /translation="MTIKMIASDMDGTFLTANDTYSQGRFERILDNLKARDMRFIAASG
FT                   RQVKNLQELFEPTISKGYEIDYVGSNGAMVATHEEQLYSVHLSPEQLHKVIDWNAKNPD
FT                   SAENIIIMTGDKATYVSNHATGPVAKMVFQFYPNVKQVEKLMTVDDHILEITFVWPNDE
FT                   VQQHVSELREIFGDELHATGSGFGSVDVLGKGVDKAAGLQVLQDYYNVLDREVMTFGDN
FT                   GNDLEMLQKYEHGYVMPNADNFMLEVIQKKALNTNVNDGVLETIENYLSI"
FT   CDS_pept        complement(408512..408994)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0409"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91057"
FT                   /protein_id="CBL91057.1"
FT                   /translation="MQFGRFRIGLRTLKTALAVMIIITAFYFFHRPPFIAALASVFALR
FT                   ESWDKTLSFAKIRLVSNTVGGLLALIYFLVHAQTHNATWVSMIFLPLLVIIAIVFLDGF
FT                   NFNSGVIGALAALLMISLNIPAGATVLYVIDRIIDTFIGVLVSIGVNRFASPKPKR"
FT   CDS_pept        409118..409858
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0410"
FT                   /product="nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91058"
FT                   /protein_id="CBL91058.1"
FT                   /translation="MSNITIDLLNNHKSIRAFTDQPVSDEIVKTILTAASAGPNINNYQ
FT                   PVTFVEITDQALKAEITTQVGMAYIESAMRYFVVTVDFNKDLIGLTPEIRKQAEEVLSS
FT                   YAMLEGGIISAGIALGRAQVAAESLGLGSVTMAGALRAFELYEEKLQLPKLVKAVMGFS
FT                   IGYPAQEPGIKPKLPLAGTWMKSQYSQKQMVDAVTIYDKTMIKYYAARGIDSSWTQNNA
FT                   KMLTRKQDFSQLGKYPKRKGFTLN"
FT   CDS_pept        complement(409879..410313)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0411"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91059"
FT                   /protein_id="CBL91059.1"
FT                   /translation="MSYDFKSNASREYLENIIDLNHITIIHLSGTTYDPDVVNIQKKAI
FT                   IINNNYQSNFSYEFRIAHELAHLLCTTSSENYNLSLLTKNDIEKQANIDGIQLLINFYF
FT                   SEIASGKLRWNYRFQFISTFGLGPLTHLVEKILNPIKNSV"
FT   CDS_pept        complement(410316..410696)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0412"
FT                   /product="Transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91060"
FT                   /protein_id="CBL91060.1"
FT                   /translation="MVTKETFGSQLKKIREIKGFTVRQTAMQGHISPAYLSQIENGNKN
FT                   IPKVETLYKIASGLRISNDDILNLAGITKNKSAETPSAHIDLGEQLENTDILLSFEGKD
FT                   LSPKYRQAILSVLKTLPDAKND"
FT   CDS_pept        410847..411059
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0413"
FT                   /product="Putative helix-turn-helix family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91061"
FT                   /protein_id="CBL91061.1"
FT                   /translation="MAFTLKFRDPVNVKGKIAMKGESVAGFARRIEVNYSLMIEYLNCK
FT                   KYPSPPTAKKIAEGLGCEIEDIFFI"
FT   CDS_pept        411194..414142
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0414"
FT                   /product="putative mucus binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91062"
FT                   /protein_id="CBL91062.1"
FT                   /translation="MEKSKKHYKLYKSGKLWITAAIAVGMFSVTSVTAQASSSANAMTA
FT                   GQPTQRVVPTQQVDTKSQLIDNKPAENVNTSDQSVDDTKLNQSVDEAKKANVAVTEDNK
FT                   AAKTTEIQGTESADASAQVTAAQASDKADYAQQITDLNVAKEKEVAYEKAVNTGKKDNI
FT                   DGKTQIATSSNTQALKLDKSKPVDESTPTGNIQPTNVYSGSDEKASPNMASSTKVWEYS
FT                   GNQVIGATITKNWAKAGTIAIRDSSGQIVEKSVDLNETFHDFQVQNGNWSDTSDYHDQG
FT                   IPKVTISSNAVDNVEMWNVNWQTTFWFTYSGTKQIVPISKLTGSNDDPKFYFLSASISG
FT                   SLYTGAKNPTQWEDGNWQPNEREYVQTNDASTVVIQPNSTVGLETLAQNGVVTNLPHGM
FT                   GYTQTGAVYPKTDDDDPDVYALQEGVSFADFNTDKPTLYLGAVPIEKSARWWHSNHNMN
FT                   SDELAFVQKPKATYHKAKISHTQVPIVTINEKINYVDEFENPIHTVYDTNNATNKKFVT
FT                   ITRTTADGNQYQEMWVATGEVANPNIVRTTTKDVNTGKDVIDEVITNTGWTIADAGVFP
FT                   AVRNPIITGYHVIKTTDAAQDLNETTNQTVTNTEPNQLREITVIYVHNNEKAIVSYIDD
FT                   NTGKTLETKELIGKYGTTDQYRTAGTIKNYEDKGYVLNTDNPTAADNYPRDGITYDQDG
FT                   VIQSFEVHLKHTSETISPSHPKTPGDAINPNDPASPSWPKETGDVERAGSQTVSYSGAG
FT                   DKTPGAVVTTDAHAFQREVTVDKVTGAVTQTSDWTTQTFKSVLTPTVEGYHADKGVAGG
FT                   LTATVDQPDVKEAVVYTANGKLVPVDQDGQEIPGADQPIYPTDPTDPTKVVPNEAVPGV
FT                   ENYTPDATTPVTPSDPSADTTVPYHKNGQITVTDNTKNNNDVKPNNKHTINKSSTVNQQ
FT                   TKTSNKARNDEHTGNVSLPKTAVAEHSNNGVLGMMSLGLIGMMSVIVKKRRK"
FT   CDS_pept        414297..415277
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="LEGAS_0415"
FT                   /product="mannose-6-phosphate isomerase, class I"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91063"
FT                   /protein_id="CBL91063.1"
FT                   /translation="MTVLILQPELHNKIWGGTNLKQFNYDLASDHVGEAWVIAAHNNGV
FT                   STVINGQYKGKTLTEIWNEQPDLFGGHDENQEFPLLVKILDAHENLSIQVHPNDKQSSE
FT                   NFGKTESWYILDSTPDAKLYYGHYATDQADLKNLVAEKAWDKLLRTIPVQKGDFFYVPA
FT                   GTFHALGAGVLALEIQQSSDTTYRFYDFDRVDLTTNKLRPLQIEEAIAVTKVPHVDPIL
FT                   NQRTRIQGSTILTRLLTSPKFTIDKLSVRGLSNFNQHHSYELFNVIAGEVTLTDNETTY
FT                   YLKKGDNFIMLKDTGNYTLDGHGDIMVSFVTPDSYSNQELAYLDN"
FT   CDS_pept        415484..416434
FT                   /transl_table=11
FT                   /gene="manL"
FT                   /locus_tag="LEGAS_0416"
FT                   /product="PTS system, mannose-specific component IIAB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91064"
FT                   /protein_id="CBL91064.1"
FT                   /translation="MVNLIVASHGDFAKGILMSGSMIFGEQKNVEVVTFQPTEGPDDLD
FT                   KHYQEALAKFDNDDDTLFLVDLWGGSPFNRASLIQKQDAEHKAIVAGLNLPMLIEAYGG
FT                   RLGMNTAADLAKYLVPVAKDGVRSVPEAEEEKPKAVVKADATAGLKAGHINIKLVRLDT
FT                   RLLHGQVATAWTPDSKANRIIVVSDAVAHDELRKSLIQQAAPNGVQANIVPISKMVEVA
FT                   SDDRLGGVDAFLLFETVEDVLRAVEGGVPIKSLNVGSMAHSEGKTMVNKVLSMDKTDVA
FT                   AFEKLRDMGVVFDVRKVPSDNSANLFDLIKKANVK"
FT   CDS_pept        416470..417279
FT                   /transl_table=11
FT                   /gene="manM"
FT                   /locus_tag="LEGAS_0417"
FT                   /product="PTS system, mannose-specific component IIC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91065"
FT                   /protein_id="CBL91065.1"
FT                   /translation="MSIIAMVLVVIIAFFAGMEGILDEFQIHQPLVSATLIGLVTGHLT
FT                   AGIMLGGSLQMIALGWANIGAAVAPDIALASVASSIIMVKGGNFTSTGIGVAVASAIPL
FT                   AVAGLFLTMIVRTIAVGLTHGADAAAKEGKYQTIERLHLVGILLQGLRIAIPAGLLIAI
FT                   PASAVQAALTAMPAWLTGGMTIGGGMVVAVGYAMVINMMATREVWPFFAIGFALAAVSQ
FT                   LTLIALGAIGVSLALIYINLSKMGGNNGGGSNGGNSGDPVGDILNQY"
FT   CDS_pept        417294..418205
FT                   /transl_table=11
FT                   /gene="manN"
FT                   /locus_tag="LEGAS_0418"
FT                   /product="PTS system, mannose-specific component IID"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91066"
FT                   /protein_id="CBL91066.1"
FT                   /translation="MTEKIELTRNDRLSVAWRSQFLQGSWNYERMQNVGWAYTLIPAIK
FT                   KLYTTKEDRTAALKRHLEFFNTHPYVASPIIGVTLALEEERANGAAIDDTAIQGVKIGM
FT                   MGPLAGIGDPVFWFTVRPILGALGASLALSGNILGPILFFVLWNLIRMSFIWYTQEFGY
FT                   RAGSAITQDLSGGLLKDITKGASILGMFILAVLVERWVSIKFAVSLPAKKLAEGAYINF
FT                   PNGSVTGGKLQQILADQASGLSLTKMAPNTLQANLDSLIPGLMGLLLTFLAMWLLKKKV
FT                   SPIVMIIGIFIFGILMRVLHIM"
FT   CDS_pept        418325..418702
FT                   /transl_table=11
FT                   /gene="manO"
FT                   /locus_tag="LEGAS_0419"
FT                   /product="ManO"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91067"
FT                   /protein_id="CBL91067.1"
FT                   /translation="MVQSLNKKVEITAQGISFLGIGAQYGKFLIGDKAFEFFNDNNVDD
FT                   FIQIPWDNITAVYTSVSSNNKVSRRFRIETDKGKFDFSSAESGRLLKTARGHIGNDKIL
FT                   KNPTVLKRLSMMFKKKNKKGV"
FT   CDS_pept        418702..419535
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0420"
FT                   /product="YitT family protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91068"
FT                   /protein_id="CBL91068.1"
FT                   /translation="MKLLQKFQVVRYLTIVIALEIVAVSINFFYVPAKVAAGGATGFAI
FT                   LMYELVGFDRAITVLVVNLLMIILAAIFLDRGTTARITFGSLVLPILLKLTPSFQILTD
FT                   RTFAVLVGGTIFAIGVAMLYRVDASSGGTAVPPMILKKYFRIAPALSLLVIDTVVSLGN
FT                   LLTEGLGALILAMFSLIITAAVMNYIETGLDRRKMIYITSNARIEDVKVYLTENETSYT
FT                   VMGVHGGYTGDAREMLMVILDNHEYNHLVRGLHAVDPQAFIIAYDISEAHGGTFV"
FT   CDS_pept        419706..419990
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="LEGAS_0421"
FT                   /product="10 kDa chaperonin GROES"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91069"
FT                   /protein_id="CBL91069.1"
FT                   /translation="MLKPLGDRVIIEVTEAAEQTVGGIVLANNAKDKPVTGKIVAAGTG
FT                   YVLNDGSVRELAVKINDEVLFDKYAGQEVSFEGTDYLALHEKDIVAIVE"
FT   CDS_pept        420056..421675
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="LEGAS_0422"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91070"
FT                   /protein_id="CBL91070.1"
FT                   /translation="MAKELKFSEDARSKMKAGVDKLADTVKTTIGPKGRNVVLEQSYGA
FT                   PTITNDGVTIAKAIELEDHFENMGAKLVAEVASKTNDIAGDGTTTATVLTQAIVAEGLK
FT                   NVTAGANPVGIRTGIEKATAAAVKKLHEMSHTVSTKAEIAQIASISASNEEVGELIAEA
FT                   MDKVGNDGVITIEESKGIETTLDVVEGMQFDRGYMSQYMVTDNDKMEANLDNPYILITD
FT                   KKISNIQDVLPVLQSVVEQGRALLIIADDITGEALPTLVLNKMRGTFSVVAVKAPGFGD
FT                   RRKAQLEDIAVLTGGTVITEDLGLNLKDVTIDQLGQASKVNVSKDNTTIVEGSGDKNAV
FT                   ATRVDIIKQQIAETTSDFDREKLQERLAKLAGGVAVINVGAATETELKERKYRIEDALN
FT                   ATRAAVEEGFVSGGGTALVNAISAVTALSEEGDVQTGINTVIKALEAPVRQIVENAGFE
FT                   GSVIVNKLKEQVEGFGYNAATNEWVDMIAAGIVDPTKVTRSALQNAASVSALLLTTEAV
FT                   VAELPSDDSVPAMPQGGMPGMM"
FT   CDS_pept        421856..422257
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0423"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91071"
FT                   /protein_id="CBL91071.1"
FT                   /translation="MMIIYYSLTGHTKKVALEIAKKTEDELYEIQLDKPYKSNPLVLAR
FT                   FTREKAKGVIPTAHKIDIDDDVIYLGYPMWGGDMSLAMQGFLMANDLSGKHIKPFITSG
FT                   KSTLEMSLKTLKKLAPDAMIDANFNPDML"
FT   CDS_pept        complement(422270..423607)
FT                   /transl_table=11
FT                   /gene="pepC"
FT                   /locus_tag="LEGAS_0424"
FT                   /product="Aminopeptidase C"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91072"
FT                   /protein_id="CBL91072.1"
FT                   /translation="MSSEITKQQLTEFKQSAQSPLTTIARRATTKNGIHNASFNQEIVN
FT                   ANVPTFSIDLNTGKVANQKKSGRCWMFAALNTMRHDIKDLFHLDGDFQLSQSYTFFWDK
FT                   FEKANYFYENVLNTANSPLDSRQVSFLMATPQQDGGQWDMIVSLIEKYGVVPQSVYPES
FT                   AASSDSHEFNITFNTLLRHDAIILRDLVSQKSSQHDIDSTRKNMLSHIYRVLSITFGEP
FT                   PVTFDFEYRDTEKQFQIERQLTPQTYFEKFVNWDLSEYISIINAPTADKPFNATYNVDM
FT                   LGNVIGGRQVKHLNVPIETMKSFAIAQLKDGKSVWFGVDMGPQVDRANGLMADGIFATD
FT                   DLFQVHSDMTKAQRLAYGDSLMTHAMVLTGVDLDENGHPIKWQVENSWGEEAGKNGYFT
FT                   MSDEWMSEYAYQVVVKKEYLGPELVNIYDNATPKLLAPWDPMGALA"
FT   CDS_pept        423829..424209
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0425"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91073"
FT                   /protein_id="CBL91073.1"
FT                   /translation="MKKHGLTEKEQGEALTAAAEIINIPYTFESQAPFRVWIDKDENIY
FT                   VDIKSAAVGFRAELNYGDIGVATLKNNVDVPTSDDLMSLVEQLIDDDVQDFLLGFAMDA
FT                   PVRDNGEYASSLREAFQAFTTK"
FT   CDS_pept        424297..425184
FT                   /transl_table=11
FT                   /gene="menA"
FT                   /locus_tag="LEGAS_0426"
FT                   /product="prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91074"
FT                   /protein_id="CBL91074.1"
FT                   /translation="MTPKQFLDLVEIRVVIPSVAPLMVGLAYSQWQYARVNWLNAILLI
FT                   IATISVHLAVNTFNRYEDAKRQKSNEFLREKAQGEVITNKQVLHVAETLAGIAVLAGIA
FT                   VALRTDYITWIIGIISFLIGYLYSAGPKPITNTPFGEVVSGITMGYFIFIAQVYVNTRM
FT                   VPTINVLFQWLIVSLPLTIFIAEIMFANNIADHDEDEENQRQTLVHYLGMASSKKVYMF
FT                   WTIAAFIEVIIATLVGWLPITSYAMVILLPIVIKNARAFIRRPVKQETFVLAIKNLVIV
FT                   MCGMTIVILAGIWL"
FT   CDS_pept        complement(425206..425850)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0427"
FT                   /product="CBS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91075"
FT                   /protein_id="CBL91075.1"
FT                   /translation="MLHESLITPKSKLTTVTENTTIAQVNDLFNSPSESHTRTMPILDE
FT                   SGNLFRGNVYKQHVYEHIAKNGDMNLPVTTIMRNSTKFIYTTSQFYEVFFAIRDLPFIA
FT                   VLDDNHHFTGIFTHDALMDLLSQSWSVRTGGVALSVATHKAQGDLKKISTIIAKYSNIE
FT                   SVLSLQPSNGTITLMFTLPLVFDSITLQKLVKHLEKRHFEVISIENLQRFN"
FT   CDS_pept        425970..426539
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="LEGAS_0428"
FT                   /product="Peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91076"
FT                   /protein_id="CBL91076.1"
FT                   /translation="MKYIIGLGNIGLEYDKTRHNIGFMAIDAFASAHSVSFAPSKQFAT
FT                   IAKLTVDGEQVVLVKPTTYMNDSGKAVRAILDYYGGDINTDVMVLVDDMDLPFSKLRFR
FT                   AKGSAGGHNGLKSIMAHTGSQTFLRLKFGLGHPNHEQQAVIHYVLGKFSRAETDDVNHM
FT                   LDRSTLAIEEWIQGNSVSELSNKYNG"
FT   CDS_pept        426599..430117
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="LEGAS_0429"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91077"
FT                   /protein_id="CBL91077.1"
FT                   /translation="MLTHFLAQSDTIKHLNEQAADGSSQLLLGVNGSARAASVAALYEA
FT                   NPRQMLVVTDTQVHADQLFSELSSLMTSVFNFPAEESLATEIAISSPDLRLQRVASLLA
FT                   LRKGEAKVIVTSLAGVERLLPRPETVDAAKLSLTVGQTYQLNDIKKTLMMMGYTPTKLV
FT                   QGAGEFAQRGSIIDIYPLTSDEPIRLDFFDDELDQLKNFDVSTQKSTTVLKKYHVQPAT
FT                   DFIVSETQYDIAKQTIETAFNNYRKELTGVAKKHATEGFAATQHVLNEHGRVNQLLPYA
FT                   THFFDGETTLLDYFSDDVLVFVDEFTRLKDMQIQQLTYDQEWLDKQLSTYQLIPGQVLR
FT                   ADFADLLTQNKSAVIYLANFQRGLNNIKFTNIEEVTTRPANQYYGQIETLRTDLQYAQD
FT                   AGMTVILLINDEKQSHHLSESLSDFKVPIIETRQVQPNQVQIMKGNLAIGFEWPKLHLI
FT                   VLTAHELFTQTRQVAPRQRKINNAERLKSYSELNVGDYVVHINHGIGRYEGLQTMTVDG
FT                   GKQDYLSIAYQKNAKIFIPVTQLNLIQKYIGASDAAKAPKLNKLGGVEWAKTKRQVAAK
FT                   IEDIADDLLELYAKREAQQGYAFPPDDTEQLKFDMAFGYPETPDQIRSIEEIKVDMQKV
FT                   RPMDRLLVGDVGFGKTEVALRAVFKAVHAGKQVAFLAPTTILVQQHYETMLARFNDFPN
FT                   IKIGVLSRFQTTAQNKFVIKQLNEHQIDIVVGTHRLLSKDVDFLDLGLLIIDEEQRFGV
FT                   KHKERLKQLRHSVDVLTLTATPIPRTLNMAMVGARDLSIIETPPANRYPIQTYVLEADW
FT                   IIVRNAIEKELARGGQAFYLHNRVADIDRVASQIEDLVPSARVGAIHGQMSETQLESVL
FT                   YDFLNGNYDVLVTTTIIETGVDIPNANTLIVENADHMGLSQLYQLRGRVGRSARLAYAY
FT                   FTYPFSRTPSEEAEKRLEAIRDFTELGSGFRIAMRDLSIRGAGDILGKQQHGFIDSVGY
FT                   DMYTKMLKDAVATKQGYTVTTSKPTETDAELILGVLAYLPDTYVPDNAQKIELYTRIRE
FT                   ARTDKEFEEIETDMLDRFGDMPDEVARLLLVGQIKQLADQARVTNIRRQKQQLVIIFNS
FT                   DATAALAGEAIFETLVNVPLKVAVRTETGNLQVSITVNDVAESSIWLNILRDFLLVVIA
FT                   RQQVTK"
FT   CDS_pept        430159..430443
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0430"
FT                   /product="Heat shock protein 15"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91078"
FT                   /protein_id="CBL91078.1"
FT                   /translation="MRLDKYLKVSRLIKRRTVAKEIADQGRISINGKVAKSSSDVSTND
FT                   ELEVRFGNKTLTVKVAKIVETTKKEASADMYEIVSETFSQDFRETSDEK"
FT   CDS_pept        430518..430913
FT                   /transl_table=11
FT                   /gene="diviC"
FT                   /locus_tag="LEGAS_0431"
FT                   /product="septum formation initiator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91079"
FT                   /protein_id="CBL91079.1"
FT                   /translation="MSTYNRRQSHKQRVNPEIRAIIRNSEPANMQAKKHYQRAHANREK
FT                   KILFFGAVFATIFAIQLLISQVKLHTANVTLTASQDRLTAVQKTNSDLKSSRKRLDDPT
FT                   YLQQILRDKYGYTKQGEIIYNLPSDNN"
FT   CDS_pept        430943..432250
FT                   /transl_table=11
FT                   /gene="tilS"
FT                   /locus_tag="LEGAS_0432"
FT                   /product="tRNA(Ile)-lysidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91080"
FT                   /protein_id="CBL91080.1"
FT                   /translation="MTKKIQKQLQLYHWEATVIVAVSGGVDSVVLLHTLRQQLPDAKLV
FT                   VAHVNYHLREESDADEKFVHHLADKYHAIFEQTAWLNVPDIAVEKQARDFRYQFFEQLA
FT                   SKYHTTTVVVAHHADDQAETVLLKLIRGGQLMQLAGMSQQNRRIVRPFLCITKQELVSY
FT                   AQKHNLNWHEDKTNHDAMYTPRNFLRQIIIPQLKKINPRVVPHINSFAEQIKKQDDLIT
FT                   AQVELYVQTIENSWQTIPNIWLEPTIKHYIQKKGIYQFKQAQILQVVQLLNNDKKPTGR
FT                   IQLSKNINFVKSYQYIHLENSAKMTNTLQVLPPIMLKLNQWQNFAENTFLWTNSEPNSD
FT                   EQSFSFNLAQLPTHLYLRSVKTSDRLALIYGHKKLRRLAIDEKLSTLERQDMQVLANQN
FT                   DEVIAVKMRKHWRVNVDFVSKQDVKPYWLAWRIEEK"
FT   CDS_pept        432250..432789
FT                   /transl_table=11
FT                   /gene="hpt1"
FT                   /locus_tag="LEGAS_0433"
FT                   /product="Hypoxanthine-guanine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91081"
FT                   /protein_id="CBL91081.1"
FT                   /translation="MNNDIQEVLFNQDNIHDAAVRLGQQITQDYAGEKPVVLSVLKGAY
FT                   LWTADLLREVDLYIDLEFINVSSYHGGVKSTDEITLVTDIRSDIMGRQVIILEDIVDTG
FT                   QSLLFMKELLAKRGAASIKVATLLDKKAGRKVDIEADYVGFNVRNEFVVGYGLDYKELY
FT                   RNLPYVGILKKEVYTK"
FT   CDS_pept        432813..434900
FT                   /transl_table=11
FT                   /gene="ftsH"
FT                   /locus_tag="LEGAS_0434"
FT                   /product="Cell division protease ftsH homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91082"
FT                   /protein_id="CBL91082.1"
FT                   /translation="MNNNQKGGFLKSSIFYVFIFLAVVGMIYGLFGNDKSTSKTLTSSE
FT                   FLKALSDKDLKSITVQPGNGIYNISGEYRKAKTVKSDKGFSILQQSQKVTKFTSTVLPN
FT                   DASLKSVTDTAKTTKTDLVTKQQESSGFWLNLLVSIVPIILIVGVFYLMMSQAGGKGGQ
FT                   GGMMSFGKSKAKPSDPKDNKVRFSDVAGAEEEKQELVEVVEFLKSPKKFVSLGARIPKG
FT                   VLLEGPPGTGKTLLAKAVAGEANVPFFSMSGSDFVEMFVGVGASRVRDLFENAKKSAPA
FT                   IIFIDEIDAVGRRRGTGMGGGNDEREQTLNQILIEMDGFEGSEGVIILASTNRSDVLDP
FT                   ALLRSGRFDRKILIGAPDVKGREAILNVHAKNKPLADNVDLKAVAQQTPGYVGADLENL
FT                   LNEAALLAARRNKKKVDAADIDEAEDRIFQGPAKTNRSMSERERRTTAYHEAGHALVGL
FT                   IRSEASIVRKVTIVPRGRIGGYALMTPKTDRYNLRYSEAKEQLAGLMGGRAAELFMFNE
FT                   ASSGASNDFQQATGLTRQMVTAFGMSDKLGMVQLEGNASVGYAEQAGNRGYSEETARLI
FT                   DEEVRRLSKEAFEDATKIISEHKDKLIAIAEALLEVETLDEKQIKDIYETGKFTRKDIQ
FT                   DNDELATAKSFDEAKAAVDAKDSEAEARFENHDEEPENDDHSEADHSSDSPNDDKVDEN
FT                   K"
FT   CDS_pept        434973..435869
FT                   /transl_table=11
FT                   /gene="hslO"
FT                   /locus_tag="LEGAS_0435"
FT                   /product="33 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91083"
FT                   /protein_id="CBL91083.1"
FT                   /translation="MADQFIKTITKNKYFRAFALNGTNLVRQATAAHETSRLASVVLGR
FT                   GLLATSLTAQSVLKGEERMAIQINGRGPIGNVVVEADAKGSVRGYVTNDKLASIFDENN
FT                   QLDVAQAVGTNGFLQITKFAPYSNPYIGQSQLVSGEIGDDFTYYLAQSEQIPSVVGVSV
FT                   YMNDDDSVKSAGGFLVQALPDATDEAIDQLEVDLKNMKPLSDMLIENYTPLKILEAIFG
FT                   EGEVEILQVAGVGLAAEPTKDAYREMLTTLPAVEIQAMIDEDNGAEIVGKFSGKRYFFT
FT                   PEELTDVILEINANNAD"
FT   CDS_pept        436010..437491
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="LEGAS_0436"
FT                   /product="Lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91084"
FT                   /protein_id="CBL91084.1"
FT                   /translation="MVEEKALNDQMMARRQKLATIVDDLHLDPFGKRFERTAKAQELHD
FT                   LYDDSSLETLEAAQHEVIIAGRMIAKRGAGKVIFADFRDVSGKIQMYAKRDDLGENYPI
FT                   IKRADLGDFLGIKGIVMKTEAGELTILATELTHLTKALRPMPDKFHGIADVETRYRKRY
FT                   LDLIANEESFKKFQLRSKIISAIRGYMDSQDFMEVETPILQTEAGGAAARPFITHHNAL
FT                   NIDMYMRIATELYLKRLVVGGFERVYEMGRIFRNEGMDPKHNPEFTTMETYAAYMDFTD
FT                   VMDETEGIFKAAAAVVSDDLKVTYQGTEIDLGVKFARKHMVDLIKEQTGIDFWQEMTVE
FT                   EAQKLADDKHVKYEKYWHVGHIINAFFEEFVEDTLIQPVFVYGHPVDVSPLAKKNADDS
FT                   RFTDRFELFIMGSEYGNAFTELNDPIDQRARFEAQVAERENGNDEAENIDEDFIEALEY
FT                   GMPPTGGLGIGIDRLVMLLTDSDTIRDVLLFPTMR"
FT   tRNA            437573..437645
FT                   /locus_tag="LEGAS_R0007"
FT                   /product="tRNA-Asn"
FT   tRNA            437752..437824
FT                   /locus_tag="LEGAS_R0008"
FT                   /product="tRNA-Asn"
FT   tRNA            437862..437937
FT                   /locus_tag="LEGAS_R0009"
FT                   /product="tRNA-Thr"
FT   CDS_pept        complement(438215..439381)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0437"
FT                   /product="Multidrug transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91085"
FT                   /protein_id="CBL91085.1"
FT                   /translation="MTKIQQRALILLVGSQLLIMLGIGLIIPVEPYIKADMSLTATDMG
FT                   IMAALFAAVQFIASPIIGRFSDKFARVPLIAAGLLLFAVSEGLFAFGIGHSLLQLNIAR
FT                   ALGGLAAALSMPAITALASNMTTSANRARVIGWLSASFSGGIILGPGIGGVLANIDHTL
FT                   PFFGSAILGLVAFFIFIFLMPDEKKIRIAQSSTQHNNIKLTGQFWSVALIMLLIMILVS
FT                   SFGLSAFENMFSLYFHDVRGFNLTEIAWFLVVNGFLSLIIQVVFFEKMVRYIGELMVIR
FT                   VSFISGFLAIIWILFSQSKWEVFVATLIAFVGFDILRPAITTLLSHVNEEQQGLINGLN
FT                   MSLTSVGNIIGPVLGGVLLDIGSNLPYTFVAVILATASVLTFTIRFKR"
FT   CDS_pept        439443..439643
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91086"
FT                   /protein_id="CBL91086.1"
FT                   /translation="MTTPSLHPLLQDNANTILIASVAITISEQNIIKKSWCQVNDTAAV
FT                   LISIGQKNQSNDFFAARKLVI"
FT   CDS_pept        439678..441000
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0439"
FT                   /product="Amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91087"
FT                   /protein_id="CBL91087.1"
FT                   /translation="MATNQNLNRTMTLIPAISTVVGTVIGAGVFYKASSVADATGSTSM
FT                   SLFVWLVGGLISLAAGLTGAELAAALPQTGGMLVYIERAYGKLASYVLGWAQIIIYFPA
FT                   SLAAKGIIFGTQVANLFHWGYVAIIPSGIAALVSVAAINMLGSKIAGQFQSITLFFKLI
FT                   PLALIIIFGLLQPGGVDVSIFPVTPGHAVGGWASAMGAGLLATMYAYDGWIHVGNIAGE
FT                   MKNPTRDLPRAIAGGLLGIMVIYLLVNYAFLHALPFSAIQGNANTAMDAAQQIFGSFGG
FT                   KLITIGILISIYGTLNGYTMTGMRLPYAMALEKGLPFSAQLVKLNRFQIPYVAGIFQLV
FT                   LAIGLMFVGGFDMLTDMLVFVIWLFYTLVFVAVIKLRHTEPDLKRPYRVPLYPIVPIIA
FT                   ILGGLFIIVMTLMTEWQLALIGVAATLAGLPLYFIMQKRQK"
FT   CDS_pept        441189..442574
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91088"
FT                   /protein_id="CBL91088.1"
FT                   /translation="MSKIKFHIASQTELVLDQAAQLGDVVDLTDEQNIDTSVINGKIAE
FT                   ILEERLAQAKEDWEFQQDKQTKAELANQLQQQKQQLQENINDKATRIVELETQLKSIAK
FT                   QNEVELKSQLVQKGLDLQETITKKESEIVALEAQITSIKQQSQSDLETQLLKKDAATQS
FT                   ELAQRKQELSELTSQLQLKDQEKQLQLANIQSQYEAQLKTANEQVEFYKDFKARQSTKE
FT                   IGESLEQYAMTEFNKIRPYAFPNAYFEKDNTLSETNSKGDFIFRDYQDETEFVSIMFDM
FT                   KNEGDTTASKHKNADFFKELDKDRREKETEYAVLVSMLEADSDLYNTGIVQVNDYEKMY
FT                   VIRPQFFIQFIGVLRNAALNTVAYKQELEQVREQNIDITHFESDLTNFKSAFGKNYQSA
FT                   SKNFKNAIDEIDKSIARMEAVKRSLTTSENQLRLANNKLDDVSVKKLTRGNPTMKAKFE
FT                   VEK"
FT   CDS_pept        442758..443543
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0441"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91089"
FT                   /protein_id="CBL91089.1"
FT                   /translation="MDMEIKNKCMLCHNLSENSELSAEHYPAKSVGNNDIVALDLGKMF
FT                   DFLLDKENIQNFFTDIETGKEFNKRLDMLFDNELSTTQYPRGRVAYTLCRSCNTFLGKY
FT                   DEAYKKFFDSDGNPKVVSGFVKQTKIKIIKAIYAKFLSLPECSGIKFDFIDYLKSTDQD
FT                   SYDGLWQIYFLKRSQSTDILNMRSLDVGVLNYDEGQVFELSDEKFIFHLTNFKPKNNVT
FT                   GINLFSIQNKYVLVGGENIDGSGGYHGEMIIKKMLDLEN"
FT   CDS_pept        443560..444213
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0442"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91090"
FT                   /protein_id="CBL91090.1"
FT                   /translation="MNTRELAIVTWLLIIIICFLLSSRFRPMFWRGIHTLLKIAVEPAF
FT                   VLIFIYQSIIIAGIILFILKYNLTLWIVKDYLIVFFTMVITFLGESKSKNFFSSLIHSL
FT                   GFGAIFQFFISTYTFDYWKEMFIVFVTVVVSTLLVVNEKHNSPVKNLLNGFLLIMMFLI
FT                   MTILIYKIVKDIAQLGNLNYWEGYFVEPVSWLINIPLIIFAIPHNYFWNRVAIE"
FT   CDS_pept        complement(444694..444996)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0443"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91091"
FT                   /protein_id="CBL91091.1"
FT                   /translation="MSTTCPVQDTIAVVKGKFTVEILEAIHNGYNHYGTMKNQIPTINP
FT                   RILATRIKDLEANGIITREHLPTIPPQIAYHFTDKGLKLLQLVPEIKAWYGDYHE"
FT   CDS_pept        445078..445833
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0444"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91092"
FT                   /protein_id="CBL91092.1"
FT                   /translation="MIEKSIIQVKNLSKRYDDNNQILEGIDLDIFESAFTVIMGPSGAG
FT                   KSTLLQNISTMDQPTSGQVIFEDQDLTKLSDKSLSRFRRKEIGFIFQSFNLIEHLSVLE
FT                   NVCLPGFLLKSKTKKQVIQRAKDLLTGLGLGDHVNQAINHLSGGQKQRVAIARSLINQP
FT                   KILFADEPTGALDSTSGIEVLDNLTLNNQNGQTIVMVTHDLKAALRADRILFIKDGQIY
FT                   GDRRFTPYDASQLKARRAEVEAWLLEMGW"
FT   CDS_pept        445835..448048
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0445"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91093"
FT                   /protein_id="CBL91093.1"
FT                   /translation="MQKIIKSLILGQKAFMVTIAILTFLSSLTMITVLTAYQANVSHYQ
FT                   TAYRTHKLPDILVKQDTQQDVAADLKGLKNVKSVSSAPSLMTQVEGKDKQNITLLLSDD
FT                   TSHFNVQAPSNHEIVLASYLESTGNFKRGDAIQIGNKSLTVKGFYEDQLLGSPLFKYKQ
FT                   GIVSQTTFNTLVAQKSSQMTQMAFVNLVKAPKNSEKLLSDYHDRLKADLIYDKGYIQKA
FT                   YTMLPTIVALVIILAAIFLFGICQFVIRFALVSGIAKDRKKIATFKTLGMSGRQVKLAY
FT                   VSAFLLSNIAGLVVAILASFVTSNLAFKFFWHLNGFTSVKHISLNIVVVLAITLLMLGL
FT                   SMIIILFSLKETSSISPASAFQDGQSKSNQGKFNFDLTKNSLPLQIGIAFKDYVQKIGH
FT                   YMTFTLVIGLFLFLSLMIANLNQGFKGHVDSLFGLPKVDVVMRTPDHTTRGEALQQINA
FT                   LTPIKSSGYIQETKILLKKEVIPLHRYSKMPSEMKVLSGHTPKNQHELLLSSNLIKTLK
FT                   LKVGQKVHVKTQLSNNTEMTIVGTYQTINNLGKEAYSLVDIDLPMNSTYVNLKSTSQKD
FT                   KLLAGFHRDNVQLTDTSASSKSLITTIQTAVKLLANMILILTLVISGLFVYLVSYLTIE
FT                   TEKRQLALKKMLGFTNVQLKVQYLFRAGFALALGIGLSLILDKFIGSFLLNGLVNLGGL
FT                   TQFSVQLPLSYEIAIILLLVFESSLIVVSASRRITKIKIGDFL"
FT   CDS_pept        448045..449298
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0446"
FT                   /product="putative substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91094"
FT                   /protein_id="CBL91094.1"
FT                   /translation="MKIVHSIFLKIALSMGLIMYFAYAVPTGKYANLYLIGVSVFTALF
FT                   LPIFTLISTYLEQKGFRLTGSMFLSKLAKLVWQSFYNFLALGLLVKGNIIDPNNLKMVG
FT                   GLIGAVCLTSLASQGLQYLAITLSNHDKGNRFANIFFALSLNVIISALAALGYKNVQVF
FT                   FVIMGLMLGVIGVLISLITDIWGLLPSKGGIGLFLGTFNPVHKSHVAILKDFIDKRQLD
FT                   KVYIHPTVIPKIHQYLLDKKMIKIVDQRAGKRYYEKSAIADPLVNFFPTGQVFYEAENR
FT                   LFMLKVAIKEAGLENKVEILFEPNLYQKDGFYAIIKAIKKRHPHTKLHGLLGTDEGGML
FT                   LHDIYDETWIKPFVKLRRDNISGTAIRKGEKGMTTPKITAALDLFSNLKEGQSDQLFGQ
FT                   TVQLVNNRLEVADDKICL"
FT   CDS_pept        449436..449858
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0447"
FT                   /product="HTH-type transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91095"
FT                   /protein_id="CBL91095.1"
FT                   /translation="MLIGEKIKIIREDRKISQEQMAKSLNVSGQAVSNWERGKGHPDIS
FT                   NIIRLSEIYDISLDELIREDKNYKEVLLEKKIGKTVDNIFNVGLLLTTIIVLLYGYITH
FT                   GFDSHQRFYIIFALVMIIHIGIYVYKQVFGKNIDTD"
FT   CDS_pept        450368..453046
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0448"
FT                   /product="DNA2/NAM7 helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91096"
FT                   /protein_id="CBL91096.1"
FT                   /translation="MASDEQRVRIIKALKLIDQIGESLLPDKIGIDSNKISQLDFDSIK
FT                   TVNSSFFETLFPNKIDKILTSNQTKHRHEKTEDLIFPVFFGIYKGQELRDLIKSDDSAD
FT                   VVEPDLSKNFSAMLAFNEKFEVVQGTTFVPANTVLLNNINDVSEKIKDFEQKLETVYQD
FT                   FIDDNLSFTEKLKEINKFIRSHFAAASEEIDYAMPIHKDNLTNLHSFFANDIQLILAAG
FT                   SERYGNVKRYIDGFDAQKRINLEGEDKSIFNDILNPVNFPDGRWPSKPAYTLSFMQQVA
FT                   VNLAINDKNNIRSVNGPPGTGKTTLLKDVFADMMVKQSEQLAHFTDPKEAIIKGEHFAW
FT                   DEENPQFHIDYHLAPELMGYGVVVASSNNSAVENISKELPEEPDLSTDEYMIDYFKEAY
FT                   SNQYDKPVPEKTWGFFSAAGGNSTNRDNLMTGLEGIIDSATEAEDGGDWQTTRMEFLAT
FT                   LNEVRDIKQRTAQYFLDIQAYENSKETTTTNSVKSELDSLENKLSIAQEDVIASESEST
FT                   ENGNKISTLNSQIQNEKAGKPSGFLIFKKQRIEAKKIELYIRTLNRDIRDLLVKQDVAN
FT                   QKKIHGNILVKQIEQQMQLLKEKNQHNRAKELKLKTAYNTAMSYFKSLKNVKALNREFW
FT                   DKETNEQIQLSILWFDDEFRALQTRAFVEAMKVRKLTIIQIVQDKKNNPFTHVLNQTWP
FT                   KKHLIKAKHPEVINHSWALIQFLVPVISSTFASFGSFFGDMAEESIDNLFIDEAGQALP
FT                   VQALGAFWRAKRVMVVGDPSQIAPVQVTEESMLDQIKNYYGIKTAIFTKPESSVQTIVD
FT                   RASQFGANLENGWVGVPLWVHRRCLDPMFSIANCIAYNNKMVQGSSRDIGAAYWFDANG
FT                   VATDQQFVPNHRDWLEAAIQQ"
FT   CDS_pept        453050..453802
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0449"
FT                   /product="DNA2/NAM7 helicase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91097"
FT                   /protein_id="CBL91097.1"
FT                   /translation="MISKENNLENSQAINEANLITLSDIYVISPFRIVAKEMKRIKQPT
FT                   GIEEEEFKRWKENNVGTVHKFQGKEAKAVFFILGADENSAGSVTWATREPNLLNVAVTR
FT                   AKKEFYLIGDKKAFAKFKNLDVVAECMSFNASPEWQIVQSGMVHTELVKPEPTVIDVSA
FT                   RREHNNSMNLESNVKQIVIGSVNYWVKSNYHRIYVKILSVPHTNKFFYDLDELAWSIDP
FT                   DSEFTDYQIETAVLAFKHVNKMGDLDER"
FT   CDS_pept        454177..455628
FT                   /transl_table=11
FT                   /gene="pbuG2"
FT                   /locus_tag="LEGAS_0450"
FT                   /product="Hypoxanthine/guanine permease (putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91098"
FT                   /protein_id="CBL91098.1"
FT                   /translation="MEKLFQLKENKTTVRREIVAGITTFVSMAYIFFLNPQILGQTGIP
FT                   TQAVFLAAILVAVFGTLFMGLFANVPFALAPGIGMQAYFTYTIVFGFGFTWQQALAIVF
FT                   LVGLVDIVITLTHGRRAIVQGIPSELKAAIGGGIGLFVTYIGLKNAGFINFIVDPGNII
FT                   TLNGKPFTGEVHGALNSILANGSVTPELTKFNSSSTILALIGFIILIVLVMRRVPGAFL
FT                   ISLIVTTLIGIPMGVTNTHIGAGTSVGHAFGELGHVFGQSLGAQGLGSLFNNWHNTSLA
FT                   LVTIFAMGLSGLFDAIGTLIGIGNQTGIFSKQDQKAFDSSNGFNSKMDRALIVDTFTTA
FT                   LAGIVGTSNTTTFIESASGVAAGARTGLANIVTAIGFALMILFAPFVGVVPTAATSPLL
FT                   ILVGIMMMGEFKKISWKSLEVAIPAFFTSVFMAFSYSISYGIAAGFIFFIIVKLALGKF
FT                   KEVSPVLLIVSVFFLINFVVLAFIH"
FT   CDS_pept        455728..455856
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0451"
FT                   /product="N-terminal part of an ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91099"
FT                   /protein_id="CBL91099.1"
FT                   /translation="MLEIKNLSVTYGSKVALTVPNLTINKGEIIGVMGNQDLGNQR"
FT   CDS_pept        455928..456527
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0452"
FT                   /product="C-terminal part of an ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91100"
FT                   /protein_id="CBL91100.1"
FT                   /translation="MQEQHYVDTMTNQKIIEGLLNTRIKRDEKLAELINFFDFGSQLSL
FT                   HFKNLSGGQKQRMSLIMVLYQEPELLFLDEMTTGLDFESRQALINHLKVYFKQHQTTVI
FT                   MVTHYAQEIEQLADKLLIIHDGQVKAFDKPKNLFNQYIGYSAFIVGNNAEKSISIHRPE
FT                   EEYSVARQLIDSGDDFRRTQGDIELVYTAITKGQRA"
FT   CDS_pept        456524..457252
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0453"
FT                   /product="membrane protein transporter."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91101"
FT                   /protein_id="CBL91101.1"
FT                   /translation="MIKKRKLIFECQNLLGNMITLFFGFMFAPMMAFVFGSSYSNVPQA
FT                   LNQVYLTFFCTIPLSMVLVGFSSLFSQEVEQGFTLRAELFGYSRISQAIHKFIALTGFV
FT                   LLSSIIYSWIFLSHFNLSIPSQSIMIQMGIFQVLNAAIYFMVVFLLTTFLKKFSRVYGI
FT                   SMISYFVIMIVSGIMGNMNVGKLGHYLPIKLFITDYTNRLNDTDYISGKIGLYLFILLG
FT                   ILSVIMKVVVGNNNGNKHQY"
FT   CDS_pept        457230..457697
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0454"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91102"
FT                   /protein_id="CBL91102.1"
FT                   /translation="MEININIDDKLEDVQVLISGSDIEQLADIARYLKSKNTSSRQLAI
FT                   KTADNIRVVDKADIIVVESFGNDLTFTLKNNQKLTTRKTLEKFLEENSKYDFVQISKSE
FT                   VMNLSYLSKMESAFSGNYYAFLTNQTRVTVSRRFIKGILSRLEGSAEDEIL"
FT   CDS_pept        457684..458079
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91103"
FT                   /protein_id="CBL91103.1"
FT                   /translation="MKYFKKSITYLLVGIGVGSFISLLSFTLNQGTPTMKQFYLLMTMS
FT                   AIMGLLSLIFEYDKITFMAQLISHFILEMLTYGLFIWLTFGSHVITITNIPTFLITYII
FT                   IFIYFRKQGHDNARRINQALTQRDHKK"
FT   CDS_pept        458239..459234
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0456"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91104"
FT                   /protein_id="CBL91104.1"
FT                   /translation="MRKQKVIIDADPGIDDSLAMLVALRSQPLDVIGISIVEGNVPTAI
FT                   GVQNALKVLREANRLDIPVFSGAESPLKHDYVSAQDTHGDDGLGESNMTLVTDVKPSQR
FT                   DAQAGYAKLLSENEDVWFLALGPLTNVALALKQQPDIWQQVSRLIVMGGADQTNGNTSP
FT                   VAEYNFWVDPDAADYVFQNSPLNIELVPLDVTRKLEFTPNMLQMMQYLDAEKSAFVAQI
FT                   IQFYFDFHWQQEHVLGAVINDPLVIIYALHPELVQSIDKYVTVVTEGVALGQSIVDREN
FT                   FWQKKPNATILQAVDAKAVMSHIISGLLIRDAADIEKELDNIATNLERLS"
FT   CDS_pept        459231..459782
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0457"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91105"
FT                   /protein_id="CBL91105.1"
FT                   /translation="MTKHVSAQKIALIALFIVINIVGGHLALYARLPIYLDTIGTLLGS
FT                   AFFGPIGGLFTGILTALINGTTGDLFSIYFMPSQIATALVSGFVYKKIKPTDFKNIWWV
FT                   ALVISIPATIISTIITVILFHGITSSGSSMIVQVLHGFGLSQSISVFLVQVGTDYLDRM
FT                   IGVYVVAIVYRTLLSRIKLV"
FT   CDS_pept        460263..462344
FT                   /transl_table=11
FT                   /gene="topA2"
FT                   /locus_tag="LEGAS_0458"
FT                   /product="DNA topoisomerase I-like"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91106"
FT                   /protein_id="CBL91106.1"
FT                   /translation="MTNYLILTEKPSAAANFTKALGGKTGVFNDFTYKIANLRGHVMTL
FT                   KDPEAMVAEELKKQYKSWLVKHLPWNLSDFSWARTYIRQRNMRTGKVESTKKLIDDLKK
FT                   ESKSGYDAIVIATDTDPSGEGELLAWEALDAIGWRGQVLRANFMDESVSGIQKAMHQLR
FT                   DVSDKMADGEYVKGESRNRWDFASMQLTRIATTAAKKAGFKVVAREGRLKSVIIWRVYQ
FT                   QLDAIKNYVKTPYFEVKFKDPAEHVFGRVTPQGDVIPWRFATKEEAEIDFSQYHKTDVI
FT                   NEKHQTRTQAPGKLLDLAGLASILAPRGFSSKEVLSTYQKMYEAQIVSYPRTEDKTVTP
FT                   EQFNELLPLIDQIADVVGVDKMLLTHRSPRTTHVKSQGAHGANRPGENLPKTTQSLVKF
FT                   GASGPAIYEVLAKNYLAMLAEDYVYDHVTANLKDYPEFKTAFNRPLKMNFKLVYDSQKA
FT                   IKVEEEEEENSTASQLGPQARPYLHEGANPKPQTPTTKWIMAFLEKHNVGTGATRVSTL
FT                   SEMSRGIKAMLTETRGKLGLTETGQVSAIMVKDTWIASPKITKRLFEMMDQVGQFDMTM
FT                   DQVLDSVTKVVEHDMPIMLDNAEQLETLLGKPKQVPKKKVTEKMTGLFKGEEITFAREW
FT                   SGHIFTDDELTKMLNGAEISFQSKSKRGKIYTATGKLAKQTFKGSTFYGFKLNPKAKK"
FT   CDS_pept        463152..463706
FT                   /transl_table=11
FT                   /gene="mdaB"
FT                   /locus_tag="LEGAS_0459"
FT                   /product="Modulator of drug activity B"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91107"
FT                   /protein_id="CBL91107.1"
FT                   /translation="MNILIINGFEKHVDANGQLNNRLFTEYVRQFKDKHDTKITVIEDY
FT                   KRIEEINKWLWADLIIIQFPIYWFNVPGALKSYFDDVFAYGIFYGLDYTKYGQGGRLFG
FT                   KKFMLSTTWNAPTAAFNDNNQFFNGMSVSDILQPTIKALEFIGLTSWSQDGVISCHDVI
FT                   HNPEIELYLSEQKQFIEEVNV"
FT   CDS_pept        463703..464428
FT                   /transl_table=11
FT                   /gene="tpiA2"
FT                   /locus_tag="LEGAS_0460"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91108"
FT                   /protein_id="CBL91108.1"
FT                   /translation="MICIVNFKNMMHYEKQLKWLQDIEREFLDFKLLVAPTLPEHNRYH
FT                   NYEIVAQNISLVQRTVGEVSASVLNGLKIQYAFVGHLERRRLLNETTDMINERLINCLH
FT                   NHIVPIICLGIHSGPDLVIRELKSILKNSDLSDQRVIIAYESLKSTQSNQPVYSYVEME
FT                   AVYLKLKQYMDELTNSSGLSAYHLVMGGHINEEGINVAEKIGYDGVLIGDRYQEVTSFQ
FT                   PLIKTLNRIKRERLLTHGS"
FT   CDS_pept        464418..465671
FT                   /transl_table=11
FT                   /gene="cinA"
FT                   /locus_tag="LEGAS_0461"
FT                   /product="CinA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91109"
FT                   /protein_id="CBL91109.1"
FT                   /translation="MEAEIISVGTGLLLGQITDTNRPYIARALHDMGIDSHHQSIVGDN
FT                   EKSIHAALNLAVSRAKLIIMIGGLGPTTDDLTKQVVSQFINQPLIPDSYTLSKLKKWHD
FT                   DVGIEMADNNYRQALFLKDAVPLKNDFGFAVGSFYQNTIGPDFLLLPGPPWEMEPMFDQ
FT                   YVLPLFTKTYCNGQALSSLVMRYFGIGESRLSQLINGLIVNQTNPTIKTYAQKHEVVIR
FT                   LKATSSSENKANNLNKKMATQINQLVGDYFYGVGEHSTLEKVVAQLLQEEEKTIAMTEV
FT                   FTRGLVQSTLQNVVSNTELVTGGFNGMSALLDLTDDEIELSGDNGAELVKRLAELTQKR
FT                   LGANIGLAILAEKPESIGHQEYVNEKVWFGLFDNQQQLMVTSQIFAKDHQDNIEEAIFV
FT                   ALDLVRRHLIHQDLVERA"
FT   CDS_pept        465692..466426
FT                   /transl_table=11
FT                   /gene="fabG2"
FT                   /locus_tag="LEGAS_0462"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91110"
FT                   /protein_id="CBL91110.1"
FT                   /translation="MVEQIQGKTVLITGSSRGIGLAIAKHFDQLGAQVVLHSRHGIDEK
FT                   IKSQFNLPPLEVKFELTHQQAINRAITDLYQTNEFKGVDILINNAGITADQLAVNMSSE
FT                   NFTQVIHANLIGTFNVTQPVLKHMLKSKSGCIINMSSIVGLHGNIGQVNYAASKAGLIG
FT                   MTKTLAKEAARRQVRVNAIAPGMFKSDMTDVLSDKIKERILETIPMKRFGNVTELAEVA
FT                   EFLAESSYMTGQTIVIDGGQSI"
FT   CDS_pept        466444..467520
FT                   /transl_table=11
FT                   /gene="gldA"
FT                   /locus_tag="LEGAS_0463"
FT                   /product="glycerol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91111"
FT                   /protein_id="CBL91111.1"
FT                   /translation="MKSFSSPSLYIQGQDILLNHCDQMKRLGKRAVILSNGVAIDIAAN
FT                   PLSDKLNEQHLFSEVLTISDDFDDYALSCLCQKIRHSNAGIVIAVGGGKVIDTAKIIAA
FT                   QVECRLVVIPTLASTDAPTSRLSAKYNRQGNFERYIFFDDSPALVMVDTSIIVNAPTRT
FT                   LIAGIADALATFIEYRAVQCGNGHNMFGDRQTITAGVLAEQASKTIFQNAELAIEANNA
FT                   HVVDNYFEAVVEANILMSGLGFESGGEAAAHSIANGLTTFISPAIMHGEKVAFGLLGQL
FT                   ILSKSSDITYKKYLDFQRLLGLPVCLKDLGIMNDQNILRQIAREILRPHETIHQMNLSF
FT                   TEEDIVNMLLQIDSYAKK"
FT   CDS_pept        467666..467935
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0464"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91112"
FT                   /protein_id="CBL91112.1"
FT                   /translation="MTLFKKQHDLLSYLETIHLDDSVEQAMVERAISQLKKKTYEHKVI
FT                   VALAAEFRKLALEQQISKAGLALYMKLQEPNIGDDVGLTVGLWF"
FT   CDS_pept        complement(468141..468809)
FT                   /transl_table=11
FT                   /gene="tenA"
FT                   /locus_tag="LEGAS_0465"
FT                   /product="Thiaminase-2"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91113"
FT                   /protein_id="CBL91113.1"
FT                   /translation="MTFSQDILTRAQPIMDTIMVHPFVKGIATGNVPDDILNYYVEQDE
FT                   HYLKDYLQVTALTVTKTNDTNDIARLLETAQFISNESKAHEIMLNITGHHVENWRRSPD
FT                   TQRYTDHMYTSAYHGTYADALAVLLPCAWSYGVIGRELVAQGANNDANPLKEWIEIYSP
FT                   QANDEIDYNAWRFDALERAVANLNDSQKEHVIQTFLKSLEMEWRFWEAAWNQTQWRFDF
FT                   "
FT   CDS_pept        complement(468821..469483)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0466"
FT                   /product="Thiamin ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91114"
FT                   /protein_id="CBL91114.1"
FT                   /translation="MNPLIKFTTVMVIALELTFIKSVTLNVIVIGVSGFLYLFLKLHWR
FT                   QWLWLFILPLLPGLGSWFSLMYFGTGDHEHMAWIMLSRVFAYLWLGGLFTLKLNDERDV
FT                   FLATLEQKAKLSATFVYALVGVLNFMPAVSQEMKTIRVASQMRGQTLHIWQPQLYFKAI
FT                   LAAIRWSQNLAEGMVSHGFTEGAARTHLQVVTIKRRDWFLLIIILIAFQLLLLPNWY"
FT   CDS_pept        complement(469480..470889)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0467"
FT                   /product="Thiamin ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91115"
FT                   /protein_id="CBL91115.1"
FT                   /translation="MTDLVVDNVNFAYRETPVLTDISLKLRPNSFNLLIGPSGSGKSTL
FT                   LKLLSGLYPTFSDGTLTGELTLDGYDIHDIVPYQRVTHIGYLFQNPTRQFVMRTPFEEL
FT                   RFSLENLQVKPEDIEKRITNAMESVGMTAFMHHDLMNLSGGEKQKVALATVLAADSDYL
FT                   LLDEPFANVDPVARLQLIDVIKAYQNEGKTILITDHDWSGYTDAIDDIFVMTAGKLHNA
FT                   SSDEQQQILAKLPNQPAIHTSLPNEKEGIITLESVTLKNGKRTLLSTTNRLFPRGKRIL
FT                   ITGPNGVGKSTLLSALVKLYPYGGTITYQQEDIAKRKIAKHVQDIALVFQNAEQQFVAM
FT                   TVQEELTQAQALSHSPELWSDDTIITVLTQLNLHDLRDHIVYQLSGGQQKKLQVLLMLI
FT                   IGTPTLLFDEPLAGLDSASQQHLLDVIADFTRRQHQTVIMISHQLHAVTDWFDYHLKFD
FT                   NQQLNYIGDAS"
FT   CDS_pept        complement(470882..471463)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0468"
FT                   /product="Thiamin ABC transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91116"
FT                   /protein_id="CBL91116.1"
FT                   /translation="MQTISKSKSTRWALRDVLLLAFVAVFIGFIFWVLGPIYNLLSAAL
FT                   TPLGLAPFANELLIGGWMMAAPLASILIRQAGAGVLGELFAAAVEMLLGGQWGVATLLS
FT                   GLVQGIGSEAGFAVLGYKNWGWRGIFASAITGTIVTFIWSTFRDGYSSYHIGLLIALFI
FT                   TRFISLLFFGGVLVVAIQKLIEKAGVLHRD"
FT   CDS_pept        471812..472345
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0469"
FT                   /product="Reductase (Putative)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91117"
FT                   /protein_id="CBL91117.1"
FT                   /translation="MRQVVFYGAISLDGFLSDENDDLQWLFDTNLNGQSTYETFEKQIS
FT                   TFVMGRKTFEVAQKLMSEATFYAGKEKVVFSRGKHLSQTDTTYVSGNVVDIIKDYQKQA
FT                   GNDIWVVGGGSILKPLLEANMVDEFWIQIVPVLLGQGKRLFEPGRYRYRLQVIETTQLG
FT                   EMTEIHLKSASAIK"
FT   CDS_pept        complement(472501..473025)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0470"
FT                   /product="acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91118"
FT                   /protein_id="CBL91118.1"
FT                   /translation="MTVNLKPFSKSDIKYVYDVEYGILADRTWMAFNGPYFRDPIPTWH
FT                   EFQQKMPELIDNAYHRLIWYNDRIVGEVSAHWIDGKLQHWLEVGIIIYQKSDWGKGIAS
FT                   IALKIWLAELFSQHEKLPHIGLTTWSGNIGMIRVSEKVGFVHEGTIRSVRYWQGAYYDS
FT                   VKYGVLRAEFA"
FT   tRNA            complement(473324..473394)
FT                   /locus_tag="LEGAS_R0010"
FT                   /product="tRNA-Gln"
FT   CDS_pept        473505..474023
FT                   /transl_table=11
FT                   /gene="pgp"
FT                   /locus_tag="LEGAS_0471"
FT                   /product="Phosphatidylglycerophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91119"
FT                   /protein_id="CBL91119.1"
FT                   /translation="MQYATYENTVEKLNRHHITLREIAIIGYDSEKSYVPGLTIEQVEE
FT                   AVISVLHKRVVQHQIWVALELDRLAEAHLLESPLQDLVENDDTLFGVDETLGTAIAMSF
FT                   DTIGVTNYGYIDKIKVGLVGELDRKGKTTAAVTTFADDIVGALAAAAASKVAHKYAAGT
FT                   NRTVSNLDD"
FT   CDS_pept        474145..475311
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="LEGAS_0472"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91120"
FT                   /protein_id="CBL91120.1"
FT                   /translation="MLANIYIMAKLLKNIDLYTGSKHIKDAFIRFTDVIDDVGYMIDFT
FT                   PRDDDELITEATGKLIVPGFIDVHKHGGYGLDTMDGDAEKLNDMVNKMVTEGITSLFPT
FT                   TITQSPENIERALVTINEVAKTNPVIQGIHLEGPFINKVFMGAQPEEYIIDPDTELLKK
FT                   WYALSGERIRLVTYAPENGGIPDFEEFMLKHHIIPSIGHSNATREQLIHSRASHITHLY
FT                   NAQRPLHHREPGVTGHGMLETSITGELIADGFHIVPDMLEIAFRLKGAHQLELVTDSMR
FT                   AEGLGDGVSELGGQKVVVKDKQARLENGHLAGSVLAYDDAFRNIQRFTSADIHDAVQMT
FT                   SVNQAREFGLTQKGDLSAGKDADFNIFNKEDMQLQATYSLGRRFARKN"
FT   CDS_pept        475311..476018
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0473"
FT                   /product="Transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91121"
FT                   /protein_id="CBL91121.1"
FT                   /translation="MTKPAIPRYIQIHNQIKSRIEAGEWQSQKRLPAERELSETFNVSR
FT                   MTLRQAIQTLVDEGLLERKVGSGTYVAEKKVSERALGMTSFTELMANTGRISKTQTVSY
FT                   KITSPSASEIMHLQLADDDDILVMERLRMGDNEPILLERTTLPAKLISHFSRHDLTESL
FT                   YATLEKAGIQPGRAEQTISATLANERLSELLKIRRGDAILNVRQVSFDQNEQPFEYVRS
FT                   YYVGERFEFTLTR"
FT   CDS_pept        complement(476166..476861)
FT                   /transl_table=11
FT                   /gene="metI"
FT                   /locus_tag="LEGAS_0474"
FT                   /product="ABC-type methionine transporter, permease
FT                   component, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91122"
FT                   /protein_id="CBL91122.1"
FT                   /translation="MTKWFSNTFPNVVYQGWTGDTGWWTSIVQTFYMTFWSAIFGGILG
FT                   LIFGIGLIITAPNGIAPNKLLFWFFDKIVSVFRAVPFIILLAFIAPFTKLIVGTQIGTT
FT                   AALVPLALGVFPFYARQIQVALAEVDSGIVEAAQSVGASFWDIVFGVYLREGRSEIARV
FT                   STVTLISLIGLTAMAGAIGAGGLGNMAIAYGYNRFATDTTLVATLLVLIFVLVVQLIGD
FT                   YLAKKFSHK"
FT   CDS_pept        complement(476864..477943)
FT                   /transl_table=11
FT                   /gene="metN"
FT                   /locus_tag="LEGAS_0475"
FT                   /product="Methionine import ATP-binding protein metN"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91123"
FT                   /protein_id="CBL91123.1"
FT                   /translation="MSNPIISLNHIDVTFYQKKRTITAVKDVSITINRGDVYGIVGYSG
FT                   AGKSTLVRVINLLQEPTSGSVIINGETFFQADNDKNKKVRIKANDLRNRRRKIGMIFQH
FT                   FNLLNERTVTENVAFALQHSKLTQDQKKLKVTELLKLVDLTDRAEQYPSQLSGGQKQRV
FT                   AIARALANDPEILISDEATSALDPKTTNQILSLLKKLNEKLGLTIVLITHEMQAVKEIA
FT                   NKVAVMQNGEIIERGSLLDIFAQPTQQLTKEFIETATNIDKAIATISAQPLVKNLNDNE
FT                   LFIRLSYVGATTDEPLIAGLFRDFQVTANILYGNVEILQNTPVGSLLVILSGTDEQIKA
FT                   ATSTLADHHVEIEILKGGK"
FT   CDS_pept        complement(477984..479315)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0476"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase related
FT                   deacylase."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91124"
FT                   /protein_id="CBL91124.1"
FT                   /translation="MNIRQQYMTLLEQLVAIPSVSAMETHLPEIATIIANEFRKLGAQV
FT                   IYDDTYFAPFILAKFLSRNPNAKTLVIYNHYDVQPAEPLNLWQSDPWRLTAHDGKLYGR
FT                   GVDDDKGNLTARLAAIAEYLIENNQELPINITFIVEGSEETASRYLTAYLAKYQDQLQA
FT                   DLVIWESGGKNAEDIIEIFGGNKGIVTFDLSVTTAANDLHSSLAAIVDSAPMRLSRAIA
FT                   TLFDSLGNIAVPHFYDDVVEPNDREKALVQALPLTRESLIAQHGLTVPLYSDRNGDNLK
FT                   ETLYFKPTINIEGITSGYNGNGVKTVLPATATAKLESRLVPNMSPDLTLQRISDHLQAA
FT                   GLSDIVITKTLGQPGYRSDMSDPEILRVIDVVANYYHVSPVVLPTSPGTGPMAIIHQSL
FT                   QAPIASFGVGYAGTKDHAPNENIRLSDYNQHIDVIKALIKRYEL"
FT   CDS_pept        complement(479387..480229)
FT                   /transl_table=11
FT                   /gene="metQ2"
FT                   /locus_tag="LEGAS_0477"
FT                   /product="Probable D-methionine-binding lipoprotein MetQ"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91125"
FT                   /protein_id="CBL91125.1"
FT                   /translation="MSKKTNWIIGGIVIVIAAGAYLTFGHHSNKSSAKTVTIGVMAGDK
FT                   NEDEIWKSVSKTAKDKYGITLKTKKFTDYLQPNKALSAGDIDLNAFQNYPYLANWNEQY
FT                   KTNIVAIGDTWTTPLRIYSDKYKKVSNIKSGDKITIANDPTNENRGLHLLAEAGLIKIK
FT                   DTTKATPKDITENPKNLKITPVDGSQTASSLTDPTIGASVINTNFAKSAKLDVNSAIYI
FT                   EKLNKDSQQYFNFIAANKKDKNNPVYQDVVKSLQTDKTKSLVKKFYGTAQLTVWDYKK"
FT   CDS_pept        complement(480272..481123)
FT                   /transl_table=11
FT                   /gene="metQ1"
FT                   /locus_tag="LEGAS_0478"
FT                   /product="Probable D-methionine-binding lipoprotein MetQ"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91126"
FT                   /protein_id="CBL91126.1"
FT                   /translation="MSKLTNWVIGGVAVIAIGGIAYATFGHKSAEKSNNKIVTVGIMSG
FT                   SKQDTDIWKSVSKTAKDKYGITLKFKQFSDYNQPNKALAAGDIDINAFQHYAFLAASNK
FT                   ATGDKIVAIGDTVISPIRLYSNTYKKVSEYKTGDTIVVPNDTSNESRSLYVLKAAGLID
FT                   LKSGLTTATVKDITKNPKSLKIKELAADQTARSLTDVQGAVVNGTYADTAGLDYKKAIF
FT                   VEPINKNSHQWVNIIAAKNSDKNKQVLKDVVKSYHTQATKDAINKAYDGVELAAWDTDF
FT                   SK"
FT   CDS_pept        complement(481546..482214)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0479"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91127"
FT                   /protein_id="CBL91127.1"
FT                   /translation="MSEISTHPIQERLPIALLLATNSGFVDAYTFQYHGERFASLQTGN
FT                   IIQAGISLARGQFNYASSFLLPILFFLLGAAFNNIIKHQFKARKLSTQQHSLIIEIIGI
FT                   SLVVFIRTQISSTVFITLLSFFLAIQLDAFPKVQGLPFTSVMSTGNLRNVGANLITYFY
FT                   TKNRTALQNASLFSLIILAFLFGAFISALLSTYLKHFTLLGSSVILMTIFGLLFDYSKK
FT                   "
FT   CDS_pept        482422..484266
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0480"
FT                   /product="Hypothetical membrane spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91128"
FT                   /protein_id="CBL91128.1"
FT                   /translation="MRTFIKFIIAAILTSLIGLEIVQADYRVTNYQQEVHITKNGTADI
FT                   DKTVTYKFDDDMNGIYLKESLTKPIDGNKPYQWGGLQTITVARNGEKARPIAPRVGDEN
FT                   IGYVTSETPSSVQEKVYYPIKANDDITVRYTYRLKDLIINWDDVSELNWRIISNWDQAL
FT                   ENVKITVFLPKQPAKIFKGWVHSSSIGHLTINKKRAELRVTTARVKANHTLELHTYFDK
FT                   SQTPLNTNIQPGHRAKIISQSEAERTIKHNKTLRMIAICGFIVLPIAFIALFALIVWYK
FT                   FRIRSQLRHAQQKSGINIETVHIYDIPNDLGPALINARIKQQADVSKVIVATLMDLIAR
FT                   KKVMITYQNVSDVDHAVYRVVDDSGLRQFESLLIDMIFGKKRVDVYQYEFQKPESRVSK
FT                   RIHNGIASFQREISAAEAKDSIIDSVTTNKVSSTKILMMSLLVIVGGSAIIGLLFMANY
FT                   SNIWQLWLVAGGMFIMSLVGLLILKQQSTTFFTVPEGVTEKWQWTGFAAMLHDIANLDN
FT                   KTVLDVQLWDKLLAYAVIFGEANQVAKTLKLWSEDANISVINLPVYMIYSSFGANWSVN
FT                   LANNIQTNAGFESNVSGNGGSFSGGYSGGGGGGGGGAF"
FT   CDS_pept        484564..487227
FT                   /transl_table=11
FT                   /gene="pacL1"
FT                   /locus_tag="LEGAS_0481"
FT                   /product="Cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91129"
FT                   /protein_id="CBL91129.1"
FT                   /translation="MAEQPLYNQDVTKVLSDLRTDEKNGLTQVEANQRFLADGPNQLKE
FT                   AVSTTLFQKFINQFKDFMIAILLVAAVVAAFTGELVDAIFILAIVIINAVFGVFQEAKA
FT                   EDAINALKEMSTPNANVIRDGKDMSVKSTELVTGDVVRLEAGDIVPADIRIIESASLQI
FT                   EEASLTGESVPVDKVATTLTATDLPLGDRANLGFMNTNVTYGRGIGVVVGVGMATEMGH
FT                   IAGMLESSDDTKTPLQENLIKLGRILTYLILFIAAITFVVGLARGRETIIDMLLTSISL
FT                   AVAAIPEGLPAIVTITLALGTTRMAARNALIRKLPAVETLGSTDIIGSDKTGTLTQNKM
FT                   TVEKIVVNAEISDAATTEPLSGTFGRLADILALNNDTKRTENGYIGDPTETALIAFNEN
FT                   HQRDIDTLFREMPRLAEIPFDSERKLMSTVHPAPNGYIITVKGAPDELLKRATKIEMAG
FT                   NIVALSDDIRAKLLSINSELATQALRVLGFAYKLTDAVPEEMRSELVENELVFTGFTGL
FT                   IDPERPEVAQAVAEAKKAGIRSMMITGDHRDTAAAIAIRLGILDEKDKETAVISGSDLD
FT                   NMTENEFAANVHKYSVYARVAPEHKVKIVSAWQKKGKVVAMTGDGVNDAPALKTADIGI
FT                   AMGITGTEVSKGASDMVLADDNFATIVHAVEEGRKVFANIQKALQYLLASNLAEVISIF
FT                   VMTLLGWHILAPIMILWINLVTDTLPAIALGVEPAQKDVMTQKPRGRSASFLSGGVGAA
FT                   IVWQGILQAVIVLSVYGFALAYPVHLADAEAHRDALTMSFMTLGLMQMFNAINVKSVYG
FT                   SMLGKQAFQNKLFNWALLGSLIVMAAVVIIPALNPVFHVSHLDSYQWAIVLFAGISIII
FT                   IVEIVKLIQRKIFKKG"
FT   CDS_pept        487236..487679
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0482"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91130"
FT                   /protein_id="CBL91130.1"
FT                   /translation="MAKFNPKQAQIYIQTLQNVLTNTEETATRVTPFFTKLDDAKQADK
FT                   IAEIPTAEFAEIKAEFEDTVESYKNNATQLTSASAPIRLLGVHKSLTSAYVKYAEATQL
FT                   MADAVIVADQKIDVQKYEKSEQDQSVYLEKIHTAVAKIMNSSM"
FT   CDS_pept        complement(487777..488184)
FT                   /transl_table=11
FT                   /gene="fur2"
FT                   /locus_tag="LEGAS_0483"
FT                   /product="Ferric uptake regulation protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91131"
FT                   /protein_id="CBL91131.1"
FT                   /translation="MVDKTLRDILQAHGLKATFQRLSILEYLMTHETHPTAEMIHVDLS
FT                   NISLATIYNTLDKLVDVGIIIVIDTLKDDKRHYDYYGEPHYHIINSNTNEIIDADNFDV
FT                   APLFEAARQVSGLNITGFHIEIYGVDPDQAK"
FT   CDS_pept        488305..488979
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0484"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91132"
FT                   /protein_id="CBL91132.1"
FT                   /translation="MDKQSLMQRNNLIRAAVMGANDGILSVSGIVLGVAGATSHTGTIL
FT                   LAGFAGMLAGTVSMAMGEYVSVSSQHDAQEKVRRVQTEALATNYDDEFSYVEDKYVSDG
FT                   ISPHLAQQATEEMMTKDALTTTVRERYGFSLDHELSAGGAALASLISFPIGSILPMVAI
FT                   SLMPRDMREVATFIAVIVALAITGYAAASLNGANKKRVALRNVVAGIFTMIVTYAIGSL
FT                   FR"
FT   CDS_pept        489027..489731
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0485"
FT                   /product="integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91133"
FT                   /protein_id="CBL91133.1"
FT                   /translation="MDIKLKKEHVKKEQATMDERLNAIRAGVLGSNDGILTVVGVLFSV
FT                   AAATTNNFAIFIAGLADLMACALSMASGEYASVSSQSDSEKVVVEQERELLKTDFAGQH
FT                   QSVENFYVDRGVTRATAKSIADELLSKKPLETMLSTKYDITLGHYMNPWSAAWASLFSA
FT                   AIGGVFPLAALILSPTRYQFIATIAATVVAVGLTGLLSAKMSNGLVKRAMIRNVIIGLL
FT                   TIAIHYGIGKLF"
FT   CDS_pept        489779..490633
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0486"
FT                   /product="Ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91134"
FT                   /protein_id="CBL91134.1"
FT                   /translation="MLNQLKELWQKIDKKLKLSTLGTLFLRAQVGYVGPTFAYFALLTV
FT                   FPMLIAIAIIISITNVSETNIISLIQSVLPRDIEKIVLPILQSVLSSKSTSLLSFSVLL
FT                   TLWTVSRVIAVFRVSFNRIADVEDRISNLLSRFWSFVWLLIIIAAFGVLMISSNILTIV
FT                   LQQIPINQWTSFLQHQTKWLIWLGMWLALIMMNYLLPTKEGRAPLRFVAIGSLIEVGAL
FT                   NILNIGFTWYANLAVKQYGFYQSMSAIIVLLIWLNLIATILVTGYVLIQWLTVLKQEKV
FT                   INI"
FT   CDS_pept        490654..491253
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0487"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91135"
FT                   /protein_id="CBL91135.1"
FT                   /translation="MFKDSDFEIFNVASLTDRMKLIRTIIDPKFEQSAEAILPILNTNG
FT                   QQWYAHVAKHLRRTTNAPDNTWVAFAPNKRGYKMMPHFELGIWADHVYLYLAVEENMKP
FT                   KETAAIVAKMTSARDIIAKLSNDFVLSSDHMVNTSNALTLSTYDDAVQRFANIKHSEVL
FT                   VGIKLLRGDKHFEEDTDLFQITTVLALLLPLYDKLK"
FT   CDS_pept        complement(491285..492109)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0488"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91136"
FT                   /protein_id="CBL91136.1"
FT                   /translation="MNSQTNQQQSHLLPDGRPIPRRITTNPQEKRHYENFTPAGFFDWR
FT                   RWVPLLVIVISLNIVWWRQPLLHTKALSGAALTWQLIPLFGYTITIAIAMTLMMTQNFR
FT                   SILSYLFLALSILFTFSSLIQTRHEIFTLLLLFTAFFIAIQQTWFGLQNWLGLLLFSVL
FT                   ATFAIPISIFYVTNNFLTQRFIWQLLPMLFGFGFYFTPILMPNPDGRKLSILTLGLFWV
FT                   TILSHNVGISTVFIIIFSLMAFILQFVKAKIGNWQHMGYVLLMALSMLLIYH"
FT   CDS_pept        492488..493645
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="LEGAS_0489"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91137"
FT                   /protein_id="CBL91137.1"
FT                   /translation="MTKYFTSESVSAGHPDKIADQIADAILDAVLEQDPHARSAVEVTT
FT                   STGDVSIFGELSTSAYVNVRQIATDTIREIGYNKAELGFTADSVNVSNKIVEQSGDISQ
FT                   AVDNADDDPEQLGAGDQGMVFGYATNETDSYIPLTLALSHRLMRKIRDVREAGTVSYLR
FT                   PDAKAEVSVELDDNDKVIRIAAVVLSTQHDEDVTLDQLRSDIRQLVIDEVLPQDLVDEN
FT                   TIYYINPSGRFVLGGPQADSGLTGRKIIVDTYGGAAHHGGGAFSGKDATKVDRSAAYFA
FT                   RYVAKNLVAAGVADKLELQVAYAIGVAQPVSLNIDTFGTSTVADTKIREITAQLFDFRP
FT                   LAIINHLNLRRPIYKQTAAFGHFGRTDIDLPWEALDKVDEIKALL"
FT   CDS_pept        493679..494617
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0490"
FT                   /product="Unknown enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91138"
FT                   /protein_id="CBL91138.1"
FT                   /translation="MVKKQATIELLMFGMAVGESMTQLSNSQQDELLQDPIQFTEELSW
FT                   GSQTSLSLTTIASLSRGYQLTDVMNHFQNWYKRRQFVPENTVQHVDAITKKAMDNYTKN
FT                   RDTLASGVLEDIADSENILVRMLPVALYLHHEYGVSFINDETAMLTLHRIAGLTHNDEG
FT                   ALVSVGMLSLIISQILDGQSLRDAVENGLAFGFEYYSRHKVFESELIAFEELNLPDFAN
FT                   IPVNHIKLDGRSASTLEAIIWSLLNSNSYVQAMQNAFLHGHANSIIPTAVSAIAAVFYD
FT                   DDLVLQASQHLISRKLIVSVTRQAERLGRFN"
FT   CDS_pept        complement(494670..495599)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0491"
FT                   /product="Diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91139"
FT                   /protein_id="CBL91139.1"
FT                   /translation="MPNYFVINNPSAGNGVHSNIVINIKKTPNIAAWHDTDYAGHAMYL
FT                   AKKLAKTIDDPTAVVLVIGGDGTLNEVLNGLLQFKRAVKLPIAYIPTGSGNDFARGINL
FT                   GTAEQAFSHLKRVTQTQLLNIGKINGDAPHHITKYFVNSIGIGFDAAVVAQTNQTALKR
FT                   RLNKLGCGSLSYLLSVLCVFFKQHDFQMTLMNGEDYIQMPHAFLVTLTNQVYFGGGIAI
FT                   LPGADVHQNELDMVVADKMSFIQFLVMFASLKKNGGHLQFKSVHKISLARGAKIHVRDI
FT                   QPGQIDGEELGNGTFSFNIDYQTYPFWL"
FT   CDS_pept        complement(495678..497195)
FT                   /transl_table=11
FT                   /gene="ppcA"
FT                   /locus_tag="LEGAS_0492"
FT                   /product="phosphoenolpyruvate carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91140"
FT                   /protein_id="CBL91140.1"
FT                   /translation="MTQRKFPTIMGTQHPDNANAPFWDASQQPFISAYNEMNEAFENFS
FT                   ELNVDEYMWDWEGKHADAAVIDRLFSTEYDYFKTNQIGRDKFLTFRFPNIWEEKGYSLM
FT                   QAMTAILSSEDFAHDLGFDQRPLFEAILPMAQRADQLLEMQILFEKLANFKSVEFTKTD
FT                   KNTPYIEMIPLFEDFNTQLHAPEILKEYLKLHEEHFGFRPKYLRVFLAGSDSALTAGFM
FT                   SSITGNKLAIARLHEFAKEENIDVYPISGTGSAIFRGGLSPHRIDRYVTEFPGVRTATV
FT                   QSAFRYDFPLADVQQAITELKEKLPNAEPLKISANDQKILAEVAEESARFYADTLDQLI
FT                   PDMQPIFKAFPKRRDRRQHVGVLGYSRSVDGIELPRAINFTGSFYSIGIPPEFIGFGRA
FT                   LANLNADHLSVFVRNYPSMKKDFRELAGYINLDALEILKTQSPAWAEVEQDIMTLKAIF
FT                   NLEIGPHNREQQQHAEIALQVVQIKDGAPVATTALINRMAQLRHFLG"
FT   CDS_pept        complement(497403..499085)
FT                   /transl_table=11
FT                   /gene="rnjB"
FT                   /locus_tag="LEGAS_0493"
FT                   /product="Ribonuclease J1"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91141"
FT                   /protein_id="CBL91141.1"
FT                   /translation="MTYSVDIKPNEVAVYALGGLGEIGKNTYGIEYQNEIIVVDAGIKF
FT                   PEDDLLGIDYVIPDYTYLVDNIDRVKALVITHGHEDHIGAISYFLQSVNVPVYAGPLAM
FT                   ALIKNKLEEKQMLNRVELHEITDGSVLEFDKLSVEFFRTTHSIPDVFGVAIHTPVGTIV
FT                   ETGDFKFDLTPTTKQPPNLWSMARIGENGVLLMMSDSTNAERPEWTKSEAWVAKSVNRI
FT                   FDKIEHGRIIFATFASNMNRVRMATDAAIAHGRKIAVFGRSMESAVTNGRALGYLNIPD
FT                   NMLVEQSEIKHIPDDELLILSTGSQGEPMAALARIAEGTHKQIRLKPKDNVIFSSSPIP
FT                   GNTASVNQVINKLEEGGANVIYGKVNNIHTSGHGGQEEEKLMIALMKPKFFMPVHGEYR
FT                   MLKVHASLAQELDVPKDHTFILENGDVLALDGENARVAGHFPGDDTYIDGSGIGDIGSV
FT                   VLHDRQKLSQDGLVVVTATIDLKEKEILSGPDILSRGFVYMRESGDLINEGRRVIFGTM
FT                   RRVMSNPNVNEADIRQAVIDDLSRFLYKETARKPMVLPMLIMI"
FT   CDS_pept        complement(499088..499300)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0494"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91142"
FT                   /protein_id="CBL91142.1"
FT                   /translation="MIYKVYYQEHPERNPKRETTVSLYLTADSLPQAREIIEENTTYNV
FT                   EAIEELTDKALTYEKANPDFEITTF"
FT   CDS_pept        499455..500030
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91143"
FT                   /protein_id="CBL91143.1"
FT                   /translation="MTVQSIAVFMGAQFGNDPEYTIIAEKLGQLIAEKKLKLVYGGGRD
FT                   GLMGATALSTMAHGGEVIGITPNNLAEDAISPEQVTRLIEVDSMSERKDLMMRYADAFV
FT                   VLPGGFGTLEELAQVLSWAKIGLHDKPLVLLNINGFYDSLWAWLKETVTKGFVAEHELQ
FT                   HVQLFDNIDDTLIYINQFNVLIHETNDY"
FT   CDS_pept        500053..500517
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0496"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91144"
FT                   /protein_id="CBL91144.1"
FT                   /translation="MVNSDLMAEFISVYMSSLKNLEKLISQPTSQFGISFEQWLIMTAV
FT                   VNSDQDKLLTMTKIAAERGVTKGAIARQLKPLFEQGYLEQVRDEQDHRRILLNATLEGQ
FT                   RVESIITRCVNSRFNGWLDTYGLVEGQALLSTLRRLDALIVQPELNKEKH"
FT   CDS_pept        500622..501182
FT                   /transl_table=11
FT                   /gene="efp"
FT                   /locus_tag="LEGAS_0497"
FT                   /product="Protein Translation Elongation Factor P"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91145"
FT                   /protein_id="CBL91145.1"
FT                   /translation="MAIGMNDLKNGLTIEYTNGLWRVLDFQHVKPGKGGAFVRSKLKNL
FT                   RTGAVNEVTFRPGDKFEQADITTRPMSYLYAENDGRVFMDVETYEQVNLPDDKIASALK
FT                   FLLEGMEVKVTMYGNEILGAELPSTVPLKITETQPGIKGATATGSGKPATLETGATITV
FT                   PDFINEGETIIVNTEDGAYKGRA"
FT   CDS_pept        501314..501778
FT                   /transl_table=11
FT                   /gene="asp2"
FT                   /locus_tag="LEGAS_0498"
FT                   /product="Alkaline shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91146"
FT                   /protein_id="CBL91146.1"
FT                   /translation="MAREIKRNKQTAKNIILATENSVVGGTTQVTPEVIEVVAQIATQE
FT                   VPGVYSMRGTLSDRFTNAFGSNARGKGVELSHTEEGLVIDAYVFLQYGVVVPKVALEIQ
FT                   HAIQSQISSMTDLQVTQINVHVTGIVPEKISSSIDPDNLFGESGTTEVVK"
FT   CDS_pept        501778..502194
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="LEGAS_0499"
FT                   /product="N utilization substance protein B homolog"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91147"
FT                   /protein_id="CBL91147.1"
FT                   /translation="MSNLTRHESRQAAFQVLFALEKDPKSNNIDKLYDIVLEGKDYDDY
FT                   LPRLVNGVLGTKSELDEQITAHLANGWAINRINKADLIILRLAIYELLNNLVPYKVAID
FT                   EALILTKTFSDEESRKFVNGLLKNFTPAVAPKVE"
FT   CDS_pept        502414..503211
FT                   /transl_table=11
FT                   /gene="tatD"
FT                   /locus_tag="LEGAS_0500"
FT                   /product="Hydrolase, TatD family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91148"
FT                   /protein_id="CBL91148.1"
FT                   /translation="MAIYDLTKTPADSYDTHTHLNDDKLFHDVPAYIGRAHEFRVMEMN
FT                   IVGYDAKGNERALEIAQAHDNIYAVLGFQPEDTGDFDAVAAEKLEKQLQQSKVVGVGET
FT                   GLDYYWETTAHDVQKKAFQTHLALAKKYDLPIIIHNRDAFEDVYAMLKDSGVTKGVMHS
FT                   FSGTPEQAMAFVNLGMHISFSGVVTFKKAEDVREAAKSVPLNRLLVETDAPYLAPTPFR
FT                   GKDNEPALVKYIVDSLAETLNMTPKEISDITRQNAHRLFLNHD"
FT   CDS_pept        503204..503764
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0501"
FT                   /product="Ribonuclease M5"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91149"
FT                   /protein_id="CBL91149.1"
FT                   /translation="MIERPHINEMIVVEGKSDTQNLARAVVADTIETGGSAVNGDAIKR
FT                   AQYAAKTRGVIILTDPDFNGQRIRQIMTTAVPLAKQAYITQSEGRAQKDNWHKSLGVEH
FT                   AEPNILRQALAFVMTPKIDIVTDVDQQFLIQSGLLNGQDARKRREIVGESLHIGYTNGK
FT                   QLLKRVQQFGITQAQILTVLKGK"
FT   CDS_pept        503769..504656
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="LEGAS_0502"
FT                   /product="Dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91150"
FT                   /protein_id="CBL91150.1"
FT                   /translation="MAEIIDIANPTRTQAILNAYGLHAKKKFGQNFLTDLDVLHGIVDT
FT                   ADITNEDYVIEIGPGIGSLTEQIARAAKKVLAFEIDTQMVKVLGETLKDYDNVKVISGD
FT                   ILEMNLPQIITEEFGETAHVKVVANLPYYITTPILMQLLRTNITWDNIVVMMQREVADR
FT                   LNAEVGTKAYGVLTLTVQYFANAQLAIEVPATAFNPAPKVESAVVKLTPLVPQVIVDQP
FT                   ERLFGVIKGSFSHRRKSLWNNMLQTYGKDTYIKEKITAALKQATIDPSIRAERLDLTQL
FT                   TTLYLALREQELTQ"
FT   CDS_pept        504760..504993
FT                   /transl_table=11
FT                   /gene="veg"
FT                   /locus_tag="LEGAS_0503"
FT                   /product="Protein veg"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91151"
FT                   /protein_id="CBL91151.1"
FT                   /translation="MPSSLQDIKIKLDAHVGEAVTVVAQAGRKKITERTGVLRSTFPSL
FT                   FVVELDEEAKFERASYSYTDILTNNIDITFAE"
FT   CDS_pept        505043..505897
FT                   /transl_table=11
FT                   /gene="znuA2"
FT                   /locus_tag="LEGAS_0504"
FT                   /product="ABC transporter substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91152"
FT                   /protein_id="CBL91152.1"
FT                   /translation="MKKQVFYAILTISLIPIGIFLIGMKMTVATHPTHHVPVQIVTDNV
FT                   AYQQIAQAVANTSGHVSLLSGNLAQNNEKSIFKQAEILVTDSHQNQLLTQRRNLKLHSK
FT                   LLVASDVVKNQAYANYWLSPEITLKTIARLSDLLSDLDPRNRNNYINNSQKLNEQTQAL
FT                   SQGIESLKQEKNVHYIATNNAQQVFMTQLNYTSDVSNIEITSDKDFDKLTKRIRDKQIR
FT                   FVLTASQDQSDRDQHLVALAKSANIPVITFNQVLPSNQKVWQWQLTFVEQLQAVFKPVE
FT                   SGK"
FT   CDS_pept        505897..506598
FT                   /transl_table=11
FT                   /gene="znuC2"
FT                   /locus_tag="LEGAS_0505"
FT                   /product="Zinc/iron ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91153"
FT                   /protein_id="CBL91153.1"
FT                   /translation="MSIIRTKDFGIHYGEKKILTHATIDIPAGRFFALLGENGAGKTSF
FT                   VKALIGQNQQTDGELKLNTNRVGFVPQFRDITRDFPLNIAEFVALNYNKGWRLWLNKRE
FT                   KSAVESALKLMDLADMSDKRLGLASGGQKQRAFVAQALVQQPDLLILDESTASLDHEHK
FT                   IQLLQTVKQLQKTQHLTILFITHELELVAQFADGYLLFENGHVTQGGVDELQSLTMKMT
FT                   HIHAEDEVRHV"
FT   CDS_pept        506591..507382
FT                   /transl_table=11
FT                   /gene="znuB2"
FT                   /locus_tag="LEGAS_0506"
FT                   /product="Zinc/iron ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91154"
FT                   /protein_id="CBL91154.1"
FT                   /translation="MFSYDFMQNAFMAGTVVSIVAGIVGTFAVARNYAFLTHTLSEIGF
FT                   AGAAFGLFAGWPALLGMMIATSGASIAIGALESGYTKRDNVTSAISALAIGLGILFLAL
FT                   GHTSTTAATGILFGSVLGISRQNLLLLIVLAIFVMVTLLINYRSLRQLAFDEAGIFLQS
FT                   GRQKAVRYIFLVIIALSVSISSQLVGSLLIFVLVTLPAASAKYYATATTRLMGLAVIFA
FT                   LFGTWSGLTLAYLTNLPASFFIAVIEVLIYLVSVWQFQKSA"
FT   CDS_pept        507484..508317
FT                   /transl_table=11
FT                   /gene="purR"
FT                   /locus_tag="LEGAS_0507"
FT                   /product="pur operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91155"
FT                   /protein_id="CBL91155.1"
FT                   /translation="MKTRRSDRLVDMARYMLERPRTLISLSYFAKRYDSAKSSISEDLS
FT                   ILKRTFQERGTGLLETVPGAAGGARFIPFMAEDEAKSFIEEIRQYVNDETRVLPGGYVY
FT                   LSDLLGRPDILRQVGRLIATQYLRDNIDAVMTAATKGVPLAQAVAEQLNVPFVIVRDDA
FT                   KVTEGPTVSVNYLTGSSKRVEKMELSRRSLRTGSRVLIVDDFMKAGGTIQGMQTLVSEF
FT                   DGTVVGTAVFAEGRSATRLLDRFTSLLHVDTNLKNGDPIIVTAGNYAKEIYKREA"
FT   CDS_pept        508324..509697
FT                   /transl_table=11
FT                   /gene="glmU"
FT                   /locus_tag="LEGAS_0508"
FT                   /product="Bifunctional: UDP-N-acetylglucosamine
FT                   pyrophosphorylase/Glucosamine-1-phosphate
FT                   N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91156"
FT                   /protein_id="CBL91156.1"
FT                   /translation="MIDEVNVLVLAAGNGSRMKSSAPKVLHEVAGQMMIDWVLDAVEPL
FT                   SKNKPITVIGVGADSVQAHVGSRSEFVLQSEQLGTGHAVQQAQSQLESSHGVTLIMSGD
FT                   TPMFRSETLSEFIDEHKRSNNAVTVLTAIADDPTGYGRIVRADDDTVIKIVEQKDASVT
FT                   ERRIREVNTGVYIFDNQLLFESLSQVKNNNAQGEYYLPDTLDILRQSGHQIGAYTLQNF
FT                   TESQGVNDRVALSVANQVMHERINHQLMIAGVELVDPASTFIDATVIIGQDTVIEGGVT
FT                   ILGQTVIGKNNLITQGSRISDSFIGDDSVITSSHLESARLANGVTVGPYAHLRPQTNLG
FT                   DHVHIGNFVEVKQATVAANTKAGHLTYIGNATIGEDVNIGAGTIFVNYDGVNKFTTVVG
FT                   DRAFIGSNTKIVAPVNIATEAITAAGSTITNDVPGHAMAIARARQINKENFWDHMPHK"
FT   CDS_pept        509871..510368
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0509"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91157"
FT                   /protein_id="CBL91157.1"
FT                   /translation="MQITGEKALENILEDAIYFYKDTILDSDHIALDNLFMILDKHIHD
FT                   DNFIHITGEINGGITEGGTTLTLETNIVNLPLRYTNQLKKLIWPEKEDNQVNIYMIIEN
FT                   VDVSQSNLKIALASSVAAYLDDAASVKIKISQWFDEQLANIVIAQNKVEENDDPENKTS
FT                   DN"
FT   CDS_pept        complement(510383..510640)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91158"
FT                   /protein_id="CBL91158.1"
FT                   /translation="MIKLTKLEKHDISRVANPKYTDFADIYVPDSNAGSKKMMAKYIIE
FT                   AYDLGELYGVKSTVSHHILDFTYLNGEQQSRITGKIEYDA"
FT   CDS_pept        511028..511657
FT                   /transl_table=11
FT                   /gene="comEA"
FT                   /locus_tag="LEGAS_0511"
FT                   /product="ComE operon protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91159"
FT                   /protein_id="CBL91159.1"
FT                   /translation="MIDKFDVIKEKLAVYKIWLLFGGVILIGCTAMIVVKQPKSVEMPT
FT                   AYSMSSTSSSAATTSISSKAAVMIDVKGAVKNPGVYDIVNSPRAQTAIAKAGGLMHEAD
FT                   TLKLNLAQKLSDGQMLYVPVIGEAASNKVAIGQSGTESNQEITKINLNTATVEELQTLE
FT                   GVGEKKAEQIIAYREAHDGFKKLDEIKEVSGIGAKRFETLQDKITI"
FT   CDS_pept        511657..513945
FT                   /transl_table=11
FT                   /gene="comEC"
FT                   /locus_tag="LEGAS_0512"
FT                   /product="ComE operon protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91160"
FT                   /protein_id="CBL91160.1"
FT                   /translation="MINRSFLIVSLLIATVGGCIYRFNSVTIVLLVLVIVISCFNLNKW
FT                   FMMIVIILGTPFLLYFIHDAHELRIQSLEPDQESAQISGVILPDEITIDGDNLMTNARL
FT                   DVNKHIVRLYAKLTSESEKQAWLSEKNIVHFEATSDLSRIKPPTNFNQFDAQRYYETKH
FT                   ITHQVTIKSWQVKPINSKKIWQKCRYQLHIWHAQGIQNAAKLPQPLSDYAQALILGTAS
FT                   QSLYGNNPGVQTLGLIHLFSVSGFHVSYVLMLLMAVLRRLYVPQEVSAWLGALLLVNYF
FT                   VFAGEPAVLVRALIAGLIMMTRLAGCRRIPIESVWAVSLLGSLIYEPGILFTLGGQLSF
FT                   AMTFCLLFTTKLNFWQVNLLLSAVSLPLIVSQQYTWHVLQTFVNFAAIPIFSVVIVPAV
FT                   IVGFIGQTVPFVTHLMNSIIGLFAHSVDFIATLPGNLIIGKLSWFVSIILFLVALLLFV
FT                   TEKKIAQVARVSWITLLGSVLLWTRFPVHGEFSIFDIGQGDATLICEPFKRSVTLIDTG
FT                   GQVMFGSKQKWQEQAFQRTKGETVIVNYLHSQGISHIDNLVLTHQDFDHIGDAKIILQK
FT                   IRVNHIIIPAGMAEQQAFAKEIKPYLKKTHVIEVTQGMMIPKMPLHIVHPFQVGKAENE
FT                   DSIALYGNIGGQNIFTAGDLNQAGESAIAAKYPNMRVDILKLGHHGSKTSSNPTVIKQW
FT                   QPKVGIVSAGRNNRYHHPHMETLKTIQDQQMTLFNTQTHGMIRYNYTRKKGQFEVKLNH
FT                   ELATTTTTN"
FT   CDS_pept        513914..514915
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="LEGAS_0513"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91161"
FT                   /protein_id="CBL91161.1"
FT                   /translation="MNLQQLQQQIKNKALANFYVVTGNEDVLIYRAQQAFRQLIQLADR
FT                   DMNYSQFDLIDQALDEVINDAMSMPFFGDRRVVVVQNPEFLTAKGKISVQNQEQLVKLL
FT                   EKPIAENIVVFFINDLKIDKRKKITKTLLKYAENIELPALNESQSRQAITQELQQRAYK
FT                   IEQDALQELILRTNAHYTAMKNELPKLIAYATHTKNISLEAVTTLVPKTLTATIFDLVD
FT                   AVMTRQSKKALLIYRDLLQNGEPALRINAVLTGQFRLLLQIAGLKGTEQDMSKQLGIHP
FT                   YRIKLAHQMLKKYLLASLRDSYLGMVGIEVKLKSTNQEPALLFERFILKNTL"
FT   CDS_pept        complement(514986..515237)
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="LEGAS_0514"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91162"
FT                   /protein_id="CBL91162.1"
FT                   /translation="MPVIESAIQRVRLTKKQHDRNEPQLSAYRTAVKRFEKASAAGEDN
FT                   LAELYKTASSAIDHAYSKGLIKKNKASREKSRLAKYVK"
FT   CDS_pept        complement(515287..515556)
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="LEGAS_0515"
FT                   /product="30S ribosomal protein S15"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91163"
FT                   /protein_id="CBL91163.1"
FT                   /translation="MALTQERKNEIINEYARHEGDTGSAEVQVAVLTADINELNTHMAI
FT                   HKHDFHSQRGLMKKIGSRRNLLRYLRNTDIQRYRELIQRLGLRR"
FT   CDS_pept        515784..516092
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="LEGAS_0516"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91164"
FT                   /protein_id="CBL91164.1"
FT                   /translation="MSETTISKSEVAHVANLAKLAFDDAELVQFTTQLDNILNIFDTLG
FT                   EVNTDGVAPTYSVTENVNHLREDVADNWHQKQALLKNAPLEAADLIKVPAILDGEGE"
FT   CDS_pept        516095..517561
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="LEGAS_0517"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91165"
FT                   /protein_id="CBL91165.1"
FT                   /translation="MTINFFDNDLTSLHEKLVNNDISTVDLTQATLENIEKTDSELQAF
FT                   IRTNSDEALLQAKKIDAQHDFSNILSGLPLAFKDNLATNGIETTGASHILEGFKPVYDA
FT                   TVVSKLSTVGAISVGKTNMDEFAMGGSTETSYYKKTTNAWDHTKVPGGSSGGSASAVAG
FT                   GQIPFALGSDTGGSIRQPAAFNGIVGLKPTYGRVSRWGLFAMASSLDQIGPFTRTVKDN
FT                   ALVLNTIAGFDEKDSTSSKRDVPDFTSKLTGDVKGLKIAVPKEYFGEGIDPKVATTVKA
FT                   AIAQLEAMGATVDEVSLPHTKYGVAAYYIIMSSEASSNLQRYDGVRYGFRADDVKNLED
FT                   LYIKTRSEGFGDEVKRRIMLGTFSLSAGAYDAFFKKAAKIRTLLIEDFNKVFADYDVIV
FT                   GPTAPTVAYGLGEEIDDPTAMYLADVLTIPVNLAGLPGLSVNAGFVDGLPVGLQIIGKP
FT                   FDEATVYQTGYAFEQASRLFEQRPNIAKKY"
FT   CDS_pept        517631..519070
FT                   /transl_table=11
FT                   /gene="gtaB"
FT                   /locus_tag="LEGAS_0518"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91166"
FT                   /protein_id="CBL91166.1"
FT                   /translation="MATGNFETTIGLEVHVEMQTNSKLMSPSPVHYGDKPNENTNVIDF
FT                   GYPGVLPVANKGAIEFGMRAALALHATVSPFIRWDRKNYFYPDNPKAYQTTQSQTPLGT
FT                   NGYLDVTLADGTVKRVRIKEMHVEEDAGKNTHGADGYSYVDLNRQGTPLIEIVSEPDIA
FT                   SPEEAYAYLEQLRQAILFTGISEAKMQEGQMRADVNISIRPFGSSGYGTKVEMKNINSF
FT                   NYVRNALIFEEKRQAEVLRSGGVIQQETRRYNEPTKSTILMRVKEGADDYRYFPEPDLA
FT                   PITIDQTWIKKVADELPKSAGDRQRDYVSNLGIELYDAKVLTQTLAMSDFYDATVAAGA
FT                   DAKRAANYLIGDVNAFMNKHQIELQDTQLTPVHLAGMIKLIEAGTISTKQAKQVFEAIM
FT                   AGEEPESFAKKNGLVQISDPVVLLGWITDVLDNNPQSIEDFKGGKDRATGYLIGQLMKM
FT                   SKGQANPGVMNKMLLEELARR"
FT   CDS_pept        519230..520219
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0519"
FT                   /product="Diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91167"
FT                   /protein_id="CBL91167.1"
FT                   /translation="MRARIIYNPTSGREAIKREMLAILHTYELAGYETSAFATTPEPMS
FT                   AAKEAKRAAIAGFDLIVAAGGDGTINEVVNGLAPLPKRPMMAVIPAGTTNDYARALKLP
FT                   RDEPLEAAKIIFQRETIKMDIGKIDQAGMSKYFMNIAALGTISEVTYAVPSLMKSLYGY
FT                   LAYLVKGTELITRIKPVNAKVTYDTGEYSGKISMIFLALTNSVGGFETIVPDAKLDDGK
FT                   FTLLIIKESNLAQILQIVAQMLNGGKHVDNQQMIYKKTNKVAITPLDQDQLKVNLDGEY
FT                   GGDAPMVFTDLQQHIEFVANRSGMQEAATISDTTKEKFVADVEKLDVK"
FT   CDS_pept        520298..521692
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0520"
FT                   /product="RNA m5u methyltransferase family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91168"
FT                   /protein_id="CBL91168.1"
FT                   /translation="MAKANRVYKTEVPVKKNQEIQGEVIDITYQGMGVVKIDNFPIFVV
FT                   DAIPGEVVNLSITKVLKNYAFGRVLTRVQESPNRAEDVDKVAITTGIAPLANLKYEAQL
FT                   TFKQHQIEQMFKKVNVEVDVKPTLGMENPTKYRNKAQVPVQLINGRLETGFYRRGSHKL
FT                   VPTDDFYIQDPKVDEAVVVTRDILRDLGISAYDEETNKGVVRHIMARRGYYSHELMVVI
FT                   VTNTKKLPDATEIATRLQAKLPELKSFIHNINNHDTNVIMGQWNETIWGANEIHDQLMD
FT                   KDFVIGPNSFYQVNPQTTATLYTLAAEKAGLKKTDIVVDAYSGIGTITLSIADKVKKIY
FT                   GVEVVETAVEDAEKNAKNNHIENVSFVTADAPEQMVKWAEDGLKPNVVFVDPPRKGLTA
FT                   ELIFAVSAMKPETFVYISCNPATLARDAVQILAEGFKIDGAVQPIDQFPQTTHVESITV
FT                   FKRVTD"
FT   CDS_pept        521883..523499
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="LEGAS_0521"
FT                   /product="CTP synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91169"
FT                   /protein_id="CBL91169.1"
FT                   /translation="MADKQVKYIFVTGGVVSSLGKGIVAASLGRLLKNRGLKLAIQKLD
FT                   PYINIDPGTMSPYQHGETFVTGDGLETDLDMGHYERFMDINTNMYSNVTTGRIYSEVLA
FT                   KERRGDYNGGTVQVIPHITDAIKDKMKKAAQSTDADVVIVEVGGTVGDIESLPFIEALR
FT                   QMKSDLGSENVFYIHTSLIVYLTAAGEAKTKPTQHSVAQLRSLGIQPDMIVLRTSAPLE
FT                   ESLIKKISTFTDVSPEAVVESRDVETLYEIPLNLQAQGMDDVVLNKLQIDAPKADMVDW
FT                   SKMIEGIKNPKRSVKIAVVGKYTDLPDAYISVNEALKHGGYAQEADVTIKHIKSETVTA
FT                   DNVKVLLAGVDGIMVPGGFGERGTEGKIEAIRYARESNIPFLGVCLGMQLASVEFARHV
FT                   LGYADANSTELNPETTAPIIDLMKDQQDIENLGGTLRLGLYPAMLVPNTLTAKAYGNVA
FT                   EIEQRHRHRYEFNTTYRQEFESAGIIFSATSPDDRLMEVIEYPKNDFFVAAQYHPEFLS
FT                   RPERPEGLYRDFIGAALQHEA"
FT   CDS_pept        523578..525368
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="LEGAS_0522"
FT                   /product="excinuclease ABC, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91170"
FT                   /protein_id="CBL91170.1"
FT                   /translation="MLANPSKHIEQKLALLPAEPGSYQMKDQNGKIIYVGKAKNLKNRV
FT                   RSYFKQEHNGKTAELVQNIVDFEFIVTNSDKEAFLLENELIKKYKPYYNIRLKYGTGYP
FT                   YIKITKERDPKMALVNEVKKDGGFYFGPYPNVYAAQETLRFLEKNYPLRRCNGYQGRPC
FT                   LYYNMGQCLGPCWHEVSKQDYDEQIDRIKHFLDGDTTTVKKAIAEKMKAAADTLEFERA
FT                   ADLRDQLKYIDETVESQRVLSKDTTPRDLFNYYLDKGWMTVEVFFLRQARLIRQFKRTF
FT                   SVVGTEDEEMMNFIQQFYAQRNIQKPHEVLVPHGINIAALTEILAVSVRIPVRGEKRDL
FT                   MDLAKKNARIALEEKFRLMQLNEKKTTGAMMEITDALKIPMGHRIEAFDHSHTQGVEIV
FT                   SAMVVFDDGVPNKDLYRKYKIKSVNHADEWAETQEVIRRRYSRLLKENGKMPDLILMDG
FT                   GEIQLHAAKEVLEDELNLHVPIAAMVKNDKHKTADLIDGKTEKIVILDKQSEGFFLIQR
FT                   VQEEVHRFAINFHRQLRSKNSLASRLDNIQGVGPKTRQKLLREFGSLPKITAASVDDLM
FT                   MIGVNEKLARVIHLSLQAGQ"
FT   CDS_pept        525438..526190
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0523"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91171"
FT                   /protein_id="CBL91171.1"
FT                   /translation="MLEVKNLSKQFGRFEAVKNANFAVDRGEIVGFVGPNGAGKSTTID
FT                   MILGLTKPETGEILINSEILTQKSAAKLHQKMGFLSTDMNLDRNLTGYEALAFFAHLRG
FT                   DWTPEVKNNIKKLAVEINANLNKKIKKLSRGNRQKIGLIASIMNAPELLVMDEPTSGFD
FT                   PIVQSEFIRLLKAHKAQGGSALISSHNLSEIAEICDRVVFIVGGRIVDNQSMNELREKA
FT                   PKREIIDLDAVLEKLVDKNPDQRLEEGE"
FT   CDS_pept        526192..526986
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0524"
FT                   /product="ABC-type transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91172"
FT                   /protein_id="CBL91172.1"
FT                   /translation="MLSNVFLKTLYEERIAIIGWAIGILLAIIGVGVMFPSIKEIFGSQ
FT                   MAQIPKEFQGWFGENGNMMSSFKGYVATELVGNVGIMLVIQAIIFGSSLLAGDEENNVL
FT                   QPLLTLPISRRSIYAQKWVALAVINLTLVIVWAIAVEIAALLVHETVGFNILFRIGIVF
FT                   FLTNLALATIAYSIGAMTGKRSAGGIFIGVYAFLAYFINALAGQGDVVKTLNQLSIFKY
FT                   AGYIELSSHTILFGNIVVIVMALIIFYVLGLLIFSRRDIQMN"
FT   CDS_pept        527194..528513
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0525"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91173"
FT                   /protein_id="CBL91173.1"
FT                   /translation="MAFVDQAEIEVKAGKGGDGIVSFRHEKFVAMGGPFGGDGGRGGSI
FT                   IFKVDEGLRTLMDFRYNRHFKAQPGGNGGTKGMTGASSEDRYIKVPQGTTVKDADTGEV
FT                   LGDLLENGQELLVAQGGRGGRGNIHFATSANPAPELSENGEPGIIRNLKLELKVLADVG
FT                   LVGFPSAGKSTLLSVVSNAKPKVAAYHFTTLSPNIGMVRLDDERDFVMADLPGLIEGAS
FT                   QGIGLGFQFLRHVERTKVVLHLVDMSGVEGTDPYTQYRKILDELQQYDETILDRPQIVV
FT                   PTKMDMPDSDENLAKFQKEIAAESGLPVQPMIVPISALTREGTQELMRLTADMLATAPA
FT                   PESYRTVDETITSEKTYDFKPENHDFTIVWSEESEQWIIGGSEVEKLFLMTNIQRDATI
FT                   MRFGRQLRHMGVDDALRKAGAKDGDDIRISDSDFVFEFSD"
FT   CDS_pept        528772..530457
FT                   /transl_table=11
FT                   /gene="alsS"
FT                   /locus_tag="LEGAS_0526"
FT                   /product="acetolactate synthase, catabolic"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91174"
FT                   /protein_id="CBL91174.1"
FT                   /translation="MSEQKYGADIVTDSLVNHGVDLVFGIPGAKIDRLFETLEHPKSGQ
FT                   KVPKLIVARHEQNAAFMAQAFARITGKTGVVIATSGPGVGNLVTGLMTASAESDSVVAI
FT                   GGQVPRRDLYRLTHQSTNSIALFNPITNFSSEIQDPNNISEILANAFAAANGAKKGAAF
FT                   VSLPQDIDDAPVDVEALAQVPMAKQGAASLSDLDWLAGKIKQAKLPVLLVGARASDDES
FT                   VTALHKLLNQVSLPVVETFQGAGVISRDLEETSYFGRIGLFRNQTGDKLLQQSDLVITL
FT                   GYDAIEYEPRNWNKENTLNIVALDTTPVQIDNNFVPQRQLIGDLSQSIDLLTERINGYQ
FT                   LPDASQKILHDLKTDLRLSNEPTYTPAEGNLNHPLTVIKSIQTHVTDDMTVSTDIGSHY
FT                   IWMARHFKSYVARHFLISNGMQTLGVGLPWAMTAAMVRPNAKSVSVSGDGGFFFSAMEL
FT                   ETAVRLNLNTVHIVWNDNAHYDMVKFQEEMKYNGESAGVNFGNIDLVKYAEAFGAKGLR
FT                   VTTPADLDAVLDEAFATKGPVVVDIPVDYSHNYELGSQLIHGEG"
FT   CDS_pept        530979..533120
FT                   /transl_table=11
FT                   /gene="nrdD"
FT                   /locus_tag="LEGAS_0527"
FT                   /product="Anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91175"
FT                   /protein_id="CBL91175.1"
FT                   /translation="MNKINVATTITKRSGEKVQFRPYKIALILESLNIEGDVYEAIMSI
FT                   VLSKATQPNVTTQVIYQTILTQLETLSPKAAESFQSIHIADEQAWLQATNPENKLKSLI
FT                   NQDDKTMHENANKDSHVFNTFRDLTAGMIGKSKGLTMMPESVAKAHLRGDIHWHDLDYT
FT                   PLSPMTNCCLVDFDYMFKSGYTMGNAQVETPKSIGTATAQMAQIIANVASSQYGGTSIN
FT                   RADELLAPYAEMNYQKHLHNAKIYVQADKRQAYAETATKKDIYDAMQALEYEINTLASA
FT                   QGQTPFTTLGFGLGTNWLEREIQKSIFKIRIKGIGPNHRTAIFPKLVFSLKRGINMNAE
FT                   DVNYDIKKLAIECASKRMYPDVLNYEKIVALTGSFKAPMGCRSFLQGWQNEQGVEVNEG
FT                   RMNLGVVTLNVPRIALQSQGSKSRFWEILDERLALAKQALKFKLARTKEAVPENAPILY
FT                   KNGAFGKMLQDDDDVDTLFKNGRATLSLGYIGLYEVGTYFFGPNWETNQEAHDFTVEIV
FT                   RRLHVACKAWEAEDGYHYSVYSTPAESLTDRFCELDKARFGAIADITDKDYYTNSFHYD
FT                   VRKHPTPFEKLLFEEAYPKYTNGGFIHYCEYPNLRQNPAALEAVWDFAYDHVGYLGTNT
FT                   PIDKCFKCGFEGDFKPTARGFCCPECGNHDPKTCDVVKRTCGYLGNPQARPMIHGRHVE
FT                   IASRVKNMSQSEVDQKHVK"
FT   CDS_pept        533110..533697
FT                   /transl_table=11
FT                   /gene="nrdG"
FT                   /locus_tag="LEGAS_0528"
FT                   /product="Anaerobic ribonucleoside-triphosphate reductase
FT                   activating protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91176"
FT                   /protein_id="CBL91176.1"
FT                   /translation="MSSKLANGITVPESKEWQSADLSLNYVADYKPFIMVDGPGVRCSI
FT                   YLSGCKFLCPGCYNVVAQNFHYGTAYTQELEDQIVADLSHSYVQGLTLLGGEPFLNTAV
FT                   ALKLTRRIRAEFGHTKDIWSWTGYTWDELMAETADKKALLQEIDVLVDGRFVQALMNLK
FT                   LRFKGSSNQRIIDVPESLVKKEIVLWTDEYEN"
FT   CDS_pept        533860..534957
FT                   /transl_table=11
FT                   /gene="tagH"
FT                   /locus_tag="LEGAS_0529"
FT                   /product="teichoic acids export ATP-binding protein TagH"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91177"
FT                   /protein_id="CBL91177.1"
FT                   /translation="MTEDSKKIVYTPTDPRGLNEPFLPVSIAKQIDLPGNDNVSGAPLK
FT                   VSGRYITKEYDMGTSRNEKIQAILNPLKSKKEKFWGLKGISFDVFEGDVVGVVGVNGSG
FT                   KSTLLNILSGALMETSGRLILKGKTSLLSVWDGLRDNLTGLENIRLKSLMMGLSNKEID
FT                   NQINDIAEFSELGKFIKQPVKNYSSGMRSKLGFAIAVHQNPDIMIIDEALSVGDQTFTR
FT                   KALNKMQEFKAAGKTIFFVSHALGQIEEFTDKTMWIQYGELRAYGDTATILQEYKNWTK
FT                   WYNQLDDDVKKSYVAARKQAQNDFNRTQLTERIVEDNHLSDADKKKIARDNAVGGRLTW
FT                   WNWLLLAIGTGIFVYAVYLYVYLGR"
FT   CDS_pept        534965..535780
FT                   /transl_table=11
FT                   /gene="tagG"
FT                   /locus_tag="LEGAS_0530"
FT                   /product="teichoic acid translocation permease protein
FT                   TagG"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91178"
FT                   /protein_id="CBL91178.1"
FT                   /translation="MREIWLVLREQIKYFPVMLRLARYETRAKYKDHSLGILWDLINPV
FT                   MQIATYWLVFGIGLRQGNVADGIPYVGWLVIGQATWLFLNTSFMDATWSIRNNVRQVSK
FT                   MNFPISIMPTVRTWINVIPFVITLAVGVLIAVGSGVHLTMHAFQFVYYFIAMLAFLHAL
FT                   GIFNATITVLFPDYQQLIQTIMRFVFWFSGAVIDIAAKLGPDHARISRLIELNPFYYLI
FT                   SGVRDSFLSTGWIWDHPSQNLAFWMFVLVVLLLGSHLHLKFRAYFADLV"
FT   CDS_pept        535853..539407
FT                   /transl_table=11
FT                   /gene="tagF"
FT                   /locus_tag="LEGAS_0531"
FT                   /product="teichoic acid biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91179"
FT                   /protein_id="CBL91179.1"
FT                   /translation="MTEPIIHIPKNLDKPITVVNKSNRKNTRLSVVVPMYNVALFLKEA
FT                   LDSLLRQGINDELQVILIDDGSKDETSTIAKDYVDQYPDVFELYLFENGGLGAARNRGT
FT                   NLAVGEYVTYVDPDDIVVDDSYHNMLSIINRTGSDVIGGAVRRFNSTGKQWTSTVHNKA
FT                   YHDAYEATTLGEHPELVWDTTAWNKIYNLEFIQSNSLYFPEKMLYEDMPMVVPMYSLAK
FT                   KIDVFDEVIYLWRERDEGAPSITQSTAQKNNFTDRVKGMKMILSSLADYDAPENAQNEQ
FT                   LNKMLNFDLRLPFTYEKYIALDDEYKDTIYEQVKGFLKLLTPAQFNQAQYWYRALYTVW
FT                   LYQPKVVVQNAITKFAKYEFCVQFNQDDGSFHSSYQDDFDFDLATLNSDFDPFTRLYSV
FT                   TEENNQVVLVGHLFYRYMDLPTRNLISNLKVELVNKNGEVLVHSNGVADMQYDPDATAK
FT                   WGFENTQSRREQAAHNFDISSYRITVPFAELERLNETVYVKLKLTVYDRELELLISEPM
FT                   PGDQPRPEGFVIDNGFLLTSYSSDWRLRLTYLANAPLVTTFTWSRNHYLWTIKNAKKNI
FT                   IIYNPTNREILKLVKNGNEYSLSKSDANYIGTPGGAGQAWWQFMTTDNTNDYDSFELVR
FT                   MATPTIAEPHTLKKNMTVFHVSNHVATLAVSWQYPLIADAELDDENVTIRFWLDGWARL
FT                   ASSANITFIQDGLDNKYVAKKIEGNFLKRNLWEVQLPLGFGLYAQNRMLHPEVTLTFFQ
FT                   RQPFTMPLRWGKSKFNIFREEHPVGRLTWYFGSDDSEEHRVLTMRQSTNREGFTTMGEK
FT                   VSFWQGKYQEWLQEPIFEKTIMYSSYWGQDFNDNPRALYEYIEKHYPGYQHVVVYSNIL
FT                   QDIELPGVIPVVTGTKKYWYYLAHAKYFVNNVNFEGKERVKRPEQLEIQTMHGTPLKQM
FT                   GFKVLQDWTSASYEQYLEKNRNWDYLTVPSDYVAEIAASAYRHQAKVLNTGYPRNDELF
FT                   VRNNEAEILRIKRAMKVPVDKKLVLYAPTWRKKGERKLGIDFESMYASLRDDLFVLIRP
FT                   HHLSGDIEVPMAYADKMILSDDSFAIDDYYLISDVMITDYSSVMFDYALLNKPMVFFVY
FT                   DFDNYVSSRGLNFDFKADAPGPLVYTQTELEISLQSFEEIPKRYEDKIAIFDTKFIQYD
FT                   DGHASENIFKAVFDPEKS"
FT   CDS_pept        539699..541174
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0532"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91180"
FT                   /protein_id="CBL91180.1"
FT                   /translation="MKTSRRTFYFLVILIAWLPYWWAFFPIIVSYDGAAQLANFFGLSY
FT                   PNNHQPYTAAAIMGVLIKFFMKLTNNNSTWSFALYAGLIGSCSAIVCSRLVVKFGTAFG
FT                   RNIQWLSLLLFALFPLFPFYAFSYDKTAPFLIGIGMSFSALISIAIDKNLNNHLWELAI
FT                   GTVVTSVFRSDGYYVMVIVLLACVVVLRSKQLLLCLISIIVLMTVITKVIFPMAFIAPG
FT                   LPGDSISVPLQQVAYTVKTHEAQLKGSKLYDDLNKIMPLKKITEAYNPNLADYVKFNYG
FT                   NTYNNENKSKKEAFETFLKERSKYGIRNFLKLWLRLGMKYPFDYVKAWIYQVDSYYSPT
FT                   NDNEQEKSSGQLFMNLNQVWVQNRITDVMRQLNFSVDYNGSEFAKKFKNRLLTPLHNNN
FT                   IIYKIFLSAWLYDWLLIISSLILLVKMIRKKVSIVWGLPFLLPLGVLGVAMLTPVDGGM
FT                   RYILPVIMAVPMCIAVIFDTNHLNIKDKNREII"
FT   CDS_pept        541294..542244
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0533"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91181"
FT                   /protein_id="CBL91181.1"
FT                   /translation="MDKLAVLIPAYNEAQTIEKVVKDVLNVTQSINGTVIYVYDNNSKD
FT                   STVELARNAGAVVRHEYAQGKGAVIRRMFREVDAEVYVMIDADDTYPVEAIPEMYDKVK
FT                   SHGVDMVVGDRLSSTYFEENKRPFHNVGNSVVRGLINSLFKTDIKDILTGYRAFSFEFV
FT                   KTFPVLSRGFEIETEMSIHATEKRMLVENQVISYRDRPEGSESKLDTYGDGMRVLKTVL
FT                   NLYRNYHPFAFFGAISTVFILFSLVVFFIRVVQPYAETGLVDNMPTLIVTMILLLIAVI
FT                   SFFSGMILNSVQAKDKRDFELALIEASNRKKELSN"
FT   CDS_pept        542336..545248
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0534"
FT                   /product="putative acyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91182"
FT                   /protein_id="CBL91182.1"
FT                   /translation="MLKRIGEKRINNQKVKLSNIEILRFISILLVILHHVAIHTNWTIG
FT                   LSTNFEFVRDGMILSGKVGVDLFIIISGYLMINSRAKLTSLVRTVSETIVFSIFMYIVA
FT                   IVLKINGTVFSTAYFFKRLFPVIFSDYWFVTAYVFMYILLPIVLPFLSKLTKKDYQRFL
FT                   IIGFLVVSIWPMIALNKGMNFSYVILFLYLFAIGGYIRKYGLRINAIVASIAVILLTAS
FT                   AVLITYAIRMILHAPHNTLYQLFSFLGWSGPNSWGENIIIWFDASPFPLVIAAFIFIGV
FT                   ISLKQYYNNIVNFFGSHVFGAYLFQSAPIFSPWIYVTIINVNRINGTLNRLVFSLGVAI
FT                   LFVFIGIVLHVILEPIANKLSGFLLKIINELSTQCNEFRNSNLGFINLLGPTIIKITFS
FT                   IITAVFAVPGNKVLEIIIVSAILMAMMRSHHIKIGKKLKSINWSVGIIGGALYIVTFLP
FT                   ANYFNTSLISHIGLVLISFGTFSFAIANMLNQLKNEQNQNGEHLGFYDSYWKYILLYST
FT                   VIFIYFIAYYPGIMVVDSVNQWNQIHHAYPWNNWHPIGHTAVLWLTSKIWDNPASFVIL
FT                   QSIVYVTLFSYFATLLKQYSGKKWVGYLFFVLTAIVPFFPLQAMILVKDTLFTYAFVFF
FT                   GLALFQTVRTHGQWLHKPLAFVFTLLSVMGISLWRSNGIPIVIVMCLLTIIILGVKKYW
FT                   RLIIIMVIAIISYFVISGPIITNFHVFEPSKTESYGMLIQVDAGIIHDKGSLNLQQQQY
FT                   FSKLMNNKNIASYQPTNIDAIKFGPGFDAKLLNNDTGKFKKESISLIKSNKIKALKAYK
FT                   AQTAILWNQNAKYRIGTFIRDKYSSFVPVSYFLTGSDIEKYNIKYQMFRYDSYWGGFSK
FT                   LHLILGNWQAMFKIKSVQYWFLPGIYLMMQVIIAGWLVAQGMWRKLLVILPIIGLAATY
FT                   MLAIPVPDIRYVQPILLYVFITILVVKMPNNTVDGSEIKH"
FT   CDS_pept        545355..546329
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0535"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91183"
FT                   /protein_id="CBL91183.1"
FT                   /translation="MTEKTVTAAIVTYNRLELLKESLAAILAQTKYLSHVIIVNNMSTD
FT                   GTTEYLDSLNDERIVVYHATENLGGAGGFNQAVRLFGEQLQDDFVWLMDDDTIPEPDAL
FT                   SHLVAFTLDHPEVGFVNSQVRWGSIDGNPSWMNVTAPRAFTWQRYLIDTEEPAVEVVNS
FT                   TFVSVMFSREMVAMIGLPQKEYFIWGDDMEYTNRIADIKRGYMVMNSIAVHKSKENTKP
FT                   GDIVAEVDDSRLWRYNFEYRNRILTARRISRKEMIKVFSVAILRDLRKTLLKKNVAFRA
FT                   KKLGVITRGLWRGLFFNPTIEYAEGLRQQKIKSLRGAEMDLLD"
FT   CDS_pept        complement(546430..547533)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0536"
FT                   /product="transcriptional regulator, AraC family,"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91184"
FT                   /protein_id="CBL91184.1"
FT                   /translation="MNDIQKLADILNAAVILLNSNTHEANYLNAQPTDTSNHTINFLLA
FT                   NIQLLSNHQYQSLNSPWGHILTCQITNNLIICLSFNYSETSNELMTMHSLSNLKSISQI
FT                   IYKLYNGKDAPDTDVIITKFSDKQLVKIENNQPFDATLFFNAETDIIKAIIYSHNEQLT
FT                   SALEKLSYIKIIGERFANNNYIRGEKDTLISYIAVLNRAIIQWGYPVESAFRLHNDLVQ
FT                   EIELSSQFFDFFQVIREVTWHYFNVIKNYRVTNFLPLHERIRQYVKEHITESMTLDDIA
FT                   TRLNASKKLLNPAFKNEYGITITQFIRQVKIDAAKELLIASDLTLLDISNLLSFSTTTY
FT                   FVKTFKEITGLTPKYFRQHFFDQHLHL"
FT   CDS_pept        547773..552128
FT                   /transl_table=11
FT                   /gene="srr-2"
FT                   /locus_tag="LEGAS_0537"
FT                   /product="Serine-rich repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91185"
FT                   /protein_id="CBL91185.1"
FT                   /translation="MKKRVQKNYRETKLVTRFKMYKDGKNWVTSGVSKLLSWVKSTQDN
FT                   ELSLNSKKSKHTEGTIFKAVASISALIGGSAIVSQEAFADTDNTATEKNIDNVGTVVNK
FT                   DQVVLPNQTVSNQDSVLNKTSTSENKSFSVSSSESVSTSELISDSESISTSESISDSES
FT                   ISTSESINNSESTSESASHTKVASASDSTSNSVPASTSEKTSDTQASAISESASNSESV
FT                   STTELVSSSESISSSSSSNRSATDTPATTRSHTTTYATEANSTGFAVNDPQYPNSMPRN
FT                   SDNVNRYDFEWLTVYNGSTKVGDISISIDRNGSGQLYIQEISTNGTTKNLTLSQSTASI
FT                   SSLSFSGTTYYYDGIDGNYSLVIKRLSGTLKTNYVGFVADSSGNAYGTVTNFVPKNVNQ
FT                   NTTYVDEEGQVINNSDNVTQNGWTGQTYTTSSGHVINGYYSDDVNDNGNGTMSQFGKIG
FT                   AKYEKNYHDGTSVIYTQLDSIGTMQADVYRNGVKSVTYTIPVGQTVQYVNGNTTYNIRN
FT                   PYIQQTQDIQYQYKKLGNLIIKNEDGTIVNETQYVNDSTDAAKAYYPTNTVPDKPGYII
FT                   TAKDSNGNTIDINTIRNGAMPNDLSIDTIVTYEKDPVSISASESISGSESVSTSESISG
FT                   SESASTSESVSGSESISTSESTSGSESVSTSESISGSESVSTSESVSGSESVSTSESVS
FT                   GSESVSTSESVSDSSSVSTSESISGSESASTSESVSGSESVSTSESTSGSESVSTSESA
FT                   SGSESVSTSESVSGSESVSTSESISDSSSASTSESVSGSESVSTSESVSGSESVSTSES
FT                   VSDSSSVSTSESISGSESVSTSESTSGSESVSTSESISGSESVSTSESVSGSESESVST
FT                   SESISDSSSASTSESVSGSESVSTSESVSDSSSVSTSESVSDSSSVSTSESISGSESVS
FT                   TSESISGSESVSTSESISGSESVSTSESISGSESVSTSESISGSESVSTSESTSGSESV
FT                   STSESTSGSESVSTSESISGSESVSTSESVSGSESVSTSESISGSESVSTSESISDSSS
FT                   ASTSESTSGSESVSTSESVSDSSSVSTSESVSGSESVSTSESISGSESVSTSESISGSE
FT                   SVSTSESISGSESVSTSESVSDSSSVSTSESISGSESASTSESVSGSESVSTSESTSGS
FT                   ESVSTSESASGSESVSTSESVSGSESVSTSESISGSESVSTSESESISGSESVSTSEST
FT                   SGSESESVSTSESISDSSSASTSESVSGSESVSTSESVSDSSSVSTSESVSDSSSVSTS
FT                   ESISGSESVSTSESISGSESVSTSESVSGSESASTSESVSGSESVSTSESVSGSESVST
FT                   SESVSGSESVSTSESTSGSESASTSESVSGSESVSTSESMSTSDSTSESMSESLVQSSF
FT                   KTQKVSKDSVLPSTGINSNNSNNISALLGLGVLSTAAIIKKSKKNKNTK"
FT   CDS_pept        552229..553494
FT                   /transl_table=11
FT                   /gene="secY2"
FT                   /locus_tag="LEGAS_0538"
FT                   /product="preprotein translocase, SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91186"
FT                   /db_xref="GOA:D8MEB8"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR014269"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="UniProtKB/Swiss-Prot:D8MEB8"
FT                   /protein_id="CBL91186.1"
FT                   /translation="MKGENINNIHLVLKKMLWTSLIVFIFLIGRNILIPGVDAKQLARF
FT                   LNNQYLLQIVNGTTGGDLSRMSLFALGLGPWMSATILWRVLTLIKRFDLKKIPIERTFL
FT                   FKIAIAIIIGFIQSIAIISNIDINPKISIFAQTQFGAMATISLIMVSGAVFLVWLSNMN
FT                   EILGIGGPTVLILASMIINWPTNVSLYILENVRSSLDINSVILMLVIMISIVFLVLLTV
FT                   VVQRAQRQIPIRRILVNNNFYQQSYLPIQINPAGGMPLMYSMTLLVLPQYILQAVHYWL
FT                   PNNVLVENGLDNIAITKPLGVTAYIIILFALSIGFAFININPDQIAEDLQQNSDYIDNV
FT                   EPGDATREYITEIVFRLSFVGALYMSLIAGFPLYFGIIDKQYTQYALTAGSIIILVNLV
FT                   INIIDQMKALLTKNNYSALFFE"
FT   CDS_pept        553530..555119
FT                   /transl_table=11
FT                   /gene="asp1"
FT                   /locus_tag="LEGAS_0539"
FT                   /product="accessory secretory protein Asp1"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91187"
FT                   /protein_id="CBL91187.1"
FT                   /translation="MFYFVPYWYGESKATTFDDTVNQIRMFEAVHENSETIICEYSPQI
FT                   RCFLHQQNLSLNKYWSVFDMIQNIEDVNNKIVDFNDLSWPIESEFVYTPFRVNVILAGK
FT                   IFANISFGLESQLSSVSYFDDDQISKTLIFDDRGFLSSIIYFSAGKKTVQEYFDVSGIW
FT                   QIRVTYLTESEKIVINPMSYHRFKKNTYHSLNDLIQEMINYHFANESDLKHATLIIAAN
FT                   EKYNQLLLNLSYRPSNLVLSFFKNRYEYKKNEQLLIDELSLADIVIADTIGQLEDIKEI
FT                   VVAKNNSHLVNKLQHITPYDTRFQLGISQQYKELTILLNTQELSKEEIIFVLYTILSCM
FT                   ADNNLIALSITCSEENNAEKIDDYIKQVLVEYYHLDNNVILNDLQMDNTTDENKLGDRD
FT                   NAGDTQQPVGVSLYKRISMHTFPTENDMIQAFENVRLIIDISHRPNIYTQIAGISAGIP
FT                   QINLSASPYIINQQNGLIIQDLSELKKAIDYYLIGLSHWNTALVYAVQQMRQYTNGAIV
FT                   RKWRHILGEENG"
FT   CDS_pept        555112..556653
FT                   /transl_table=11
FT                   /gene="asp2"
FT                   /locus_tag="LEGAS_0540"
FT                   /product="accessory secretory protein Asp2"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91188"
FT                   /protein_id="CBL91188.1"
FT                   /translation="MADKIIRILQVGVTNWATQLNLADQSMDWQFVSNDNVSDYFTKLL
FT                   NNEDGTPLFEAILLTDSDKLDCFEPIFKIANPYTILIDSNQIIENQQLLELLARYQAYK
FT                   IDMSVKEKVVYDLAHYFFVGQYGEKLNINQVQVSPHFNGQIQYNGHVNLLLTGDFGTTL
FT                   TSTLSWQYNIAAKSDHNHELWLEYDTSENVMMALSVQMIESGTSNILKQWIVKGEAMTA
FT                   PLLIESHAKSAYYLAVSLQVQGDGYIKVGNLHNRLARKKFGQFILGGERLIDNKHEEIM
FT                   AYFDPGDMKPPLNVYFSGYRSAEGFEGYWMMKKMGTPFLLITDPRLEGGAFYIGSKEIE
FT                   NNIYQIIQQKMNDLNFTTDQLVLSGLSMGTFGALYYASKLEPHAIIIGKPLVNLGNIAL
FT                   NEKLVRPNIFPTSLDLLLSMTGGNTVKHAEMLNQRFWQQFDQANFNQTLFAIAYMKDDD
FT                   YDSTAYHDLLTSLSHSQAIIISKGIAGRHNDDSAAINNWFFSQYQRILVDEFKRK"
FT   CDS_pept        556661..557656
FT                   /transl_table=11
FT                   /gene="asp3"
FT                   /locus_tag="LEGAS_0541"
FT                   /product="Accessory secretory protein Asp3"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91189"
FT                   /protein_id="CBL91189.1"
FT                   /translation="MVNQNAIIYWQPHIGETYMYGSIINYVTKDHVTFQNDLFSAGSFV
FT                   HTWLSSSSYQVQRSVVALPLLENGIEYQIKMNASVMPENTVYLQFKFYDRYEDMIDSVT
FT                   IKNGVGKFIYPNNAYAYSMALINAGLQELVFHHVEISEAIHEKQLLFDNDGLYISDILN
FT                   NETNSSLLQVLFTEPVVGTIGIVPDNLLNQIPDVVQITSSKLYGGFYMNNQVENDIIAV
FT                   LDQIQKIYEVQSINFIGYGPVSSAAALYYATKVTQSTAYVSSDYGDISLSKNVIYTDGY
FT                   EQFIAAKKNFVNTSKHTYYQVEPLIANLKIVGTLLDKSSRLQSYIDFVGH"
FT   CDS_pept        557667..560039
FT                   /transl_table=11
FT                   /gene="secA2"
FT                   /locus_tag="LEGAS_0542"
FT                   /product="Preprotein translocase, SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91190"
FT                   /protein_id="CBL91190.1"
FT                   /translation="MLTLDNMRLRKTQKILRQVNRLTNVMSKMSDVELKQQTNLLKQQL
FT                   NSGKKLDDILPQAFATIREADKRVLGKFPYDVQVLGGIVLHQGNIAEMKTGEGKTLTAT
FT                   LPIYLNALTGEGVMLITTNSYLAIRDAHELGKVYEWLGLSVAVGVNENPNYNYTVTEKQ
FT                   EIYRADILYTTNDAIGFDYLQENLVASQDKQFLRTFNYAILDEVDAILLDSAQTPLIIS
FT                   GSPRVQSNLFNIADQFVLTLSESTDYALDDEKKHVWLTDQGIEQAKCFFEKPNLFSTDN
FT                   YLLIRHIELALQAKELFKSNHDYVIDKDEIKLLDVKNGRIMAGTKLQSGLHQAIEAKEH
FT                   LNITQQTRAMASITYQNLFRMFKKLAGMTGTGKTNEEEFIETYNMTVIVIPTHRPMIRK
FT                   DLPDKIYVNLPEKLYASMSLVKTCYQKQQPVLLATGSVEISEIYSQMLLREGIPHNVLN
FT                   ARNIAKEAAIIAEAGQLGAVTVATAMAGRGTDIKLGEGVSELGGLAVIGTERMTSKRID
FT                   LQLAGRAGRQGDPGFSQFFVSLEDDIIIKRGSERIHRYYKKFAEQFNVENPHELTQHRF
FT                   KTSVNKAQFSEESQGRVARLNALEFDESMRIQRTLVYEERNKLLRMNRTLEKELLSAAH
FT                   REIDNFLRKNKQLTSNLLKRYILDNINYNFKQSDSILDPDNFHDVASQLLKMVEEELQR
FT                   KREVMASTTQTINFQRVCVLKAIDVGWIEQVDNLQQLRLVVTDRRYSQKNPLYEYQKET
FT                   IISYQKMCKQVDKLVLKNIMLSTIKREKNGELTVSFP"
FT   CDS_pept        560065..561072
FT                   /transl_table=11
FT                   /gene="nss"
FT                   /locus_tag="LEGAS_0543"
FT                   /product="Nucleotide sugar synthetase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91191"
FT                   /protein_id="CBL91191.1"
FT                   /translation="MRTHITNIYGQSSSSTAMIAQNMVTEVAKSLGFNEIGIYSYPIHT
FT                   DTPQEIRKRIDGMLAGVSAHDVVIVQLPSWNGIEFDELFINKLLSYPGIKIAVFIHDVV
FT                   PLMFENNYYLMQRSINLYNKAVTLIVPSKAMANRLKSEGLVMDHIVIQQLWDHATSLMP
FT                   AAPKFEPLINFAGSVTRFPFVKSWHNDTKLQVFSQYDEKNLNERVSYQGWLPDNEILRH
FT                   LNRGFGLVWSENTKNQFEREYSKINLSYKLSTYLASGLPVIVNQGISNQKFIEDNNIGI
FT                   VVPSLSEVDQRIKNITKAQYNDMAENVKRVGYLIRQGYFTKKILIDTMHQILSY"
FT   CDS_pept        561087..562595
FT                   /transl_table=11
FT                   /gene="gtfA"
FT                   /locus_tag="LEGAS_0544"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91192"
FT                   /protein_id="CBL91192.1"
FT                   /translation="MTIYSFNLGIGWASSGVEYAQLYRAQIFRNLKQKAKFVFLDLITG
FT                   DNIEHLTHNIGFTDDEIIWIYQYFSDIKIEPTSYSLKQLENSFSLSFDRIEQNTGYVRY
FT                   IFDKANVMVTAYFAKKNKNVVERAEYVSRGKLIRKDYYTHTKLFSEYYTPRDNRAYVYE
FT                   RRFFNQDGSIALEEIVDGESSMFRLKNQVIQGKNGLIAYFLKSLNLTKTDIIILDRATN
FT                   IGSTIFKYSAPAKLGVVVHAEHFNDNQTDEQNVLWNNFYEYQFDQVKNVDFLITATQSQ
FT                   EEVLRRHFDQYTAYTPNIVTIPVGNLDKLHIPLKARKTHSLITASRLANEKHVDWLVSA
FT                   VIKAKEVVPDITFDIYGKGGEEQKIRKIINDNHAQDYIKLMGHSELTQVYQKYDAYISA
FT                   STSEGFGLTLMEAVGSGLPIIGFDVRYGNQTFIQNKKNGYLITYDKSDDISIIISKLTH
FT                   DIIVLYTEHHLADFEQQSYNIAKDYLIDEVQQKWQNLIERALND"
FT   CDS_pept        562588..563916
FT                   /transl_table=11
FT                   /gene="gtfB"
FT                   /locus_tag="LEGAS_0545"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91193"
FT                   /protein_id="CBL91193.1"
FT                   /translation="MINLFDRYTQSSRDLHDSLKAAGYDQATVVVTEDGFLPDHVSSPF
FT                   SYYTKIYEQVGRPLYFNQVDCPNFWEIRGNNHDATIYDEDKKMANIIYVPNLAHKRYVQ
FT                   KVEWLDLNGHIRSVDHYSKNGNKFAHTNYNIMNQPTITTYYSVDNHEIIVENHITKDII
FT                   LNLNQQVYIFKSRADFVTYYLKSVYGNDMNRILYNSLSVPFLVSYQLEQPGDDLLFWQE
FT                   PLAQDMILPGNMINLLEHHGRTQKIIFQNKIDYNKVQNKYPHLAHQLSYVGYIYPINKH
FT                   DQDPNEALILTNSDDIEQITQIVEALPSVNFNIGALTEMSSKLMRLMKYQNVTLYPNIE
FT                   YHVIDELLTTCAFYLDINHDMEIMSAVRRAFLNNLLILTFDNTSHNQEFTLPEHIFTTN
FT                   NSSELVNSVLKYMSNRQMLSDALILQQNHANQSSIDDYQNIIN"
FT   CDS_pept        563935..564144
FT                   /transl_table=11
FT                   /gene="asp4"
FT                   /locus_tag="LEGAS_0546"
FT                   /product="Accessory secretory protein Asp4"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91194"
FT                   /protein_id="CBL91194.1"
FT                   /translation="MNEKDDNKQFQQDPVQREINERLKYARYKVPNQKKVRHKYENMQT
FT                   LLAGIMALGILFGLIAIIIQLFMK"
FT   CDS_pept        564225..565082
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0547"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91195"
FT                   /protein_id="CBL91195.1"
FT                   /translation="MKKAIFYTYSGEYEWLVAVSIQSIIDHYISEETIDILVFTDKTFE
FT                   TQQATIKKLPCLSGKPQIKISFWRFPNWINRITNNVSERFPAVTFLRLGIPIEFQEFDK
FT                   MLYLDADTLIYTDIHHVFNQLKTETIAGVLDIFHYLNTADDQILKQYNDTYNIVDSSKY
FT                   INSGVLLYNNKQYAQHWTIDELVNNINDGQFSHFPDQELINQKFNPNILILPHEYNYQE
FT                   NISFLDHWQVPEKYKESLTLSEKNVRIKHFLPLPKPSSPLIGYRDQFDIDWWQMAMRLK
FT                   EILS"
FT   CDS_pept        complement(565158..565655)
FT                   /transl_table=11
FT                   /gene="speG"
FT                   /locus_tag="LEGAS_0548"
FT                   /product="spermidine N(1)-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91196"
FT                   /protein_id="CBL91196.1"
FT                   /translation="MKIRPLEKKDLPYIYQQENSRKVMALWFQEAYTSFDELELLYERH
FT                   VLDQTERRFVVEDDKQFIGVVELMYIDGLHRHTEIQIIIHPDHQGNGYAQMAIKAGTEY
FT                   AFKVLNMHKVYLYVDVDNDAAIHIYKKIGFIEEGILRGHFFAEGKYHDSMMMGMLVTEF
FT                   IS"
FT   CDS_pept        complement(565686..566654)
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="LEGAS_0549"
FT                   /product="Thymidylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91197"
FT                   /protein_id="CBL91197.1"
FT                   /translation="MSKNEQQYLDLAKKVLDEGTQKGDRTGTGTHSLFGTQMRFDLQEG
FT                   FPLLTTKKVYFGLIKSELLWFLRGDNNIRFLLQHNNHIWDEWAFKNWIESDQYTGPDMT
FT                   NFGHRAQKDTAFALAYKEQKDIFVDKILNDDEFMETFGYVGDVYGKLWRNWETSSLTAD
FT                   TDTIDQVSRLVEQIKTNPDSRRLILTAWNAEKTPQAPLPSCHVLSQFYVADGKLSVQLY
FT                   QRSGDFFLGVPFNIASYSLLLHMVAAQTGYEVGDFVHTIGDTHIYNNHTEQITEQLSRP
FT                   MHKLPKLWLNPEVKSLFDYTMDDIKVLDYESEPAIKAPVAV"
FT   CDS_pept        complement(566929..567411)
FT                   /transl_table=11
FT                   /gene="comEB"
FT                   /locus_tag="LEGAS_0550"
FT                   /product="ComE operon protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91198"
FT                   /protein_id="CBL91198.1"
FT                   /translation="MSYNRISWDQYFIAQAAILSTRSTCTRLHVGAVIVQNNRIISSGY
FT                   NGSVSGTPHCTDVGDLIVDGHCIRAVHAEQNALMQAAQMGISVDGAEVYVTDVPCVHCT
FT                   KLLLQAGIQKINFMRDYHNDSFAEELLAQKHVILKQVPFSEQTASQIDLHQFISYE"
FT   CDS_pept        567484..568326
FT                   /transl_table=11
FT                   /gene="folD"
FT                   /locus_tag="LEGAS_0551"
FT                   /product="FolD bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91199"
FT                   /protein_id="CBL91199.1"
FT                   /translation="MTEILDGAAVAKITNEKTAERVSRLNKPVTLAVIYDPKNDGSRLY
FT                   VGMKSKKAAALGITTLDIPTDENATTASVIKLVEELNADEHVTGILVQSPLAKGVKERE
FT                   IFSAVAPHKDADGLGATVQGMLFGDALEDYTVAATPQGVMTLLHHYNIEMFRKSAVVIG
FT                   RSQLFGRPMFALLTNADATVTLAHRYTPEAMLKAQLKMADIVVVGVGIPHFISGADLKS
FT                   GAVVVDVGMNYVNGKAVGDVDFESAQGVASYITPVPGGVGPMTIATLLENTVSLAEKY"
FT   CDS_pept        complement(568689..569234)
FT                   /transl_table=11
FT                   /gene="bioY2"
FT                   /locus_tag="LEGAS_0552"
FT                   /product="BioY, a putative biotin permease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91200"
FT                   /protein_id="CBL91200.1"
FT                   /translation="MKTQKLTFTVVMIALLVVMAYVPTIPLGIVPITIQNIGIMLAGAL
FT                   LGWRNGFLAIIVWLFLAAIGLPVLTGGAGGLPAFFSATAGYLWAYPFAALLIGLTITYL
FT                   DHLNYTNFFTMFLTILIFGVVLIDISGAFGLHIVTHMPLTKALTFQLAFIPGDIIKAVI
FT                   ATIITLTLRRRFRILYHV"
FT   CDS_pept        complement(569350..569967)
FT                   /transl_table=11
FT                   /gene="busR"
FT                   /locus_tag="LEGAS_0553"
FT                   /product="transcriptional repressor BusR"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91201"
FT                   /protein_id="CBL91201.1"
FT                   /translation="MQTIREPRYRKIAYQIAQKIADNEYAVGSKLHARSTLSVAFGVSS
FT                   ETARKAVSILADLQIVKLIHGSGVEVLSREKAKAFLNQAQTTSDIQTIHKQINDLITNQ
FT                   KQEIKSMENALTLLLEQSQRVQRHSPLSPYELALSDDSPKFGQSIGTLTLWQSTGTTIV
FT                   ALLHDDELVVSPGPYAVIERGDTLYFVGNETAVQAVQNFFYH"
FT   CDS_pept        570170..571363
FT                   /transl_table=11
FT                   /gene="busAA"
FT                   /locus_tag="LEGAS_0554"
FT                   /product="glycine betaine transport ATP-binding protein
FT                   opuAA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91202"
FT                   /protein_id="CBL91202.1"
FT                   /translation="MAKVEIKHLTKIFGKRPKAALKMVKQHKSKDEIVEKTGSTVGVYD
FT                   INMSIDEGEIFVIMGLSGSGKSTLIRLLNRLIEPTQGQLFIDGEEITKFNKKQMLEIRR
FT                   QKMSMVFQNFGLFPHRTLLENTEYGLEIQGVNKEERRKRAEHALDNAKLLSYKDQYPSQ
FT                   LSGGMQQRVGLARALTNDPDILLMDEAFSALDPLVRGEMQDELLELQANVQKTIIFITH
FT                   DLNEALHIGDHIAIMKDGELQQIGTGEEILTHPANEYVKSFIGGVDRSKVLTAESIMIP
FT                   ALTTNIDVDGPTVALRKMADEEVSGLVAVNRKREMLGYLSSDEAAKARRNQTPLSQAVM
FT                   QMPTVDLDTLVADIMPIIYDAQTPVAVVDANKHARGVIIRGSVLEALADTEGDETDA"
FT   CDS_pept        571356..573062
FT                   /transl_table=11
FT                   /gene="busAB"
FT                   /locus_tag="LEGAS_0555"
FT                   /product="OpuABC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91203"
FT                   /protein_id="CBL91203.1"
FT                   /translation="MPNLPKVPLESWISEGVNWLTTHLSGLFNLMQRSGQSIMDGLTNG
FT                   LTAIPMPLMIAGLTVIAILTTPKKYGFPLFTLIGLALIANQNLWSDLMSTVTLVIMASV
FT                   ISLVIGIPLGIITAKSPKTAAIVKPILDFMQTMPGFVYLIPAVAFFGIGVVPGVFASII
FT                   FALPPMVRMTDLGIRQVPVALVEAADSFGSTTWQKLIKLELPNARNTILAGANQTIMLA
FT                   LSMVVTASMIGAPGLGRGVLSAVQRADVGSGFVNGLGLVILAIIIDRFTQKLNTKPGQK
FT                   VATRPWRRWAILATALIMIGGGVVNAVTSQKSSGQKVNLGYVSWDSEVASTNVLAESLR
FT                   QHGYDVTMTPLDNAVLWQSLANGQVDASVSAWLPYTHKALYDRYKNDISLLGPNLHGAK
FT                   TGFVVPDYMKVNSIADLTNEANKTVTGIEPGAGEMITAQKTLDSYSNLKGWNLLSASSG
FT                   AMATALDKAYKTKQDIVVTGWSPHWMFSKYKLKYLQDPKGTMGKNESINTITRKDLKKD
FT                   NPKFEKVMDKFNWTKEDMESVMLDIQNGAKPKQAATKWLKSHQKLADSWYK"
FT   CDS_pept        complement(573278..575206)
FT                   /transl_table=11
FT                   /gene="lacS"
FT                   /locus_tag="LEGAS_0556"
FT                   /product="lactose permease (Lactose-proton symporter)
FT                   (Lactose transportprotein)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91204"
FT                   /protein_id="CBL91204.1"
FT                   /translation="MKSNKQSMSSRMSYAFGAFGNDVFFATLSTYFIMFVTTHLFNSGN
FT                   AAQNDRMISIITLVIFLLRFVELAIDPFIGNAIDNTVSRWGKFKPWVVIGGTVGSIALV
FT                   ILFTNMGGLNKSNPIVYLVLFALIYITMDIFYSFKDIGFWSMIPALTFDSREREKTATF
FT                   ARIGSTLGANLVGVVVMPLVLFFSLNRNGGTGDTRGWFWFAVIVAGVAWISSIVVGIGT
FT                   KEVDSDLRKNKEKTSFKNVMHILTHNDQLMWIALAYGLYTTGITLVNSLELYYFTFILG
FT                   NASAFTIFAGINVFTGLISVALFPKLADKLNRRSLFFWCILTMTVGIILFVIAGTSLPL
FT                   VILAAQLFAIPQPLVFLVVLMTISDSVEYGQLKLGHRDESLTLSVRPLLDKLAGAISNG
FT                   VVGLTAVAAGMTTGATAASITGSGQLIFKVIMFGVPFVVIILGTFVFYKKVTLTEKKHA
FT                   EIVDQLEKTWGKEFVVSSSDNDIIVPKLAIGQSTFNAPIAGKLIALSDVKDKTFSSGSL
FT                   GDGFGIIPSDGRVYAPFDGIVRVAFSTRHAVGLVSDSGVVTLIHIGIGTVAMRGTGFIT
FT                   YFERGQHVKKGDLLIEFWDKSIKDAGFDDTVIVTITNSTALSSLEHTKKSGSIVDKNDI
FT                   ILHLSKD"
FT   CDS_pept        575393..576403
FT                   /transl_table=11
FT                   /gene="galR1"
FT                   /locus_tag="LEGAS_0557"
FT                   /product="Galactose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91205"
FT                   /protein_id="CBL91205.1"
FT                   /translation="MVTIKQIATATGVSSSTVSRVLNSDMTLSVSDNTRQKVIDTAKQL
FT                   NYIKKAKKNEKQKAIHICVLTVFSESREARDTYWRQIYMGIEKAAYQSGVLIDEIIRID
FT                   QGVDAMLLGNFDAVIILGNISEEAITKIREINHNIVLVDSTVHYDDVTAVNPELSQMTY
FT                   RILDELYGNGRRHIGFIGGDNDVLELDGTSKSKINDPRFDSYHEWMSLKQLQPQSFIGD
FT                   WRPETGSQGTVKLLADGNIIDALVVASDPIAIGAISILKNYGLEPGKDIDIVSFDNLDI
FT                   VAYIIPPLTTVELSPLALGKTALAQAIELSSAAHDWTNWTTIPSSLKYRETFKLK"
FT   CDS_pept        576609..577799
FT                   /transl_table=11
FT                   /gene="galK"
FT                   /locus_tag="LEGAS_0558"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91206"
FT                   /protein_id="CBL91206.1"
FT                   /translation="MTNVYEKLSQVFVNKFNHMPSDKFFSPGRINLIGEHTDYNGGHVF
FT                   PASITLGTYGVASARSDKQVKLYSTNFVEQGVISFDIDDETKMSNASWGNFVKGVLQAM
FT                   KGYGNHFTYGFELVIEGDIPNGSGLSSSSSLELLIGVMAQKLYNLKIPRLQLVACGQRA
FT                   ENDFVGVNTGIMDQFAIGFGEKEHAIYLDTNTMIYEMVPIHLGEYVVVIMNTNKRRELA
FT                   ESKYNERVRETQEAVYQLQNHLDIQFLGELDDKTFEKNAHFITDETVLKRARHAVSENE
FT                   RTEVAVKALKANDLVAFGQLMNASHRSLKEDYEVTGIELDTLAETAQGISGVLGARMTG
FT                   AGFGGCAIALVHHNSVDELEKIVGEKYESVVGYAPSFYVANIGDGAHWVGAIQEDK"
FT   CDS_pept        577799..579304
FT                   /transl_table=11
FT                   /gene="galT"
FT                   /locus_tag="LEGAS_0559"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91207"
FT                   /protein_id="CBL91207.1"
FT                   /translation="MNSSALVNIFAKRVIEATDYLDDDKVYLINQILGIVGESSYMVAP
FT                   EDSDLEKLSTLDILDQLIMLSKNNGTLANRQMNEDMLGAQLMNLFVPRPSQVNKLFWTY
FT                   YQVSPESATNYLFELSKRSNYIKTREISQNISFPAPTNYGELQITINLSKPEKDPKAIA
FT                   AAAAMSHESNQKLQYPASQLARENEGYWGRLDYAARTNHRVVPLTLGGETWYFQYSPYA
FT                   YFNEHAIVLSQTIRPMHIDEENMARLLEFVTQFPDYFIGSNADLPIVGGSILSHDHFQA
FT                   GRYELPMAKAAIKQKIHIANVTLDEAGVLNWPMTAIRLIDKNKNKLLKAAMHVIKIWHV
FT                   YDDTSLSIQSYDENGTPHHTVTPIVRYRHDRYEIDLVLRDNNVSDAFPDGIFHPHPDVQ
FT                   HIKKENIGLIEVMGLAILPPRLKKELVAVEDFLLEKVDHVASKHQAWADQLLVSHEVNT
FT                   ENVENIVQQSVGQIFKRVLEDAGIFKSNDIGQQGLQKFIHEIE"
FT   CDS_pept        579388..580425
FT                   /transl_table=11
FT                   /gene="galM"
FT                   /locus_tag="LEGAS_0560"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91208"
FT                   /protein_id="CBL91208.1"
FT                   /translation="MNIIESAFGDHAKLFTMVNDNGVQLAVTDFGARIVHLNVPINNER
FT                   RELILGFDSAEEYIAKDHYIGATIGRVAGRIANGSFQLNQTNYQVVKNENDNTLHGGPD
FT                   SFEMAYWQSETDISDNKVSTSFTHTSPNQNNGFPGNLTVKVTYTLDNDNVWQVSYEANS
FT                   DAMTLFNPTNHVYFNLTGHPGMSVADHMLSIDADHFAPLDDQNLTTGEQRDVAQTAFDF
FT                   RKAKKVNEALISADPQNQLVSGLDHPFLLNQATDSASPQARLVSPDQKVAINMRTTAPS
FT                   VVVFTANFGDDYQLPMRQEQLINHGGITLETQVAPGAEKYPAFGNIVLPANEVYQATTR
FT                   FDIDI"
FT   CDS_pept        580456..583554
FT                   /transl_table=11
FT                   /gene="lacZ"
FT                   /locus_tag="LEGAS_0561"
FT                   /product="beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91209"
FT                   /protein_id="CBL91209.1"
FT                   /translation="MATIENVLYRRDWENPTVTNWHRLPIHTDMSYGLDLALQVANESQ
FT                   RQSLNGDWQFSYFSNQSVVDEAWRTNDLPQANSIQVPGNWQLQGNYDVPVYTNVDYPFT
FT                   VNPPYVPEDNSMGGYSKEFEVPDSWFETDHEVHIVLNGVSSAFYLWLNGEWIGYSEDSR
FT                   LPAEFDLTDKLIHGQNRLAVLVLKWSKASYFEDQDMWRMSGIFRDVDLIKVPKVRFKNF
FT                   TIQTQLDDDLDSAVFETKAEVLTSGRNDLKVTTNLYWQAKKIDTTTSKLGSQIVDERGA
FT                   NDSEVTLKLPVKNPKLWSAEIPHLYTMQIILHDDTQIYQVENKAIGIRKIQIKDGLLML
FT                   NNQPLMIRGVNKHEFTADKGYYVDDDTMISDIRMMKEHNFNAVRLSHYPNASRWYELCD
FT                   QYGLYVVDETNIETHGVTPMNRLTNDSQYLPLMMTRVTRMVQRDFNHASIIIWSLGNES
FT                   GYGHNHDAMYNWVKQTDPSRPVQYEGGGADTSVTDIIVPMYARVDQDQIEPVNSKWSIK
FT                   KWISLPGETRPLILCEYAHSMGNSLGGFNKYWQAFEQFPKLQGGFIWDWVDQGLLKKTA
FT                   NGETTYAYGGDFGDYPNDRQFSLDGLLFPDRTPKPALLEAAYCQQYFSFQLDKTSRGEI
FT                   NTLTVTSKHLFKTVNDATLICDWINGDDVIKTQRVNLNLPAGGSQRIVLDVPEFNDDDV
FT                   FLNVKILQRENDGIIRAKTRLAYHQFIIQNQVPQSLKTVTPELNNTKCIVSEKDEAIVI
FT                   VANNNQFTFNRVNGLLTSWQFESKENLLTPLKDQFSRAPLDNDIGVSEATKIDPNAWKE
FT                   KWQAAGVNELVSQLTHFDYQSVGQNIEVKTQHKFFSPIDQHLMFISNKRYQITLTGTLA
FT                   ISVDVWRQIADPEPARIGLTVQLNALPKIVDYDGLGPMENYSDRNSASIMGRWSMPLSD
FT                   LYTPYIFPSENGLRTQVKRLTFDHHVLESNQQKFAFNMSQYSPDQLASATHRHLLKPEK
FT                   GVWLNIDGFHMGIGGDDSWSPSVAPEFLLPDTNYHYQLTWCCE"
FT   CDS_pept        583584..584588
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0562"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91210"
FT                   /protein_id="CBL91210.1"
FT                   /translation="MYNANKNRYEGMIYNRVGKSGLKISALGLGFWHNFGSVDPYENQK
FT                   AIVHQAFDLGITYFDLANNYGPIPGSAEENFGRMMSQDMKPYRDEMVITSKAGYDMWDG
FT                   PYGSWGSRKSIIASANQSLTRLGLDYVDIFYSHRPDPETPTEETALALDQLVREGKTLY
FT                   VGISNYNGAQTTEIAKIFKKLGTPFIIHQPRYSMFDRHIERDLLPVLKQEEKSAVVYSP
FT                   LAQGLLTDRYLNGIPADSRAAKSSSPFLKVGQVEKTLNSVKQLNKIAIGRGQTLAEMAL
FT                   AWDLRQPEIASVLVGASRPEQLVDNIKALKTLNFSDADEKAIDAILIAHEKND"
FT   CDS_pept        complement(584646..585107)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0563"
FT                   /product="Putative substrate binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91211"
FT                   /protein_id="CBL91211.1"
FT                   /translation="MDNTPFFLTNHKWYKYEERETADGVSFQRFELTNKATPEAIKSFK
FT                   ETIIASGPDARLDPEDLNRFQQALGFAARQHLFSEDHGLHGTALTDELRFISYTIRLYQ
FT                   LLDDDLVAPNTLIFSKRIGTLYRQFLKIHPTRINDSMLNSWIIAQDTKI"
FT   CDS_pept        complement(585138..586367)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0564"
FT                   /product="ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91212"
FT                   /protein_id="CBL91212.1"
FT                   /translation="MNSGLIIVMKQTFRSHFKTRGYWLLVLSPIIFAVVVGGIIFGVTQ
FT                   MQGNTTPTVAVIGNSQVRQVFIRDEKALGIKVSKITDSQKANRSLTAQDLDGILTLNSE
FT                   NATLTTQPKSNTINKEAFVSVLGNISRSQKAASYGLTAKQTQDLIQPFNLKSVVKQSNN
FT                   KSTNGENSDTANYGIAVAIGIITTVIVMWYASMIATEIANEKSSRIMETLLAATSASIQ
FT                   YFGKMIGIFALAVTHLLIYIIAGAIGYVILQNNTMLDGIKQTFSGVTLGFTLYAIAFIL
FT                   IAVALYLVLTAMIASLINDNAQVQQAIQPITFLATIGYMFSFIMTNMPNNFAIKILSYV
FT                   PFISQSMMPVRLVTKVETWPAAILSLVISFIALIILAWFGKNIYAKNVLSYSDDKIMSQ
FT                   LIKNIKNIKN"
FT   CDS_pept        complement(586364..587254)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0565"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91213"
FT                   /protein_id="CBL91213.1"
FT                   /translation="MIQLTNLNKQFGQTIAVNDMNMTLEPGKVMGLIGQNGAGKTTTFR
FT                   LILNFIAPTSGDISWNGHPITQSDKQKIGFLPEERGLYQKLTIEEQILYFSELHGMTRS
FT                   DAKIALADWLKRLDVVGKATDKVQSLSKGNAQKIQMIAALIFNPEFIILDEPFSGLDPV
FT                   NTSIMMNEIVRMRDNGAMIIFSSHDMNNVTKISDNLTMLKQGKIVLQGGVQEIREQFGR
FT                   TKVYIEGPFSKAELASIAGVTHINQQGAGFDITITDEAIGHQIFDFVTRNGYIPAFSQQ
FT                   PPTLDDIFRQEVALS"
FT   CDS_pept        complement(587318..587527)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0566"
FT                   /product="Transcriptional regulator, XRE family,putative."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91214"
FT                   /protein_id="CBL91214.1"
FT                   /translation="MKNRIQELRKSRHMTQAELADKLEVTRQTIISLEKGKYNASLTLA
FT                   HNIASFFQLTIETVFIFEEDKTDV"
FT   CDS_pept        587679..587888
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0567"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91215"
FT                   /protein_id="CBL91215.1"
FT                   /translation="MADEKYQTLDLPMNEVFDWSEDKTPLRDALWNHYMDESNKNTSAT
FT                   LKHLKAYQTMSSDEIKTEAEKILK"
FT   tRNA            587977..588051
FT                   /locus_tag="LEGAS_R0011"
FT                   /product="tRNA-Glu"
FT   CDS_pept        588519..588779
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0568"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91216"
FT                   /protein_id="CBL91216.1"
FT                   /translation="MAEVEPRYKQDIADITFCLSVIKPEHSEVIKRYYSDKFITWEEVV
FT                   SEAGKSHSSLRTWRNDFKTLLNVMTHHGDEFIELRHEALQV"
FT   CDS_pept        complement(590111..591181)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0569"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91217"
FT                   /protein_id="CBL91217.1"
FT                   /translation="MSKEFEYKNLIAFHPGTYVEELVNDLNITQSEFAERLGTSAKTVS
FT                   KIINGEDRISRELASKLSKLSGISVKTWLNLQANYDAKVIEITENMSNDESKIASLIDI
FT                   SSLKKNKFIEKKRYKLEEKIAMLRKLLNWENIANLAEFNTSISYRRSENINERSIVNSN
FT                   VMLELASNQARSVSSKPYNKKDLEKQLPLIKNMVTQQPNDFFQSLKVKLQEAGIILIAM
FT                   PAFQGAGLNGATKKFKDGSVLLTITDKNKDSDIFWFSLLHEIGHIYHEDFSSNFKDDEY
FT                   EEKEQKANIFAANFLISESEYIKFIAKNDFTEYSICKFAKENNTLPGIVVGRLQNDRYI
FT                   EYKDFYYLKEQYSITN"
FT   CDS_pept        complement(591667..592488)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0570"
FT                   /product="Hydrolase, HAD superfamily, Cof subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91218"
FT                   /protein_id="CBL91218.1"
FT                   /translation="MTKLIVTDMDGTFLNDHHNFDTKMFEVILELCQKKNVQFAVASGS
FT                   QYMRLVKQFEKYQTHINFICQNGASVYIGNRLLYSEKLTHEELKSLDNILSDQTVTTHL
FT                   KQKLYLGQEGAYFLSHNGEALVEANKYFPLLHVIGKINDIEELYNDNVLGMAVIGNGSI
FT                   TNKTLSRMIQNIIPNSFSCLGSGFDFYLIQHDNVDKVVGVKNLQEYFNVKPDDTIVFGN
FT                   NYNDLKMLESTPHSFIMSNSPDDMKSMFNILDFSNNQNGVQKKILSYLENL"
FT   CDS_pept        complement(592638..592790)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0571"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91219"
FT                   /protein_id="CBL91219.1"
FT                   /translation="MKPLLMMSLLFFILGITFLVLSKNENNKIYQFSGFSFLITGIIVA
FT                   TAQLI"
FT   CDS_pept        complement(593128..593592)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0572"
FT                   /product="transcriptional repressor of pbsx genes,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91220"
FT                   /protein_id="CBL91220.1"
FT                   /translation="MSITAQRIKQLRKIYGLTQKDLADKINSSRTNVARIETDKVHPSY
FT                   PMLSTIANAFDVPIEYLQGIVNADIDNNHENVLYFYDDGEQLDPNMSFYAHNEKELHEL
FT                   WDDTDETVTKLLLPNGDVFIESITADELRSLDKYATFLKWQRNNSDTSHN"
FT   CDS_pept        593822..594088
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0573"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91221"
FT                   /protein_id="CBL91221.1"
FT                   /translation="MTVSNALFIEAQVIKDTNSALEDIQETLALSLGDSLKAGDHITTP
FT                   TVINMLKDLEDMQLKYYDRLEDNENTQGALENQEQSGDEETAE"
FT   CDS_pept        594085..594348
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0574"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91222"
FT                   /protein_id="CBL91222.1"
FT                   /translation="MKIPRSEQETIVIYDVEVGKWHIDTTYPPHIRKYTPAMGEIEEKT
FT                   QDRLAGLISDEFSGSFMTRKRKTLTDEQRQKVVEQLRKGQEQ"
FT   CDS_pept        594345..594458
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0575"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91223"
FT                   /protein_id="CBL91223.1"
FT                   /translation="MSITIWLGQVITIIVLVGGAFVAGMVVGGSHKGGGKA"
FT   CDS_pept        594455..594616
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91224"
FT                   /protein_id="CBL91224.1"
FT                   /translation="MNLYIKTLNKLFETLPSIADSEAIKGHDKARAEIMTAYEHLDKAM
FT                   TRLVIDNV"
FT   CDS_pept        594627..594893
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0577"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91225"
FT                   /protein_id="CBL91225.1"
FT                   /translation="MPVSNDELMEELAEMNFQMLQGIGDVKDTLDQRHHVWKRAENVAK
FT                   HFDVSLGTVKSWKRRGLITGYKHDKIVIYDVLVIERDLFQVEN"
FT   CDS_pept        595011..595187
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0578"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91226"
FT                   /protein_id="CBL91226.1"
FT                   /translation="MDKNKKHTFTLSVEEINRINLKAGETLLVIDSETSTVKPANEEHF
FT                   HEWLKNLHWGGEQ"
FT   CDS_pept        595184..595504
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0579"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91227"
FT                   /protein_id="CBL91227.1"
FT                   /translation="MKNVTQLSDIERQFLSALPDGRDNAVTLLKLSRTLHIGKHQASEV
FT                   VARLRNAGYLVGSSKSRPNGVYFIITAQEFWETVNTIKKSIQSQQTTLDALMNHEERFT
FT                   RE"
FT   CDS_pept        595895..596713
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0580"
FT                   /product="prophage Lp4 protein 7, DNA replication"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91228"
FT                   /protein_id="CBL91228.1"
FT                   /translation="MNRWEHVRQYQQAGAYVFMALPNQKHNGIAGGFHNSFSNGDELEQ
FT                   WITQYQAYRFGNIGIDLSKSNLVVVDIDKHGQNGMASILAWFKSHNVNPDTLQDTYVEQ
FT                   TPTGGLHAFYLIPSGQDKPKHIINAIKGVDVLSNTAVMTAPSTMNGGQYRQITPFDKIK
FT                   PVPTWVYDLANGLGTDRPNNVYRAKYSLADRWKMTINGFETGERNNQAMSLAGYLFAID
FT                   VTPQDIYDIMQSVNERSNEPLPDHELNTVYMSARSREEKKRARMNDYGRD"
FT   CDS_pept        596700..598103
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0581"
FT                   /product="poxvirus D5 protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91229"
FT                   /protein_id="CBL91229.1"
FT                   /translation="MAEIDTTALPKKSSHIPSWLDVQYNETGEISKTTVNVERLAEFVA
FT                   KETHFYTDNNNLAGYLFNGQYWKRYKNVKQADNALSSRVATLLKQNKKLTSAKQVKNIV
FT                   DLIRVITVKDVADYIDFTDKPYMVSFTNGTLDMRTLEIKPNAPQYHALGGLDYPVSDKD
FT                   LPTPKTDEFFTRLLGDENAELLYKFIGYGFKRNYLPFQNFVILYGKGGNGKGTALTYIG
FT                   QKLYSGNVSELSLQAFGDKFKTVGLVGKYANIGSDIPANYMPNTENLKLAVSGKEKFEV
FT                   ESKGVQAFSIVNYATLFFSANDLPNIRRDSGLDRRPLVLTTQGKGFTNADGKSDLFDES
FT                   ELLDERPAFTRKVIKMFMDAERARTLNIPENVQKATADWLKSADIVSQWLDEHTEEEKD
FT                   RRPTAKYMYQQFSRDIEDMGMQETINRNTFYSRMENLGVKSSKSVTISSLDDEHGKSTK
FT                   RFLDIKYVD"
FT   CDS_pept        598372..598530
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0582"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91230"
FT                   /protein_id="CBL91230.1"
FT                   /translation="MDTDFYDKCMSSYEALMDNKTEDISISFGEFCQIEAIKQGLEKLS
FT                   VTIWRSH"
FT   CDS_pept        598541..598912
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0583"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0583"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91231"
FT                   /protein_id="CBL91231.1"
FT                   /translation="MNYIVGFIFIALVGYIFEQHRRIHYLVKRNIEQENLKVIQDHQYD
FT                   TLKHLTNMLDNTLKALGYDYRQFYKNNFVKHELTPEQIQQLWQGQQREIKQSDNEVTRF
FT                   DVELNKGGLYDWWHSFRDR"
FT   CDS_pept        599020..599424
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0584"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0584"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91232"
FT                   /protein_id="CBL91232.1"
FT                   /translation="MNINDLMSRFTRPEKTYAEKESTMFYVYVFNLVMDELIRRKLTNR
FT                   RAINYVLSFTTHGNKTRAYQETHPMASKRTANVNANKYHKRFDVYVAQSISMHLVYKGR
FT                   LALAMAIKDINVHGIERYVNKLILEVWKGE"
FT   CDS_pept        599425..599625
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0585"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91233"
FT                   /protein_id="CBL91233.1"
FT                   /translation="MTASNNHPQQWPQWMNRSKAHQYISVADNTFIKRYVKTGKVKAYP
FT                   TEHGTRYNRDEIDEAVRHYYD"
FT   CDS_pept        599746..600867
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0586"
FT                   /product="prophage Lp3 protein 1, integrase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91234"
FT                   /protein_id="CBL91234.1"
FT                   /translation="MKVQKIETSKGKTWEVDGYLINGGQKVRVKKRGFDSKRTAQQWFN
FT                   NETVLFDNGESRYNKKTTPNNMTVKELYDIWLETYQHSVEESTLGKTMTIFRLHVLPTW
FT                   RDTLLTDIKPLDLQRYINTLQRDMQMYKKVTGYFRRLLDVAVKMDVIAVNPFTKIDLPR
FT                   ERKVINKPKQFMDVDEFKAFIAVLDSRYSQINLQAYTLLRLGAFTGMRTEELLALQWRH
FT                   IDFDNGYVSITQALGRGLGGSTYIKEPKSRTSKRTLKIDNKMLSVMSSWYDTTKYNRDD
FT                   NFVFTHGGHTLQPLRPNKWLHDVSDRYGVAVGLSMHKLRHTWATLALDQGATVKQVQTY
FT                   LGHADASITLNVYSDITKRASDEAGNILAKISI"
FT   CDS_pept        601412..601606
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0587"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91235"
FT                   /protein_id="CBL91235.1"
FT                   /translation="MEEINGKQSIKTHIMDATEVNAQHALELEQASKERRMRSKEQIKA
FT                   EVIGNNNIDYKKHMKWVDE"
FT   CDS_pept        601925..602206
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0588"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91236"
FT                   /protein_id="CBL91236.1"
FT                   /translation="MIKIRLGNDVDSESLFDKIDDIKLEINKFYKKNNFRGMMAKYVND
FT                   HSEINSIEKFRYSQTVYDTIIKIVKLKIKLLMTILNIFRIRQVTCALS"
FT   CDS_pept        complement(603223..603693)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0589"
FT                   /product="putative DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91237"
FT                   /protein_id="CBL91237.1"
FT                   /translation="MKDNLKQLFTSRLIAYRLYKHPKIYTIEDAKNLAFTKDIFEIKNL
FT                   FLRNQNKSEYYLFSLPADSKLSLAQIALITHNKKISFASEKDLNDKLGVTPGSVSILNA
FT                   VNDLDKSVNYYIDKTLFDHKNVAYHPNQNDETIVFDGSKIEDLLKDYPVKIY"
FT   CDS_pept        603855..604427
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0590"
FT                   /product="Uracil DNA glycosylase superfamily protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91238"
FT                   /protein_id="CBL91238.1"
FT                   /translation="MTIFEEIVNDKMNFEFTSRGLKPIYHAPTSAKIVIIGQAPGLRVQ
FT                   NSGIMWHDASGDRLREWMGISKDVFYNSGRIGVIPMDFYYPGKAKSGDLPPRKGIADKW
FT                   HSRLLKQMPNIQMTILVGSYAQKYYLKLNSQAKITTVIKDYQKYLPNYFPIVHPSPRNN
FT                   IWLKKNPWFEQKVVPDLQKMISQIISN"
FT   CDS_pept        complement(604668..604826)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0591"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91239"
FT                   /protein_id="CBL91239.1"
FT                   /translation="MKTQLVLGFWTAGGFTDKLNDALADLEAHSHEIIEVQYRTPVFAY
FT                   TALIVYK"
FT   CDS_pept        complement(604958..605629)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0592"
FT                   /product="Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0592"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91240"
FT                   /protein_id="CBL91240.1"
FT                   /translation="MTSKQRNSILILSTIVAIFVIVGVIYKQSKPTDQAQHNTSKATTS
FT                   AQLKSSSLKSSSSSSSNATITNSSSNNDTNTSASSNNSTKATWSADKQNKLSSFMSAWQ
FT                   SKMDQSFVGTYDGQEPNYYGITFPTDLTNGKYNNHIKFDEVTTAVTWSPDGSGESANKV
FT                   VAIASGKVSKNNFNMALYFFVIQNNQPKVYISRTTNGDDLYFSETQNNDLKSGFANIFN
FT                   N"
FT   CDS_pept        complement(606065..606325)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0593"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0593"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91241"
FT                   /protein_id="CBL91241.1"
FT                   /translation="MKHEKFIEYLSWTATAMSILMYVSYIPQIIDNLSGSKGNPVQPLV
FT                   AAVNCGLWVLYGLIKEDRDIPLATANFPGIIFGFVTFLTAI"
FT   CDS_pept        606569..607114
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0594"
FT                   /product="Vancomycin B-type resistance protein vanW"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91242"
FT                   /protein_id="CBL91242.1"
FT                   /translation="MKRKLFCEISPLTYKISYESRILKRQITDQLFGRIAQEKSQTQLP
FT                   YLIFSHQSLMRRGLRKVPIPVEEAKVANLKIAAPKVSHIIIKPGETFSFWHLVGRCTEK
FT                   SGYQNGLMVANDGELKKGTGGGLCQFSNLIHWMILHTPLEVVEKYHHEQVDMFPDANRE
FT                   VPFGSGTSIVYNYLGLPV"
FT   CDS_pept        607200..607388
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0595"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91243"
FT                   /protein_id="CBL91243.1"
FT                   /translation="MDTYEVKAIGEHFASKDGIVYRCGQIFQYRYDQNHQLINQTLIKT
FT                   NHARVAYDTSQLAVIKN"
FT   CDS_pept        607408..607881
FT                   /transl_table=11
FT                   /gene="yagU2"
FT                   /locus_tag="LEGAS_0596"
FT                   /product="integral membrane protein, requirement for acid
FT                   resistance."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91244"
FT                   /protein_id="CBL91244.1"
FT                   /translation="MIITSILIGIAAGLISGMVKIGWEAILPPRTQERDETNPPQQLLQ
FT                   QMGVPRRITHAYVHYSKDQKVYYIALLIHFSFSLFFGILFVLTYRVWPIIGMWQGTLYG
FT                   IVIWFAFHIVIMPVLKTVPSPAKQPFTEHFSEILGHIVWAWTIYLVVIALMYH"
FT   CDS_pept        608037..609443
FT                   /transl_table=11
FT                   /gene="gabD"
FT                   /locus_tag="LEGAS_0597"
FT                   /product="succinate-semialdehyde dehydrogenase [NADP ]"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91245"
FT                   /protein_id="CBL91245.1"
FT                   /translation="MSYQTINPLTDEVVKTYDNHDDAYVEEALSRGHALYKKWRNDPID
FT                   SRSEALSHVADLIALKADELAKILTIEMGKRLVEAKGEVAITVAIARYYAKHGAEFLKP
FT                   RDIVSSIGPAQIISRPTGVLLMVEPWNFPYYQIMRVFAPNYVAGNPMVLKHASNTPMAA
FT                   EAFEKIVQEAGLPDGSLTNLFINYDQVNKIIGDDRVQGVALTGSERAGQLVAAEAGKNM
FT                   KQSSLELGGSDPFVILDDADLSEIKKIISGARLYNAGQVCTSSKRFIVTEKNYDKIVDM
FT                   LKTAFSGVKLGDPMQPETTLAPLSTSKAKQNLTKQVREAVEAGATLSFGSVEQTQPAAL
FT                   FEPVILTGITKENPAFYQEFFGPVGEVFKVKDEAEAIALANDSHYGLSGIVFGGDADHA
FT                   AEVASKIETGVVFVNSFGGTLPELPFGGVKNSGYGRELGDLGIDTFVNKQTIVTKHEPI
FT                   DPENAFGGFI"
FT   CDS_pept        609689..611719
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="LEGAS_0598"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91246"
FT                   /protein_id="CBL91246.1"
FT                   /translation="MITHVDNVDVLAGVGPKRLDALHELGIFTIEDLIGYFPFRYEDLG
FT                   ERLPSETLDGDKVTFKGIVSTPPVITRFGKKNQTRFGLLIEHENIRVTFFNQPWIAQNI
FT                   DVGQEVAVYGTYNAAKAALTGMKIINASVDALDPIYPSSKKITAKTIRHLIELAWADVR
FT                   GTLGSLVPENMRTKYRLLDRNMMIESMHFPSDMAAAKAARRSAAFEEFFVFQMRLQLLK
FT                   LADQNFAGEGINYDERAIRNFETSLPFKLTAAQTKVISEILQDQKRPRHMNRLLQGDVG
FT                   SGKTVVAAMAMYAVVTAGMQAAIMAPTEILAQQHALSLTQLFDNAGLSLRVELLTSGLK
FT                   VAARRHLLEDLENGDIDILVGTHALLQPDVAFHHLGLAVIDEQHRFGVNQRAALRENGV
FT                   NPDILAMTATPIPRTLSITAYGEMDVSIIDQLPNGRKVIKTTRMGHNQLDNAIAFVKKQ
FT                   IDVGAQAYIVTPLIEESESLDVQNATAMYEAMQLEFPQYQVGLLHGRLSNDEKKTLMAD
FT                   FKANRIQILVATTVIEVGVDVPNATVMLILDADRFGLAQLHQLRGRVGRGSRQSYTILV
FT                   ADPKTDYGTARLDAMVETTDGFILAQRDLELRGSGDILGTKQSGVPEFVVGDPIKDLTM
FT                   MEIAQQEAITLVSQKNWDKQADNQTLVDYLSRTMANYRHFD"
FT   CDS_pept        611752..614346
FT                   /transl_table=11
FT                   /gene="mutS1"
FT                   /locus_tag="LEGAS_0599"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91247"
FT                   /protein_id="CBL91247.1"
FT                   /translation="MGKPADTPMMVQYHEIKSQYPDAFVFYRLGDFYELFEEDAIQGAK
FT                   LLELTLTARNKNSKNPVPMAGIPHHAAKNYIDILVDQGHKVAIVEQMEDPAVAHGMVKR
FT                   DVVQLITPGTKMIDGVGSDKQNNYLAAVLPGDGTWVLAYIDLSTGELKATTMYRFSDVM
FT                   DELSSLEVKEVVLRKNDEQTTRQGLATQLGERGLVISTQTITGENATVSFLTQPLIKSD
FT                   EVAATSMLLNYIFDTQRRNLDHIVPAMSYERLTYLKFNQDTRTNLDLIENTRTKKRAGS
FT                   LLGLIDETHTAMGGRLLKQWVLKPLRDQHDIESRLDLVQAFQDDFFTRGALQDHLKSVY
FT                   DLERLSARAAMGTMNAREIVQLKRSLLTIPGIKAVLSDTTSILNVTGNKLDDMVDLASL
FT                   IEEAVVDDPPISVREGDIINDGFDEKIDNYRRVLHDNQQWLAQLEADERAATGIHSLKV
FT                   GYNKNFGYFIEVTKANIVKLEANRYERLQTLTNAERFVTPELKEHERLIIEAQAKRTQR
FT                   EYELFVTVRERVKANISRVQKLAQQIAHLDVLAALSDVADNRRFIRPIFTDHNSIMIKQ
FT                   GRHPVVESLLSVGEFVANDVLLDETTNMQLITGPNMAGKSTYMRELALIVILAQMGSFV
FT                   PAEYVELPIFDQIFTRIGANDDMAMGQSTFMVEMAEANHALQEATAHSLVLFDELGRGT
FT                   ATYDGMALAQAIIEFLDAHIHAKTLFSTHYHELTVLADQHASIENVHVGAVEDDTGHLH
FT                   FLHQIQKGPADKSYGIHVAALAGLPDELITNATKILTALENKETVITTQNQPADTMEPE
FT                   RSGLSEQVALFNVDVADKETQIILDALDDFDILKMTPVDAMNALNALKQLRK"
FT   CDS_pept        614375..616360
FT                   /transl_table=11
FT                   /gene="mutL"
FT                   /locus_tag="LEGAS_0600"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91248"
FT                   /protein_id="CBL91248.1"
FT                   /translation="MGKIHELSNLLANQIAAGEVIERPASVVKELVENAIDSGATQIEV
FT                   IVEDAGETLIRVVDNGSGIEPEDVPLAFTRHATSKIMNRHDLFNIVSLGFRGEALPSIA
FT                   AIADVTLNTTTELATQGLMYHIKGGKQVSATPANGRRGTVISVRDLFYNTPARLKYLKR
FT                   PQTELSRVADIMNRLALSYTNIAFTVVSDGRDLLKTTGNGNQQQVIAAIYGRDTAQKML
FT                   SFAGEDDDFNVTGYVSLPELTRGSREYLTILVNGRFIKNFTVSNAIIHGYGSKLMIGRF
FT                   PMGVININTDPLLIDVNVHPQKSEIRLSKETELSELLVQTIKARLADENLIPDAYENLY
FT                   GQTKKTEYKRVQPAQIAPWLNTNLATVKQPDSKTNITINTGSDIAGISITKRAQLSARS
FT                   VSTFVTKYEHEATLPVFDTPVTEQVTESVATYQSPFTDIAVKSQETLDVTPQRPSGFPD
FT                   LSYIGQMHGTFLFAQTEDGLFLIDQHAAQERINYEYYRQKIGEVSDDKQRLLVPIVINY
FT                   TASDMLKIADHEQDLLHVGLTVMPFGPTSVIIREHPTWFENGQEEDTIREMIDWILRDG
FT                   ALTVAEFREKAAIMMSCKRAIRANMHLSDAQARTLLQTLANSENPYNCPHGRPVVTQFT
FT                   LTEMEKMFKRIQDSHEKWETYDIHPY"
FT   CDS_pept        616399..616914
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0601"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91249"
FT                   /protein_id="CBL91249.1"
FT                   /translation="MNNNDIIIRLRYALNIQNADMIKIFEFGGVTIDETQLHILLTKQD
FT                   EGSKRDEKIDIKGLESFMNGLIISQRGQKFGPDLKPVAPTFDIDKEENINNVVMKKLKI
FT                   AMSYTSDDYISFLKTAGVTISTNALSAVLRRSDHRNYKPAGDRYLRNILKGMAMEYRPD
FT                   DVKKTARK"
FT   CDS_pept        616977..617390
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="LEGAS_0602"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91250"
FT                   /protein_id="CBL91250.1"
FT                   /translation="MTERTLMLIKPDGVKRGKIGEIIRRIENKGYQIIDMKMVVPTEKL
FT                   LNLHYAEHVGKPYYPSLVNYMMSGPVVVMIGEGTNIISGWRTLMGETNPTKAAPGTIRG
FT                   DLGREWEEKAMMNIVHGSDSAMSAEHEINLWFT"
FT   CDS_pept        617501..618379
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="LEGAS_0603"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91251"
FT                   /protein_id="CBL91251.1"
FT                   /translation="MKLNDITILENQSLAPYAHTQVGGKVDYLAMPKTHLELQQLLNWA
FT                   KSQEQPVHIFGRLSNLVVRDGGLRGLSILLHDLRDIKIDQHTITADAGADLILVTETAM
FT                   THGLAGLEWAAGIPGSVGGAVFMNAGAYGGQTEMVVTTVTAIMPDLKIQTFNLNELEFG
FT                   YRHSVFQKNGGVIVNVTFTLTPDVKSDIQLRMDVNNYRRADKQPLNYPSNGSVFKRPEG
FT                   YFAGKLIMDSDLQGARIGGVEVSKKHAGFMVNIDNGTGNDYEDLIHHVQATVKKKFNVT
FT                   LETEVRIIGER"
FT   CDS_pept        618384..620477
FT                   /transl_table=11
FT                   /gene="nhaK1"
FT                   /locus_tag="LEGAS_0604"
FT                   /product="Na /H antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91252"
FT                   /protein_id="CBL91252.1"
FT                   /translation="MVILELVVILIVSVTVSNVVSHFIPDVPISLFQIAIGLLLSLAFG
FT                   IFIKIDSHWFMLLFVAPLLYNDAWRFPKHELWELRGPILGNAIILVLLTTLVGGFFIHL
FT                   LMPQLETSVALALAAVVSPTDPVAVQAIAKRVKLPKTVLHIVSGESLINDASGLVSFNT
FT                   AIKATVAGTFLLSHAIGNFFWMTIVGLIIGLLLGSLLNWLGDVFDRVGLNDVVFHTVVT
FT                   ILAPFLIYWVAEDIFHASGVIAVVAGAIITKILSDQHVDARNPEISITGIRTWEIFVYL
FT                   LNGIIFVLLGIELPPALAAVVQNSQMNTGHAIFYGIVVWFIIFAIRTFWAYGNQVALYL
FT                   KTRETKPAFNMAVTSGLTGVRGAVTMAAVMTVPTIINDGTAFPQRDLLVFVAAVVVIVS
FT                   LLVATIMLPIMTKERSAHDFTQPEMLDSEAVATETIKPEMTESQARIFAIQVGIQTLRE
FT                   QQREDNRAIVYELITRKQGTIAQIKRQLIGNTSGFTSSDDSELRLIGLQAQRDRLQQLL
FT                   VQEDISPLTFSSQSRRLERLENLIAADAHYHFSSQWALVLMRRGLRSIRIWFSDETSAK
FT                   IKKETSLAIRETSKEAIKALSAYMEKYSGDTVTHRMERQNAYNLIVTYRYRIENEKHVD
FT                   TPEQRQLDDKIRMELELKALNAQRETIQNLYEQRRITRQAGINIRQFINFSETAALAGK
FT                   DEE"
FT   CDS_pept        620535..621350
FT                   /transl_table=11
FT                   /gene="ossG"
FT                   /locus_tag="LEGAS_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91253"
FT                   /protein_id="CBL91253.1"
FT                   /translation="MLSYLTINNLMHAVDILIIWFLMYKIIQFVEGTRALQILFGVGTV
FT                   ILVKVVSWYLGLMTLSWVMDQLITWAPIALVVIFQQEIRRGLETLGRRLTVRRAHIDNT
FT                   VEHQLIKSLDDALQYMSKRRIGALITIQREDHLDEYIKTGIKLDANVTGQLLINTFIPN
FT                   TPLHDGAVIISKSRIAVAAAYLPLSESTRIPKELGTRHRAAVGISEASDAITVVVSEET
FT                   GEISITQKGDLLRHMDQKSYLNFFEHQFLPAADDAVTKMHWWRKGGQLR"
FT   CDS_pept        621347..622426
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0606"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91254"
FT                   /protein_id="CBL91254.1"
FT                   /translation="MKKIGQSKIVNLAIAFVIAILLSSYVLSTRSTKLSSNGSNNFSTI
FT                   IPEKKATLKVALNVQFDNDKYVVIGAPTTVQVDIEGSGALVSAAQSRNDIQTSIDLRGL
FT                   KSGKHTATVALRGVNASLTSTVNPQKVTVTIARKTSATLPINVSYNKNNIAKGYTASEP
FT                   TTEPKHVTISGPKSNVDAVTSIAARLNLPSGVKESLTRTAQLVALDKNGNTVEVNLSRQ
FT                   TVDATLVIAPEDSKRLTLNASVKNGGSNNYQITFDPKTVTAYGSSDILNTMDNISVSVD
FT                   VGNIRNGGTVNVSLPSIDGIVRYDKTNVTATVSQIKVNNNNNSESSMSDSSSASSAVSS
FT                   SASASSGTDTSDAKTSSSN"
FT   CDS_pept        622445..623809
FT                   /transl_table=11
FT                   /gene="glmM"
FT                   /locus_tag="LEGAS_0607"
FT                   /product="phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91255"
FT                   /protein_id="CBL91255.1"
FT                   /translation="MSDIKLKYFGTDGVRGIANESLTPELAFRLGRTGGAILTQHAESH
FT                   KKPVVIVGRDTRISGEMLQQAIVAGFLSVGIDVLSLGVITTPAVAFLVQNLEADAGVQI
FT                   TASHNPAADNGIKFFGNDGFKLSDELEYEIEQLLDAPTDTLPRPSAEGIGVVNNYPEGA
FT                   LRYMSFLQKTIPTDLVGMRVALDGANGATSGLLARLFADLNVEFVTMGTEPNGLNINDG
FT                   VGSTHPEALAELVKANDVQAGLSFDGDGDRLIAVDENGEIVDGDKIVFIIGKFMNEQGR
FT                   LKHHTVVSTIMSNIGFYKALKDNDMMSVQTAVGDRYVMEEMSKSDYNLGGEQSGHIIFR
FT                   DWATTGDGLLTALQLLYVMKETGTKLSELAEAVQVYPQKLVNIKVGDKVAIQQNPAVVS
FT                   KIAEVEAQMAGDGRVLVRPSGTESLIRVMAEAPTTELVERYVEMIADVVREQAMQ"
FT   CDS_pept        623899..624600
FT                   /transl_table=11
FT                   /gene="rnc"
FT                   /locus_tag="LEGAS_0608"
FT                   /product="Ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91256"
FT                   /protein_id="CBL91256.1"
FT                   /translation="MSQDSFKKYLLTEFNIQFNDDSLLQEALTQRNYLNEHQDESGRDY
FT                   QRLEFLGDSVMQVSVAEYLFKRYPNWHEGQLTEMRIAMVQTRSFAHFSRVVHLNEGIRL
FT                   GKGEEMSGARDRDSLLEDIWEAFIGALYLDQGLEAVSVFLDQTLFAAIDTDFFDRFIDF
FT                   KSRLQEKLQKNGAVDIYYRTESEQPLAGNTQLFEASISVDDHELARGTGKSIKDAEKAA
FT                   ARTALKLLEDK"
FT   CDS_pept        624604..628158
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="LEGAS_0609"
FT                   /product="Chromosome partition protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91257"
FT                   /protein_id="CBL91257.1"
FT                   /translation="MKLKSLEISGFKSFADKTIIEFMPGMTGIVGPNGSGKSNIIEAIR
FT                   WVMGEQSAKDLRGTKMSDVIFGGTNKRHALNRSEVSMTFDNSDRYVKSEFNEIRITRKL
FT                   YRSGESTYQINGVDSRLRDIHELFMDTGLGRESFSIISQGRVEGIFNAKPEERRGIIEE
FT                   VAGVYKYKQNKERAQKELTQTSDNLARVANIIYEIQGRIEPLAEQSAQAIDYIAQKERF
FT                   ETLDTLKLALTHRTLETQIKDVTTQVEVQDGRVNQIKSTLDVLHKSLSEKRQERISMQL
FT                   MRDKVQQDILHDTQSRERLIGAQNLSAQQIDTLEQNIAQKNSQLTDFGNRLAELERQIN
FT                   QLTNDKKKFQKQHHELQQQMASFDNVVQVKLQKNLQSQIDNHRHVYIQTMQEIAALRNG
FT                   LQSDRKLQQRLINRQQVLSTQLLDEKETLLTLKTNANLDLPEQGEIINIDRLKRHVDDL
FT                   KKQIEHNTKQYQDHEKQWYDALNDLNKSRSQRDALTALDEYAGFYQGVRVLMQSQVRNQ
FT                   FLGIKGVVAGLMTVPMDYTQAVETVLGGALQQVIVDTTTTAKSVIRYLTQKRAGRVTIL
FT                   PIDTIKPRQLTGIERIKMSDGFIGIAADLVEMPAEMHAIKSNLLGSTVIAEDLDAATKI
FT                   ARMGNYRFRVVSLGGQVVNAGGSMTGGANQKSGTTILSRQTELNQLNERLAVLTQTTQK
FT                   LEKSVQDQRLQGDELRSELLLSQTQFANAKNETAQIDYDLARRKDAVKQQTRVLQALQI
FT                   ESEDLAKQLVDVDTQLHVNQKSLDLAQNAQKDQEVEAAKLDQQLADISIQSQVSSEQKA
FT                   TVQTNYATVQAKMDSLATQINLLLAQKDDIQQQKDDVENALNASNEQLIAAKNNANNIE
FT                   KVDTITQRLEVIQTKFDDYTKRLNSLTDLVVTIESQFATQQETLRVNNSKQNQVVGQLT
FT                   RLESELDNVQTQLLTQYDIVDITDIVASHDINELSNIESQLVLLKRSLDEIGSVNMDAI
FT                   SEYEEVKTRFEFLTRQRDDLKMARETLLQTIDEMDKEVQIRFKQTFDAVAARFSNIYTQ
FT                   MFGGGRAEICLTDPKHLLTTGIDITAQPPGKKFQQMSLLSGGEKALTAITLLFAILHVR
FT                   PVPFVVLDEAEAALDEANVDRFAKYLYHFSGDTQFIVITHRKGTMVKANLLYGVTMQEA
FT                   GVSKMIAVDLDKATESVE"
FT   CDS_pept        628160..629326
FT                   /transl_table=11
FT                   /gene="ftsY"
FT                   /locus_tag="LEGAS_0610"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91258"
FT                   /protein_id="CBL91258.1"
FT                   /translation="MGLFDIFRKKKIEESSEVSKDSVESLSNQDNSAVHEIPEEIQEPK
FT                   VEQNLDAIEESVSEHVSKSDPIQEPELSVEPEVVEQQIYTKGLEKSRTGFAARFNKFLA
FT                   NFRSVDEDFFEDLEETLVGADVGFDMAIKISDDLREEVKLENVHRPEDVRDVIIKKMVD
FT                   MYEADGVNEDATMHFNVNGTTVILLVGVNGVGKTTTIGKLSTKYQQQGKSVLLAAADTF
FT                   RAGATKQLQEWGIRAGVPVVAGKEKADPASVVFEAVAKARDEHYDILFVDTAGRLQNNV
FT                   NLMQELEKMKRIIKREIPGAPHEVLLVLDATTGQNALQQAKLFKNSSDVTGIVLTKMDG
FT                   TAKGGIVFAIRNDMQLPVKWVGFGEKASDLREFKPEEFIYGMFKDLMA"
FT   CDS_pept        629323..629667
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0611"
FT                   /product="Signal recognition particle associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91259"
FT                   /protein_id="CBL91259.1"
FT                   /translation="MNFKEKNHINGLFGFYGELLTIKQQDYLRYYFEDDYSIVEIAEVE
FT                   TVSRQAVSDNIKRGIDQLLKYEHVLHLQEKFETRSAIETQVQDYISVYYNKDNVLKKLV
FT                   SQLMAHEIED"
FT   CDS_pept        629768..631237
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="LEGAS_0612"
FT                   /product="Signal recognition particle protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91260"
FT                   /protein_id="CBL91260.1"
FT                   /translation="MAFENLTERLSKAMKNLTGRGRVSEEDLRATMREIRLALLEADVN
FT                   YDTVKKFVANVREKASGADILEGLNPAQQVVKIVNDELTTTMGEEAAPLNKSPKIPTII
FT                   MMAGLQGAGKTTTVAKLAYKLKKEENARPLLIAADVYRPAAIDQLEILGRDLEIPVFQL
FT                   GTAVNPREIVRQGLAKAAENKNDYVFIDTAGRLQIDDVLMQELKDVAEIAHPDEILLTV
FT                   DAMTGQNAAETAKGFSAALDLTGVVLTKLDGDTRGGAALSIRDVTGKPIKFVGQGEKPT
FT                   DLDVFYPDRMASRILGMGDVLTLIEKAQRDFDEEAQAKQLEKMRQNTFDFNDFVAQLKQ
FT                   VQSMGPMEDLLKMIPGMANNPALANVNIDAKQFSHLEAIVNSMTPAEREDPDLINPSRR
FT                   RRLAAGAGRPIIEVNRMIKQFDQMRKMMNQATNGNFGGIDKMMGGSGMDMSSMMGGGGM
FT                   PSGNFGQKVQNFAIKQAARRLQKAKKKRGKK"
FT   CDS_pept        631237..631416
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0613"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0613"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91261"
FT                   /protein_id="CBL91261.1"
FT                   /translation="MQRLELVLPVLVFVVMLGANILNAPNLSIPIVLLAVVSAAVPSII
FT                   IFGLIKFLEWWIKR"
FT   CDS_pept        631481..632284
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0614"
FT                   /product="Hydrolase, HAD superfamily, Cof subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91262"
FT                   /protein_id="CBL91262.1"
FT                   /translation="MSIKLIASDLDATFLKNDKTFNEVLFQEVLDKLHAQGGQFVVATG
FT                   NHVQKVRDYFKNFSGQYQLIANNGAEVILDGELMHVWSVSADVPAVVDNLANKYKAELQ
FT                   LGVSFVAANKAFMIVKNPNDEHLDFAKKYFENLTLINSVTEINEPILKVSLVLPRLEYE
FT                   FMREIKLLLGNKVHVTTSGYGAIDIVNPNVNKANALTYIAETLNVKPSEIMAFGDGLND
FT                   LEMLEYVGQPFAMTNSDEELFQHDFARSVTDNDNDGVLKTILEKL"
FT   CDS_pept        632392..632937
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0615"
FT                   /product="Chromate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91263"
FT                   /protein_id="CBL91263.1"
FT                   /translation="MTKYGVLVGSIRKNSYSQGVAEALVAGLPDDAEVTYINISELPLY
FT                   SQDYDAQSPESYDVFRSEIAKQDAFIFVTPEHNRSISAALKNALDVGSRPWGESVWTGK
FT                   PALVASQSISGISGVLAHHVLRQSLVFLDMPTMQQPELYIGNVQSLADDSGHITNPDTK
FT                   AFLGDAAQKFVSFANKFE"
FT   CDS_pept        633191..634627
FT                   /transl_table=11
FT                   /gene="bglA"
FT                   /locus_tag="LEGAS_0616"
FT                   /product="6-phospho-beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91264"
FT                   /protein_id="CBL91264.1"
FT                   /translation="MSNSLSKEFLWGGAVAAHQLEGGWQEGGKGISVADVMTVGKPGQE
FT                   RAITNGVLPDEYYPNHDAIDFYHRYKGDIALLKEMGFKCFRTSIAWTRIYPTGEESEPN
FT                   EAGLKFYDDLFDELLKNDIEPIITLSHFELPYNLVTKYGGFRNRKLIDLFVKFAATCFT
FT                   RYQNKVKYWMTFNEINNQANYDSDFLVFTNSGLRFKPGENREEGMYQSAHNELVASARV
FT                   VKLGHEINPDFQIGCMIAMGPVYPATMNPDDVLAAQKAMEKNYFFADVHVNGFYPEFLK
FT                   KYWARKGFDINITPQDEADLKAGTVDYIGFSYYMSHAVKKNSETPFDDMTPQNSQVKNT
FT                   YLEASDWGWQIDPKGLRYALNWFTDKYHLPLFIVENGFGAYDKVEADGKIHDSYRIDYL
FT                   REHIRQMILAVVEDGVDLIGYTPWGCIDLVSAGTGEMDKRYGFIYVDKNNKNEGTLKRS
FT                   KKDSFYWFKDVIASNGENLK"
FT   CDS_pept        634643..634957
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0617"
FT                   /product="PTS lactose/cellobiose IIB component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91265"
FT                   /protein_id="CBL91265.1"
FT                   /translation="MKKALIICAAGMSSSMMAKKTTDYFKEQHKDIEMDAITATEGEDA
FT                   IRAGEFDLYLISPQTSMYLDGFQKIGQEVGKPVVSIPFNAYIPIPMGIEKMAKLVEESI
FT                   "
FT   CDS_pept        634983..636977
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0618"
FT                   /product="Transcriptional antiterminators, BglG family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91266"
FT                   /protein_id="CBL91266.1"
FT                   /translation="MKESDLLRYLLENQERFVTSEELAGILSLSPRTIRNYIKVLKTKL
FT                   VLHGAVLESKPSFGYCLHISHPVTFDLFLNKNYQLSQWHENNTEEIDIADRQKYILNKL
FT                   VIESKKMLIEDLAQRLFVTRSTLSKDLSIIRKKLMPYALTIENKPHSGIFVTGLERNRR
FT                   HFILDYFFTHNDNSFQHYMENKSFFKKISFDQITIIVLDECRESGIYLTDFTIQNIVLY
FT                   IALSVQRMAGGFELQPVDFDDSLETRQVYTVAENIIHRLENSYHLKVPKSEVAYLTIQL
FT                   LAKGKNINVTNDEALHEDLDFVLQQIEEATGCPISQDYDLKKNLIAHLKPMIVRLEQGL
FT                   QLKNPLLQEIKANYSHYFSDVKRYVHLSRYLSKFDINDDEIAYLALHLMAAAEKYRDLN
FT                   KPKVLLICATGYGSAQLLNNRLEKEFGKQLNIIGIKGYYEIDDAALNGVDIIISTIDLS
FT                   TQVFKIPVVQVSVFLTENDIKKLGHFLNNLNDNSRQLSSVTTKDVTNSQSTNYFDQFTD
FT                   VSRFKIWRVPTDREDVLNQLSDMLLTDEPAEFKQELLDQIDQRELLSAITFNDVIAVPH
FT                   PARAMSKVPKIAIGVIPAGLKWSHSYPNIKLVFLLSPSYLNNQGLMAITQTIVHLVDNT
FT                   TQQADLVVTKNFSDFRQKFILFMKGGKSK"
FT   CDS_pept        636974..637339
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0619"
FT                   /product="PTS lactose/cellobiose IIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91267"
FT                   /protein_id="CBL91267.1"
FT                   /translation="MNSEEIQVIAFEIILHSGNSRTNVHEAFSAMRLKNFKLSEQKLQD
FT                   ANTELLLAHKSQTKLLQTYAAGTKIDMEIILVHAQDHLMTTMTLREMAIEMQHLYKEVK
FT                   QIEGSSQSTTRESPVER"
FT   CDS_pept        637290..637844
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0620"
FT                   /product="Possible sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91268"
FT                   /protein_id="CBL91268.1"
FT                   /translation="MKAAVNQRRERAQSKDKQLAVTVEKNRQDMSLKSMQFNRFMLIRY
FT                   ATALFFFVNLYWALIMRHTWVVIIPLAVMFVSGFAIVEQIKLFGQHTNQLIFSKLFFRT
FT                   QLAVNVALMISTMTPLFASLFQFVNNTNQNRYIVLVILLLGFGVILFVNKRLTLIASNH
FT                   DKYYSRLVAYQAILKKNKGMK"
FT   CDS_pept        637847..639193
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0621"
FT                   /product="PTS lactose/cellobiose IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91269"
FT                   /protein_id="CBL91269.1"
FT                   /translation="MENGRLFNILQKVLLKPMTKIAQYRIVRAIMAAGMASIPFTIVGS
FT                   MILVLNILPTVFPFLTDFFNATFFKFSDLYMIANTATMGILAMYFSLAIGFELTRIIQA
FT                   EDKLKVAPLNGAFLSLFAFFMCLPELVMKGGKIVLVNSITANEKVINGFRMTSTIDRIG
FT                   TSGIFTAIIMAILAVWLYTFCVKHNWTIKMPDAVPEGVSRSFTALIPTFVIALVVLAIN
FT                   GGLVLLGTDIFKMIAIPFSFVTSMTSTWLGVMVIEFLIHALWIVGIHGANIISAFITPI
FT                   FLANMVANSHGANIPFAGEFNNSFAILGGSGATLGLCIFIALLARSEQLKVLGRASIVP
FT                   SLFNINEPLIFGLPIVYNPYLAIPFFLAPMVTASVAYAAINFHFIRPIVIQAPWPSPAG
FT                   IGAFISTVDWRASVLAILCVIIAFLIYLPFIKIYDTKLYHDEQGIPTKS"
FT   CDS_pept        639259..640110
FT                   /transl_table=11
FT                   /gene="hisK"
FT                   /locus_tag="LEGAS_0622"
FT                   /product="histidinol-phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91270"
FT                   /protein_id="CBL91270.1"
FT                   /translation="MIKKDGHTHTQFSHHGSHEPLDDYIERAISLGFTEYVVTEHAPLP
FT                   TMFLEHFTGPSEARHGSAMLITELAAYQKEVNRVQLKYADQIDIKSGFELDYLENYETE
FT                   LRQFILMQADWLDEVVVSVHFLPNHDKLVAPIDFDPETLAKYFPDIHSLPQTVFKNYFN
FT                   TVQKSVRFAATLPNDIVIRIGHMTLIRKYQKYFNLPKFDVDNQLRIDDLLMQIKNDHFQ
FT                   LDYNAAGLMKPYNGETYPTLDIVQKANDLGIELVYGSDAHEVSAVGQFYNMTVSDTLKN
FT                   EK"
FT   CDS_pept        640451..642055
FT                   /transl_table=11
FT                   /gene="hisZG"
FT                   /locus_tag="LEGAS_0623"
FT                   /product="ATP phosphoribosyltransferase, ATP
FT                   phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0623"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91271"
FT                   /protein_id="CBL91271.1"
FT                   /translation="MGEKILAAGSHDEFGEALVQKQQITHLISKTLNKKAFVAINTPLI
FT                   ERESVFEQYQHDNVFHLRDQMGENLVLRPDLTLPVARFLASKSQQARVQKFYYIGDVFR
FT                   RTDYLSGEYNQETQAGIELIGDSSFKAEIQALDIMLDFAQQFEIADVQVVISDTRLIDR
FT                   VLGTLDISSKQQKLLKQAIESKNMTAFEKVRMTIKDFPAHLTRWPLAFGEDGETVMWQL
FT                   QDLPEVNDLVDRWLKLATFIHEHYPDVAVTVDLAAASPQPYYTGTIIRGFVPSLGRYLF
FT                   SGGRYDRLLESFQTESLPAVGMGFNIDTIMAEWQREVADHNPEEPIVVVLAKGRVEKDT
FT                   RPLLKSAGIDTTPLENQDRKLVFDSPDGIYRFILVKPDDVIKYLDRGIGDVGIVGSDTI
FT                   AEQIQNHYDVLNLQTGQAAFVLAAPQNFMINGIQRKRIATKYPKTASRYFSQHGEDVEL
FT                   VKLSGSVELGPLTGLSDAIIDITQTGDTLRENNLVIYDTVGEVATHLLVRPGALLQFQS
FT                   KLKQVIENLITLLNQTK"
FT   CDS_pept        642066..643343
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="LEGAS_0624"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0624"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91272"
FT                   /protein_id="CBL91272.1"
FT                   /translation="MQIIKNESIDQIKSRIRQQTSKTSDPLVESRVINIIKNVREKGDI
FT                   ALKAYAKEFDHVSLDELKVSAEQIDLAVKNVDPAVIKALEKAAVNIRSFHQLELQQSFE
FT                   ESPRSGVTRGTKVTPLSAVGIYVPGGTAAYPSSVLMNALPAKIAGVETIIMVTPPQKNG
FT                   LNDAVLAAARIAGIDSIYQVGGAQAIAALAYGTESIPQVDKITGPGNAYVATAKRAVFG
FT                   QVAIDMIAGPSEIGILADESARAKDVAADLLSQAEHDINARAILITNSEKLAQAVFDEV
FT                   NVQLNTLPRAAIAREAIDNNGFIYLVDTIDNMIDLMNAVAPEHLEIQLENAYDYINKIQ
FT                   NAGSVFLGKYASEPLGDYLAGPNHILPTGGTARFSSALGVWDFQKRIQYLYYSKDALLD
FT                   DVNDVTVLAREEGLEGHARAIEIRQS"
FT   CDS_pept        643393..643980
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="LEGAS_0625"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91273"
FT                   /protein_id="CBL91273.1"
FT                   /translation="MSRIANITRNTFETQIKLMLAIDEQTLISVNTGIGYLDHMLTLFA
FT                   KHGRFGLQVTVNGDLNVDSHHTTEDIGIALGEAFTQALGDKSGIERYGAQLIPMDETLS
FT                   RAVVDLSGRAYLVFQAELTAPLLGSFETEVVEDFWQGFADQARANVHIEVLYGRNTHHK
FT                   IESIFKAMGRAMRQAVTINPEIKGINSTKGVI"
FT   CDS_pept        <643998..644621
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="LEGAS_0626"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0626"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91274"
FT                   /protein_id="CBL91274.1"
FT                   /translation="VIVVIDYGAGNIFNVMKAIKYVGLAAKLTKDPSEILAADGLVIPG
FT                   VGAYKTAMDKINENQLLVPIKKAANNGTPILGVCLGMQLLFDSSTEFGETIGFGLIPGE
FT                   VVRLPQNTGFKVPQMGWNQNSVTIENALTQGIKNEFTYFVHSYYVKTDPKYIAASVDYG
FT                   VQVPSVVIKDNIIGAQFHPEKSGEVGLRVWQAFANMVSDKAVNV"
FT   CDS_pept        644618..645331
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="LEGAS_0627"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0627"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91275"
FT                   /protein_id="CBL91275.1"
FT                   /translation="MILPAIDLLGGQSVRLLQGNYNAVTVVDSDPVAQAKKIDKAGLHA
FT                   LHVVDLDGAKSGLAANFKTILSIRQNFTGFLEVGGGIRTLDQIEQYYNAGINRVILGSV
FT                   ALKNPTLVRQAVEKYGELIAVGIDGKDGKIATEGWLEQSNISFETLLSAMIAIGVKHFI
FT                   VTDVVRDGMLQGPNIDLLVKLQQHFVTANIIASGGIAQMSDLVALNQAGIQDIIVGKAL
FT                   ASGSISLTQLAELEE"
FT   CDS_pept        645333..646097
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="LEGAS_0628"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0628"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91276"
FT                   /protein_id="CBL91276.1"
FT                   /translation="MALAKRIVPALDVKNGRVVKGINFLNLQDVGDPVDTAIAYQNSGA
FT                   DELVFLDISATLEGRTTMIEMIERVSSAVFIPLTAGGGVTDLASIRAIIQAGADKVFLN
FT                   SAAVTNPDIIRQGAEAFGSQAIVGAIDSKWNDNLKKHQVYVSGGTKATNLETISWAKKM
FT                   VQYGAGELLVTSMNTDGTQNGYDIALYQALTQAVNVPIIASGGAGKKSDFKTVFKSGHA
FT                   DAALAASVFHYGKIAISDLKESLYREGLVMRL"
FT   CDS_pept        646094..646447
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="LEGAS_0629"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0629"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91277"
FT                   /protein_id="CBL91277.1"
FT                   /translation="MTIEQTPDFNKPYQNNLVPAIITDVTTGAILMLGYMNEASYALTK
FT                   STGETWFWSRERAELWHKGATSGHTQQVVSMTLDCDLDTVLIQVIPNGVACHTGRYSCF
FT                   FNPVIDNDFRVNT"
FT   CDS_pept        646503..646823
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="LEGAS_0630"
FT                   /product="phosphoribosyl-ATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91278"
FT                   /protein_id="CBL91278.1"
FT                   /translation="MMQQSIEALYKQALNRKNKPEESSYTNYLYTKGLDKILKKIGEES
FT                   TEVILGAKNTNDELIYETADLLFHLMVLLVEKDVTLDDIKDELGSRQGQESRLHERKDW
FT                   RV"
FT   CDS_pept        646827..647897
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="LEGAS_0631"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91279"
FT                   /protein_id="CBL91279.1"
FT                   /translation="MKESIKNMKAYQAELPAEAVKAKYGLSHLARLSANESVYGSSPKV
FT                   YQAIRATAADILGYYPDGQATILREAVAKHDNVAPESLVFGVGADELIQLLTRTVLTPG
FT                   SNIIIPDPTFGEYAMHAQIEQADTKKIPVKLETGQVDFDAMLAAVDEKTTMVWLANPNN
FT                   PTGVFEKRSDILAFLEKLPKTVTLVVDEAYYDFVDEPDATVAIDVKNYTNLVVLRTLSK
FT                   AYGLANLRVGYGIMQEPLYGVMQAVRLPYNLNTYQIVGATAAVEDQDYLNQVVTKTQVE
FT                   RKQFQTFLRDNNLTFYNSQTNFLWIKVGDTKKVGEYLLSQGYQVNDHLNSEWIRIALGT
FT                   SEDNVGMRKAILTIMK"
FT   CDS_pept        648200..649483
FT                   /transl_table=11
FT                   /gene="purA"
FT                   /locus_tag="LEGAS_0632"
FT                   /product="Adenylosuccinate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91280"
FT                   /protein_id="CBL91280.1"
FT                   /translation="MSGVIVVGSQWGDEGKGKIVDFFSENADAVVRYQGGNNAGHTIWH
FT                   GETKFELSALPSGILTKGQLAILGNGVVVNPEALLAEIDKVESKGISIENLRISNRAHV
FT                   IMPYHIALDKAAESASNNRIGTTKKGIGPAYTDKISRVGIRIADLIDPEVFSKLLKEYL
FT                   PFKNDQLTKLYGEEALDYNDIYNTYVEYGRLLAPYVTDTSYLLGQLMADKKRVVFEGAQ
FT                   GIMLDVDHGTYPYVTSSNPTAGGVMNGAGVGPKQIQDVVGVIKAYTSRVGEGPFPTELH
FT                   DNIAAHIREVGHEYGVVTKRPRRIGWLDAVALRHAVQVSGLTKLAINSLDVLSGLKELK
FT                   IATSYTYRGEEIHHFPASDTWFDGLDVNCETLPGWDEDITEVQSFDALPINAQNYLKRI
FT                   SELLEVELLSFAVGPKPEETHLLSAVWQ"
FT   CDS_pept        649512..650024
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0633"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91281"
FT                   /protein_id="CBL91281.1"
FT                   /translation="MEIQTADLLFVPNQHHDMDEAIAASTGNYVHVAIAIDSKHVIHAS
FT                   PRYGVVRQTLAVFLNESNHVAVYRPRVENSDGVVARACQFEHQPYNFSFYKDDPGVYCS
FT                   QLVAAAFKSVIDFDEETMQFGDGEHQISDFWSAYYLKLGVDVPLNQLGTNPNKMATSEY
FT                   LQFIGQL"
FT   CDS_pept        complement(650140..651306)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0634"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91282"
FT                   /protein_id="CBL91282.1"
FT                   /translation="MNEVLKEQFLIDKLSDDQQSVIADMNTYINDSIVRKQHAVAIIQG
FT                   AAGTGKSVVLMQLVRQYMTDKHYKTALVVNHPELYKAYQDMAKDFSGLNPRDIRRPTAL
FT                   INDAQKSNHKYDVIFVDEAHLLYSKSEPYAHYRGKNQLTDLINLAKIVVVVYDFKQVFQ
FT                   SKMYWSQELLIDTIGNHPHKQFNMDFQYRMIASDAQVDWMDKLTAQKPITPFPNNSHFE
FT                   FEVFSTAGALYEKIKVKNKNFGLSRVVATSGFPRIDGRHNVEMDSFSLPWDEWDPQRTH
FT                   WAKRESSITQVGTIYTLQGFDLNYVGMIIGPSFGYDAKTDSMTIIPEKYSHKEIFKKRQ
FT                   DLQFTSAQYQEFIANVLNVLIKRGKYGLYLTAYDDALRERLLALQRDN"
FT   CDS_pept        complement(651442..653505)
FT                   /transl_table=11
FT                   /gene="clpE"
FT                   /locus_tag="LEGAS_0635"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   clpE"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0635"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91283"
FT                   /protein_id="CBL91283.1"
FT                   /translation="MASQDPFGFGNINFDEMMRAMNEQMQSAQPDNQANINQQQNKKDK
FT                   TKKRPTLLEEYGINLTQQARDGKLDPVIGRDLEVARTIEILNRRTKNNPVLIGEPGVGK
FT                   TAVVEGLAQAIVENKVPEKLRSKDVIRLAMSAMVQGTAMRGQFEARMRQLMKEVADNDD
FT                   VILFIDEVHEIMGAGNAEGGMDAGNILKPALARGEFQLIGATTLNEYRKIEKDGAIARR
FT                   FQPVQIEEPSKEATIQILKGIQQRYEAYHHVTFTDDAITAAVELSDRYVPERFLPDKAI
FT                   DLIDEAGSRKNLTMTIADPKSIQTKIDAADQLKQDAIDKEDFEKASYWRDQTNQLESQK
FT                   AQVEAHPEMFKPQSVTEKDILQIIEDKTDIPVGDLKDNEANQLQELDNQLAQHVVGQDI
FT                   AVQTVAKAIRRNRIGLTKSGRPIGSFLFVGPTGVGKTELAKQLAKEMFGSKDALIRFDM
FT                   SEYMEKHAVSKMIGAPAGYVGYEEAGQLTEQVRRHPYSLVLIDEVEKAHPDVMNMFLQI
FT                   LDDGRLTDAQGHVVSFKDTVIIMTSNAGSTDTGNVPMGFNQLDAQNKLLQRLENYFRPE
FT                   FLNRFDDIIEFEQLSKANLLAIVDLMLSDMNNNLADNNLHVSVSDAAKLKLVALGYNPT
FT                   LGARPLRRVLQDKIADHLADYYLAHPDVTDLYADIDADTDDIIISKTEYIKA"
FT   CDS_pept        653688..653861
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0636"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0636"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91284"
FT                   /protein_id="CBL91284.1"
FT                   /translation="MDYEQLLIDLRDGEIDEIVITPATFPAFQKIWRDFTSQNRIRGVA
FT                   GKQGNIKYVRAN"
FT   CDS_pept        653962..654969
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="LEGAS_0637"
FT                   /product="Rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0637"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91285"
FT                   /protein_id="CBL91285.1"
FT                   /translation="MAFSFGQRNVGIDLGTANTYVYIEGRGIVLREPSVVARNTQTNEV
FT                   VAVGSEAKDMLGRTPASIAAIRPMRDGVIADYDTTVAMIRYYLQKALGGRIGKPYVTIG
FT                   VPSGVTAVERRAVIDAARVAGARDAYVIEEPFAAAVGAGLPVMDPTGSMVVDMGGGTTD
FT                   VATISLGGIVSSRSIRIAGDKLDEAIANFVRNKYNVTIGEPTAERLKIEIGAASLELAR
FT                   TLPNASVRGRDLLTGLPKTIDVTAEDVATSIQEPVQEIVAAIRETLESTQPELAADVID
FT                   HGMVLTGGGAMLRDMDKIIQEATKVPVLIANEPLDAVAIGTGEALKSIDVMRQS"
FT   CDS_pept        655045..655902
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="LEGAS_0638"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91286"
FT                   /protein_id="CBL91286.1"
FT                   /translation="MRKIFSSRAVVTIIISLIVIVGLIAGSNWWAKRTNTPPFFQRFSN
FT                   DLAGGVSRIISVPTTAIGRSANSIGNLLDTFEENRELKSKIDEFAQDKVRLQTVEEENK
FT                   TLKNQLKLKATLTDYKTVSAVTISRSPTTWQSQLVINKGLKSGLKKGMPVLSGAGIIGR
FT                   ISEVNTTNSKVALISDTSEDANRFAITIKGGNGDVNGIVTDFNREKNQLIMSQVTSENQ
FT                   IKAGDLVETSGLGGVIPAGLYVGKVSSVTRDDYGLSKQINIEPAADLGNVTTVVVAVSQ
FT                   IGAQ"
FT   CDS_pept        655902..656429
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="LEGAS_0639"
FT                   /product="cell shape determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0639"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91287"
FT                   /protein_id="CBL91287.1"
FT                   /translation="MAFWQLTRLRVVYPVLLFFLLFVDGSLMAGMGGILTAFPWYILPT
FT                   LTLVWLFYAIQFEVDKDMPFWLYVILIGILFDMYYTGIFGTYTLAFIVAVAVMKQLHKV
FT                   LDERLLSGITIFLIGLIVYLVVTYGAGFIIGSANVSLVTFFVFEVLPTAILNIIVATIC
FT                   YYPTWSLFQFLK"
FT   CDS_pept        656879..657520
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0640"
FT                   /product="Polar amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91288"
FT                   /protein_id="CBL91288.1"
FT                   /translation="MNYFLELLPSLLSGLKMTLGVFFFTIIGSIPLGIIVSLGMKSEYF
FT                   TIRWLINGYIWIMRGTPLLLQLIFVYYGLGMMGISFPRFEAAIIAFIINYAAYLAEIFR
FT                   GGLQSVPRGQYDAAKVLGFTKIQTFFKIVLPQVIKIVVPSFGNEVINLVKDTSLVYVIG
FT                   LGDILRAGNIAASRDVTLIPYLLVGLIYLIMTAIVTVLLRRTEKRLNIWR"
FT   CDS_pept        657524..658162
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0641"
FT                   /product="Polar amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0641"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91289"
FT                   /protein_id="CBL91289.1"
FT                   /translation="MLEIKKLTKTYNNNTIFRDLDLTVSDGEVLSIVGPSGIGKTTLIK
FT                   ILAGLETADAGEVTLNSERLPVDGTRTDAKVGLIFQDFNLFPNYTVLDNIILAPINVNK
FT                   IDKATAKDQARSILDTLGMLNKAELYPFQLSGGQKQRAAIARALAMDPQILAYDEPTSG
FT                   LDEASTKQVAEIVKTLKHRGVTQLIITHDQFFAEIVSDRVFDFSKEVAR"
FT   CDS_pept        658162..659016
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0642"
FT                   /product="Polar amino acid ABC transporter, substrate
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0642"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91290"
FT                   /protein_id="CBL91290.1"
FT                   /translation="MVSMKKKIVVNAIIGLLFFGIVVWLAVGLSAGAKHNSQANQETSK
FT                   TDEWQRIKQDKQITIGLDDTFVPMGFRDKDGKIIGFDVDLANAVFKTMGITVKWQPIDW
FT                   SMKETELNTGNIDAIWNGYTKTAAREKQVAFSNTYHNATQVLVTLKKNNINSFSDMKGK
FT                   VLGDQTASSGDESFNQHPKVLKQYVKDQKVVGYDTFDKAFNDLNAGRIDGLLIDEDYAR
FT                   YYVAHQANPRNYTVTVGGFSVDETAVGFRKSDNQLRQAVNQTLSQFKKDGRMKHIENKW
FT                   FSN"
FT   CDS_pept        659195..660649
FT                   /transl_table=11
FT                   /gene="cls1"
FT                   /locus_tag="LEGAS_0643"
FT                   /product="Phosphatidylserine/phosphatidylglycerophosphate/c
FT                   ardiolipin synthase family enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0643"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91291"
FT                   /protein_id="CBL91291.1"
FT                   /translation="MLRDSLWIIIVTLLIINTFGAIITVFSQKRDIATIWAWLLVLLTL
FT                   PVVGFFIFFLIGSRISNKKIFRLRTQDMRGLEQIAYNQRQQLEKIEELLPIPDSASELV
FT                   RLFLTSDDAVLTRGNEIQIFTNGFDKFNALFEDIEHATHHIHLEYFTIYDDKIGNQLID
FT                   LLTKKAQEGIEVRIVFDQFGSHGQHRDMYKRLRDAGGIVVPFLMRRFQLLTLRFNFRNH
FT                   RKIAIIDGTIGYIGGFNVGDQYLGYFKKFGHWRDTHIRIHGDAVLSMQSRFLMDWNATA
FT                   EAEEVLSETIEYFPEIVQLPGLAMVQIVSSGPDNDMKQIKQGFMRMFASARTEITIQTP
FT                   YFIPDAAILETLEIAVMSGVRVRLMIPDRPDHPIVYRATQYYAKELIELGAEVYRYDGG
FT                   FLHSKVVSIDHEIGTVGSANMDIRSFVLNFETNAFVYDPDFAARLEDMFEQDIKDATKL
FT                   TIEDFEQQSFWLTFLQKFSRLFSPIL"
FT   CDS_pept        660655..661926
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0644"
FT                   /product="zinc protease M16 related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0644"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91292"
FT                   /protein_id="CBL91292.1"
FT                   /translation="MKKIQIKSGVNLVVLPTTQFKTMHIAVDFAAPLLDVDKVSARSLL
FT                   TYLTAVSSNKYPSQQMVAQKTIDLYGAQYQTDVMRFGQTHHVRYTLQIPAPTYIDAENN
FT                   LLHDAFDFLRDMIFNPLIMDDYFDLPIFTKEKQSLMNELDSLTDDKQRYAMSKLRELTY
FT                   DLPAMTISSSGRTSDVESLTSKGVYQVYQDMINNDTINIVVYGDIDEARVVSELTTWPL
FT                   LARQEQSLKPFYRQELLSETNELTDLQADINQAIMTMSYRLAIAPSDPRRFVALVMNAL
FT                   FGGSPLSKLFTIIREKESLAYSIYSRWQHDTGFITVAAGLDADKVAQTDTMIQAQITAI
FT                   QVGDFSEETLSAIKASLINDYLSQQDSPASEIGLVFSRLLTNRETTVAAWIAAVNAVTS
FT                   ADVSKMAREVVLQSRFTLMPEVLS"
FT   CDS_pept        661923..663194
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0645"
FT                   /product="zinc protease M16 related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0645"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91293"
FT                   /protein_id="CBL91293.1"
FT                   /translation="MIEKKYKRLKEKVITETLSNGLKVVMIPKKSYHKTFAVITTPFGA
FT                   LDQRFQINNDKPVDIPAGTAHFLEHKLFEKEKSDAFTRFGELGADANAFTNAYQTSYLF
FT                   STTQNLNLALIHLLDFVQTPYFSEKTIAKEQGIIGQEIQMYDDDPNWSVYMGLMGLMYP
FT                   SAPLSEDIAGTKESILKITPALLYNIHRAFYQSDQLTLQIVGNFDPDEMLRVVRDNQTT
FT                   KTLEKINVKTFQAPINQPKIIQETKKFDVSRPKIGFGMRLPTNARTGKEATKFVLAADI
FT                   LSDILFGEQTDWYQNLYNKGIIDTEFETSFDLLRNYQFMTFFAETTEYEALTVAINNQL
FT                   TEYKKNLDGKELVFESLRRATLGEGIQRLNSLESIALRGDDVLFGTNLFDKIMLLQDLT
FT                   YNDILDTAEELYKNAKLQRFVLQK"
FT   CDS_pept        663208..664086
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0646"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0646"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91294"
FT                   /protein_id="CBL91294.1"
FT                   /translation="MSEILTNQIGEQLKAARLKKNLSLDDVQASTKIQEKYLEAIENNN
FT                   LGILPGDFYVRAFIRQYALAVDLNPEDLLGEAGPASISRSKDLNRAHRDNDGVVRAGID
FT                   TTRSAKSQISSMLPTIWIGIIVFLVLVGIWFVLTHLNTGSQQSNGGGDVSISSSTVPDS
FT                   TSSSQSSASSPRKKATKKAVAPKMKLGTPEQNTAQQTTIYNLSKQNTRQHTIKITAQNT
FT                   GTNVQVTADGDVLLNEVITADKTITVPKGTGVVNVQFTNVANAVMTFDSQRINVISTST
FT                   PFWNVLMNLNN"
FT   CDS_pept        664096..664677
FT                   /transl_table=11
FT                   /gene="pgsA"
FT                   /locus_tag="LEGAS_0647"
FT                   /product="CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0647"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91295"
FT                   /protein_id="CBL91295.1"
FT                   /translation="MNLPNKLTVFRIILIPIFILILTIPYDWATITTMTVVLPVNWLMA
FT                   AIVFAVASATDFLDGKIARSQHLVTNFGKFADPLADKLLVITALIFLTSFHVVPAWMTA
FT                   VIVIRELAITGLRTLIVENNGQVLAAQMPGKIKTFSQMFAIFFLYIKNIPFIYFGFPVG
FT                   DILLWIAVIFTIYSGIDYFWQNRYVFSDGM"
FT   CDS_pept        664812..665957
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="LEGAS_0648"
FT                   /product="RecA protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0648"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91296"
FT                   /protein_id="CBL91296.1"
FT                   /translation="MVTKKTTKKDDKENQAKGRKTALDEALKKIEKNFGKGSVMFLGEN
FT                   TLTQIETYPSGSVKLDVALGVGGYPKGRIIEVYGPESSGKTTIALHAVAEVQKAGGTAA
FT                   YIDAENALDVKYAEALGVQKDELLLSQPDTGEQGLEIADALVQSGAVDIIVIDSVAALV
FT                   PRAEIEGEMGDSHVGLQARLMSQALRKLAGTLNRTGTIAIFINQIREKIGVMFGNPETT
FT                   PGGRALKFYSTIRLEVRRSTQIKDGTDVTGNLTKVKVVKNKVAPPFKVAEVDIMYGKGI
FT                   SQTGEILDLGAEQEIIRKAGAFYYYNDIKIGQGREKAKEFLDAPENAEMRQEIYVKVRN
FT                   AFGIGDGETSADESTNDDISDSEPETLNLATDDDLTDEPIV"
FT   CDS_pept        666072..666761
FT                   /transl_table=11
FT                   /gene="phoP_pnpR"
FT                   /locus_tag="LEGAS_0649"
FT                   /product="alkaline phosphatase synthesis transcriptional
FT                   regulatory proteinphoP"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0649"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91297"
FT                   /protein_id="CBL91297.1"
FT                   /translation="MTKILVVDDEPAISTLLKYNLEQNGYQVTIATDGQSAYELIGEQT
FT                   FDAILLDLMLPVMDGMTVLKNLRQDKIATPVLLVTAKGDEFDRVFGLELGADDYITKPF
FT                   SLREVLARLKAVLRRSQTERSTSDKPDVIEIQDIVIDDNKKVVTKSGKNLTLTPREYEL
FT                   LLYFSQRVGRVIDRETILTAVWGYEFVGESRMVDMHISNLREKVENNPKSPQILKTVRG
FT                   FGYTMVN"
FT   CDS_pept        666943..667848
FT                   /transl_table=11
FT                   /gene="pstS1"
FT                   /locus_tag="LEGAS_0650"
FT                   /product="phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91298"
FT                   /protein_id="CBL91298.1"
FT                   /translation="MNKTVIGVVGGVVVIAAGLAIYANSNSHTDKKTTVSTTKKLSGKV
FT                   LSLGSTALQPLAEQVGTSFQEKNPGVTITVQGGGSGAGLSQVSNGSVQIGNSDVFAEEK
FT                   DGVDASKLKDHQVAVVGIAPVVNSDVQVSNISKTQLRDIFTGKITNWKEVGGKDEKIVI
FT                   INRATGSGTRSVFEKNVLDGQNAVQSTEQDSNGTVQKIVSTTPGAISYLAFAYLDASGI
FT                   KALDVDKVTPNKKNVEDNSWPIWAYEHMYTKGTETEATKAFLKYFATKEVQKTIVPKLG
FT                   YIGLTDMKVTRDATGKVENK"
FT   CDS_pept        667919..669274
FT                   /transl_table=11
FT                   /gene="phoR_pnpS"
FT                   /locus_tag="LEGAS_0651"
FT                   /product="histidine protein kinase, sensor protein '"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0651"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91299"
FT                   /protein_id="CBL91299.1"
FT                   /translation="MTKKIFKYLSFLVPNLIMSAILGKTMSFDRQQWVIMVVFLLIATA
FT                   SGILVAQFWEKVQQTELQVMQNRMLATIQGQEPRGVLTEPNSPHYDLIHQFNTLQNYIK
FT                   QTQRTAQRDVTNYQSLLASLPVGVINVNRRHIIDVFNTTAADLLGVQQPKIPIAESLVI
FT                   KQFTLSELMTQTFNTQHNQQSILNLQINGEVKQYEVSTLYHQGDLKHAEVMIIIYDLTS
FT                   VLQIERMQSDFLANASHELKTPLTAITGFVETLQGPAGEDPNTRKQFLKIVADESERLS
FT                   SLVIDILSLSRVKQKNDAVDTKLIIKNVVDEQWQHIKTMAATKHITFKNNVSQNFVVHG
FT                   LKTDLETILQNLIVNAVKYNKQGGDVTVSVYKDHQHWQINIKDSGIGIPKNQQSRIFER
FT                   FYRGDESRQRTIANGTGLGLAIVNEIVSKHNGEVKVNSQVGVGTTISVTLPL"
FT   CDS_pept        669372..670253
FT                   /transl_table=11
FT                   /gene="pstS2"
FT                   /locus_tag="LEGAS_0652"
FT                   /product="phosphate ABC transporter, substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0652"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91300"
FT                   /protein_id="CBL91300.1"
FT                   /translation="MSKSHHGTIVATIVAVSIAAALGTAYATRDKSASETSITAVGSTA
FT                   LQPFVEAAGEEYAKINLGTFVNVQGGGTGTGLSQVAQGAVDLGNSDVFAEEKEGINANR
FT                   LVDHQVAVVGIAPLLNKDIGLKDLSTEQLQAIFTGKVTNWQQVGGKNQKIVIINRAAGS
FT                   GTRATFEKWGLLGKQSIEAQEQDSSGMVRSIVATTPGAISYAAFGYIDDTIVAASVNHV
FT                   SPLNKNVASGMYPIWSYEHVYTNGKPTPEVAKFLNYLTSKEIQSTLVPKLGYISIHDMR
FT                   VTRQLNGNIIKK"
FT   CDS_pept        670382..671305
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="LEGAS_0653"
FT                   /product="phosphate ABC transporter, permease protein PstC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0653"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91301"
FT                   /protein_id="CBL91301.1"
FT                   /translation="MDNITQKLMQKSESTKKDSLGRAVSLAALSLIVIVVVSIFAFVMS
FT                   RGLSTFFHDGVHVKDFLFGSTWNPSVVNPQTKQPYIGALPMILGSFLVTFLAAIVATPF
FT                   AIGTSLFMTEIAQKRGAKIMQPVIELLVGIPSVVYGFIGLTVVVPFIRSVFGGSGFGIL
FT                   SGTIVLFVMVLPTITSMTVDTLKSVPRHYRESALAIGATRWQMIYKVVLRAATPGILTA
FT                   IVFGMARAFGEALAVQMVIGNAALMPHNLTSPASTLTSILTMGIGNTVMGSLQNDVLWT
FT                   LAMILLVMSLVFNLVVRAIGRKGEMK"
FT   CDS_pept        671305..672189
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="LEGAS_0654"
FT                   /product="phosphate ABC transporter, permease protein PstA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0654"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91302"
FT                   /protein_id="CBL91302.1"
FT                   /translation="MNAKSADKIATAVIYMIAGIVALILIAMLAFILIRGVPNLSWHFL
FT                   TSPARAFEAGGGIGIQLFNSFYLLILAMLISFPIALGAAIYLNEYSKKGRFTTVVRTAI
FT                   EILSSLPSVVVGLFGFLIFVVQFHFGFSILSGAIALTFFNLPLLTRSIETSLAQIPNLQ
FT                   REAGSALGLSRWETVIHIILPAAVPSIVTGVVLSAGRVFGEAAALIYTAGQSAPALNFT
FT                   NWNPFNISSPLNPMRPAETLAVHIWKINSEGIMPDANAVSAGASAVLIIVVLLFNLSAR
FT                   KIGAQLYKKLTSA"
FT   CDS_pept        672262..673101
FT                   /transl_table=11
FT                   /gene="pstB1"
FT                   /locus_tag="LEGAS_0655"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0655"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91303"
FT                   /protein_id="CBL91303.1"
FT                   /translation="MVNNIDLKPASEFITENKPERYIYDVGAGDHEIAISTKDLQVSYG
FT                   QNLALSEGDLSFERYKITSLVGASGSGKSTFLRSLNRMNDSVATVKGNIMYRGVDINTK
FT                   AIDVYEMRRHIGMVFQRPNPFAKSIYNNITFALTQRGQYTKQELDEIVETSLKQAALWD
FT                   QVKDELDKSALALSGGQAQRLVIARALALKPDILLLDEPSSALDPISSAQVEDTLLKLK
FT                   NQYTIIIVTHNMQQAARISDYTAFFHMGKVIEYDLTRKIFTRPKVELTNDYISGNFG"
FT   CDS_pept        673098..673868
FT                   /transl_table=11
FT                   /gene="pstB2"
FT                   /locus_tag="LEGAS_0656"
FT                   /product="phosphate ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0656"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91304"
FT                   /protein_id="CBL91304.1"
FT                   /translation="MTDIKQKNILETRDVKLWYGQKEALHGINLNFPEKGITALIGPSG
FT                   SGKSTYIRAINRMHDLEDNVTVTGSFDFKGTDIYAPTTDTVDLRKRIGMVFQQPNPFPF
FT                   SIYENVIFGLKLAGIKDKAVLDEAVEKSLKQASIWEEVKDDLHKSALGLSGGQQQRVSL
FT                   ARVLATSPELLLLDEPTSALDPVSSHNIEETLLNLRDDYAMIIVTHSMSQASRISDRTA
FT                   FFLNGNLVEVDATKHIFLNPQSQETQDYVSGRFG"
FT   CDS_pept        673932..674606
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="LEGAS_0657"
FT                   /product="phosphate transport system regulatory protein
FT                   PhoU"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0657"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91305"
FT                   /protein_id="CBL91305.1"
FT                   /translation="MRRLFDEELADLDNSFTEMGMLVAQTIQKSVQSFVDHDREGAKAI
FT                   LDNDHQINEREAAIEKKTFEMIALYQPVTTDLREIVTILKAVSVLERMGDQARNIANST
FT                   IRVKGTKHISSVEQALGEIGEQVATMVSTVMDYYIKNDALGAESIAEENQTLSKRAAQV
FT                   RFDSVEGMKEDADLVDSAADYLVIAGYLKRIGDYTTDIAEWIVYKRTGKIIELNPGYNY
FT                   FI"
FT   CDS_pept        674781..675137
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0658"
FT                   /product="Integral membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0658"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91306"
FT                   /protein_id="CBL91306.1"
FT                   /translation="MRFFARLATTMLVFLVISSLFSEAFRVDNWMTALGAALVLAVLNT
FT                   IIKPILTILTLPLTFITFGLFTIVINGIMLEITADLVGGFDFSSFGWAMFTAIILSIVN
FT                   TLLTSDLHVHVERK"
FT   CDS_pept        675139..676101
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="LEGAS_0659"
FT                   /product="HPr kinase/phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0659"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91307"
FT                   /protein_id="CBL91307.1"
FT                   /translation="MAQNSVTVKQLVDNTRLEIVAGKQYLERVITTADISRPGLEMTGY
FT                   FNYYAPERVQLLGITETSFSERMGHEELLMVFRRMADPVTPAFVVSTGLPISDELKQAA
FT                   DEAKIPILTSTLTSSRILSNMTYYLGGQLAPRENVHGVLIDVHGLGVLITGDAGIGKTE
FT                   AALELIQQDKARLVADDRVDIYQEDEERLIGEPNEVLRNMMEIRGVGIIDVQQVYGAVS
FT                   VRSHATIALNIHLSNGKIGEANFDRLGNDNDTLEILGVKIKRMVVPVTPGRNTASVIDA
FT                   AAVKFRTANMGIDALKTLEERMSVEMVKNEKIDLENKHD"
FT   CDS_pept        676094..677104
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="LEGAS_0660"
FT                   /product="glycerol-3-phosphate dehydrogenase [NAD(P) ]
FT                   (NAD(P)H-dependent glycerol-3-phosphate dehydrogenase)
FT                   (NAD(P)H-dependentdihydroxyacetone-phosphate reductase)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91308"
FT                   /protein_id="CBL91308.1"
FT                   /translation="MTKIAVLGAGSWGTALANTAAENGHDVRLWTHNLNQVEEINQQHT
FT                   NSKYLPHATLVDALVATNDMFLAIENVEIVLSVVPTKAVREVAKKLATALEEQAHTVIL
FT                   AHATKGLEQGSYKRISEMIAEEVPEAYRSALVVISGPSHAEDVIKHDLTAVSIGSSDES
FT                   AAKLLQKALSNETFRAYTNHDLLGSELFAALKNIVAIASGALIGLGYGVNAQAALLTRS
FT                   LVEMRDLGAAMGAKPETLYELAGIGDLIVTGMSPNSRNYRAGLGLGKGKNVQQVTEEMG
FT                   MVIEGVNTTKAVYDFSKMYHVDMPITSAVYQVLYENKPLRTAVADLMARPLKSED"
FT   CDS_pept        677147..678019
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="LEGAS_0661"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0661"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91309"
FT                   /protein_id="CBL91309.1"
FT                   /translation="MKPVRKAIIPAAGLGTRFLPATKALAKEMLPIVDTPTIEYIVREA
FT                   IASGIEDIVIVDGKSKRSIEDHFDSNPELENNLRDKGKDELLKIVQETTDINMYFIRQS
FT                   HPKGLGDAVLTAKAFIGDEPFVVLLGDDLMEDDVPLTKQLIQRYEETGESTLAVMKVPH
FT                   DQVSEYGVIDPAAEASDGLYRVKSFVEKPKPEDAPSDLAIIGRYLLTPEIFEELENTQP
FT                   GKGNEIQLTDAIDSLNNRQHVYAHEFKGSRYDIGSKIGFLETNIEFGLKHPQTKDQLRA
FT                   YIKELAAKL"
FT   CDS_pept        678147..679100
FT                   /transl_table=11
FT                   /gene="trxB"
FT                   /locus_tag="LEGAS_0662"
FT                   /product="thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0662"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91310"
FT                   /protein_id="CBL91310.1"
FT                   /translation="MAKDKQYDVVIIGAGPAGMTAATYASRANLSVLMLDRGIYGGQMN
FT                   NTAEVENYPGFDSILGPDLSEKMYASSTRFGAEYGFGTVENIEIDGHNKIINTDMGRYI
FT                   AKAIIIATGSEHVHLGADGEEAYQGRGVSYCAVCDGAFFRDEDVVIVGGGDSAIEEGLY
FT                   LTNIAKSVTVLHRRDSLRAQKIIQDRAFANDKMSFRWHTEVIEITGDSDKVTGVRVIDN
FT                   QTHEVSQINTSGVFVYVGLKPNTQGFENLDITNDDGWVITDEQMRTGIPGVFAVGDVRA
FT                   KELRQITTAVGDGSIAGQGVYDYISALPAAVNEQVI"
FT   CDS_pept        679120..679236
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0663"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0663"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91311"
FT                   /protein_id="CBL91311.1"
FT                   /translation="MKKLSFFVDLFFIIFFSSISHKNTNILVILILKTDENL"
FT   CDS_pept        679380..680573
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0664"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0664"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91312"
FT                   /protein_id="CBL91312.1"
FT                   /translation="MQSQDKWITKIAFLGISFMLTSAYAINGAMPQMTKALGVSATQVQ
FT                   ALATTPSIVVTVFVLLSSFIAAKLGDKKTIMLGMLLVGFAGIVPFFVTSYPIILVSRMV
FT                   LGAGFGIFNSLAVSMIAVMYQGQTRATMLGWRAAVEQIGQAVLTFIAGLLLNFGWQTTF
FT                   LVYLLAFPILYLFYVRVPDTTEMLAADQKNNKKTHINRNVPQNISPLVWVLTLFAAFIV
FT                   IDYMAIQLSFPFMAQSLGVSGLLVSTILSLMLVAAMVGGLVYGGMQKLFGRFTLQVGLL
FT                   LMVLSNFLVAFSNGNFVTLTIGVLLIGFPMQLISPFIFSQLPNLAPLKKQPFVTSIVLI
FT                   GFNVGVFVEPFALSLLAKIMGNETHSVSEAAYTTIPLLGIILLIIAGVTFITNRKRA"
FT   CDS_pept        680675..682126
FT                   /transl_table=11
FT                   /gene="gftA"
FT                   /locus_tag="LEGAS_0665"
FT                   /product="sucrose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0665"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91313"
FT                   /protein_id="CBL91313.1"
FT                   /translation="MKKLTNEAMLITYADSLGKNLKELNQVLSNELNGVVGGVHVLPFF
FT                   PSTGDRGFAPEQYETVDPKFGDWSDVDKLADKYYLMFDFMLNHISPQSKYFQDFLEKKE
FT                   ASEYYDMFLKYSDFWPENRPTDADIDLIYKRKDKAPFAPVTFADGTTDQVWNTFGDQQM
FT                   DLDVTKEVTKKFIKDSLVNLAHHGASVIRLDAFAYAIKKLDTNDFFVEPEIWAILDEVR
FT                   EILAAEGSEVLPEIHEHYKIVRKITEHDMYSYDFALPLITLYSLYSGKTERIADWLRQS
FT                   PMKQFTTLDTHDGIGVVDAKDLLTQEETDFTTEEMYKVGANVKKIFSSAAYNNLDIYQI
FT                   NTTYYSALGNDDAAYLLARAAQIFAPGIPQIYYVGLLAGENDIELLENSKEGRNINRHY
FT                   YDLAEIAETTKRPVVSNLFDLLRFRNTSAAFDLDGSIDVVNDGENELTVSRTSADGKTT
FT                   AVLDANFATKSFTVTENGKEIFTTK"
FT   CDS_pept        682190..682525
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="LEGAS_0666"
FT                   /product="Putative selenite transport protein DedA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0666"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91314"
FT                   /protein_id="CBL91314.1"
FT                   /translation="MLILASDLPHFLIEILSADNPFSTSKLIILFLLIFIETAGIVTGF
FT                   IPGDTILTTAGGLAGTHHNFGELMAYIAVFSLASFLGDAVNYWFGAFLMKQISKIPFLK
FT                   RHLQGGC"
FT   CDS_pept        682519..682845
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="LEGAS_0667"
FT                   /product="Putative selenite transport protein DedA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0667"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91315"
FT                   /protein_id="CBL91315.1"
FT                   /translation="MLDKLATNFHPKRWLLFVVLGRFLPFIRVVVSLLARRLALPFVSY
FT                   IRMAAFASVLWSAVIVSAGYFIGHLNIPSDMLLIIVVGIAIVFILALRVPKFRQAIVNL
FT                   FVRK"
FT   CDS_pept        682891..684591
FT                   /transl_table=11
FT                   /gene="pgm"
FT                   /locus_tag="LEGAS_0668"
FT                   /product="Phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0668"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91316"
FT                   /protein_id="CBL91316.1"
FT                   /translation="MIYQEQLAKWEAATLPEYLAKDLAHYTPEQQEDAFYQNLSFGTAG
FT                   MRGVLGAGTNRMNIYTVRQVTEALARYIDDQGNAAKTSGVAISFDSRHFSPEFASDAAQ
FT                   VLSAHGIKAYLFSSLRPTPELSFAVRELGTFAGIMITASHNPKEYNGYKVYGADGGQMV
FT                   PEAVDAVVSKLENIQDVFNIALDESNAYVQVIDSEIDDKYLANVATVTVNPELVAKEGA
FT                   SLKFVYSPLHGTGQYIGEKALQQAGFTNYTIVKEQAVIDGDFPTVKKPNPEDAAALAMA
FT                   IDYAKREGADAVVATDPDADRMGAAVKLADGTFQVLTGNQIAAVLVNYLLTAKKETNTL
FT                   PENGVIVTSIVSSRFASKVAESFGVITEDVLTGFKYIAATIDKYEATKEQTFLFGFEES
FT                   FGYLVKPFAHDKDAIQALVLFAEVAAYYKSQGKTFADGLEELFEKFGYFEEKTISLDFP
FT                   GIHGNDEMGAIISQFRDKQPDTIGGLKVIRAQDFSKSIETTVNGKITTLPQPKANVLKY
FT                   WLEDGSWVAIRPSGTEPKLKFYIGVESDSQVASQSKIDVMTKDLMSYTK"
FT   CDS_pept        684713..685072
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="LEGAS_0669"
FT                   /product="50S ribosomal protein L19"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0669"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91317"
FT                   /protein_id="CBL91317.1"
FT                   /translation="MRQNSILENITSVQLRSDIPDFRAGDTVKVFAKIVEGSRERIQLF
FT                   EGVVIKRKGAGIQATYTVRKISSGVGVERTFALHSPRVEKIEVIRFGAVRRAKLYYLRA
FT                   LQGKAARIKERRRDV"
FT   CDS_pept        685432..686517
FT                   /transl_table=11
FT                   /gene="dinB"
FT                   /locus_tag="LEGAS_0670"
FT                   /product="DNA polymerase IV"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91318"
FT                   /protein_id="CBL91318.1"
FT                   /translation="MVEFMITNDTRKILHVDLDAFYAQIEMRDNPELRHKVLIIARDPE
FT                   ETGGRGVVATANYAARKLGVHSAMSASEAKKLAPHAVFLSPNFTKYRAVSNQIHNVFDA
FT                   FTKKVEPVALDEAYLDVSDLNLSGSMLAARIRHEILRVTGLTSSIGISHNKLLAKLGSE
FT                   YNKPNGVTVITTQNMLTFLDELAIGDFRGVGKKTHEKFKRLQIENGSDLRKMSYDELRS
FT                   QFGKVGEHLYYQARGVHFGEVQWQRQRQSIAKEETYDHFLHSERDIQYEFKKLAAALIE
FT                   ALKKHHRVGRTLNIKVRDDNFNTMTRAITRELPWPLSEELLTENAQNIFEDLMAPPFSV
FT                   RLLGISMGNLQSNSFEEMTLF"
FT   CDS_pept        686585..687601
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0671"
FT                   /product="Phosphoesterase, DHH family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0671"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91319"
FT                   /protein_id="CBL91319.1"
FT                   /translation="MATIEEQLLQQIKRYDTIIIHRHQRPDPDAFGSQLGLKAVLQASF
FT                   PEKHIYAVGKEVPGLSWMNEDDTFMDDIPDKTYKNALIIMVDTANSPRIDDQRWPNGLE
FT                   TIKIDHHPNDEPYGDWQWIKPGHSATSTMIYEFYETLKDQGLIMTDKAARLLYIGIVGD
FT                   TGRFMYGMDKETFRVVSELFNYKFNYEAVHHNMETITENAAKLSGYVLQNLNILPSGFA
FT                   FVVLTKALVKQFDLRESGTAFVVPLPSKIDKVKAWAIFEEQDEGNYRVRLRSRTIVINK
FT                   IANQFEGGGHPMASGAWAQTGQDVERLIKMVDSALIKQYGTEGTAQEITEKIESREI"
FT   CDS_pept        687601..688965
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0672"
FT                   /product="ATP-dependent RNA
FT                   helicase/Autoaggregation-mediating protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0672"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91320"
FT                   /protein_id="CBL91320.1"
FT                   /translation="MAETANQFGQFNLKPEIIVALTKIGFTQPTPVQAKLIPSILQGND
FT                   VVGQSQTGSGKTHTFLIPILNQLSQNEQYVQAVITTPSRELAAQITKAAKDFAESWQQN
FT                   VTISEFVGGTDKMRQIKQLEKGQPQIVIGTPGRIKDLVSTGALKLHAVHTLVVDEADMT
FT                   LDMGFLSEVDFIAGAMPDKLQTLVFSATMPEKLKPFLKKYLDNPKFEAIPVSTVIADTI
FT                   DNWLLATKSKNRNDVIYQVLSIGNPYLALVFANTKERAKEIASNLRGRGLKVAEIHGDI
FT                   EPRERRRVMKAIQNLEFQYVVATDLAARGIDIEGVSHVINDDIPDELEFFVHRVGRTGR
FT                   NGLAGLAITLYGPDEEQEVAELEALGINFKAKQIKDGEIVDVKDRRARKQRVATTKKLD
FT                   PTMVGMVKKKKKIVKPGYKRRIKSAIQRKDQMDRRISKREEMRATRKENKKRGDR"
FT   CDS_pept        complement(689003..689842)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0673"
FT                   /product="Putative acyltransferases and hydrolases with the
FT                   alpha/beta hydrolase fold."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0673"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91321"
FT                   /protein_id="CBL91321.1"
FT                   /translation="MKNRIVLTLILILSLILMVFLGIYGQHWVSETSTHQSKIKNSHMT
FT                   PVIFVPGSEATVNRFDHLLSEINASGPTHSVLKVKVNQDGELIYTGKINANDRQPFIVI
FT                   GFQNNEDGYNNIKKQTQWLTSALYALQDRYHFQTFSAVGHSNGGLIWTNFFEKYFDSDD
FT                   FSIPTLMTLGTPFNFSETSLQRRTEMLKDFIQDNSKIPSHLTVYSIAGTEDYTDDGIVP
FT                   IQSVIAGKYIYQKRVKSYTQITVTGDNAQHSNLPDNPEVMKLIQSNIITPLSRRDRH"
FT   CDS_pept        complement(689832..691052)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0674"
FT                   /product="PTS lactose/cellobiose IIC component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0674"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91322"
FT                   /protein_id="CBL91322.1"
FT                   /translation="MLNRLINTVQNLDEALYHRPFLQAISIAMQQSVPILAIDIYCRLF
FT                   FKLAISPDALLANIFYDYPIIPDSVSDQLMFIIQNLDVAVTMIFVIGLTYHYLTQKGIE
FT                   NTTLPIITNFIAIYMLLFAKNQSTTNTAIHYLLVTLFTLLSCFTYYWYYRRLKTTTSPF
FT                   SLKYLLWATTMIFASLLLHIGLHLSSITTIISNLLSKNFFTTFSGLLLISILSPLLFIV
FT                   GFSLPSELSSNQTSFNAMISNLDKFLTHGLATSPLPFPENLYSIYGAFTLFGGVGNTLA
FT                   LNILLLFTISKKYKRLSILSWFPSLFDNNYLLYAGLPMFLRPLMLVPMLLVNITSMLIS
FT                   YVAIAGHIVQPAIFITPNNLPNMLLPTLASATPIRSTILAILIFSVSLLIYRPFLKRLT
FT                   TEVTHEK"
FT   CDS_pept        691208..691348
FT                   /transl_table=11
FT                   /gene="dltX"
FT                   /locus_tag="LEGAS_0675"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0675"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91323"
FT                   /protein_id="CBL91323.1"
FT                   /translation="MIKQFFQRPIVNFISRTLFYFIIILVLIYLYSYSGVGEGHFIYNE
FT                   F"
FT   CDS_pept        691364..692896
FT                   /transl_table=11
FT                   /gene="dltA"
FT                   /locus_tag="LEGAS_0676"
FT                   /product="D-alanine-activating enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0676"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91324"
FT                   /protein_id="CBL91324.1"
FT                   /translation="MIIKNIMTAIDTIAETQGHTIAYDELGNTHTYEQLKKYSDSLASF
FT                   IENLHVADKAPIMVYGGQQFDMIASFLGSVKAGHAYVPVDVNSADERLTDIIEIGQPAL
FT                   IIAVDELPIEVADVTVINKTQLTEIFNTGNAFKMTQPVVGDENFYIIFTSGTTGKPKGV
FT                   QISHDNLVSFASWMLGETFDWQSGSNVLSQPPYSFDLSVMDWIPTLLAKGTLKALPKES
FT                   ADDFKALFKILPSLQLNKWVSTPSFADVALLDPEFKQQNHPNLNAFFFCGEVLTSTTAQ
FT                   KLLDRFPDAKVYNTYGPTEATVAVTGLQITQDVIASYDKMPIGYVKSDTKIMIQDSDGI
FT                   AVSEDEAGEIVIVGPSVSKGYLNNPEKTAATFTVIDGQQAYKTGDLATRDVNGLLHYKG
FT                   RSDFQIKLHGFRIELEEVAQQLQQSQWVEQAVAVPRYDADGKVKQLLAIIVAKNNTFEK
FT                   PILLTNAIKSELENIMMPYMVPSRFMYREALPLTPNGKIDLKGLISEVNNNA"
FT   CDS_pept        692889..694094
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="LEGAS_0677"
FT                   /product="protein DltB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0677"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91325"
FT                   /protein_id="CBL91325.1"
FT                   /translation="MLNLQPYADPKYFIFLLVALLPLAIGLYFGKRLNWYEVVVSVIFI
FT                   FLMFDGHKYHEGFALIGYIIWQWLLVWAYTLYRKKNNQAMVFYGAIVLAILPLVLVKVA
FT                   PDAHWTHVTSLLGFLGISYLTFRSVAMIMETRDGAIKEFNPWLFLRFMLFMPTISSGPI
FT                   DRYRRFIKDITTVPDRTKYISMLEKAVWYFFLGFLYKFIISHILVDELLPKITDLALQD
FT                   ANLHNGWTWWLVPYMYTWGLDLFFDFAGYSLFAVATSYVMGIELPMNFNKPFLSKNLKD
FT                   FWNRWHMSLSFWFRDYIFMRLVFLIMKKKWIKSRVTVSNIAYIANMLIMGCWHGLHWYY
FT                   IAYGLFQGVGMVINDAWLRYKKKRNFPHNKFTEAFAIVITFNVVMFSFLLFSGFLDTLW
FT                   FK"
FT   CDS_pept        694123..694359
FT                   /transl_table=11
FT                   /gene="dltC"
FT                   /locus_tag="LEGAS_0678"
FT                   /product="D-alanyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0678"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91326"
FT                   /protein_id="CBL91326.1"
FT                   /translation="MAVKEDVIDILNTIIGEDISDQMDDDFFDSGLLDSMATVELLLDL
FT                   ESKFDIQAPVSEFNRDEWNTPNKVIVKVESLIG"
FT   CDS_pept        694365..695648
FT                   /transl_table=11
FT                   /gene="dltD"
FT                   /locus_tag="LEGAS_0679"
FT                   /product="D-alanyl transfer protein DltD"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0679"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91327"
FT                   /protein_id="CBL91327.1"
FT                   /translation="MKKRGLWWIFGPVVVAFVLIFALFLAPFSLNHITHKNIRDASVSF
FT                   SKNTFKGEAIKTAAFSDHSKRYVPFFGSSELLRLDTMHPSMLAAKYHRNYQPFLLGQAG
FT                   TESLTHYLGMQEMPHALHKKQAVFIISQQWFTKKGTKLSFPEFYSPLQTVDWLRNINHI
FT                   TPTDRFIAGRLLEQKQIKESDFYAALITKISDNKPLSKTDINLLSVRHRVLLREDQLFS
FT                   NFSHSSNWDKHVEPALKILPKQDNNSSLLREATKIGKKETTNNEFQIKNSFYKYRVKLR
FT                   LKQLAHSQKKFDYRQSDEYADFQAVLAEFAKQHTDVLFIIQPVNQRWSRYTGLNQDMYY
FT                   QSVNKIKKQLTTQGFNNIVDFSHNGSANYFMQDTIHLGWNGWVAADRHINPFLTNGYKP
FT                   TNYHINNNYLSHDWQNLMPTADNLEQFK"
FT   CDS_pept        complement(695724..696443)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91328"
FT                   /protein_id="CBL91328.1"
FT                   /translation="MNSYDYDKILQTNFQVNSFALTLLRDGLLKNLLQEDYPHILYWAG
FT                   KEIARQFPTDALSSVVTFFDNAGFGTIEIASQDSKNQRWYLTGDLVKQRLGLDKSADFS
FT                   LEAGFLAQQLETQTGAIAEATFKLMKKNEGVSFEVVTDLNETVDVSDIKQRVAARESFL
FT                   RQTHENIEHAKIINIRDDGDISHEQSITDSLLAFKFDDIDLPKEAPTSLSAMSGDDTID
FT                   PFNFPTSTDAESQSPFS"
FT   CDS_pept        696534..697994
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0681"
FT                   /product="Glutamate racemase/Nucleoside-triphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0681"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91329"
FT                   /protein_id="CBL91329.1"
FT                   /translation="MNKNNPIGMIDSGVGGLTVIKEAQKQLPNEQFIFIGDTARMPYGP
FT                   RTTDEVIAYTFQMANYLITEKQIKMLVIACNTATACALTVLQKKLTIPVIGVIQPGAQA
FT                   AQLATKNKTIGIIATDGTVNSKAYELQIHQYGADTKVLSQGEPDFVQLVEANKYQDHAT
FT                   RDIVMNHLAPFKAAGIDTLILGCTHFPLLEPFIREAVGKQITLIDSGRETIYAIKQCLN
FT                   KLALNSDIKHNHDEDIYYTTSDSDDETFKVIATNWLARIHELDVRHLKIVDNGTLQHLE
FT                   EISMPRLILASNNQHKIIEIEAILNDIGINLTVTPLNSLGDSVPEIIEDGTTFEENATK
FT                   KAMTIAKIAPNDYILADDSGLSIDALNGEPGVYSARYAGDHDDQANNDKVLNKLEGITS
FT                   REAQFTSVLVLVGPNKPKLVATGTVRGLITDQRYGDNGFGYDPLFLVPQFDKTFAQLTA
FT                   NEKNQVSHRGLALQELGKHLPEWLKGGV"
FT   CDS_pept        698032..698568
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0682"
FT                   /product="Phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0682"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91330"
FT                   /protein_id="CBL91330.1"
FT                   /translation="MSKFLIVSDNHGDREILSDIIARWRPQVAGIFFNGDSELSAKDTV
FT                   FDGVSTVIGNMDYDPDFVEARATTIDQVTFFQTHGHLYHVTVFNGWANLELLDKAALES
FT                   DAQVVLFGHTHVDGALAYNGKLFINPGSTSLPKGPRSIIGGTYAILIVESDKFIVHFYN
FT                   RSHVLLDNLTVEMAR"
FT   CDS_pept        698624..699682
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="LEGAS_0683"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0683"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91331"
FT                   /protein_id="CBL91331.1"
FT                   /translation="MVNQQEPQFNQWYDENTAADQLIHDAAANEAEQSNEFSLRPQFLR
FT                   EYIGQAALKEELNVYISAAKQREEALDHVLLFGPPGLGKTTLAMIIANEMAVHIKTTSG
FT                   PAIEKPGDLVALLNELEPGDILFIDEIHRLPTNIEEIMYSAMEDYFVDIMVGQGPTARA
FT                   VHFPLPPFTLIGATTRPGMLSKPLRDRFGIINAMAYYTPEELQEIVVRSSDIFNAPIKL
FT                   AGAYEVALRSRGTPRIANRLLKRVRDFAQVEGKSAIDKAIVDIALDKLRVDNRGLDETD
FT                   HKFLGTMIEYYKGGPVGLNTIAANIGEEAETLESMVEPYLLQIGFLQRTPRGRVVTESA
FT                   YAHLKIPYQREQ"
FT   CDS_pept        699682..700542
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0684"
FT                   /product="putative phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0684"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91332"
FT                   /protein_id="CBL91332.1"
FT                   /translation="MQYIMSDTHFNHEKILYFDQSRAESLRALNIEPTIKNMDSYLETT
FT                   WNNVVKDEDTVYFLGDLGMFRKKQDFIAQLTRLNGHIVFFKGNHDHSDQLKAAVKASET
FT                   GIVEVVDTAKAVKINGVQVWLSHYAIDLPYPMLSVHGHIHEAEYQSDGMINLSLDSDYM
FT                   QTRRFGAPISFDELTPLLVARQKKIAEHYQIESENKRYDRLIERAFDETITINKPTANQ
FT                   RHELALLVDYLNTNELTYADVLKAFNIPNEDKVLSNQEKEKVALTGFEFEKKINLQGNI
FT                   GEKND"
FT   CDS_pept        700535..701596
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="LEGAS_0685"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0685"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91333"
FT                   /protein_id="CBL91333.1"
FT                   /translation="MTEEQHYQLADFDYDLPETLIAQTPLKQRDSSRLLVLDADTGLYE
FT                   DKHFYDILDYVNPGDAIVMNNSRVLPARLHGVRPETGGHAEVLLLRQDHGDVWETLVKP
FT                   AKKSPVGSTIFFGNDIDNPVMTATVVGELEHGGRYIEFHYEGIFMELLEKLGEMPLPPY
FT                   IKEKLADQERYQTVYSKVDGSAAAPTAGLHWTPELLDKVRAKGVQTIELTLHVGLGTFR
FT                   PVEEENIEDHKMHSEFYQLSSEAADALNKVHATGGRIIATGTTSIRTLETIGSKFNGQL
FT                   QADSGWTDIFIKPGYQWTTVDAFITNFHLPKSTLVMLVAAFTGRDNILNAYQHAVNDKY
FT                   RFFSFGDAMFIKR"
FT   CDS_pept        701716..702306
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="LEGAS_0686"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0686"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91334"
FT                   /protein_id="CBL91334.1"
FT                   /translation="MYEYINGLITNIYPAYLVICDRSGVGYKLFVANPYRFEQNVESHV
FT                   YVEQIVRENEITMYGFIDENEKILFNKLLNVSGIGPKSALAILASDDSVGLVNAVANDD
FT                   ATYLTQFPGVGKKTAQQIVLDLKGKLDDLAASVGMTTPVSQPNSNQALSDALEALNSLG
FT                   YSTKEIAKLEKTLAAKHDTTDGYIRSALKLLVN"
FT   CDS_pept        complement(702350..702982)
FT                   /transl_table=11
FT                   /gene="dgk1"
FT                   /locus_tag="LEGAS_0687"
FT                   /product="deoxyguanosine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0687"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91335"
FT                   /protein_id="CBL91335.1"
FT                   /translation="MVIITAGMIGVGKTTLTGLIAEHFGTKAFYEPVGDNPVLPLYYSD
FT                   PKQYGFLLQIYFLNRRFDMIKKALADDNNVLDRSIYEDALFTSENHKDGNITDAEMSVY
FT                   TQLLNNMMAELQKLPKKAPDLLVYAETDFETILYRIKKRGRDYEQFENNDALRQYYFRM
FT                   WSAYRDWFDAYDASPKIKIDLQTFDLEQNKNQEVILDQIDKALKTIH"
FT   CDS_pept        complement(703080..703460)
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="LEGAS_0688"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0688"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91336"
FT                   /protein_id="CBL91336.1"
FT                   /translation="MLSEFKTFIMRGNVLDLAVGVIIGGAFTGLVKSLTNNLIGPILSF
FT                   FTGGTSDLASLKLVITKELTFKYGAFINDLINFLITAFVVFILIKVINRLFRTNKEKAV
FT                   EVNPELEILTEIRDLLEAEKKA"
FT   CDS_pept        703742..703936
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0689"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0689"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91337"
FT                   /protein_id="CBL91337.1"
FT                   /translation="MNKKEQLTIWHEQLINIINDVNTPHTLGGITNDANRAHDSRLARR
FT                   ALDNLIILSEEINAKREDN"
FT   CDS_pept        704319..704732
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="LEGAS_0690"
FT                   /product="SSU ribosomal protein S16P"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91338"
FT                   /protein_id="CBL91338.1"
FT                   /translation="MSVKIRLKRMGAKKRPFYRVVIADSRSPRDGRFIETVGTYNPITQ
FT                   PAEIKLDEEKILSWLSNGAQPSETVRNLLSNAGILAKHTESKSGKKPAAAKPAASVAKP
FT                   TEKNTVAELKAYLNAKGIEFASSAKKADLLALV"
FT   CDS_pept        704907..705503
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0691"
FT                   /product="5'(3')-deoxyribonucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0691"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91339"
FT                   /protein_id="CBL91339.1"
FT                   /translation="MVKKPKLFLDMDNVLVDTLSILNAVDMRSEKVKKPDQIPGIFRDL
FT                   PPMVGAVEAVKSLAENYELHILSTAPWKNPSAWQDKLLWLAQYFGDDNQSPFYKRVTLT
FT                   HDKSLARGVGGILIDDRPYHGASQWNDETADSLWIQYGYDDQLVWSEQLVDYLNAVAKA
FT                   YKTSGTLRLSAEAVAEHAGYQLFGQNDHFEKAHWE"
FT   CDS_pept        705644..706396
FT                   /transl_table=11
FT                   /gene="fruR"
FT                   /locus_tag="LEGAS_0692"
FT                   /product="Transcription regulator of fructose operon"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0692"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91340"
FT                   /protein_id="CBL91340.1"
FT                   /translation="MIVEERQERLLAVIQKHQFISLQELKGVTQTSISTIRRDLALLTD
FT                   KGLVKRVHGGVEFIAQNKKSSTVSERRPIYQADKQKIAKRAVQQLQGGETIFLDAGSTT
FT                   GEVIAYLADKKPAITVVTNSVHHAANLSDLMIPVLIIGGQVKQTTDAVIGAAAVEQIKN
FT                   MVFDVSFVGADGISVEFGLTTPDLEEAAVKRAVVERSHVSYVLADASKIGVASFAKAVT
FT                   LEEVVLVTTNLVSKQRDELKKVMKVLVV"
FT   CDS_pept        706410..707321
FT                   /transl_table=11
FT                   /gene="fruK"
FT                   /locus_tag="LEGAS_0693"
FT                   /product="1-phosphofructokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0693"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91341"
FT                   /protein_id="CBL91341.1"
FT                   /translation="MIYTVTLNPSLDFITRLKTLTLGETNRADSETIFPGGKGINVSRL
FT                   LGQLAIDNTAWGFLGGFTGQHLQNTLRDTHLTQDFTQIAGNTRINLKIKATNETEINAT
FT                   GPAITAQELAIFFQKFDCLTHDDVVVLSGSVPKRLDSHVYQQMLHKIQLCGARFVIDTT
FT                   GQQLKTALADRPLLVKPNRRELAQLYDTDLATQADLLRWGRQLIVDGAQHAIVSLAGEG
FT                   ALLFTQQTQYFAKPIKGQVQNSAGAGDSMIAGFIGTWLQSEDVLESFKIAVASGTATAF
FT                   SNDIATKQKIEEIYQQVIITTI"
FT   CDS_pept        707339..709258
FT                   /transl_table=11
FT                   /gene="fruA"
FT                   /locus_tag="LEGAS_0694"
FT                   /product="PTS system, fructose-specific IIABC component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0694"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91342"
FT                   /protein_id="CBL91342.1"
FT                   /translation="MKISELLLPDVMLLDLKATTKQAAFDEMIDQLYAADRITDKQEFL
FT                   KGILAREAQTTTGLGDGIAMPHAKNNAVKQPTVAFARSKNGVDYDAMDGQPVHLLFMIA
FT                   VPANANNTHLEALASLSRYLLQDGFMDKLKQAETPAKVVSLFTAQESESTEVVVDDDAP
FT                   YLVAVTACTTGIAHTYMAEEALKKHAEKLGIRIKVETNGASGVGNKLTDADIAHAQGVI
FT                   IAADKKVDMARFDGKPLINRPVADGIRKPDELIDLALRQTAPIYHSNEPRQQSTEAPQS
FT                   IGKAFYRHLMSGVSSMLPFVIGGGIAIAFAFLIDQSLGVPNSALSSLGTYHPIAAFFKQ
FT                   IGGAAFGFMLPVLAGYIAYSIAEKPGLVAGFVAGALSANGYNLYNVGLNANHAPIPSGF
FT                   LGALVGGFLAGGIMLLLKKLFQKLPKSLDGIKSILFYPVLGVLLTGFAMLLINIPMSAI
FT                   NTGLNNFLSGLDGTNAVLLGAILGGMMSIDMGGPINKAAYVFGTGTLAATVASGGSVIM
FT                   AAVMAGGMVPPLAVFVATLLFKHKFDQQERQAGLTNIVMGLSFITEGAIPFAAADPVRA
FT                   IPSFMVGSVLSGGLVGFAGIKLLAPHGGIFVIALTSSPLLYLFFIAIGAVVSGVVYGFF
FT                   KKAV"
FT   CDS_pept        709510..710034
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="LEGAS_0695"
FT                   /product="Methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0695"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91343"
FT                   /protein_id="CBL91343.1"
FT                   /translation="MIIYDTMAFLDRQLTIFKQDDALVFVSLAIDGVKEFHLFYPNEQV
FT                   MRATLIEIIDFQRYVTGRASDFSQLKINYLKGTPFQRDVWTAMHEMLPNETLTYGELAI
FT                   RANHPTAIRAVASAVGKNPLTIINACHRILPKSGGVGQYRYGSEMKQKLRQLDQAMMAS
FT                   KLTEKSDIITL"
FT   CDS_pept        710031..710552
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="LEGAS_0696"
FT                   /product="16S rRNA processing protein RimM"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0696"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91344"
FT                   /protein_id="CBL91344.1"
FT                   /translation="MTNTENYFKVGTIVNTHGIRGEVKIMAITDFAADRFKKGAELQID
FT                   TKQGFVPVKVQDSRMHKNMWLVLFEGVTNINEIEKYKTHDIYVIGGAREALGDDEYYYN
FT                   EIIGCRVIDLEDNDIGVISEIMETGANDVWVVSRDGQSDALIPMIDDVVKNVDVAGKLV
FT                   TIDALEGLLD"
FT   CDS_pept        710552..711277
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="LEGAS_0697"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0697"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91345"
FT                   /protein_id="CBL91345.1"
FT                   /translation="MRIDVLSLFPDMFTPLKQSILGKAIDKGALDFHVTDFRDYTENKH
FT                   NNVDDYPFGGGAGMLLMAQPIFDAMAAVEKQAGDKGHVVLLDPAGRKFDHHVAEELAQK
FT                   EHLTFIAGHYEGYDERIRELVDDEISLGDYVLTGGELGAMVIIDATARFLPDVLGNNVS
FT                   ADEDSFQNDLLEFPQYTRPAEFRGRKVPDVLMSGNHAKIAEWRLKESLRRTWQRRPDLL
FT                   EKRQLTNKERDLLDDVKHE"
FT   CDS_pept        complement(711647..712474)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0698"
FT                   /product="Transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0698"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91346"
FT                   /protein_id="CBL91346.1"
FT                   /translation="MQKDVTFNLIKERRKIKNISQSELGRIIGSQAMVSRIENGQILPN
FT                   LQTIHLICKTLDLTVEEYFYTYYKIGTDMTDFRNDLDEKYMSTDTTALEQQYSDIKATN
FT                   MLTLKHKHQMLMIQATIYHKAFKLASLNDQNFLLKYFDQIMRWQLYDIYLLECTLNMMP
FT                   SEKIKPYISDILVQYIRTENKVYANDIILTLIVKYLESSIVQKKDVITDWILLKLEDLK
FT                   IRENSNSKIWFLFLIALYQHDTKKINQAYTVTDYLNAPYLKKKFNLIQSIYLK"
FT   CDS_pept        712712..717040
FT                   /transl_table=11
FT                   /gene="epsA"
FT                   /locus_tag="LEGAS_0699"
FT                   /product="Dextransucrase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0699"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91347"
FT                   /protein_id="CBL91347.1"
FT                   /translation="MRNERLVCERKKLYKSGKILVTAGIFSLAIFGATISDSRADTIDT
FT                   NSTTMAVKEDSTKNQPNPSPTVVDKTAPQVVEKSVEPVTDKPVETPAKDTATVPTVDKP
FT                   VEAPAKDTTVPTAEKLVETPAKDTTVPTVDKPVEAPAKDTAIVPTTAKTGDTQTAATVY
FT                   KTTDTKKADKPVEATSKTATTNKSDAQKLDQVESASPNIKQINGKTYFVGDDGQIKKNF
FT                   TAVIDGQVLYFDKTTGELTSNDRQYVEGLTNIANEHNAAYSLKSDSFTNVDGYLTASSW
FT                   YRPKDILKAGTTWTPSMATDFRPLLMSWWPDKDTQIAYLKYMQSLGLLEDDVAISNNSQ
FT                   TSDLTNHAMSVQKNIEQRISLSGNTDWLKTDISQWIKTQPNWNITSESKSNDHLQGGAL
FT                   LYVNSDKTPDANSDDRLLNRTPINQKGQITDSGQQGGYEMLLANDVDNSNPVVQAEQLN
FT                   WLYYMMNIGTITQNDPTANFDGYRVDAVDNVDADLLQIASDYFKAAYKIDQSDSQANAH
FT                   LSILEDWESKDAAYIKAHGNNQLTMDFPIHLGLKYALNVPVSQRSGLEQTITNSLVNRT
FT                   EDATENTAQPNYSFIRAHDSEVQTVIAQIVKDKINPKSDGLTVTPDEIEKAFAIYNADE
FT                   LKADKEYTAYNIPSSYALLLTNKDTIPRVYYGDLYTDDGQYMAKKSPYYDAITSLLQSR
FT                   VKYVSGGQSMGMSYLHDNQGVLTSVRYGTGSMKATDAGNAETRTEGIGLVISNKTDLNL
FT                   NNDEQVVLNMGAAHKNQDYRALMLSTKDGLKIYNNDAGAPIVRTNDLGQLIFKSDMVYG
FT                   INDPQVSGYLAAWVPVGASDNQDVRTTSSKTTSTDGATYHSNAALDSQVIYEGFSNFQA
FT                   MPTNADEYTNVKIVQNAALFKSLGITSFELAPQYRSSTDTSFLDSIVQNGYAFTDRYDI
FT                   GYNTPTKYGTADQLVNTLRALHAQGIQAINDWVPDQIYNLPGEQIVTADRTNSSGKDDA
FT                   DSVINHTLYDSSTIGGGQYQAQYGGAFLDQLKADYPTLFETKQISTGKPMNPNVKITEW
FT                   SAKYFNGSNIQGRGAWYVLKDWATNQYFNVSSDNDFLPKQLLGEKTSTGFTTDENGKTS
FT                   FYSTSGYQAKNTFIQDNTNWYYFDNDGYMVVGTQQINGKKYYFLPNGVELQDAYLSDGQ
FT                   NQYYYNKTGKAVTNQYYIGPDNNWRYFFADGHMALGLTTITADNGSTSEQYFDQNGVQV
FT                   KGTDIRDTAGNLRYFDGQTGNLLTNTWQELANKSWIYLNAQGIAVTGQQNINGQILYFN
FT                   YDGTQIKNDFKRLDNGAWLYLNAQGVALTGEQTINGAQVYFNQNGEQVKNDQVKNSDGT
FT                   ISYYAGINGQKLTNDFAELPDGSWLYLDNQGHAVTGEQIINNQVLYFNDNGVQLKGGTH
FT                   IDEAGHMHYYDADSGERVSNQSVQIDGRKIYFDNAGNAVD"
FT   CDS_pept        717195..717962
FT                   /transl_table=11
FT                   /gene="epsB"
FT                   /locus_tag="LEGAS_0700"
FT                   /product="tyrosine-protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91348"
FT                   /protein_id="CBL91348.1"
FT                   /translation="MIDLHSHLLPNIDDGSKSIRASLRMAHEAVEDGIEAALMTPHHMN
FT                   GHYMNHKADVIRLTQEFQAHLDKEKIPLQVFPSQEVRINGGLIDALDNDDILFADEDNR
FT                   YLLLEFPDDDVPTYSDDMIFNIMQRGISVQIAHPERNLKIMAQPDILFNLIEKGAIAQV
FT                   TASSYVGTFGKKVEKFSEAIVAHNLAHVFVSDAHDLPNREYEMRQAFHKLGTNLGKQYQ
FT                   QMFEKNAEAILDGNNVEKLIPEMIVKRHFFNGF"
FT   CDS_pept        717993..718880
FT                   /transl_table=11
FT                   /gene="epsC"
FT                   /locus_tag="LEGAS_0701"
FT                   /product="Polysaccharide-chain-length determination
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0701"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91349"
FT                   /protein_id="CBL91349.1"
FT                   /translation="MNNVLELRQLWDIIRKYFFMLVLMAIIGGAVGFGIAKFFIAPTYI
FT                   ASTSMLVNRTTDNAQTTANLSDQQADVQIINTYKNLVTSSNVLGDVSNTLKKPDRIVVQ
FT                   KYQPAVFDTLADGTRRLITPEQKEVTRASSQKKYNLTVDDLKKMVSISNQQNSQVFAIN
FT                   VKSNDPKQAALVANTVADSFRDKIGHFMKINNVSIIDSAKTPDSPVGPNKKLFTLAGLV
FT                   ILGGLTFLIALVRELSDTTVKSPDEVTELFGMTNLGVIGHIKAMKHFDVAYMQAENRST
FT                   GNHSRSRVSRLNRE"
FT   CDS_pept        718899..719663
FT                   /transl_table=11
FT                   /gene="epsD"
FT                   /locus_tag="LEGAS_0702"
FT                   /product="Tyrosine-protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0702"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91350"
FT                   /protein_id="CBL91350.1"
FT                   /translation="MAFFKKRSQTGRDRLSTETMTKGARLITAAEPKNPVSEQFRTLRT
FT                   NIEFASVAKGDVKTLLISSALPSEGKSTITANLAVACAQQGKKVLLVDADLRRPTVAVT
FT                   FGITDNHGLTNYLADANSDIQAIIHKTSMDKLDVVTSGPVPPNPAELLGSGRMTTLISE
FT                   LRAHYDLVIFDVPPFLMVTDAQVLMSKMDGVAIVVSADKTTKGALQRTNDILKIAGSPV
FT                   LGFIYNDMNRKKKGSAGYGYGYGYGYGDTTAK"
FT   CDS_pept        719702..720325
FT                   /transl_table=11
FT                   /gene="epsE1"
FT                   /locus_tag="LEGAS_0703"
FT                   /product="Exopolysaccharide phosphogalactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0703"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91351"
FT                   /protein_id="CBL91351.1"
FT                   /translation="MLYKKVVKRVLDLLLAVPMAIILFIPLIVIGLIIKFTSKGPALFR
FT                   QERYGMNSKPFLLYKFRSMTDEAPVKANSDFDDITSYVTPFGMIIRKTSIDELPQLMNI
FT                   IKGDMSFIGPRPLAKTDSKVLFLRKHNGADQVLPGISGLAQVNGRNNLSDEDKAAYDAK
FT                   YAAHLSFRVDMLLTVETFVSVMKRDGIFKETDIDDAGKDVVKHD"
FT   CDS_pept        720318..721469
FT                   /transl_table=11
FT                   /gene="epsF"
FT                   /locus_tag="LEGAS_0704"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0704"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91352"
FT                   /protein_id="CBL91352.1"
FT                   /translation="MTKKVLMLAAKANMIQQFNHRNIGILQGLGYEVHVATNMVDFGSM
FT                   SSEEDERFKQWMINHDVIAHQIDFERRMGSLKGNLRSIKQLRRLFQQYDFTFTHVHSPL
FT                   GSILGRLVAKQFKVPTIYTAHGFHFFKGGPKSGWLVFYPLEWLFSFITDTLITINDEDY
FT                   TLAKKHMHAKHIVKINGIGVDVEKAWRVTDEEKQEARKRVRQELNIPEDAFLISSVGEL
FT                   SDRKNHRVVLQALKEMTPEQRQNIYYIIAGTGANGAMLNELAESFDFGEHFKLLGYRSD
FT                   VHDINYASDISIFPSFQEGLGVAGLEAVVAGLYIIGSNIRGIRDYILNKSIGKTFPPSD
FT                   PNILAAIIFEKSKYNYKKNTIDNDELINFDKRKVDYEMKKIYE"
FT   CDS_pept        721462..722580
FT                   /transl_table=11
FT                   /gene="epsG"
FT                   /locus_tag="LEGAS_0705"
FT                   /product="Glycosyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0705"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91353"
FT                   /protein_id="CBL91353.1"
FT                   /translation="MNKQDKIVRLNKSKKVVFHFLNTGNYSGAENVVINIATLINDCEH
FT                   VYVSPSGAIDKILKEFNIRHIVIKKLTSKTVYNVIKNNQPTIVHAHDFRASIMIARNAS
FT                   YIHSYGGFVISHLHNNDPRMRRFGLLPLLYRWSIPKYNKIIVVSESIIDEYIFSQYIKK
FT                   NIDVLILKNIVNDSIILRKADMFVAPRSDLIYVGRLVEQKNPIMFLEIVKLITKVFPNV
FT                   KANILGDGPLREKTEKFIWNNELTDNIELIGFTSNPYPYIKSSKIGVSTSKWEGFGLSI
FT                   LEEQLLGNPVVATPVGGVVDLVNEDVGMLSNSIKEMSAEIIQLLSNETYLAKKSCMAKE
FT                   NVKTKNSISHFQSILREVYGVENKYYSTHNNI"
FT   CDS_pept        722540..723448
FT                   /transl_table=11
FT                   /gene="epsH"
FT                   /locus_tag="LEGAS_0706"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0706"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91354"
FT                   /protein_id="CBL91354.1"
FT                   /translation="MLKINITVLTTTYNRVELLQKLYDSLGKQSDQDFQWLIIDDGSTD
FT                   NTFEVIKKISTKQNAFRINYFRKENGGKHTALNYAHSYITGDVITIVDSDDILVPDAVA
FT                   AIRHYWDSVYKNKEYATVVFEQVNQSGVKLGEFPKKIYSGSDLDYRIKKAIAGDFAETI
FT                   RASVFKKFPFPVYKNKEKFFPEGWLWTNVALLYSTVNISYTIVVGGYQDDGLSKRGRLM
FT                   RLQSPVGLMKYYRLLENVKVISLKYKIKNALAFNVYKLSNQKFIHTLTGNEIKTEFGHD
FT                   TLTERLLKLPAIIIYYYWKKR"
FT   CDS_pept        723459..724613
FT                   /transl_table=11
FT                   /gene="epsI"
FT                   /locus_tag="LEGAS_0707"
FT                   /product="membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0707"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91355"
FT                   /protein_id="CBL91355.1"
FT                   /translation="MIFYTSILCISGIFMIISGITNIGAIKNIFASIVIILLALLSGTR
FT                   YHLGGYDYSNYEYMFQLAPTLNHLNLVNYVQQNGLIGSDVGWTFINSTIKSMGFNFYGL
FT                   TVFVAIFFWFTLYFVLKKYMTNINIFIVIAVYKYLLDVSFIYMRQSVAVAIFALSLRYI
FT                   LNKKIVPYMLLIIFAATVHFSAVILIPIYWINRIKITQKRLLWYTMLFAFSFILVFLHV
FT                   DVISMFGFFSNIVSGSGAQKISEASNGTLYGEVGILSSILHFIEFLIVDFFLIKNFNKL
FT                   KLNDEKQLLMIRLFMLLLPIYSVFATSPIMVRYGFYFLFTYPVIIDYLIVKISIINKIF
FT                   WYSLLVFVSFVGMYKFVIGFDNGADFYYDSFIFHNESIRSNSNE"
FT   CDS_pept        724634..725626
FT                   /transl_table=11
FT                   /gene="epsJ"
FT                   /locus_tag="LEGAS_0708"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0708"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91356"
FT                   /protein_id="CBL91356.1"
FT                   /translation="MSNDINKGAFFSIIVPMFNSERYIAHTINSIVEQSYSDWELILVD
FT                   DGSTDDSFKVARKSTENVGHKVKMYSKSNSGLAETRNYGTKYIQGNYILFVDSDDYIDV
FT                   DLLFILNEYIVKRNQPDILVFDYGEFDDGSNKVKLVTHFDKQLKRYGEVIWNKCFNVSF
FT                   YIKNNFQFNKGITYEDTAIIHVIMALAKSIVKVEKVGYFYRRERIGSITSNKLDEEVDN
FT                   RMLALDKFEENIQKYTQNSYILNKKLNRMNYFLSLSWIYLLLDYQNVSNHDDSYKKIVK
FT                   KIKKSKIRLGIFKSRIAKDIILYLIVIISLDLKFDFIIKKISRMRSLGQ"
FT   CDS_pept        725661..727076
FT                   /transl_table=11
FT                   /gene="epsK"
FT                   /locus_tag="LEGAS_0709"
FT                   /product="Polysaccharide Transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0709"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91357"
FT                   /protein_id="CBL91357.1"
FT                   /translation="MKVLKNFFYNMTYQVLLIILPLVTMPYVSRVLGPDGLGKYSYTNS
FT                   IMSYFVLLGSLGISLYGSRQVAYVQDSKENRSKVFWDVAILKIVTTVISILLLAFFLTI
FT                   YNEYTSLIIAQSLTLVANMFDVSWYFIGIEDFKKTITRNVAVKIISLALIFSLVHTKSD
FT                   LTIYILIITGSTLIGNFILIPFLKGQIYFVDVNKLHFSKHVMPILLLFIPQLATQIYLV
FT                   VNKTMLGQMDSIKSVGFFSSSDTLVRLALTIVSSISAVLMPRIANLLAKGDKKGVNHYM
FT                   DKSFQFINFLSFPLVLGLIAISSKFVPLFLGKGFGVVSNLIILESPIIILISWSIAITN
FT                   QYLIPSGLNKEYIGSTFAGAISNIILNLLFIRNYGVYGAIISTLISELIVLAYLLFGIK
FT                   NKLNVKKMLFSNIHKYLFSSLVMFLIIILVDIWLPKTICAVILEITLGIIVYIIALFFV
FT                   KADILLKWEVFFD"
FT   CDS_pept        727429..727584
FT                   /transl_table=11
FT                   /gene="eps?"
FT                   /locus_tag="LEGAS_0710"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91358"
FT                   /protein_id="CBL91358.1"
FT                   /translation="MHAILKDMNKSEDDFEFVQDRSGHDLRYAIDATKIREELGWTPKY
FT                   TDLQQV"
FT   CDS_pept        727733..728572
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="LEGAS_0711"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0711"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91359"
FT                   /protein_id="CBL91359.1"
FT                   /translation="MKFLITGANGQLGQELQKLLRERELDFVAFDSTQLDITSREAVLA
FT                   TFESVKPDVILHAAAYTKVDLAEDDGREVNWQVNVNGTKNVADAVKKIGAKVVAVSTDY
FT                   VFDGTQNNDYVETDPVNPQNAYGRAKLAGELAVTESGADAYIVRTSWVFGEFGNNFVYT
FT                   MQRLATTHPRLTVVNDQLGRPTWTRTLAEFMLHLVDVKATYGVYHLSNTGTTTWFDFAR
FT                   EILKNTDVEIAPVTSAEFPQKAYRPRHSVMSLDKAESTGFEILNWREALNAFLMGLD"
FT   CDS_pept        complement(728726..730069)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0712"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0712"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91360"
FT                   /protein_id="CBL91360.1"
FT                   /translation="MDKFIKQQTSLSQSHHMAIPWQSLIQNDKQPAKDASLPERASIVG
FT                   RIGIQMLSCGTGAWRVRDAMNKIARKLDLSCSADIGLINLTYTCFSDGHSYTQQLSLPN
FT                   TGVNTDKLNTLENFVKHIGDTFSTLTVRQVHNKINDIQNKPKQYSPIVAGLAAALACSA
FT                   FIFLLGGGIPEMICSFIGAGIGNFVRATLGKHTITTLVGVAISVAIACLVYMFAFKIFE
FT                   TYLHVLVQHEAGYIGAMLFVVPGFPFITSMLDMSKLDMRSGLERLTYAIMITLVATLVG
FT                   WLVALFFDFRPENFLPLGLSPIVIGLLRLPASFCGVYGFSIMFNSSQRMAIVAGFIGAL
FT                   ANTLRLELVDLTTIPPAAAAFVGALVAGLIASIVTRYNGYPRISLTVPAIVIMVPGLYI
FT                   YRAIYNIGTNQIAVGALWMTKAALIMMFLPLGLFVARTLLDKNWRHFD"
FT   CDS_pept        730307..731095
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0713"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0713"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91361"
FT                   /protein_id="CBL91361.1"
FT                   /translation="MKSVYLEEFMKNVTQQSKHIDRTVSIYFRSNDNFSENKSRLNQIQ
FT                   KKISVDINIKSFEDAMAKDRLTEMRQVTSAIFVMGDEVHVYTSPHLEIEDDEIVIDKTP
FT                   RLERLEALSLKFPTNLILDVDYETITVYLVDDRGIQDITKDFGELTLQKYLGTEFRIGE
FT                   SNHVSVGNKSVSVHGHNPAKEIKKNDQIRFYQAASPDIVSYIDTNFKGMPIILGGASQN
FT                   MSTFTEAIGKNLKVKLIDKKIDGHFNATNDIYEAYQKLFK"
FT   CDS_pept        complement(731370..733064)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0714"
FT                   /product="Myosin-crossreactive antigen"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0714"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91362"
FT                   /protein_id="CBL91362.1"
FT                   /translation="MRKKKAVMIGAGIANMAAAVYLIQEGHWSGEDITFYSLDQHGSND
FT                   GDTTEAATDDYWNQNHPLENNKGYVARGGRMLNYRTYVDLMDLLNRIPSATESGMTAAE
FT                   DTRDFDAKHPTFDKARLLQPGHGILNASKLGFNRLDRQLLTQLILMPDEDETKLDNITI
FT                   AQYFENDPHFFETNFWFMWETTFAFRTQSSAQELRRYMHQMIYEFSQIEHLVGVNRTRY
FT                   NQYESIMLPLINYLKAQGCQIILDRRVIAFEFKETSMTDEITVTGLKMINTTTNETAHV
FT                   PIDNDTGVLFTNGSITDSATLGDYNTPAPENMDYGAASSLWKQATKHFYNLGNPDKFFS
FT                   DRNASEWVSFTLTTKNHLLLNEITRITTQLPGNALNSFLSTTPITPLGQIDVDMSIVAH
FT                   HQPHFTSQQPNETVIWGYFLYPRRDSLLFEKPYLELTGKEMVLELISHLSQVDPGPINI
FT                   KDRESEILDSVVNNIPVYMPYASALFNNRAKIDRPEVIPDHSTNLAFTGEFVEQPYQMV
FT                   FTEQSAVRSGEIAAYHFAGVPMSKLVKTPKYDHDIKTLLRATRKMFS"
FT   CDS_pept        complement(733121..733249)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0715"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0715"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91363"
FT                   /protein_id="CBL91363.1"
FT                   /translation="MNKSLRTLLFVTGSLVIIGGYLAKKLSLFKCDDSEDYKKFES"
FT   CDS_pept        733556..734509
FT                   /transl_table=11
FT                   /gene="panE2"
FT                   /locus_tag="LEGAS_0716"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0716"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91364"
FT                   /protein_id="CBL91364.1"
FT                   /translation="MKIAIAGFGALGSRLGVKLQKAGHEVTGIDGWPAHIAAINTNGLT
FT                   VVHDDLPPKKYFVPVVTPKEVTGEFELIILLTKTPQLDRMLTDIAPIITKKTQLLVLSN
FT                   GLGNIEVIEKHVARDQILAGVTLWTSSLVKPGEIHTTGTGSIKLQAIGHADAVSVAAAL
FT                   NQAGLNVEITQDVLTAIWHKAGINSVLNPLSVLLNANIAEFGTAGNGMDLALQILDEIQ
FT                   KVGATQGVKVNITDIMNDLTDLLKPENAGNHYPSMYQDIQNGKRTEIDFLNGFFAKIGR
FT                   QEHIDTPFNALVTALVHAKEDIERVKLAKKQETFEI"
FT   CDS_pept        734580..735107
FT                   /transl_table=11
FT                   /gene="msrA1"
FT                   /locus_tag="LEGAS_0717"
FT                   /product="methionine-S-sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0717"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91365"
FT                   /protein_id="CBL91365.1"
FT                   /translation="MTQKFESAIFAGGCFWCMVQPFDSLPGIEKVRSGYTGGHTINPTY
FT                   EEVSSHTTGHTEAVKIVYDPKKLTYAELVSIYWEQTDPTDAMGQFQDRGDSYRPVIFVA
FT                   DDTQRQIAEKSRAALAASGRFDKPILTTIEDAKPFYEAEEYHQDFYKKDPTREALEMSQ
FT                   RLAFQQKNWHKN"
FT   CDS_pept        735272..736216
FT                   /transl_table=11
FT                   /gene="rnz"
FT                   /locus_tag="LEGAS_0718"
FT                   /product="ribonuclease Z"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0718"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91366"
FT                   /protein_id="CBL91366.1"
FT                   /translation="MQLEFLGTGSGQPSKFRNVTSIALRLLDERNAVWLFDVGEATQHQ
FT                   ILKTTIRPRKVEKIFISHLHGDHIFGLPGFLSSRSFQGANKNEPLTIYGPKGVKEFVQT
FT                   ALRVSETRLSYPVVYTEIVEGVIFEDKTFRVIAAKMRHRIETWGYRVEEKDHPGELLVD
FT                   KLRHEGVPSGPIFGQLKAGKKVILPDGRRLDGHDYIGEAQKGRVVTFILDTRPNDNIGI
FT                   LAHNADVLVHESTYGAGDEEAKLAKSHAHSTSVNAAMAAHNAQVDKLVLTHLSARYIGP
FT                   MVKTLITDVRRIFPNTTVARDFDVIDIPFKKEV"
FT   CDS_pept        736247..738211
FT                   /transl_table=11
FT                   /gene="recJ"
FT                   /locus_tag="LEGAS_0719"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0719"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91367"
FT                   /protein_id="CBL91367.1"
FT                   /translation="MSQNNWHILPQPTEKTVRQLTTKLNIDPLTATVVAQKGFITPEAA
FT                   YQYLQPSIDQLHDPMLLHDMDKAFERLTEAAFGGEKIVVYGDYDLDGMTSTAVMVEALE
FT                   VLGADVTAYIPNRFKDGYGPNIDVYKRLIAEGAQIIVTVDNGVSGHEAVAYAMSQGVDV
FT                   IITDHHEMPPTLPEAYAIVHPRHPDGHYPFDDLSGVGVAFKVAQALLTDGQSITDKSEL
FT                   PTEMLDLVALGEIADMVSLTDENRTLVSWGLKQINDNPRPGLVALLKNAGQMVNQPIIS
FT                   ETVSFKIAPRLNAVGRLGDAQLALDLLLSQDSDEATEIASQIEAINAQRQEFVEEVFGA
FT                   AKQIALSDKHANDQVLVVAGENWHQGILGIVASRLVELLHKPVIVLSLIDGIYKGSGRT
FT                   YNNFDLYQLMGQYRSFYDTFGGHASALGLAISPENLSALREQLAVLPTLDVPEISVAVN
FT                   MMLPVSKMAIPVYEGLTLLEPFGTGNVQPTFGVQEPTIEKAVTMGSTNQHLKLTLANQI
FT                   EAVGFNHPEWTTIVAHPANISFVATMGLNYFRGKKRLQLLLTDVSMPPIVENDAHKKFF
FT                   GHVYKFIYAHQDLNFAQNLDKIAEQLNITKNDLNIMVQVFIELGFVKVIDGGFVKVIPN
FT                   APQKTLTTSKTYHKFLANR"
FT   CDS_pept        738285..738815
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="LEGAS_0720"
FT                   /product="Adenine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91368"
FT                   /protein_id="CBL91368.1"
FT                   /translation="MTVDLHNYVATVENFPEEGVSFRDLSPLMGNGVAYRQTIDAIANF
FT                   AKDLKIDLIAGPESRGFIVGSPLAYALNIGFVPARKGGKLPRAAVSASYSLEYGGENVL
FT                   EIHKDAIKPGQRVLIVDDLLATGGTINATREIIAELGGVVAGVAFIIELKDLQGREKIM
FT                   RAGDVPFLSLMTY"
FT   CDS_pept        complement(738883..739596)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0721"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0721"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91369"
FT                   /protein_id="CBL91369.1"
FT                   /translation="MLSQMMISELTGYATKFQNHTIAYPKILAALSTLQALKRKQLPLM
FT                   PLPSLAFSESQILKDLRLMPVDDLLSEFRQTLITDFGIWHLPNQRWIIDLHHFIAGRRV
FT                   LEIMCGNAIMTYALRAMGDNIIATDNFAWQGQDIQTPKPWTQVTQMSGLTAINTFPFDV
FT                   VIMSWAPDTDTSDVTILSALREKQFTGDFIVIGEKNQATNSKKFWQIADLTISKTLNQH
FT                   HQQFDFIHDQVFIVK"
FT   CDS_pept        complement(739641..740249)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0722"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0722"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91370"
FT                   /protein_id="CBL91370.1"
FT                   /translation="MIDIYHFSKPLSTHCLTTEQCLTNITSDIAQHAHLHFVPLINMDF
FT                   IANLENHALNPSKNHRISDSSDILFNVILDFKAAQLEGNKKARNFLVQLQHELLINQKT
FT                   YTSTLVAQLLDKIGINRANFLINRANNETISAIIKDQKFAEKIMQKKCATIALTFSKEN
FT                   ETQVLTDFSVNDLVLEFAPHLTPTVDTDRLLQSLKSYAY"
FT   CDS_pept        740509..741087
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0723"
FT                   /product="Gtp Pyrophosphokinase Family Protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0723"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91371"
FT                   /protein_id="CBL91371.1"
FT                   /translation="MDWDRFFVPYQQTVTELKIKLRGLRDQFEKDGKNSPIEFVTGRVK
FT                   TQESIEEKIVRRHLDEARLSLDLQDIAGVRIMTKYVEDVYTVVELLRSRTDFQILEERD
FT                   YVTNAKPSGYRSYHIVIEYPVQMYSGERKVLAEIQVRTIAMNVWATIEHDLRYKHGDNL
FT                   PAPMVEQLTILADDNFEWDQRVSEIRASE"
FT   CDS_pept        741084..741878
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="LEGAS_0724"
FT                   /product="inorganic polyphosphate/ATP-NAD kinase 1
FT                   (Poly(P)/ATP NAD kinase 1)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0724"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91372"
FT                   /protein_id="CBL91372.1"
FT                   /translation="MKIAIFNNNAVSSQAITKKLTLALKKNNIIIDNNEPDIVVTVGGD
FT                   GTLLGAFQHYVDQVDHIRFVGLHTGHLGFYTDWLSTELDELVNSLVNDNSQSVSYPLLD
FT                   MTVVYDSGEHYHFLALNEAAIKQPTGTLVADIYLGNQIFERFRGDGISVATPTGSTAYN
FT                   KANGGAVLHPSLSAIQMSEIASINNRVFRTLGSPLIVPQGQEIIMKPKSDHFLVMYDQS
FT                   DIKVKSITELRFRVADKQVHFAAYRHVDFWQRVHRAFISDIE"
FT   CDS_pept        741964..742866
FT                   /transl_table=11
FT                   /gene="rluD2"
FT                   /locus_tag="LEGAS_0725"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0725"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91373"
FT                   /protein_id="CBL91373.1"
FT                   /translation="MQFTWTYSGSEQRKVRTFLQAHGVSHRMFSQMKHNGGAILKNDKQ
FT                   VYTSDYLDDGDQVTIIMPTEKSNDLVVADYNPLTIIFENEHWLVVDKPYGLTTVPGHAD
FT                   RLHTLVNQVKGHLEEINAEDLVPHVVTRLDRDTSGIVLLAKHRFAHAVMDQQLQEHTVE
FT                   KFYVAYVSGILSEDHGDIHAPIGRMDDDFIKREVRDDGKPSRTEYWVERRYDDGGVQPM
FT                   TRVKVQLHTGRTHQIRVHFQNIGHPLVGDNLYGGPRWYGLKRQALHAYHMKFYDPFIEA
FT                   DREFNTTLPEDLKGLHDLT"
FT   CDS_pept        742953..744317
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="LEGAS_0726"
FT                   /product="magnesium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0726"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91374"
FT                   /protein_id="CBL91374.1"
FT                   /translation="MAEQIEQRYQTIQFLSDLLHSGQDTEFIESFESLHDFEMAQVYAD
FT                   LPEQFRSVAWRLLSIDILARVFDNLDIDEVDIVKLLQELPPQRGVLVLQEMYADNEADL
FT                   LQEMPARLVATYLSLMSKSEADTVRKLIDYDEQTAGSLMSTEYLAVEEELHVDEVMRLV
FT                   KKQALAAESISYVYVLDLQERLAGVISLRDLLTHPDNLAVSEITNDRIISVKAGDDQED
FT                   VAQIVADYNFLSIPVTDDENRLLGVITVDDIVDVIDEEAVEDYSGLAAVNVSQINDTPW
FT                   HSAIKRIPWLIALLVLGMATATLISSYDQLVRQASILAAFISLITGTAGNAGTQALALA
FT                   VRRIAVGSDNSGWKNFFSEILAGIIVGMATGFSVFVIVAIWKHNSILGFAVGLAMTMAI
FT                   IVANLAGYLIPVLIDKMGFDPAVASGPFITTLSDLTSVLIYFNVAQLFISHFVGR"
FT   CDS_pept        744387..745376
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0727"
FT                   /product="Transcriptional regulator, LytR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0727"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91375"
FT                   /protein_id="CBL91375.1"
FT                   /translation="MPTREQMRSTNKGKQNRPKKRHRILHTILLIVGLLVLIGLGTGGY
FT                   AYYNMNRTITKIQNPSQTTKKADKITANKKPVSYLLLGTDTGELGRDYKGRTDTMIVMT
FT                   VNPKTNVTTMTSIARDTLVTVNGEQMKINAAYAYGTADSAMAAVENLLNIKINGGYILV
FT                   NMGGLVKMVDAVGGVDVTSPLTFTTEGDDTQADSKSQYSFTANQTYHMDGNEALAFSRM
FT                   RHEDPNGDYGRQLRQQLILRGVLKNSASVGSLFNDSLLNTLSNNVQTDVSTSSMKNLAL
FT                   SYRSALGNIKQDQMRGTTQSMGALGSVEMMSQTEIDRVHDAISEQMAE"
FT   CDS_pept        745532..746758
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="LEGAS_0728"
FT                   /product="argininosuccinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0728"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91376"
FT                   /protein_id="CBL91376.1"
FT                   /translation="MTEKLVLAYSGGLDTSVAIPWLKGKGYEIIAVVLNVGQHGKDMDM
FT                   IQAKALQVGASQSIVIDAQAEFADQYVAPVIKANMLYEGEYPMVSALSRPLIIKKLVDI
FT                   AHENDAVAIAHGSTGHGNDQVRFEAAIHALDPDMKIEAPIREFQWSREEEIAYAAEHDV
FT                   PVPVGLESPYSIDENLWGRANEAGILENPWNQAPEGAYALTTPIEKTPDEAEFIDVTFA
FT                   AGVPVALDGVDMPLADLIIKLNELAGSHGIGRIDHIENRLVGIKSREIYEAPAAAVLMT
FT                   AHKDLEDLTLERDVAHFKPMIEQQLANLVYEAKWVSPLFDSLMAFIDETQKNVNGIVKM
FT                   KMFKGNAVAVARQSEHNSLYDEDLATYTSASSFDQEAAVGFIKLWTLSNTVYEQVNHVH
FT                   SVDKKNKIK"
FT   CDS_pept        746798..748183
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="LEGAS_0729"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0729"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91377"
FT                   /protein_id="CBL91377.1"
FT                   /translation="MATTKLWGGRFTAKAAEWVDEFGASIHFDQQMAAEDLEGSIAHAK
FT                   MLGQQNIIAFNESDQIVAGLKALQQDLIAGKLTFDVKNEDIHMNMESLLTEKIGAVAGK
FT                   LHTARSRNDQVATDFHLWVKHRLPHVLDAITELQKELLTLATTHAGTIMSGYTHLQHAQ
FT                   PITYGHYLLAYCDMFQRDYDRFEFNQLHTDILPLGAAALAGTTFPIDREFVADELGFGD
FT                   IYHNSLDAVSDRDFALEFLSNAAILMMHLSRMAEELILWSTYEFNYIELSDDFSTGSSI
FT                   MPQKKNADFAELVRGKTGRTYGALMALLTTMKSLPLAYNKDMQEDKEQVFDVMDTVIAS
FT                   IKIFTGMLGGLKVHKERMLASTQDDFSNATELADYLATKGVPFREAHAIVGQLVLQGLQ
FT                   THTPLQKTPLATLQAAAPQIEADIYAVLQSETAVNRRTSIGGTAVENVKKEIARHEKKL
FT                   EAR"
FT   CDS_pept        748183..749196
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="LEGAS_0730"
FT                   /product="ornithine carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91378"
FT                   /protein_id="CBL91378.1"
FT                   /translation="MSSHFQGKSFLKESDFTKKELETLIDLAAHFKYLKQHNIQHHYLQ
FT                   GKNIALLFEKSSTRTRSSFTVAAHDLGAHAEFLGKNDIQFGKKESLEDTAKVFGRMYDG
FT                   IEYRGFSQNVVEGLAKYSGVPVWNGLTDEWHPTQMLADFLTIKEQFKRLEGVTLAYMGD
FT                   GRNNVANSLLVTGAILGVNIHIVAPKSLQPTAEIQSLAAQKAAVSGANLLVTDDVAKGV
FT                   AGVDVLYTDVWASMGEEETFEARIKLLTPYQINTQLVAMTHNDDVIVLHDLPAFHDLNT
FT                   TMSQEIYDKFGISEMEITDEVFHAAYAHQFEQAENRLHTIKAVMAATLGNLFIPEI"
FT   CDS_pept        complement(749284..750621)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0731"
FT                   /product="Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0731"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91379"
FT                   /protein_id="CBL91379.1"
FT                   /translation="MNTKNWRVIPAVIAAGILSFSGVLIETSMNVTFPKLMSEFSTNAN
FT                   GVQWVTTGYLLAIAIIVPISAFLIRNFSTKKLFVLSNFLFLFGTVLDSFSPSLALLLVG
FT                   RILQGIGTGIALPLMFHIILTKSPIKSRGMMMGIGSMITSLAPAIGPTYGGVLLNTLGW
FT                   RSIFWFLIILILISLVIGLNSIPSEKEQRTEKFPFKTFIFLGLGLSFVLLSIEKMSLLM
FT                   AIVGIFSLVIFYIINQKQKLLQLTLFQNSRFNFYMYGFLAYQAILLGLSFILPNYLQLN
FT                   LHVSAAAAGAFMFPGALISAVLAPISGSMLDRIGQYRPILLGLIVSTVALCLMFFYFPT
FT                   LNFWTLMLSHMLLMVGIGLSYANLMTVTLATLPANETADGNSILNTTQQFVGATATAIV
FT                   AQVITTAMHKNPVNGMIIGSKQGIGGLTILIMISLILFITVNKRRK"
FT   CDS_pept        750901..752145
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="LEGAS_0732"
FT                   /product="Succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0732"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91380"
FT                   /protein_id="CBL91380.1"
FT                   /translation="MDNDELVLQDLVRINTAGKNEVAIARYLKKLFDEHDITNEIIGFD
FT                   DGRAGLIAEIGNGHGPILAFDGHEDTVALGDKTRWQTDPLSGIKIDDKIFGRGITDMKS
FT                   GLAAGVLAMIRLKRNEHLLNGTFKLYATVGEETGELGAKQMVEAGLANQIDALLIGEPS
FT                   GIQLDYIKSLPAAQSLPGIVMAENIHDISEKNKTAEQHFLEIAHKGAISYRITSQGITA
FT                   HSSMPELGVNAIDALLTFYNKQQELFNDISKIQNKLLGKTTPVVTQIAGGEQPNTVPGS
FT                   ATMGVFVRTIPEVPHEKIVSEVEKIINEINASGKAELSLTINFENQPVYSNPNGRLSQI
FT                   TKEIGEKLIHQSLPFIGVSGGTDASQFIKANPNMEVVIFGPGNITAHQVDEFVDAGMYH
FT                   SFIDIYESVVRQYLK"
FT   CDS_pept        complement(752242..753939)
FT                   /transl_table=11
FT                   /gene="fbpA"
FT                   /locus_tag="LEGAS_0733"
FT                   /product="Adherence protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0733"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91381"
FT                   /protein_id="CBL91381.1"
FT                   /translation="MPLDGLFTHALVHELNELIVGGRITKVHQPYPNEIVLVVRNNSVN
FT                   YPVLLSAHPTYARTQITHIPYENPQTAPNFVMFLRRYLEGAKLQKIEQVENDRIINFYV
FT                   NARNELGDIQQIRLTLEMMGRHSNLFLIRETDSRILELIKHVPADQNRVRSLMPGATYV
FT                   LPPAQNLKNPFITGALETLAPMILDTPFDDWAKFIQSTYQGFGRDSAQVLAQTINQDGD
FT                   HLAHAKNWLARFNDLKPTLFTAENGTLSYAAFDWLQDYATSEHFPTLGDMLDAYYIGKA
FT                   ERERVNQQAGSLVRVVKNELKKNNSKRKKLLGTLDDATNADDLKVMGDLLITYPHLVQK
FT                   GMTSIEIENYYDNNRLLKITLDPKLNGLKNAEKYFTKYRKLRTAVAYVNEQVTLTDAEI
FT                   DYFNNIVAQLDVASPKDVEDIRLELTNGGYIRANKKNKQKPKVSKPDKFESSDGTLIEV
FT                   GKNNLQNERLSLKQADRRDIWLHVQKIPGSHVIIHSANPSDETLVEAAKLAGYFSKARD
FT                   SANIPVDYLPAGKLRKPNGSKPGFVIFEGQQTMYVTPDASLVSRLKIK"
FT   CDS_pept        complement(754054..754689)
FT                   /transl_table=11
FT                   /gene="cutC"
FT                   /locus_tag="LEGAS_0734"
FT                   /product="Copper homeostasis protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0734"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91382"
FT                   /protein_id="CBL91382.1"
FT                   /translation="MTITIREAAVDSVETAKQMRQKGANRIELNSRLDLGGLTPDTRTI
FT                   IDTLIAIDDVPVVIMVRPRDGDFAYSDIELQQMRDSLQQIADLGGQFVTFGVVRDGLLD
FT                   KEAMSELIIHATELNLQVIMHMAFDAINHDQQQQAMYWLSDHSVHRILTHGGDLTTPIM
FT                   ALLPHLQVLVNAAPANLTILPGGGITVANSQAIADTLGVTEVHGSNIV"
FT   CDS_pept        complement(754758..754931)
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="LEGAS_0735"
FT                   /product="50S ribosomal protein L32"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0735"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91383"
FT                   /protein_id="CBL91383.1"
FT                   /translation="MATPSNKNSKSHKRNRRGHIGLNVPNIMLDQTTGEYRVAHRVSPS
FT                   GVYNGKQVIEKK"
FT   CDS_pept        complement(755030..755845)
FT                   /transl_table=11
FT                   /gene="pnuC1"
FT                   /locus_tag="LEGAS_0736"
FT                   /product="nicotinamide mononucleotide transporter
FT                   PnuC,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0736"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91384"
FT                   /protein_id="CBL91384.1"
FT                   /translation="MQNTSSKQISHWQLINPLWYAEQFKGWTRLSYTLLSIGLLIIAYT
FT                   SFGMGAPISGMTFATFFAAAFGWTTVLGLKEAKPMNGLFGLLSAAIYIYVAWLHSNPAD
FT                   AVLQLTYVILLDIPVLVMPSWVKDTDKHVRFIHETDIRGEKHGKSFWYTVIGIVAVVAF
FT                   VAAYLFETQVLHTPRPISDSLVLGTGLVGAVLTTFRFSESWFAWLLQGIMQIALWGFTV
FT                   AAGGALGASALVILVTYLMYFANDVLAIVQSSWFHHKEITVQLAQRHVK"
FT   CDS_pept        complement(755950..756486)
FT                   /transl_table=11
FT                   /gene="ntd"
FT                   /locus_tag="LEGAS_0737"
FT                   /product="Nucleoside deoxyribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0737"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91385"
FT                   /protein_id="CBL91385.1"
FT                   /translation="MNETKLIADLEEINRHVDNDKKLPGAKNIYLAAGWFSDTQEVLLK
FT                   DAFIQLSANPTIAHIHVPLLHQYGGMALGDANSEPDFEWGAMTYKADIKAIDNSDLTVA
FT                   IFEAEDADTGTAMELGYSVASNTPVVSVFSGNIDQHPINLMLSFGTDAHVTSTAELANY
FT                   DFFDITPNKYMGKLI"
FT   CDS_pept        756732..757409
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="LEGAS_0738"
FT                   /product="Putative selenite transport protein DedA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0738"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91386"
FT                   /protein_id="CBL91386.1"
FT                   /translation="MFLIDFILHIDAHIASLVTQFGPWTYLILFAIIFIETGIVIMPFL
FT                   PGDSLLFAAGAVAATPAGLHAGLNHWVFMLLFFIAAVTGDSLNFWIGRTGGYKLIRHPI
FT                   VGRFIKENHIHEAEAFFEKRGAAAIIIGRYMPIVRTFIPFVAGISQFPYSHFLRNNVIA
FT                   AFSWSLIATGAGYLFGNIPFVSAHFSVIILGIALITLLPTIIGIIRSVVISQRAKKITK
FT                   SKK"
FT   CDS_pept        757448..757993
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0739"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0739"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91387"
FT                   /protein_id="CBL91387.1"
FT                   /translation="MNNLKKLQQLTGISAEEISDALDIDLALIKSFENEENMPTVGELE
FT                   ALVGIFSSQLDAQGIETQSEKHPIHIRLSVDYLMNLGITTSDWITLKWAFEGKWQGDKL
FT                   AVGFFNQGQLTRVVTSSMDFVTAFAGYLILQTEGEFEPYIDEFDDDKEYDWRLLRINED
FT                   HFTDVTQTIITTDLPEIS"
FT   CDS_pept        757993..759369
FT                   /transl_table=11
FT                   /gene="nadV"
FT                   /locus_tag="LEGAS_0740"
FT                   /product="nicotinamide phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91388"
FT                   /protein_id="CBL91388.1"
FT                   /translation="MTENLILATDAYKLTHHLQYPTNITKLYSYGEARTGGRFDTVSWF
FT                   GMSMILHDYFHQPITDAMIDEAEQVSKLTFNTSAYFNRVVWEKVRDLGYFPVKIKALPE
FT                   GLEVPTGNALFTIESTADWFATSLNALEVVLMHVWYPTTIATNSLYIKKRLRPLFEKSG
FT                   TVAGITLAVNDFGLRGATSLESGKRGGSAHLLHFQGSDNMAASQYFKDVYGVSGRALSV
FT                   WATEHSVATAYGAGQGEFDYVNAQLDRAPDSAILSIVIDSYDALNFIKKVIGSSEIKDR
FT                   IIKRAGRIVLRPDSGEPETIDLQVLSLLGDIFGTTINDKGYKVLQHNVGVIQGDGMKAD
FT                   TIVSLYEAIMQAGWSVDNLVVGSGGGLLQEGFTRDTERFAIKAAYAENAAGEKINIQKK
FT                   PKTDAAKTSKAGLLKVVLRDKDIVTVSQNDPGQDLLQTVYENGKILSVNGNDVINRTLF
FT                   "
FT   CDS_pept        759379..759714
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0741"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0741"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91389"
FT                   /protein_id="CBL91389.1"
FT                   /translation="MNYQFKKQAELNDEVEVTMLDVKSAAQAYRDREKRDKKPDSAPEN
FT                   EVVGHGLRALATESAIGKDERKIQVAALFNAGMTSYIDLSFEMNLAESTIRQYGKELGL
FT                   TFIDTEY"
FT   CDS_pept        760075..761370
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="LEGAS_0742"
FT                   /product="diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0742"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91390"
FT                   /protein_id="CBL91390.1"
FT                   /translation="MSYPINTAQHLTIGEVDAIDLAKTYGTPLYVYDVTKIRQTMRDFK
FT                   AIFEKEDVPYVVSYASKAFASKAIYQVAQQEGIHADIVSGGELYTALAAGFDPKHLSFN
FT                   GNNKSWDELTMAVTEGVGTIIVDNFLELQLLSEITTQNGVKQDILLRISPGISAHTHEF
FT                   ISTGQQDSKFGFDLLTGQAKTAYDIARQNENFNLRGLHAHIGSQIFDVTGFEKNAALLA
FT                   ETAKSWGFQPEVINVGGGFGIRYTSEDEPLPESEYADAIIRTLKSKAAEYDWKMPEIWI
FT                   EPGRSIVGPAGQTLYTIGSRKDIPDLRHYLAVDGGMGDNIRPALYQANYDAILANNPNA
FT                   STQEVVRVAGKYCESGDVLVWQQALPKTKPGDILSVLATGAYGYAMASNYNRNPRPAVV
FT                   FVENGKHQVVIARESYAHLIALDHDYMLKNGK"
FT   CDS_pept        761425..762132
FT                   /transl_table=11
FT                   /gene="dapD"
FT                   /locus_tag="LEGAS_0743"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0743"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91391"
FT                   /protein_id="CBL91391.1"
FT                   /translation="MTEIQNDAQRLIDFIANAKKVTPVKVTYKGVLDGEIPANVQQFGG
FT                   VSFGQLIGDWSDVQPLIASLPSESVYIENESRNSAVPLLDKLHINARIEPGAIIREQVE
FT                   IGDNAVIMLGAVINIGAEIGASTMIDMGAILGGRAIVGTNSHIGAGAVLAGVIEPASAQ
FT                   PVRIGNNVLVGANAVVIEGVQVGDGAVVAAGAIVTKDVPANTVVAGVPAKVIKKIDSKT
FT                   QQKTALIDALRGL"
FT   CDS_pept        762132..763283
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0744"
FT                   /product="amino acid amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0744"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91392"
FT                   /protein_id="CBL91392.1"
FT                   /translation="MTEITFENLQQYRRDLHLIPELALVEFQTHAYLMDKITNWQNDTM
FT                   TIRTVAELPTAILVRFEGSDPKRTIGYRSDIDALPIAEQTDLPFQSIHAGVMHACGHDV
FT                   HMSLALGMVQYFSQHQPKDNFIVFFQPAEEAKSGGKLAYDLGLFEDEWRPDEFYGIHDQ
FT                   PDLPAGTLSTLVGTLFAGTAELVIDIHGQGGHAAYPHLVKDPIVAAAELIMQLQTVVSR
FT                   SVDPIKGGVVSIGVINGGKANNVIPDNIHLEGTVRSMTRTDLDIMLTRIRQIAAGVALS
FT                   NDITIDVVLESGSYLPVENNPELANQLIDFMQLRDDIAFELAQPAMTGEDFGYLLQQIP
FT                   GVMLWLGVNDNHALHSPKLNIDEAALLPGFTALRDFIEWRMNQ"
FT   CDS_pept        763335..764213
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="LEGAS_0745"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0745"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91393"
FT                   /protein_id="CBL91393.1"
FT                   /translation="MYENINLITAIITPFDEANEIDYSALKKVIDYLLSHGTQGLVIAG
FT                   TTGESPTLTHTEKLALTQYIADYVGDKVLLIANAGTNNTAESVKNARELSAITHIDGIL
FT                   AVTPYYNKPSQSGMIAHFTAIADASNKPVMLYNIPGRSAVGLTVDSVVKLAQHKNINAI
FT                   KETTSAEFIGAEIEHTQAENFAVYTGEDAQTLAAYAQGGAGTISVASHLYGKEMTDLFA
FT                   AMNTNNWREAGRIQRYLTPRMNALFAFPSPSPVKAKLSEKGLVKNIARLPILPLTEQEK
FT                   KTLDGLLETNS"
FT   CDS_pept        764210..764935
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="LEGAS_0746"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0746"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91394"
FT                   /protein_id="CBL91394.1"
FT                   /translation="MTKIILAGGFGKLGLAIQEGLAATDYEIVGILSGHHHESQYPVWT
FT                   SRDQIIEPADIFLDVSTPATVFENAQWAIKHNMAIVIGATGLTEEQVTQLREQSEHGIL
FT                   IVPNFSLSAVLLMQFAQQAAKYFPDVEIVETHNPKKIDAPSGTAVQTAKLIANERINAA
FT                   QKTSDGEARGQRVSDIPVHALRLPGYIAQQSVYFGGIDEQLTLTQSTTSRLAFVPGVLR
FT                   SLAGVEKINDLKIGLENVL"
FT   CDS_pept        765306..766103
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="LEGAS_0747"
FT                   /product="regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0747"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91395"
FT                   /protein_id="CBL91395.1"
FT                   /translation="MKTITKIATQKKLGRYSIDLDKQFAFGVSESVLIKYGLAKGRELD
FT                   DTLIEQIKHDDEVAKAFNTAINYLGHALRTIKQVKQKLTEKAVSEDIQVQVVAQLKELG
FT                   YLDDANYAMHYVSTKKLISPKGPNTIKMDLQQAGILEDDIEKALASYTYEEQIEIAQKM
FT                   AIKFANTYKRESTRAKQQKIIQALANKGFSFDIGQTVVSELDVGNDDTTELDNVKRQAE
FT                   KLWHRYRNEPLSQRQYKTKSHLYTKGYSREVIDTIMLALESES"
FT   CDS_pept        766106..766378
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0748"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0748"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91396"
FT                   /protein_id="CBL91396.1"
FT                   /translation="MQIYDSKVIQTKLSVAEQQADKISQELQRLQKAGRTDSYMEQQIK
FT                   TLKNQFPNLKLIIMQLKKQLISAKKSNQKTNTQHFVRSNNHRNDL"
FT   CDS_pept        766447..767016
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0749"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0749"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91397"
FT                   /protein_id="CBL91397.1"
FT                   /translation="MSFDKSNRGPREGDFITIKSYKHDGSLHRTWRDTMVLKTSENAII
FT                   GLNDHTLVTEDDGRRWVTREPAIVYFHKKYWFNIIAMIRDNGVSYYCNLASPYVLDKEA
FT                   LKYIDYDLDVKVFPDGEKHLLDADEYAAHSKKWHYPPEIDQILKAHVKILVDWINDGTG
FT                   PFSQGYIDVWYARYQHLMQQRLKDRR"
FT   CDS_pept        767129..770665
FT                   /transl_table=11
FT                   /gene="addB"
FT                   /locus_tag="LEGAS_0750"
FT                   /product="ATP-dependent nuclease subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91398"
FT                   /protein_id="CBL91398.1"
FT                   /translation="MALTIYMNHARTDLRHALLQDVQTKMQQDKTLTVYYIVPNHVKFD
FT                   SEVDVLKQFAIINGQNPKKELYAQSRLQVYSLSRLAWALLKNSPDIQPNIIQNTGLFIM
FT                   VSDILRDYAGQLPIFARMQSKSGFISALVKQLVELRASHITPQDLLQILNDTSNDATFL
FT                   HQTLGSKLRDLAIVADALDRKIGQEYITAQEVLPFFAMQLAGSSLKNVAFYFDGFNGFT
FT                   SAEMQVITQLIAKYPVSIALLGQADRLGKQQDGDVFNKPMYTAQQLIHTAQIFEQKVQI
FT                   NAPKQLRHLSQTTKQVLLAWESLGEYRAFNGDKDHVNLQTFAAENTIVEIQEVARRVRQ
FT                   LLVSEPELRLRDILILARDLTPYTAHIPEVMSQFDLPYFLDNDQPMANHPLVELLLNLL
FT                   LPQKDRFQYQNVMAILKTSLLRPYLDDALVSETEFFDVMGYFDNYLYANRPYETTWRNL
FT                   DKPFELFTVVDSVDEDDATITSDDSIVNRRIETMRRFILSAFDDLQRQLDQAKTMRQAA
FT                   TNLVLWLEKYHVDSAILEQRDVLLAAGELTRSRQGEQVWQLFIQTLDDIVAINGDQTFD
FT                   LTIFKEVLNAGFSGAKFSGIPNNLDQLTISEAGIVQSNHYKQLFFIGGTRTNLPAQTKT
FT                   TALINDAERLIVQPALQEAGTTKYLQNTAQQQMAEENLLFYGALATTTSGVTFSYPILD
FT                   ATGKISEISPFFKRLIDTFDITIKKISNVPSSSVDLLKHYIGTPRATLSELVKIIPTQQ
FT                   ATAAFKAVQNAISQQQKERLMRVLQAPNYRNTIQTLKPEFVQALFGEQLNVSISQLESY
FT                   YNNPLGYFLQYGLKLKERATNELNVAQTGTLYHAVLEAVLQRLIQENISLRDIKTSALM
FT                   MLLQQELASQLMLPEYNLLQENGKMRAIRDYLQKVSETLLTNLQRAARVNIARPSAVEK
FT                   LFGFPDKNALPALKFSRGQINMQVRGKIDRFDIQDNTQVFGTIIDYKSSGKQFDWGQAF
FT                   DGLQMQLLTYWQAAQMNAEALGVEAIGGAFFAQIAPQKRLISDFKGDVSALLDGQVRPD
FT                   IFKYRGLFVSEEDYIDSLDNLSDSNISQFYQLKKKNDGELYANSDFVAAQDFALLLKRN
FT                   TDNIMFAGERILAGLFPLKPTAASLQYTPYGDILRFDRSLGDTYRPEAPKGKANILKIL
FT                   QEADDNGDNIYN"
FT   CDS_pept        770643..774371
FT                   /transl_table=11
FT                   /gene="addA"
FT                   /locus_tag="LEGAS_0751"
FT                   /product="recombination helicase AddA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0751"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91399"
FT                   /protein_id="CBL91399.1"
FT                   /translation="MATTFTINQQRAVEETGHNILVAASAGSGKTTVLIERLIQKILSG
FT                   TSVENFLIVTFTNAAAKEMRERLEAALEKRMKTADSQMKRFLQEQLLLLPAANISTIDA
FT                   YALRLIENYYHVIGLDPQFRLLSDTAERDLLRQDVLDEVFASFYEESHENHADFLALVT
FT                   NFSSPSDDTQLKQIVLKLADFAEARPDGDAWLQHLNDNDISKISDITQSTIYQNDILPI
FT                   ISDMIKHLLSSATSAQSLVEGIPEFKKTQAGFMTIVDYLQHIQSDLMGTTWDNLREKVI
FT                   QMPKVSIETRASKGIKDEPDMLSILAQVTAIKNKIVGSKSDLNQLIDSFFRFDQANWQK
FT                   IQRATDELVRTLIVVTQTFRVTFAQSKRENKLVDFPDLGALALQILADEPTRKTVNGQF
FT                   IEILVDEYQDINQLQETLLSLVSNGKNMYMVGDVKQSVYGFRQADPTLFTSKYKQFNTT
FT                   ENDDSRIELADNFRSQNNVTRMTNLIFTQLMDEKLGDIAYAGEAKLVPKATYPTAVPAV
FT                   FDIDIITKQTSDPLVNDQEETQVFEKRQAQYAQLADKILKLRETTLFDRKSKPTGMRPV
FT                   NYADIAILTRSKSGYIDLVATLRDAGIPVQVESVGNYFQTMEVYLILDVLRVIDNPHQD
FT                   IPLVAVLRSPLFDFTENDLAAVRLADQKHDYWSALQKFSENSPRSKKVIALFDKWHLLA
FT                   TQNDLVTLIWTIFDDTAWLDYVAGMPGGTQRQANLHALYEYARTYQNNTNAGLFRFVRY
FT                   IEQLQENDGQLGEAPQESDAQAVRLMTIHASKGLEFPIVILPEFDKAFNTKDLTGKVLI
FT                   QKDAGIGIDYLQPDALVSMPTLQKLAVQQAIKRQSWSEEMRLLYVALTRAEQQIYVIGT
FT                   VAVDENGQNKQLSDLWQRAKNTAGQFLNEDLRLTAKSYLAWLIISLARTKNDVLENWLG
FT                   DGDVPRLLGSETLLDAELTVNFISENDIVLQHSSDTFGADEKILNASYDANDYAQAQKI
FT                   LAYDYKNKIASSTAAYQSVTEMKRLFEDPDLLNLKTLDIDEDGDFKPANELVNQSLMLP
FT                   GFMTDGSHKPSSAAVGIATHLLLQLIDFKQIQTRQTLEELRDNLVNSKRILPQVAALIN
FT                   IEQLMAFLDTPFAKRLQQHADTLQREATFAMIMPANRIYQTLTDDAPVLVHGIIDGYFI
FT                   DESTQAITIFDYKTDFIRHDRVIEELQKVKTRYQGQLRLYQQALQQEFPTYTFHDPQII
FT                   ALSVGQVISVTPPHVNG"
FT   CDS_pept        774429..775118
FT                   /transl_table=11
FT                   /gene="glpP"
FT                   /locus_tag="LEGAS_0752"
FT                   /product="Membrane-associated serine protease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0752"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91400"
FT                   /protein_id="CBL91400.1"
FT                   /translation="MLLTLKQQFKNTPVTISIFVLTVLVFFAEFLIGRGQTDNGSILVA
FT                   FGAKWGPYIKVYDQYWRLVTPLFLHAGVMHILTNMLTLWFIGPIAEETFGSRKFLGLYL
FT                   FGGIVGNIMSYLFAPLTVSVGASSALFGMFGGLILYAVQFKHDSRIRAQGTMMGLFVVL
FT                   NLMSGFFSTGIDMWGHIGGLIGGMMFAVMFGFYGRSGKYPMAWRLTMGVVTVLILALAL
FT                   IAKGGVS"
FT   CDS_pept        775115..775321
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0753"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0753"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91401"
FT                   /protein_id="CBL91401.1"
FT                   /translation="MKNFYDILTYLKTFGVYIHVGKRLWDIEIAALEVDNLKKADVIDN
FT                   KKYATMKLILAHEHRLEEENPSD"
FT   CDS_pept        775485..776453
FT                   /transl_table=11
FT                   /gene="glcK"
FT                   /locus_tag="LEGAS_0754"
FT                   /product="glucokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0754"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91402"
FT                   /protein_id="CBL91402.1"
FT                   /translation="MAKDKLIGVDLGGTTIKFAILTETGEIQQKWSIKTNVFDDGVHIV
FT                   PDIIESINHHLDLYQLDPKRVIGIGMGTPGTVNRTTGTVTGAYNLNWKTEQNVKADIES
FT                   GTGFLLTLDNDANAAALGEAWRGAGNNDDEVSFITLGTGVGGGLVSNGQLIHGTAGAGG
FT                   EIGHVVVEPNGYLCTCGNKGCLEQYTSATGVVHLAQDFSEEYVGSSKLKQLIANGDEVT
FT                   SKIVFDLAKDGDFLANKVIDKVAYYLGYATAAMSNILNPSAVVIGGGVAAAGEFLRARV
FT                   EKNWQTFAFPTVRSTTRVKLAELGNDAGVIGAASLARVDTN"
FT   CDS_pept        776605..777393
FT                   /transl_table=11
FT                   /gene="map"
FT                   /locus_tag="LEGAS_0755"
FT                   /product="Methionine aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0755"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91403"
FT                   /protein_id="CBL91403.1"
FT                   /translation="MITLKSPREIEAMRQSGAIIAGMHHMLQDLIKPGIDTWEIETKSR
FT                   DYIESHGAVPSQIGFEGFKYATTISVNNEVAHGLPRKGLHLKNGDLVKVDTVVALKGAV
FT                   SDSAWSYAVGEVTPEIQKLMAVTKKAMYLGIDQAVIGNRIGDIGNAIQQYTEVENHYGD
FT                   VRQYIGHGVGPTMHEEPQVPHYGKPGHGIRLREGMVITIEPMINIGGWEVDTDDTAEDG
FT                   WTVTTSDGSWSAQYEHTLAITKEGPKILTSQDAKFDAKYL"
FT   CDS_pept        777409..778044
FT                   /transl_table=11
FT                   /gene="epsE2"
FT                   /locus_tag="LEGAS_0756"
FT                   /product="Exopolysaccharide phosphogalactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0756"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91404"
FT                   /protein_id="CBL91404.1"
FT                   /translation="MKIKPKHKSYLITKRLIDVVFALLGLIVLSPIFVIVFVILKIDSP
FT                   KSSALFEQQRIGKDGKPFHIYKFRSMVPNAEEILKADKVLYEKYVASGYKLPTKEDPRI
FT                   TKLGSFLRRSTIDELPQFWNMLIGDMSLVGPRPIVAEELKEYGDQKDIFLSVRPGALGL
FT                   WQASGRSLIEYPERTQIELEYVANAGFFYDISIVFRNVIAIFKSKGAY"
FT   CDS_pept        778168..778947
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0757"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0757"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91405"
FT                   /protein_id="CBL91405.1"
FT                   /translation="MVDKIQILVAAHKKASMPQKECMYTPIQVGSALASEKFAGFLYDN
FT                   NGVNISAKNPYFNELTALYWARHNSDADVIGLVHYRRFFSISKKKSLSAILSEPDLREL
FT                   LQTTAVIVPKKRRYWIESSQSHYRHAHHGESLDVLRSVIATRQPDYLDSYDRNMAHSWA
FT                   HMFNMFIMKRNKFDAYMDWLFDILFAVEVQIQDDVVQWDHYEQRVYGFLSERLLDVWLD
FT                   KNHINYQEVPVIFMERQNWLLKGGRFLARKIGIGRIV"
FT   CDS_pept        779183..780388
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0758"
FT                   /product="unknown enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0758"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91406"
FT                   /protein_id="CBL91406.1"
FT                   /translation="MSRNTFLKIIMIPFVLINIMIIKETTVSANINNQEIVNEHGALLS
FT                   QLADDDSNAFVSNNVQNGFINNNSQVYYYNNQGQMIYGEQKIDNNWYYFDKITGAMAIG
FT                   FQNLGNKTVYYNNQGQMIYGEQKIDNNWYYFDKITGAMTIGFQNLGNKTVYYNNQGQMI
FT                   YGEQKIDNNWYYFDKVTGAMAIGFQNLGNKTVYYNSQGQMIYGEQKIDNNWYYFDKITG
FT                   AMTIGFQNLGNKTVYYNSQGQMIYGEQKIDNNWYYFDKVTGAISDDSTIVPKNAKEAGI
FT                   NGYNNGGWGYYSHNCTAFVAGVLSAQGVPDSVIRGLGNGSEWASCARNKGLRVDLIPEP
FT                   GTAISFKGGTSLYPYAEGHVAYVTSINNDGTFNIIEGNYSGLAYHERIIRVDSTVAGII
FT                   HF"
FT   CDS_pept        781029..782219
FT                   /transl_table=11
FT                   /gene="glf"
FT                   /locus_tag="LEGAS_0759"
FT                   /product="UDP-galactopyranose mutase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0759"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91407"
FT                   /protein_id="CBL91407.1"
FT                   /translation="MVNKFNTKNYDYLIVGAGPFGMIFAYEAAKRGKKSLIVEKRPYIA
FT                   GNTHTHVEHGITVHDFGAHIFHTDNKEVWDYIRQFAEFNGYQNQVVANYQGTLYNLPFN
FT                   MNTFYQMWGTKTPDEAQAKIAEQRELALKDLGNRQPRNLEEQAISLIGTDIYEKLIKGY
FT                   TEKQWGRPATELPAFIIKRLPVRFIYDNNYFNHRYQGIPVGGYTQIFERMLSQSQGLID
FT                   VLTDTDFFDHKETLLSEFPRVLYTGMIDQFFDYQFGELEYRSLRFESEVIDSDNYQGNA
FT                   VINYTDAKTPYTRVMEWRHLDGLADAGKTIITKEYPQEWDRSKEAYYPVNNDKNTQIYK
FT                   QYAQEARQKHPEIIFGGRLGKYRYFDMDQVFNDAFHTVREEFNVAADFNFAHDDTK"
FT   CDS_pept        782259..783218
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0760"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91408"
FT                   /protein_id="CBL91408.1"
FT                   /translation="MTEKIDKYSIEKPEVLSLVVPVHNEEETIQTFYDTLSALKDKLTA
FT                   TIQYHFVDDGSTDHTLSILRELANRDENVHYISFSRNFGKEAGLYAGLQQTTGQYVAVM
FT                   DVDLQDPPELLPQMLQDVQSGDYDAVGTRRADRSGEAKIRSWFSAQFYVWMNKISETQL
FT                   VDGARDYRVMTRQMVNAILSMSENQRFSKGIFSWVGFKTKYIPFENRERVAGSTSWSFW
FT                   SLSKYAIAGIVSFSTFPLTIITGLGFLSFGISLLSAAFIVIRALAYNNSAAGWPSIVTI
FT                   ILFIGGIQLLSLGVIGRYIAAIFLESKHRPIYITREEK"
FT   CDS_pept        783236..783667
FT                   /transl_table=11
FT                   /gene="tagD"
FT                   /locus_tag="LEGAS_0761"
FT                   /product="glycerol-3-phosphate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0761"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91409"
FT                   /protein_id="CBL91409.1"
FT                   /translation="MKRVITYGTFDMLHYGHINLLKRAKEMGDYLIVALSTDEFNWHSK
FT                   QKKTYFSYEKRKQLLEAIRYVDLVIPEEAWDQKTSDVKLYKVDTFVMGDDWAGQFDFLQ
FT                   DETDAEVVYLARTPEISTTQIKKDLNTKDLTTNHKSKTD"
FT   CDS_pept        783762..784670
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0762"
FT                   /product="Glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0762"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91410"
FT                   /protein_id="CBL91410.1"
FT                   /translation="MGTLSVSAVLVTYNRLELLSKSIQKVLSQDVDRLKHLIIIDGAST
FT                   DGTREYLDNLSDSRLIIVHLSENIGGAGGFNLGIRTFFEQTNDDFVWLMDDDSMPTANA
FT                   LTNLLDMFDNNKLAGWGASKVVWTDGNWAKMNIPGLLNGNKRRIYQGDEKWLPIKHATF
FT                   VSTIFKRDLIKKIGLPQKEYFIWGDDIEYTERAARAMSGYLVRQSIVIHASQFNSEPGD
FT                   IVGEVVVSRLPRYLFEYRNRLLTSRRRHSNLKLIKTLGHSVLDLLKTLFLPGVQYRGQK
FT                   IKLIVKGTINGFKFDPDIEKL"
FT   CDS_pept        784786..785010
FT                   /transl_table=11
FT                   /gene="cspA"
FT                   /locus_tag="LEGAS_0763"
FT                   /product="Cold shock protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0763"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91411"
FT                   /protein_id="CBL91411.1"
FT                   /translation="MKTGIVKIWQKERGYGYITPDDGGEDVFVHFNGIDMIGFKSLIQG
FT                   EKVNYVLVQGFKNYQAAQVSPIMKKAVDA"
FT   CDS_pept        785010..785561
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="LEGAS_0764"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0764"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91412"
FT                   /protein_id="CBL91412.1"
FT                   /translation="MAEREHVIDSKIIYKGPIFSIETQSVNLYNGHQAKRDIVRHVPAI
FT                   AILAFIDADHMILEKQYRASIGDFILEIPAGKLDERDFDQPEHAVERELNEELRMTAGV
FT                   IKRVVGFFETVGFSDAYMHVYTAQDLQLVSEKEQLPRDLGESLDLVTVSFNDMQVLFET
FT                   GKLTDQKTILAFLYWSYLRG"
FT   CDS_pept        785563..785859
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0765"
FT                   /product="Small membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0765"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91413"
FT                   /protein_id="CBL91413.1"
FT                   /translation="MSEELSRRAAKKAQKKREKERNQVEKNYAREHPTKITVVAPETRE
FT                   EMRLTRKGRYELGSDGKLTALGKSKRLTHRYNVTIVVLLLLIVATYAFFFLVN"
FT   CDS_pept        785987..786661
FT                   /transl_table=11
FT                   /gene="pfs"
FT                   /locus_tag="LEGAS_0766"
FT                   /product="5'-methylthioadenosine nucleosidase /
FT                   S-adenosylhomocysteine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0766"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91414"
FT                   /protein_id="CBL91414.1"
FT                   /translation="MKIGIITPMAEEKITLIAALENTATKRHGGTEITTGQYHGHEVVL
FT                   TESGIGKVAAASATTVLIDNFQPDLVVNTGSAGALDPDLKIGAEVVGTHVAYSDVDVTV
FT                   FGYDFGQVPNRPLYYEADKQVVREFSQLAAVKTGLIVSGDQFVQDEAKQRILTHFPEAM
FT                   LAEMEAAAVAQVAYQFKTPFIVLRGVSDLANGDSGIVFDDYVVEAGKVSAKLLLSYLDS
FT                   KA"
FT   CDS_pept        786742..787398
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0767"
FT                   /product="TRNA binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0767"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91415"
FT                   /protein_id="CBL91415.1"
FT                   /translation="MITTYNLKACGDILVIVLAPNADKQQVTTNGQVTRIQDRDTKKTT
FT                   GFNIVGLGKQLNITLQNGRIFLNKDQITIVNNVIREAGFNDVLVAEASKLVIGRVKSIT
FT                   AHPDSDHLSVTSTAVSDEKVLQIVSGSPNMREGIKVVVAQPGTMMPSGALIWDGALRGV
FT                   PSSGMIVSGRELQLDGAPDKPGALILPESFGEIGEPFNFDKAKSLYKDGLVDTEY"
FT   CDS_pept        787400..787543
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0768"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0768"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91416"
FT                   /protein_id="CBL91416.1"
FT                   /translation="MLIQDKLQNAPRTYRTLNDENAQYKKLIFELRKGELQYFTFLPNK
FT                   GK"
FT   CDS_pept        787543..788877
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="LEGAS_0769"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0769"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91417"
FT                   /protein_id="CBL91417.1"
FT                   /translation="MPKTYYFIGVKGTGMGPLAQILHDQGNIVIGSDIDAYTYTQAPLE
FT                   AAGIKILSFQSENVDKYREAIFVRGNAFSDEQVEVARALALGVTMMTYPEAVQEQIMQT
FT                   TSIAVAGAHGKTSTTGLLAHVLKNIAPTSYLIGDGTGRGVPNSQFFVAEADEYRRHFKD
FT                   YAPDYAILTNIDFDHPDYFKNIEDVTNAFSDFANHVKKAIFAWGDDAHLRALRPKATVY
FT                   YYGTSPENDDFVAENIHKSTQGSHFNVTFRGETLGEFSVPLFGQHSILNALAVIAVAYM
FT                   EKVDLDLIREYLMTYQGVKRRFSEKQIADITVIDDYAHHPTEIDATLDAARQKYPNKQI
FT                   IAIFQPHTYSRVIAYKDEFAKSLEAADKVYLANIFGSARESVGAVTSAEIGAEISKFGG
FT                   IIEEENMSLLMPYENAVMVFMGAGDIEKYEFAYEKLLGQLRTDLQ"
FT   CDS_pept        789021..789740
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0770"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91418"
FT                   /protein_id="CBL91418.1"
FT                   /translation="MDNFNINTRRDVTGMDAGMRAFFKQTYSFMAIAVMVTAITGFVVQ
FT                   KFFLAQVVALIAGNIVGTLALFGIQILIMTMIGRATFKNPARAFGLLMAFAVVEGLTLG
FT                   LLLAIYTGASVTMAFVSAAAVFGGMAAYGIFTKRDLTGMGSILFGLLIGLVVASVVNIL
FT                   FYNGIVSLLISGVSVIVFSLYTAYDNQNLKLMYSQFAGQADTTGLAVNGALRLYLDFVN
FT                   LFFALIRIFGVVGGSRD"
FT   CDS_pept        789838..792519
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="LEGAS_0771"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0771"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91419"
FT                   /protein_id="CBL91419.1"
FT                   /translation="MTKKLLLIDGNSLAFRAFYAMYNQLDRMISHKGLHTNALVAFNNF
FT                   LDQIVDPMQPDLAVVAWDAASGKETFRGELFPEYKDGRSKAPSEFKEQFPYLREMVALH
FT                   GLRNYEQPGLEADDIIGTYSRLGEQAGYTVIIVTGDQDLTQLATDNITVNVTKKGVTEI
FT                   ERYTPDYIMEKFNLKPLQIIEKKALTGDTSDNYPGVTKVGEKTALKLLAEYHDIDNLYA
FT                   HVDDMKQSKLKDNLINDRQSAFCARKLATILTDAHLALPLEEIEYRGIDYDNLVTFYEN
FT                   LDFKKQLAKIKALQKSGQISGSQTTVEKSINVIKLQDDNLQAVAMLGTKIAFHIEMIGQ
FT                   NYHIDDMVGFVIGSPATGYYGSRDVTLLQRPELKSVIENAGIIKNVFNIKAQLILLKRL
FT                   GIKLKGTKFDFLLVSYLLDTTDNDNELATLAQRFDLYMTSDEDIYGKGAKFAIPEDDAR
FT                   VLAHLANKADILMQVEQSAFDALQEHEQTHLYTEIELPLAQVLADMEYQGIKIDQKRLR
FT                   DIGSDLEGRIHAIEDAIYIEAGEKFNINSPKQLGVLLFEKMGLPVVKRTKTGYSTAVDV
FT                   LEKLAAQAPIVDHILQYRQLAKLKSTYVEGLLTVVHDQDSKIHTRFLQTLTQTGRLSSV
FT                   DPNLQNIPMRTEEGRQIRTAFVPSEPNWQIVGADYSQIELRVLAHMTGDKNMQRAFLNG
FT                   EDIHAETARAVFGLKDDAPVDALMRRTAKAVNFGIVYGISDFGLANNLGISRGEAKSFI
FT                   DTYFKEFPQIHAWMAKIKEIAHEQGFVETIAKRRRYLPEIGSKNFNLRSFAERTAMNSP
FT                   IQGSAADIIKIAMIKVADALQEHHMQARMLLQVHDELIFEAPIDEIQELTELVTNVMDS
FT                   AVVLDVPMRVESHYGNTWYDAK"
FT   CDS_pept        792615..792950
FT                   /transl_table=11
FT                   /gene="glnR"
FT                   /locus_tag="LEGAS_0772"
FT                   /product="Glutamine synthetase repressor."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0772"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91420"
FT                   /protein_id="CBL91420.1"
FT                   /translation="MSERELRRNLAILPMGTIRELTLLTDRQIRYYEQNELISPTRGKG
FT                   GQRRFSLNDVDRLLEIKDFLDAGDSIKDIQEIFAKQRRKAVGKQDSESALRRSLQKEFA
FT                   QIGRFDR"
FT   CDS_pept        792996..794342
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="LEGAS_0773"
FT                   /product="glutamine synthetase, type I"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0773"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91421"
FT                   /protein_id="CBL91421.1"
FT                   /translation="MARKSFTKEEINQIVIDENVEFIRVTFTDVLGAIKNVEVPTSQLD
FT                   KLLNNNLMFDGSSIEGFVRINESDMYLYPDLSTFMIFPWATDSRGGKVARLIADVYTSD
FT                   REPFEGDPRQALRKVLNEAKAAGFSAFNVGTEPEFFLFKLDANGKPTTELNDKGGYFDL
FT                   APHDMGENVRREIVLTLEKMGFEIEAAHHEVAEGQHEVDFKYASALEAADNIQTFKLVV
FT                   KTIARKNGYYATFMPKPVAGINGSGMHTNMSLFRGAENAFEDTSDEMGLSKTAYNFLGG
FT                   LLAHATAFTALANPTVNSYKRLTPGFEAPVYVAWSASNRSPMVRVPASRGKSTRLELRS
FT                   VDPTANPYTTLAAILAAGLDGIKNELEPLASVDKNIYLMDETERTKAGITDLPDTLLAA
FT                   IRELTNDSTITAAIGSHIADKFIEAKKIEYTSYRQFVSQWETDAYFENY"
FT   CDS_pept        794462..795445
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0774"
FT                   /product="YitT family protein, putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0774"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91422"
FT                   /protein_id="CBL91422.1"
FT                   /translation="MKKFTINWRKVLLIAVVFLASTAVQVLALNAFLIPNKVFSSGFNG
FT                   IAQLLSIFFVQLFHINMQTGTFIMIFNIPIGIIGWKLIGGKFTILSFLNSIVVSVVQIV
FT                   APTQALTTDPLLASLFGGLLLGVSIGLAMRYGFSTGGMDIIALVVQKRTGKSIGVLMNG
FT                   INFVVVIVAGAFIGWQNALFTLIGIYATGRAVDALYTGYQKLTALIVTSNGDEVVEALH
FT                   RDLIRGITILPSRGAYTKRDSMTLMMVLSRYELVEMQEIVHRTDPKAFINLLSTVSVSG
FT                   EFFDADRQLQMRRAVTVPKLETVTAQIEAEQQLESQLDKLETDDNK"
FT   CDS_pept        795469..795654
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0775"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0775"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91423"
FT                   /protein_id="CBL91423.1"
FT                   /translation="MPIVQVELLEGRTHEQLSKMVKDITDVIVADVGASREAVHVILRE
FT                   MPKDHYAVGGILKSDQ"
FT   CDS_pept        complement(795790..796752)
FT                   /transl_table=11
FT                   /gene="scrR1"
FT                   /locus_tag="LEGAS_0776"
FT                   /product="Sucrose operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0776"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91424"
FT                   /protein_id="CBL91424.1"
FT                   /translation="MNKKVTINDIAMIANVAKSTVSRYLNGGSVSVHTREKLDGIVQKY
FT                   NYTPNTFAQSLKQQTNHTIGVIVPRLDSIAQSDMLRGLDELNIDDTFLIINVYQDSARE
FT                   LAAIEKLQSQNVSGLIILTANLTEEIRSVIKASKLPTVIQGQDEAEFNRVIMNDIQAGK
FT                   TVGNYLQKLAPKNVLLLNVDMSLDYAVGHDRFVGIKSALNGMPHKEIITDFKLNIAKQS
FT                   AYQAMIHEDFDLIIGATDRIVVGAMQSAFALHQKPRYIGFGQSYFSETVSPNLTSFEFS
FT                   FFEAGKELYRLFRKVRDNNTIQIQRIVIDGKLIIRDSTN"
FT   CDS_pept        796926..798866
FT                   /transl_table=11
FT                   /gene="scrA1"
FT                   /locus_tag="LEGAS_0777"
FT                   /product="PTS system sucrose-specific EIIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0777"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91425"
FT                   /protein_id="CBL91425.1"
FT                   /translation="MKYNEVANRVMNAVGKDNIVAAAHCATRLRLVVKDVKKIDQAALD
FT                   DDPDLKGTFNANGQYQIIVGPGDVNGVYDEFVKMTGVKQASTDDLKEIAAKSGKRNPLM
FT                   DLIKVLSDIFVPLIPALVAGGLLMALNNILTQPFGTKSLVEMYPNIQGLAEMVNLMASA
FT                   PFAFLPILIGITATRRFGGNEILGAAAGMMLVMPNLINGYGVAEAVATGKMPSWDLFGL
FT                   SVAQAGYQGQVLPIIGVAFILATLEKFFHKHLKGAIDFTFTPMLALLITGFVTFIVVGP
FT                   VLRVVSNGITDSLVWLVTTFGFVGYGVFGSFYSAIVITGLHQSFPAIETQLLANIAKTG
FT                   GDFIFPIATAANVAQGAATFAIYFLAKGNTKLRALSSSAGASAMLGITEPALFGVNLKY
FT                   RFPFFIALGSSGVASLVMGLFHVMSSSLGPAGVIGFIAIPTNKWFGFFLAIIVSFGLSF
FT                   VVTLIYGRSHMPEVNTASVTNVHPNQVTGFEINAPVAGELVDITTVNDAVFSSGMMGTG
FT                   IAIEPEDNKIFAPIDGEVTVAYATKHAYGLKSNDGVEVLIHIGIDTVNLDGKGFTSQVT
FT                   QGQQVHRGDLLGTFDKQVILDAGYPVTTMVIVTNTNSFSDVALDTTYGKTVQSSDVIMT
FT                   AVPQNNTITEA"
FT   CDS_pept        798877..800142
FT                   /transl_table=11
FT                   /gene="scrB1"
FT                   /locus_tag="LEGAS_0778"
FT                   /product="Sucrose-6-phosphate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0778"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91426"
FT                   /protein_id="CBL91426.1"
FT                   /translation="MLVTNDAVSFEKFHLYPTKGLLNDPNGLIFFKGQYHVFYQWNPYA
FT                   CDHTYKEWGHFVSDDLKEWQRVKTALKPSLENLDSAGIYSGTAFVHDDRLYIFYTGNVR
FT                   DTSGHSVKSSQMWAVSDDGIQFKKLGELFPHPNGFTKDVRDPMVWQGKNGHYFLILGAQ
FT                   HSNKVGDIIIYESIDFKNWSYRGSLIENQLLDVRGYMLECPNFIEVDGKQILMFSPQGL
FT                   AADPKNNRYENIHNTGYVIGQFDEKSARFNVITDFKEVDHGFEFYAPQTMIAPDGRRIM
FT                   WGWAGMMTPEREAAVPTIQNRKWVHVLSLPRELHVNDKLQLVQQPITEIIDTTVLTSFD
FT                   NVSIGQYRIPTTADWTIRLSDRAMLSRHHNKLVFERQQWESGQVETRQLTGDLNNLLLI
FT                   VDVDVIEVYTEDGLNAMTARWF"
FT   CDS_pept        complement(800190..800564)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0779"
FT                   /product="Cell wall enzyme ebsB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0779"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91427"
FT                   /protein_id="CBL91427.1"
FT                   /translation="MIKIFVDAARNIQTGQSAAGAVIITNNKQRQLKSSLPDTQNNQEA
FT                   EFLALIWALKTLDSTTDIIQLYSDSQILIDAIHKNYAKHYQIYVDEISTLVSLHKLFLS
FT                   QWLPEKENLGAHNLALQALK"
FT   CDS_pept        800749..801150
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91428"
FT                   /protein_id="CBL91428.1"
FT                   /translation="MIPKRGYFQPLDITGQIGWLWWFILFMAGIILWSETTFKLEMMPI
FT                   VYLLFMLILGIITILRRRVYVAGAQLFLGRVFVSDYEKISLTTMVNWQLNGHVLSFTRA
FT                   GRSRKYWLSQNIANQIKEYMATYDKKDNN"
FT   CDS_pept        801128..802054
FT                   /transl_table=11
FT                   /gene="rluD1"
FT                   /locus_tag="LEGAS_0781"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0781"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91429"
FT                   /protein_id="CBL91429.1"
FT                   /translation="MTKKITINIIDQIGRIDAILAKENLPYSRTTLAEWLQTGHILVNG
FT                   VQVKRAYKVTTGDTITILQPEVITTEIIAEDIPLDIIYEDDDILVVNKPQGMVVHPAAG
FT                   HSSGTLVNALLFHAPLSTINGEFRPGIVHRIDRDTSGLLMVAKNDQAHQGLSAQLKAHK
FT                   NDRIYYALVRGEFVENSGTINAPINRHKVDRKKQAVQEGGREAITHFEVIERYVGYTLL
FT                   KVRLETGRTHQIRVHMTYIGHPVVGDPVYGSAQNLAGVKLNGQMLHAKTLSLTQPKTGE
FT                   ELRFDSALPAYFKDALATLTPIIQNNN"
FT   CDS_pept        802103..802630
FT                   /transl_table=11
FT                   /gene="pyrR"
FT                   /locus_tag="LEGAS_0782"
FT                   /product="PyrR bifunctional protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0782"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91430"
FT                   /protein_id="CBL91430.1"
FT                   /translation="MTNKEVLDSASLQRALTRITYEIIERNKGGQDLILVGIKTRGEFL
FT                   AQRIASRLEQLEGVKIPVMAIDITNFRDDVLNQEDSLGLNEAEKNNIADKNIVLIDDVL
FT                   FTGRTIRAALDALIHIGRPNSISLAVLVDRGHRELPIRADFVGKNIPTAQNEKIKVLVQ
FT                   EIDGHDAVEIVH"
FT   CDS_pept        802701..803786
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="LEGAS_0783"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0783"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91431"
FT                   /protein_id="CBL91431.1"
FT                   /translation="MIQRHLILEDGTIFPGLGFGAPATTFGEIIFHTAMTGYQEIITDP
FT                   IYDGQMIVFATPVVGASGIHAEAYESVKPTISGMIVHDLAEVSVNRQRRMNLDRFLKQH
FT                   NIPGLYQVDTRQLIRHLRETGPQKASIVDFADEHAIDQLVATVLTNKQVQSTATPKPYA
FT                   NPGRGRHIVVIDFGLKHGILRMLGDYDANVSVLPYTTSVAEVLTLDPDGIILSTGPGDP
FT                   RTLPDSVLTLIRVLQSKVPMLGIGLGHELFALANDAELMPLPSEHHGMNHPIQEIITRQ
FT                   IFYAMQGQGYAVDASSINRKKLFVTYRDLVDGAVQGLRHREFPAFSVQFFPDAAPGPLE
FT                   ATTVFADFFETVEDYVEHYNQ"
FT   CDS_pept        803764..806277
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="LEGAS_0784"
FT                   /product="Carbamoyl-phosphate synthase large chain"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0784"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91432"
FT                   /protein_id="CBL91432.1"
FT                   /translation="MSNITINNKIKKILFIGAGANDFGREAEHDAAIYQVMPELRGHGI
FT                   EVFVVDENPYALSLESLAATTFWQPLTIENLKKIVKENNIDTVAPLFGGEASLRLWAEV
FT                   VQSWSHGDGPVPNTLGLSIEMLLKVNNIPALTAYMAKNGLPVINNYVLKAQDEANELLR
FT                   ELQLPLMIRALHPNQTNTRHIVERLDDFEDAINLAKLQSVTQEVIISKAINGLKEVSIE
FT                   VLRDFRGNKMQIGASEDMDPIGIHTADSLSVSPILTIQDQLISKMRDYAFRVADILQLQ
FT                   GVMHVQFAVDDDTNKIYIIKVSPYIDQMATRMSLATGYPTMLVTINLALGVALEDIVLP
FT                   HNFGKNTAIMEPMMDHVVVKLPVFPFGELVQAGVHVNRQLNSVQKSIGTTLGFGRTFIE
FT                   ALEKAIRSAHFNNASFSPTNMAYINDDELIQQLIHPQDNRVLLLIEAIKRGYEIDELAE
FT                   LTAIDEFYFYQLKHLHTLEEEVEADIDSIKSLRRGKKYGLSDGLLARFWHTDFNIIRTL
FT                   AKENHIDVTYKAVEPSAGEFPENARQYYATYEAENESVQINADSVLVIGSGAFRMGDAA
FT                   SGGYATTITMSELRRLQYPTIIMNNNPSDATLLPHLADKQYLEPLEISDVMRVVELEKP
FT                   QAIVIPGNRRKLIKALRDLGQQVIILPKEKHTPSGPNENQSEFALNLFYDGQNMYPINF
FT                   TQHMAGEVRIIPQLANLPEEIAQKEIESPGVYQIIWYQNTVTWIDTVDAADIVHDSWLR
FT                   PMPFGQIAYMTKVMDVQWIRLTIRAALHELTDQDVTTLAMINQQPIVQPLSMIAADVNY
FT                   RLHLQPNEVIDGTRFEIGVGVNYYE"
FT   CDS_pept        806270..806563
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0785"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0785"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91433"
FT                   /protein_id="CBL91433.1"
FT                   /translation="MSDSKKYDTQLFTGVVVEQDASGRYRPKTGVTPNVWRTGKHTKGK
FT                   FKQIGQVFLTEKGQAIAVLNTEKLAFNKRHNYSSLQRWTSQQVSLELLKDWL"
FT   CDS_pept        complement(806648..807883)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0786"
FT                   /product="Multidrug resistance efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0786"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91434"
FT                   /protein_id="CBL91434.1"
FT                   /translation="MSENYNTKLDDSEPIWQQNVFVLWFGVFMTGVALSEVMPFLSLYI
FT                   DTLGTFSKNQLSFYSGAVFAISFLVTAIVSPFWGKLADRKGRKLMLLRAALGMSIVLFL
FT                   MGNVTNVWQLLFLRALQGGMGGFISNANALVATQTPKKHAGKALGILVTGMTAGNLIGP
FT                   LFGGTLATFFSYRTSFHITGIILFLVFVLTLFLVKETPHISTPRIANASTKYLWTHIPN
FT                   KQLIIGLFVTTMLVQTVNTAINPIISLFVRELMHNASNTTFIAGMVAAMPGIATVIAAP
FT                   PFGRIGDHLGTDRMIKIGFMIAVIAFLPTAFVTSVSMLMFFRFLVGISDATMLPAIQTL
FT                   LSKNSPTEMTSRIFSYNQSFQSLGSVMGPMFGALIASLFDYRGIFVFCTIIIIINAVLF
FT                   NVSTRHLEHESI"
FT   CDS_pept        808122..810359
FT                   /transl_table=11
FT                   /gene="relA"
FT                   /locus_tag="LEGAS_0787"
FT                   /product="GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0787"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91435"
FT                   /protein_id="CBL91435.1"
FT                   /translation="MAKTKKYTGEEVLTLVGQYMSDADTAKVRAAYEWASDLHKGQLRK
FT                   SGEPYIIHPIQVAGILAELKMDTATVISGYLHDVVEDTPATLADVEAKFGETISQIIDG
FT                   VTKISKIQYKNSQEQLAENHRKLLLAMSKDIRVIIVKLADRLHNMRTLGALREEKQHRI
FT                   ASETLDIYAPLADRLGISTIKWELEDLSLSYLNQEKYHSIASRMNMKRDERIRYVQEAV
FT                   SEIETAIQELELQHIDVYGRPKHIYSIYRKMTDKHKAFEEIYDLSAVRVLTETIPDTYA
FT                   VLGAIHSKWMPLPGRFKDYIALPKANGYQSLHTTVIGPGGRPLEVQIRTHTMHEVAEFG
FT                   VAAHWAYKQNKGANKEVKINDHSQQALNVIQGILELQEDAKNAEDFMDGVQGDLFSDRV
FT                   YAFTPRGDVFELAKGAGPLDMAFSIHTNVGIKTTGAKINGRIVPLDYKIKTGDIIEIIT
FT                   STSAKPSRDWLDLVSTRRARNKIKQYFKQLDRDDNIEAGRELVTRNLRDTGFSTIAILS
FT                   TENLTKTAEVLHYHSYDDMFAAIGYGDVTVPGVVNKLTEGIREAQQEAETAELQRELLE
FT                   EGHEIKRGETALTQRQKGSADDIVIAGVDNLLIRLGRCCTPVPGDQVIGYITKGRGISV
FT                   HRVGCPNIRAAETQGQRLVDVQWEDEEGLKPNYDADLTVHGENRNGLLNDVLRAVNGRT
FT                   RFVNSVNGHVTKNGMAQVSLSLGVKNSMQLNGIMDALNTLPAVYDVERTFH"
FT   CDS_pept        810456..810902
FT                   /transl_table=11
FT                   /gene="dtd"
FT                   /locus_tag="LEGAS_0788"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0788"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91436"
FT                   /protein_id="CBL91436.1"
FT                   /translation="MKIVLQRVTQACVSIAGDKIGEIEHGFVLFVGVADADSQLEIDYL
FT                   VRKISQLRVFEDDNERMNLSIKDIDGAILSISQFTLFANTKKGNRPSFTDAGAPAFASM
FT                   MYDHFNESLRASGLSVITGEFGANMQVSMVNDGPVTILFDTAHQ"
FT   CDS_pept        complement(810936..811553)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0789"
FT                   /product="UPF0078 membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0789"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91437"
FT                   /protein_id="CBL91437.1"
FT                   /translation="MFSTILMFVFSYLLGSLMPGFWIGKFFYHKDIRDEGSGNVGTTNS
FT                   FRVLGTAAGIVTLALDLLKGTAAGLLPLLFNSNINPMLVGVAAIIGHTFSIWLKFKGGK
FT                   AVATSAGILLAYNPYFFILAISVFILVLLLTSMVSMSAMISFSFAVCASLFYHDLVLTI
FT                   VTIILTIFVFYRHRSNISRIKNGTESTVPFGLYNSIRQNRHQ"
FT   CDS_pept        811756..813828
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="LEGAS_0790"
FT                   /product="DNA topoisomerase IV, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91438"
FT                   /protein_id="CBL91438.1"
FT                   /translation="MAEKNHYDSDSIKILEGLEAVRKRPGMYIGSTDGRGLHHLVYEIV
FT                   DNAVDEALGGYGHDIRVTIHENNAITVQDFGRGMPVGMHESGKPTPEVILTVLHAGGKF
FT                   GQGGYATSGGLHGVGSSVVNALSESLQVTIVRDGHKWQEDFIKGGQPVGTLRDLGVTKE
FT                   PSGTKVTFKPDATIFSATVYKYDTLSERLRESAFLMSGVKFSLTDERVKPKRVEEYHYE
FT                   KGLEAFVGFLNEEKETIGSIMTFEGQQDGIAVEVAAQYNDGYSETLLSFVNNVRTQDGG
FT                   THEVGFRTAWTKAFNEYARKVNLLKEKDKNLEGTDVREGLAAVISLRVPEQFLQFEGQT
FT                   KGKLGTPEARGIVDAVVNETLGRFLMENGDFGQNLIRKAIRAREAREAARKARDESRTG
FT                   KTKGQKDRLLSGKLAPAQSKNAEHNELFLVEGDSAGGSAKQGRDRKFQAILPLRGKVLN
FT                   TEKAKLADILKNEEISTLIYAIGGGVGTDFKVADTAFSKVIIMTDADDDGAHIQTLLLT
FT                   FFYKYMKPLIEAGRVYIALPPLYRVKYASKKFEDKFAWTNDELETITNQNDARYELTRF
FT                   KGLGEMNAPLLWETTMDPESRTLIRVKIDDAVLAEKRVTTLMGDKVEPRREWIEANVHF
FT                   TLDEAGSILDTVEGYDSNASDIFEKVRNHEKTDSVVSNDIKTSEPVITTWQKDDK"
FT   CDS_pept        813977..816415
FT                   /transl_table=11
FT                   /gene="parC"
FT                   /locus_tag="LEGAS_0791"
FT                   /product="DNA topoisomerase IV, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0791"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91439"
FT                   /protein_id="CBL91439.1"
FT                   /translation="MADRITELSLEAVMGERFGRYSKYIIQERALPDIRDGLKPVQRRI
FT                   LFAMDQDGNTFDHPYRKSAKSVGNVMGNFHPHGDSSIYEAMVRLSQNWKVREPLIDMNG
FT                   NNGSVDNDPAAAMRYTEARLSKIAGEMMTDLGQETVDMVLNFDDTTYEPTVLPSRVLSL
FT                   FINGATGISAGYATEIPPHNLKEINGALTYLLDHPEAPLSALMRYVKGPDFPTGGIIQG
FT                   LDGIKKAYKTGRGKIVVRAKTVISEIKGGKKKIEITELPYEVVKSNLVAKIDGIRLNKE
FT                   VAGISEVRDESDREGMSIVIELNKDVNAAGILTYLFKKTDLQIYYNFNMVAIHDQRPVH
FT                   VSLKQGLEAFLNFRKEVVLKRSAYELAKAQARQHIVEGLIRMLSILDEVVATIRASKNR
FT                   KDATQNLIDSYQFTQPQAEAIVTLQLYRLTNTDVTQLEEEFATLAAKIVRLNLIINESS
FT                   ALNDVIRDEIAEITTTYRSPRRSEIEAEVENLIIDSAITIAEEDVQVLVSRNGYYKRAS
FT                   LRSYKASDSDNGLAEDDLAIFEGQLNTTQHLFMFTNKGNIIYRPVHELPDSKWKDTGEH
FT                   FSQQLSNWHADEFVIKVIAIDNLEQEGAFTVVTNDGFIKQTILSDMVPKAYKKKTSMAI
FT                   KLKTDSSYVVGIAYFKQAKQQDVLLLSHDGVGLRFKVTDVPEIGPRTAGVKAMDLRGTD
FT                   TIMAALFITNDSQQVAIVASNGAFKYMPISEINRSKRANKGLLIFTQKKTVAYHVAAAT
FT                   IFEAHETALEILTTRWQAQELQLSDYHPSQRIGNGQYVVDVKKNGTPWLIKPLSIHATK
FT                   "
FT   CDS_pept        816464..817369
FT                   /transl_table=11
FT                   /gene="ppaC"
FT                   /locus_tag="LEGAS_0792"
FT                   /product="Manganese-dependent inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0792"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91440"
FT                   /protein_id="CBL91440.1"
FT                   /translation="MAKTLVFGHKNPDTDTIASAIAASYLLNQLGGDTEAVAQGTPNAE
FT                   TQFALDFFSVTAPRITTSADTETVVLVDHNEATQSIDNLSEVIVEGIYDHHKFSFTNST
FT                   PLYINAKPWGSVATILYYEFKQANIDIPSKVAGLMASAIISDTLLLKSPTTTAYDKPAL
FT                   EDLAAIAGLDDYEKYGLSLLKAGTDLSSRTDKELIDGDAKSFEIGGHKFRIGQVNTVDI
FT                   ADVLTRQSGIEAAMVAEDYEDFLFVITDILNSNSKALYLGDATTSIEAAFGAKISDNVI
FT                   DLPGVVSRKKQIVPPLEKQF"
FT   CDS_pept        817540..817689
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="LEGAS_0793"
FT                   /product="50S ribosomal protein L33 1"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0793"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91441"
FT                   /protein_id="CBL91441.1"
FT                   /translation="MRIHVVLGNDETGERIYLTSKNRRNTPDRLELKKYSPKLRKVVTF
FT                   KEIK"
FT   CDS_pept        817691..817960
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="LEGAS_0794"
FT                   /product="ribosomal protein S14-2"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0794"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91442"
FT                   /protein_id="CBL91442.1"
FT                   /translation="MAKKSKIAKAQKREALVAKYADKRAELKAAGDFIGLAALPKDSSP
FT                   VRVHNRDWIDGRPHAYMREFGMSRLNFRQLAHKGQIPGVRKASW"
FT   CDS_pept        818304..818780
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0795"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0795"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91443"
FT                   /protein_id="CBL91443.1"
FT                   /translation="MVNKVEQRIIELITPIVDRRKELLWDLTYTKEGGQKVLRILLDKP
FT                   NHQFITMADLTAFTQEVNELLDTSDPDPIPEAYLLDISSPGADRPLKQPWHFKWAQDGN
FT                   ENILMSLFVAKNGQKKWQGKIKTLTDNGLVLLTDHGEIILNFDEIAKAVLDIQF"
FT   CDS_pept        818901..819992
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="LEGAS_0796"
FT                   /product="N utilization substance protein A"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0796"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91444"
FT                   /protein_id="CBL91444.1"
FT                   /translation="MSKELVDALDALEAERGIEREIVVAALEDALRAAYKKQYNAEQNV
FT                   EAVFDTKKGNVAIKQVKNVVLDDDFENEDTEISLTDALVINRAYEAGDEIRFDVTPKDF
FT                   GRMAAQAAKQVIVQKMREAGREAIYNKFADYQDEIITGEVDRQDARFLYMTLPGNQEAA
FT                   MAPNDQMPNERYRMGDRIKVLVNKVENNAKGPQIFVSRTAPDLVKRLFEQEVPEVYDGT
FT                   VEIMNISREAGDRSKIAVYTHDTDLDPVGAMVGQRGARVQAVVNELGGENMDIVEWVED
FT                   EAQYIANALNPSEVADVIFNPENERAVTVIVPDNQLSLAIGKKGQNARLAARLTGFKID
FT                   IKSESEAANSLSKQSPLKAESGE"
FT   CDS_pept        820058..820360
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0797"
FT                   /product="Predicted nucleic-acid-binding protein implicated
FT                   in transcription termination"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0797"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91445"
FT                   /protein_id="CBL91445.1"
FT                   /translation="MKPRKIPMRKDIVTGEMFPKKDLVRVVRDKEGNVNLDPTSKANGR
FT                   GAYIGLDRTIAAEAKKKHIFDQAFEMKIPDEFYDELIAYVDHQQARRELFANADK"
FT   CDS_pept        820347..820670
FT                   /transl_table=11
FT                   /gene="rpl"
FT                   /locus_tag="LEGAS_0798"
FT                   /product="ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0798"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91446"
FT                   /protein_id="CBL91446.1"
FT                   /translation="MLISKDEQILNLLGLAMRAGKLVLGSDSTLTAIRGNKVQMAFFPS
FT                   DGGQSQSKKFADKSSFYNVTLIQDYTKRQLTDAIGVNRSVFAIADRGFSRKIKQLISEK
FT                   ERN"
FT   CDS_pept        820671..823181
FT                   /transl_table=11
FT                   /gene="infB"
FT                   /locus_tag="LEGAS_0799"
FT                   /product="Translation initiation factor IF-2"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0799"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91447"
FT                   /protein_id="CBL91447.1"
FT                   /translation="MTEEKKFSGSNRPARKQAVPERKELPASQRRHAAKLTDGTTVTPN
FT                   NTASRPSKPARSGQQGQQNRASNQNRTNGTATGTNAGGNRSNNGGQNRNSRPGGSRVRA
FT                   AEGRPAMRETKNWSTKPREGQVDYSKQKDNSLKQYVSENEKRKQAVAAAKEPQKPKPVA
FT                   KPVENKKTEPKVAKPTTAAPAAGAGKFGGALASGNNSARNNSRKRNTAGTGQQTPRRND
FT                   KPRGSKKSRRIAAKRGPVAPVTERKKQPLPEILEYRIGMNVQDLSKLLHRDTAEIIKKL
FT                   FLLGIMTNQNQSLDTDTIEILAADYGIEAQVKAAEDVADIDRFFDDENIDEGQLVSRPP
FT                   VVTIMGHVDHGKTTLLDYLRNSHVTEGEAGGITQHIGAYQTQLNGKTITFLDTPGHAAF
FT                   TEMRARGANVTDLTILVVAADDGVMPQTIEAINHAKAANTPIIVAVNKIDKPGAKPDDV
FT                   MNQLMAYDLVPEEYGGDTIFVKISAKFGQNVDELLEMILLQAEVLELKANPDMPARGSV
FT                   VEARLDRGRGPVATVLVQQGTMRVGDPIVVGNTYGRVRTMTNERGVELEEASPATPVQV
FT                   TGLNDVPQAGDRFIVMADEKTARAAGEERAKRAQEVIRNSGAVVTLDTLFSTMSEKAMK
FT                   TVPVIVKADVQGSVEALSGSLKKIEVDGVRVDIIHTAAGAINESDVTLASASGAIIIGF
FT                   NVRPTPLAKSQADSEKVDIRFYNVIYNAIDDVEAAMKGQLEPVYEEKVIGTVTVKELFK
FT                   FSKVGIIAGAMVEEGKITKEAKVRIIRDGIVAFDGEIASLQRGKDSVNEVKMGFEFGFT
FT                   VAKYNDVRVGDVVEAYVMAEVKAK"
FT   CDS_pept        823230..823583
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="LEGAS_0800"
FT                   /product="ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91448"
FT                   /protein_id="CBL91448.1"
FT                   /translation="MVNPQRAGRLAQEVQRDVTSLLLKRINDPRVQDVTVTSVELSGDL
FT                   QIATIYYSILSDLASDGKKAQAGLEAASGLIRKELGSRLTVYKTPELKFVRDQSVQYGN
FT                   HIEDLIRKLHSEN"
FT   CDS_pept        823679..824857
FT                   /transl_table=11
FT                   /gene="araT1"
FT                   /locus_tag="LEGAS_0801"
FT                   /product="putative aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0801"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91449"
FT                   /protein_id="CBL91449.1"
FT                   /translation="MANFIQPLNPIITEMAPDKLLGFQKSVRDIPGILKLTLGEPGFSV
FT                   DERIKKAATEAINSDRSHYAESQGEQALRLEAVNYFNKRYHLNFHGEENVIVTLGVSEA
FT                   INVVLDTLLGTDDGLLMPEPTYGPYFTSLDIAHGTKIAIDTTPNRFKLTPEMVDKAVAS
FT                   ATVPVRAILMNYPANPTGVTYSRQEVIALAETFKKHNLWVISDEIYSLLTYDQAHVSFA
FT                   EIIPEQTIYINGLSKSHAMTGYRVGFILGAADVIAEMQKVHGALTFAIPTFIQDAALIA
FT                   LRDVSDTPIIMRDAYKSRRDRIVPQLQALGFDVVSPEGAFYVFAKLPTDIGDDGDEFAL
FT                   RLAHEGKVAVIPGSSFSEVAKAYIRISYAASDADLDEGMRRLTAHINQLRGK"
FT   CDS_pept        824872..825393
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0802"
FT                   /product="Putative PTS lIIA component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0802"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91450"
FT                   /protein_id="CBL91450.1"
FT                   /translation="MNWWQNVFNQKNKYNRVKTTGQMNAVHVARKSKFPVVVAPVTGQL
FT                   QKIDGDNEQNHSKNGFMMLPDGNNIMSPVSGIVTASDEHTVIIKSVNHDKVTVQVQARN
FT                   EMLQGTRLATYGTGQQLHAGDLIGTAHAMDQNDVRVYVFFEDSVVPYVNYGAVYAGQSI
FT                   WQYQEDEDAT"
FT   CDS_pept        825383..826291
FT                   /transl_table=11
FT                   /gene="truB"
FT                   /locus_tag="LEGAS_0803"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0803"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91451"
FT                   /protein_id="CBL91451.1"
FT                   /translation="MQHNNNVDGLIVVNKPRGVTSFDVVAKVRRAIGQKKVGHAGTLDP
FT                   NVDGVLVVALGKATKLIDELQTRPKQYVGSITLGFATETEDLDGEVISKVDIDVPFTDA
FT                   AIDTAIANLNGAIKQVPPMFSAVKVGGKRLYEYARAGEDVTRPIREALIYDYKRIGATI
FT                   YENKQQHFDFEATVSKGTYIRTLAVDTGLQLGVPATMSSLTRTMGSGITIAHAANLDDI
FT                   ATIAQSELLKLIIPIKDVLTWPTKALSDDEWFAVKNGQKIATWPASDTYLQLTYHDDVK
FT                   AVYAYNKEDNVWQSRYVFTNE"
FT   CDS_pept        826294..827244
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="LEGAS_0804"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0804"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91452"
FT                   /protein_id="CBL91452.1"
FT                   /translation="MIKVIKLHYPILKKIIPDPTPQVVAMGFFDGVHLGHQAVIKQAKL
FT                   EADKQGVPLAVLTYDPQPIVVFEMLTQPLRYLTSINQKAALLADLGVNTMYVMQFTSQL
FT                   AKLAPQEFVNQVIMRLNPVTVVGGFDHVYGGDVSIADMDHLPQYAKKRFNVVSVSELDV
FT                   NNQKIGSSSIRKALELGSMNIVNSQLGRIHQTTGLVIHGEARGRELGFPTVNIKTPELE
FT                   WLPTIGIYAVKIMIGDDWHLGMASIGRNITFGDARPITVEINILDFNQQVYGENVTVNW
FT                   YNYLRGEVKFTNIPELVTQLKKDEIATRQYFDALN"
FT   CDS_pept        827371..828399
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="LEGAS_0805"
FT                   /product="heat-inducible transcription repressor HrcA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0805"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91453"
FT                   /protein_id="CBL91453.1"
FT                   /translation="MLTERQKLILSAIIYEYTQTAHAVGSKSLQEQLNIKVSSATIRNE
FT                   MAALESAALIKKLHTSAGRVPSRAGYRYYLDNLMMARVATQQDIALVMQSFRGNFHEID
FT                   DLLDESARTLSQLTGATVLILKPERLNIVVSGFRLVPLENQQLIAVLVTNDGKVTSQTF
FT                   KLPRELAVSSLDSMIKYINDQTNGRPVLEVLQMMQSDELPTQMSRMIKTPAAFLQLFGD
FT                   VLARSIGDKVHIGGRLNVLDFSDDDQNTKNVKQLLEFLTSAADVRRVATTTAHHVTIKI
FT                   AKEIDEPLLKSFSLITRAFTVPNQGDGVIALLGPIRMSYARNVLLMDAFGEALSQKMIE
FT                   YT"
FT   CDS_pept        828417..829001
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="LEGAS_0806"
FT                   /product="co-chaperone GrpE"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0806"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91454"
FT                   /protein_id="CBL91454.1"
FT                   /translation="MADETENKLKDDKITEDSDTTASNATSVEEMIEDENVVQEEIDPK
FT                   QTELNEALARVSSLEDQLLRSQAEIQNMQQRHAREIQNVHKYDGQKLASAVLPAVDNLE
FT                   RALLVESEDAVAQQIKTGVEMTLKTLVQALTDNGISATGEVGETFDPTKHQAIQSVDSD
FT                   DVDSDQIASVLQKGYILQDRVLRPAMVAVAK"
FT   CDS_pept        829110..830954
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="LEGAS_0807"
FT                   /product="chaperone protein DnaK"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0807"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91455"
FT                   /protein_id="CBL91455.1"
FT                   /translation="MSKIIGIDLGTTNSAVAVLEGGEPKIITNPDGGRTTPSVVSFKNG
FT                   ENQVGDVAKRQAITNPDTIISIKSHMGDANYKVNVDGKDYTPQEISAMILQYIKGYAED
FT                   YLGEKVDKAVITVPAYFNDAQRQATKDAGKIAGLEVERIINEPTAAALAYGLDKLDKNE
FT                   KILVYDLGGGTFDVSILELGDGVFEVLSTNGDTHLGGDDFDNAVIDYLAAQFKSDNGVD
FT                   LKSDKLALQRLKDAAESAKKTLSSATEAQIDLPFIASGEQGPLHLQTSLSRAKFNEITA
FT                   SLVKKAEQPVLNALKDAGLSFSDIDEVILNGGSTRIPAVQDSVKKLTGKEPNHSINPDE
FT                   AVALGAAVQGGVITGDVKDVVLLDVTPLSLGIETMGGVFTKLIDRNTTIPTSKSQVFST
FT                   AADNQPAVDIHVLQGERSMATDNKTLGRFQLSDIPAAQRGVPQIEVTFDIDRNGIVSVS
FT                   AKDLGTQKEQKITIQAAGGLSDDEIEQMMNDAKANEEADAKKKESVDTRNEADQLIFST
FT                   EKTLEEVGDKLGDDDKKATQDALEALKKAKEDAAADDADLTELKTKSEELGKAAQELAM
FT                   KLYQQAAPQEGAEGEAKPADDNTVDGDFEEVDPDKKKD"
FT   CDS_pept        831036..831938
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="LEGAS_0808"
FT                   /product="chaperone protein DnaJ"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0808"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91456"
FT                   /protein_id="CBL91456.1"
FT                   /translation="MNNTEFYDRLGVEKNASQDDIKKAYRKLSKKYHPDLNHDAGAEEK
FT                   YKEVQEAFETLGTEQKRAQYDQFGPAGANGGFGGQGGPGGYQQQGGFGDFSDLGDIFSQ
FT                   MFGGGFDPNRPRKGQDLQYRMHLSFEEAVFGKEETIKFNRGDGPHEIKVTVPAGVETGQ
FT                   QMRLSEQGEAGANGGPRGDLFVVFQVSPSKDGFERDGADIYLEQAIDFVQAALGTEMQV
FT                   KSVHGDVNLKIPAGTQTGTRFRLRGKGAPRLRGTGHGDQYVVVKLDVPTKLNRDQKKAL
FT                   EAYQEATDGTKKKSFFDKL"
FT   CDS_pept        complement(832076..832654)
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="LEGAS_0809"
FT                   /product="Peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0809"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91457"
FT                   /protein_id="CBL91457.1"
FT                   /translation="MTIRFTMDKITRDGASVLRKTAASVPFPLSEEHAQLAKDMMTYLV
FT                   ISQDESQNEQYGLRPGVGLAAPQVNYSLRMASILVPSLDPHESDETPYFKGTIFNPTII
FT                   SESIKRGALDVGEGCLSVDKDVPGFVPRADRITVRYQDETGATKIIKLRDYPAIVFQHE
FT                   IDHLHGHLYYDHIDLKAPWEVNDETKYID"
FT   CDS_pept        832708..832980
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91458"
FT                   /protein_id="CBL91458.1"
FT                   /translation="MSENYILPIDGNWTVDDIVKISNLVDSVLDVYETGVLKSKLLIRY
FT                   NAFRDVLPAQSEQKQFDKDFERQTGHSIYKTIKLAQGTTKDKVRG"
FT   CDS_pept        832977..833762
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="LEGAS_0811"
FT                   /product="myo-inositol-1(or 4)-monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0811"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91459"
FT                   /protein_id="CBL91459.1"
FT                   /translation="MTLSQFEIQDINQTVLLWLDEVRKRTLIAMQQHLDISIKHDARDL
FT                   VTNVDRDNEQFLNAKIRSYDSEASIVSEEGFGDHQKNMQGNVWFVDPIDGTMNFVKEQA
FT                   DFAVMIALYIDNEPVLGWILDVVNNVVYHGGPQVGVFANQLRLEQPNNDALSDGIVLLS
FT                   GARLLYGMFGYDKIAKAALGYRVIGAAGPSFLRVISGRAVGYSSKMMPWDFAAGQVLAK
FT                   TLGLSISDIDGRPLDMLSSNIVLVATNRAHRDILMLHQS"
FT   CDS_pept        833827..835668
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="LEGAS_0812"
FT                   /product="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0812"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91460"
FT                   /protein_id="CBL91460.1"
FT                   /translation="MANREDIRNIAIIAHVDHGKTTLVNELLKQSDTLDSRKELGDRAM
FT                   DTNDIEKERGITILSKNTAVKVGDKQINILDTPGHADFGGEVERIMGMVDGVLLVVDAF
FT                   EGTMPQTRFVLKKAFEQHLTPIVIVNKVDRPGARPEEVVDEVLDLFIELGADDEGLDFP
FT                   VIFASAMNGTASLSPVIADQEHSMKPIFDAVFDTIPAPIDNSDEPLQFQVAMLDYNDFV
FT                   GRIGIGRVKRGTIKIGDAVEVLKLDGTTQTFRVTKLAGFIGLDQVDIQEAKAGDLIAVS
FT                   GMEDISVGETVADPAHPDPLPILRIDEPTLQMTFRQNDSPFAGKEGKFVTARQIEDRLR
FT                   RELHTDVSLRVEDTGQAGAWLVSGRGELHLSILIETMRREGFELQASRPQVIYREIDGV
FT                   QSEPYESVQIDTPDEYSSTVIDSLNQRKGEMINMESVGNGQTRLTYMAPSRGLIGYATE
FT                   FMSATRGYGIFNHTYAEYRPVVRNWEPGRRNGALVSITQGTTTNYAIMGVEDRGQMFIG
FT                   AGIEVYEGMIVGMNARDNDISVNVTKLKPQSNVRSSNKDQTSSIKTPRLMNLEASLEFL
FT                   NDDEYVEVTPENVRIRKAILNTAEREKSAKRRKASTN"
FT   tRNA            835707..835795
FT                   /locus_tag="LEGAS_R0012"
FT                   /product="tRNA-Ser"
FT   CDS_pept        836168..836749
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0813"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0813"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91461"
FT                   /protein_id="CBL91461.1"
FT                   /translation="MKYKKTIITITAAAAISFGAGAALADSGSWIGTPNLAHTRSIIDQ
FT                   LGDKLTTQSATISTLSQQSTTYQSQLTDAKSNLMSLQNQVASLQTQATNDNAAFQTQLQ
FT                   QKIDEINQKIAEGNQKVADKQKELDGVQSQLTAANSKASDLQQQLNSLQQKSNDSENKN
FT                   SDLQKQLDNALQDAKNTETHAQDVLNQQQK"
FT   CDS_pept        837033..837746
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0814"
FT                   /product="prophage Lp1 protein 53"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0814"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91462"
FT                   /protein_id="CBL91462.1"
FT                   /translation="MLIKIFFNFKNKLKSKVKNNNYLQSSELKSVQTIGIIGDSVSFGL
FT                   KSSMNYGQYLQKITGGVVQNLAYSGAHLSDNGRKSIFQQSQYLDLCDLYILQGTDDDWL
FT                   ANVPIGHKDDTAKQSYIGAFYQTVSQLHHLNSTAKIIIVSTTCQTPVWGNVVRRTDKTE
FT                   NMLGHSLHDYMIAQEKACADLKLPFVNLMRQTLFDPSKKSFRKKYMPDGLHPNKEGHQI
FT                   IANEIVKIFKQNFGS"
FT   CDS_pept        complement(837788..838819)
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="LEGAS_0815"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0815"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91463"
FT                   /protein_id="CBL91463.1"
FT                   /translation="MAIYKILFGTYTKRISQGIYQAELDTESQQLQNPTFINELTNPTY
FT                   LALSKANKVYAVENRDGQGGIVTLDNSVRPIAEIDSQLSEGSAPAYIGVDEERQLVFAG
FT                   YYHRGTVESYRIQPDGNLTLVDTWKNSGSGPRPEQSSSHIHFANLTPDKRLVAIDLGTD
FT                   EVITFDVNDSGSLLEASRFHTEEGFGPRHIRFSADGQYAYLLGELSSLLSVLKYNKEDG
FT                   SFEHVMTASTIPSDWTAHNGSAALRLSSDGKFIYASNRGHNSVAVFKIANEGSEIERIQ
FT                   LISTEGEFPRDMNWDINQEFLVVANQDTDNVSLYARDSQSGELSLLQKDFTIPEGVRVV
FT                   FEY"
FT   CDS_pept        838940..840103
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0816"
FT                   /product="Putative Phosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0816"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91464"
FT                   /protein_id="CBL91464.1"
FT                   /translation="MKFIHAADIHLGNPFIGLDQTLPSQFKKSVQQSTLTAFKSLINSS
FT                   ITENIDFLIISGDLYNAAQNSPQIQEIVSQQFERLNSAGIPVYLSFGNHDFEANKQNHL
FT                   SWPENVHVFEQNVETKYLTLKTGESIALTGFSYQTQRQTKKIINDFPVKMQSVDCQIGL
FT                   YHGAVGIDGDPYAPFSVSDMLQKNYDYWALGHIHMRQTLNNQPFIGYSGVLQGLNRKEI
FT                   GEKGYYLVTSKNHVLVPEFYDISPIIWEELILSEVSDELDLINQVLNYKHNKITFLSVK
FT                   ITADLDETVIQRLASGTTLEKLREKASVNLWVVNLTITHELLTLLASDNIDQKYWLESF
FT                   EKIFSDFVISDYVSNQAPTFVRDYFMGEEGKSSLQNKMQQLIQSRKV"
FT   CDS_pept        840110..842476
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0817"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0817"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91465"
FT                   /protein_id="CBL91465.1"
FT                   /translation="MKIKQIDISGFGRWSQKKFDFVNDLQVVAGQNESGKSTLRAFIVG
FT                   ILFGFPSKKSSINVYDPKDGSQYGGSLIADFNNIVVKITRLGRIKSELTITYLSNQLTI
FT                   VDPEKWLTDQLAPLNRDIFNNIFNFSQQDLSKISQLKAIDLQKLLLNIGAVGSSGWLEV
FT                   SADIEKHADKQFAQRATGKRPLNIAAKQYEAHSHLLLSKNEEMVAYVAEKENIERQTQI
FT                   LSQNYEEVRKLTHRVQTSQTVMQKYQLYQSAQLLKKNMIVSVPPVTDTDIAAFQRLKIG
FT                   IDMHQNKISELNTLIKKMPQTTDSVEKYDATSELAKIQIAERHLQELINQKSSIMADEK
FT                   HLRDRFSNKKVPELLSSTEQKILTNKNKSIITLLVGIFIGIVAFFTIKPIVVVALLIIV
FT                   YGCYLFYTRRKFLNKIQKRYNMMSIADIELMQSNIKQFSDWQHQLVAIDADILEKQNKI
FT                   MAQLLPIADHFQVQLNDDVFEAVIIELMHINDQQHMQSQNNAVMIAQKNQQVLTEIKQH
FT                   QEQLAQQLSDQQNILQKYHVLNEQELLTLKQNYVDHIRTKQRYDDIMQQIEPETMNKLQ
FT                   EVTDEKELKKQLILLQHQLEQKQRTGLSLQAQLSDMQAQQKQRTSDDQFLTLQQNLADE
FT                   QTSLIDQFGDFIAEKMGVKWIDQALQLATQNRFPKMQHIATDFFKRLTGGKYVAIQFVK
FT                   DDLNLISSAGQKYRVIELSTGAQEQLYVALRLALSIVIADIIAVPLLIDDGFVNFDSIR
FT                   KQTMIDILQEIAEEQQIFYFTTSLSHKAKINVINL"
FT   CDS_pept        842490..843434
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0818"
FT                   /product="3'-5' exoribonuclease YhaM"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0818"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91466"
FT                   /protein_id="CBL91466.1"
FT                   /translation="MTKLLTEYIDTEHIDSFALIKSADIRLTKTGKTYLNLLFSDRSGD
FT                   LPGNLWDASDDQIKSLIPGQIVKLQGVRGAYQDKPQVQITNLRLSETGEPNNPTDFMIH
FT                   APVKEGEMNDELSDFILMITNPTWNRLVRKIFSLYHDQFLRFPAAKSNHHAFAGGLAFH
FT                   SLSIVKLARSVVAQYPQLNSDLLITGALLHDLGKTIELSGPIATQYTLAGDLIGHITLI
FT                   DEQIVLAANELHFDLQSEEMILIRHVVLAHHGILEYGSPVRPAVMEAEVLHQLDEMDAG
FT                   IQMMTAALNKTEAKTFSDRIFGLDNRKFYKISE"
FT   CDS_pept        complement(843481..844389)
FT                   /transl_table=11
FT                   /gene="prsA"
FT                   /locus_tag="LEGAS_0819"
FT                   /product="Foldase protein prsA precursor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0819"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91467"
FT                   /protein_id="CBL91467.1"
FT                   /translation="MRKFIWGLLTVIFIGGLVFLSLNSSKTLMTSDSGKITEKQFINDV
FT                   KKSSAGQQEFANMTINKVLDNQYGGNVSKADIQNAYDTQKAQYGDSFKSVLASNNATED
FT                   QFKTNIKNNLVMNAAIKANYKVTDKQINQAYKDYHPNITISMITAKDDNSAKQAIEALK
FT                   SGDSWNTVYKKYTTEKTYAKQNGQLPSFDSTSTSVDSAVQEAAFKLSKPNDYSDSPITG
FT                   SNGGFYVIQLNKTTTKPSLNNVRSKLSDKIVSTSLNDQKNTTKIQTIIGKILRKENVNV
FT                   KDSQLKNALNSYMTAGISSSK"
FT   CDS_pept        complement(844444..844683)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91468"
FT                   /protein_id="CBL91468.1"
FT                   /translation="MKLFDDFKQLIAQIKTIAALTKKLQSQQQILSKQLIDTQTVLDDV
FT                   QIDIEKMNFKNKPHLDRIQKTMDHLNTELSKFKA"
FT   CDS_pept        complement(844685..845116)
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="LEGAS_0821"
FT                   /product="Bis(5'-nucleosyl)-tetraphosphatase
FT                   (Asymmetrical)"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0821"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91469"
FT                   /protein_id="CBL91469.1"
FT                   /translation="MTIFDKIIAGEIPCYKVYEDDDVLAFLDISQVTPGHTLVVPKKHV
FT                   DDIFGYDETMAQKVLLKLPVIARAIKNSNPKISGLNIQSNNGPSAGQTVLYSHWHLIPR
FT                   YDDDGLTSTLAPTIDHSADFSANKYQAIADAISAQFRKD"
FT   CDS_pept        845188..845928
FT                   /transl_table=11
FT                   /gene="ecsA"
FT                   /locus_tag="LEGAS_0822"
FT                   /product="ABC-type transporter ATP-binding protein EcsA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0822"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91470"
FT                   /protein_id="CBL91470.1"
FT                   /translation="MGLKIKKISGGYVGNSVLKNVSFEVADGEIVALIGLNGAGKSTTI
FT                   NHIIGELHPQQGTIMLNDVYLSQAPTAFKSQIAYIPEQPILYDELTLEEHLHLMLSAHM
FT                   IDNTVTWSRAFELLKLFRLEDKLHWLPTHFSKGMRQKVMLVAAFMLDAPLLIVDEPFLG
FT                   LDTLAQKDVVRLIREQAKKGNSVLMTTHLLASAAKFVDKFIVLHEGTVQFIGTPLALAD
FT                   AHGLTLDNLDDFFDLMHETINDEN"
FT   CDS_pept        845918..847177
FT                   /transl_table=11
FT                   /gene="ecsB"
FT                   /locus_tag="LEGAS_0823"
FT                   /product="ABC transporter, permease protein ecsB"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0823"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91471"
FT                   /protein_id="CBL91471.1"
FT                   /translation="MKINDLFVQRFVRAQNINIKYLKLLFNDHFVVFLLIAFGASVLGY
FT                   RQLILSPQLTLIWQSAWWQLFDVLWLIIGLQMGTLVTYFKPADRLYLLSNDYFIAKSYM
FT                   KRSIEVSTVFASVWQVIFVILLVPVFWQTHVFSFWRVGTLLLFTLSYKLLLLLLLRDSL
FT                   FLKPRVNLLKYHSRIKYVLFNVIVPGTIMTLILQLPSESIWIFACSWLIVASVCGYFFY
FT                   IDDKKAGQLALDWTKIVSQAIEHEQRVLHFYATFAEVPHQSRTIKRRKYLDFMIRKLTK
FT                   QHQVMYRLYLIRLIRDTEVLPLLVRLELVGAVVMYALLRAPIWLIATIAAMTMYLIIFQ
FT                   MIPIYSNTKQKLWTQLLPIDEKAKQKSFQQLAKQVMFMTTILLAMVSLSHGWLTAIVVI
FT                   IVMYAIGIFLNKQYIPKKIK"
FT   CDS_pept        847240..847899
FT                   /transl_table=11
FT                   /gene="trmB"
FT                   /locus_tag="LEGAS_0824"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0824"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91472"
FT                   /protein_id="CBL91472.1"
FT                   /translation="MHLRAKPWASAWLTAHSDIVIDQKQATEQIGKWQMLFDQKNPIHI
FT                   EIGSGKGQFILGMALAHPEINYIGMEIQETAIAIAARKSFEQVGKLPNLRYIYGNGNGV
FT                   ETYFEKAEVAKLYLNFSDPWPKTRHESRRLTYKSFLKSYEAILPEKGEVEFKTDNRHLF
FT                   EYSMVSFVNYGMRWSTNDYSLDLHQDDEKVLGNIETEYEQKFMAKGQPIYKIKAHF"
FT   CDS_pept        848579..848992
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0825"
FT                   /product="Transcriptional regulator, ArpU family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0825"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91473"
FT                   /protein_id="CBL91473.1"
FT                   /translation="MQLLPDINEAATIRDVRQFFEVEVERIARIAHEDMGGLKSPTMSD
FT                   MPRSETFGNSVETRLNKQIEARMLFDKIKTAISFIKYPYRQILETRYIDGMNWLDMGSQ
FT                   FQYSSRQLMRKRDLAFLYFADTFEEVHDFHIYQ"
FT   CDS_pept        849305..850282
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0826"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0826"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91474"
FT                   /protein_id="CBL91474.1"
FT                   /translation="MEEKEITSDTVLTDVKTVATMLKKAGADVRLYLLWKNKKETMFSY
FT                   AETSKEIKDSFKKRWMNDYNDDKNQEITQFNVGMEKTDHLMFCSSEEFPLMKKHVEKTN
FT                   TENDPKQFVEDLSTIRPKLNLVRGYCAHIYTDEENLYLFGSTNTFNSLTKSRGFGLIGN
FT                   VGDKEITKLSDDDLIIGFNPKTTCYIHNSVCVIKNKKGFEDLFGLLEEYKKLAEETIKL
FT                   FSNYPEFYQGIENFEDDLNRRPILYRSVVNFGKKTGIIESVSQHLDEIKMIKENDAFKA
FT                   KYKDLKINDKGIVYTRSSLPLFLSLLNEEPVKSIITGNEFFAEH"
FT   CDS_pept        850304..850894
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0827"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0827"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91475"
FT                   /protein_id="CBL91475.1"
FT                   /translation="MIKIQLFLISYIPLYGLVYLQLVADKYFQYQKNFKSNKILNNVLL
FT                   IINENAVFGYYILALILFPLLFFIIYLGYRIKKDKGSDQLINRIKKSDDNIISYLMTYV
FT                   IPFLTAGINVSAPIVTNFVLFLIIMIIYIRMDLVYLNPTLILVGYNIYIDSNDDMKYLT
FT                   RNSSQAIQTSRQNHEKLKVTRITDSFSYIAKRK"
FT   CDS_pept        851346..852245
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0828"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0828"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91476"
FT                   /protein_id="CBL91476.1"
FT                   /translation="MKLKNIVISVTVILAVIGGSLVYIGHNSDTDQKENHTTKKSDRSK
FT                   SSSSSSTKEAASESQSENNILISSGKDYGIQLYHGMPGAGALTAKPTAMTKMLNRETVI
FT                   DVVASTPNMNRGKLVNIVAAGDNWELEVSNNNTQYKVKVMHAQDNKGAVVVSTEGADTL
FT                   FYGFTIPESLYVPYRQAEKEKADAVHDQLVGKKYRISPSLYDGENTDQAMNEQKAPQNL
FT                   AHDGIQDITFITDSVVRVKRSGSYRPDRDVSYTLNATTLSFDYQNIPYSLINGTVSFDS
FT                   WTTNMDGHTVTWTITPMN"
FT   CDS_pept        852311..852874
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0829"
FT                   /product="prophage Lp2 protein 34"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0829"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91477"
FT                   /protein_id="CBL91477.1"
FT                   /translation="MKLTPKQKKFADEYIKTGNATQSAIEAGYSKKTARSVGSENLTKP
FT                   DIFEYIAKRIEEIDKDKIAEQKEILEFMTRVMRRQEMEQVTNVLKKPVVLTVTGSGDDN
FT                   TYEKIVNEEVLEVTEIAGSVGDAVRAADLLSKIIKPAKEETSFEEDRARKMKADADLAE
FT                   KKVELLNGGSGEITINVKPFEEDM"
FT   CDS_pept        852874..853602
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0830"
FT                   /product="terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91478"
FT                   /protein_id="CBL91478.1"
FT                   /translation="MSEIEWNLPEMVSKAYAPLFNSKKRYIVYKGSRGSGKSEAEATKV
FT                   IYDILTKSYVNWLVLRRYANTNRQSTFTLLQKVANRMGVGSLFQFNSSLPEITYKPTGQ
FT                   KILFRGADKPLSITSISVETGNLCRLWVEEAYQLELEDAFDTVDESMRGIIADPDGYYQ
FT                   TINWETYAAIEFGERVTSQEDFNKSYGAYMWLTRKLADEAGANYDLDDNDVIEIKTHNF
FT                   ASRTGRGSDHVVDPIAFLAK"
FT   CDS_pept        853660..853845
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0831"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0831"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91479"
FT                   /protein_id="CBL91479.1"
FT                   /translation="MAQPKLKDGDNICLTTKASTSAYGTAFELHKSNSNDAYRVAFWYN
FT                   NAIVFWNILEQDLQIK"
FT   CDS_pept        854330..854575
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0832"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0832"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91480"
FT                   /protein_id="CBL91480.1"
FT                   /translation="MNYDDQLIKKIKERFIKKINTLYWVCIVYQKYSKKINVYFQFSKI
FT                   DTAIHSGQIAKYDEQYKERMAGLSKRIKHETKPTRN"
FT   CDS_pept        854720..855154
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0833"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0833"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91481"
FT                   /protein_id="CBL91481.1"
FT                   /translation="MSNQQLFTQLKQLAKLVEGNSVTVPAFSKESRTLLKDKATRNSKF
FT                   DLIINKKGHRNKDIFSLVIMSSNYPDKIMMRLDYSGSSHKGVETPHVHIFDEQHDFGSK
FT                   AISLQNLSSIMINQYMDALTWFLKENSVDMSGVQIQETIV"
FT   CDS_pept        855169..855942
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0834"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0834"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91482"
FT                   /protein_id="CBL91482.1"
FT                   /translation="MKLDTTLLLSQYLDWLKNKYRIKNLEDSNQIITPFTNAIGDNINI
FT                   YVDKIDEKHFLLSDDGETINDLSLNGIELTTTRNQMIDRILIGSGVHRVDDELTIDGVS
FT                   SEFPEKKHSLLQTILRVNDLMMTRRNNIVNLFSEEVTDFLKENDIIGTSKAKFAGISGL
FT                   NYTIDYTIPARKNRPEMFIQFHNHLTFSAITNSTFIFEDINEQRPLEVGDKPINKIIAN
FT                   TEDYAISDKAFRVAESKNIEILPFSDKNKILATLH"
FT   CDS_pept        856028..856153
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0835"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0835"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91483"
FT                   /protein_id="CBL91483.1"
FT                   /translation="MLKSIDKLGTFWGLATNIQLLLTFKKLDKSTINQYITVLIN"
FT   CDS_pept        complement(856553..857227)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0836"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0836"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91484"
FT                   /protein_id="CBL91484.1"
FT                   /translation="MSILFGFIFFFSFLASIGIAIYWFIARLKHKPFPMFKKAIIGSLV
FT                   VLTVSLMGGVATANNATKDSKPTSSASKKSESSKKSASESSEKASIANSKAISSSEAAA
FT                   SSKAKQASIESSEKASSDAAEKSSQETVRVSQAASISEAQSLSNSEKASNDNAAATTAS
FT                   QNNATDTTQVYTGTSQQIIGNARSHIYHVPGQAGYHMNSANAIYFGSEAEAQANGYRRA
FT                   QR"
FT   CDS_pept        complement(857241..857354)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0837"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0837"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91485"
FT                   /protein_id="CBL91485.1"
FT                   /translation="MQKVATAHSFGVTSLAETCHPIFNYLALCAEQPHKKV"
FT   CDS_pept        complement(857382..857501)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0838"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0838"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91486"
FT                   /protein_id="CBL91486.1"
FT                   /translation="MFYIRKTLIDTIREVSKKRDLSLTGVAIRASIGEKSIYS"
FT   CDS_pept        858674..859210
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0839"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0839"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91487"
FT                   /protein_id="CBL91487.1"
FT                   /translation="MSDEFFVKVRRAIGFDGLISIIIGAFILFLPGRSARAVAGMMGAA
FT                   LIAAGLFKLLSVFKKDSVNGTTRLGHLISSVIYIVAGLFIFIDMQAAAVSLILVVGILT
FT                   GMAWLIEGIIQLTILNQISTNKFWSILSAVISVLGGLSLLFSPLLGGILVWTFFGVTLL
FT                   IIGIFKIIQYVTLKK"
FT   CDS_pept        859823..860317
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91488"
FT                   /protein_id="CBL91488.1"
FT                   /translation="MNQSLELIKRGVTTELAYNVEQMSEESQNVLYEGFRFRLKNKTFR
FT                   SRLAKKTPTKKGYFVAFWEKDNHAKNKPFDYESSPDFLIINVIDFKNQGQFIFPKALLA
FT                   QKKILLSLNSKGKMAIRVYPEWVKELNKTAFQTQQWQLHYFIDLSKDLIDVSKLKQLYT
FT                   I"
FT   CDS_pept        860413..860733
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="LEGAS_0841"
FT                   /product="Quaternary ammonium compound-resistance protein
FT                   sugE"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0841"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91489"
FT                   /protein_id="CBL91489.1"
FT                   /translation="MPWIYLLLAGFSEILWSTTMKLSHGFTKVGWASLTVIGLIASMFF
FT                   LLQAVKYLPFSLAYPIWTGIGAVGSVVIGVILFHDQFPPITWFFIILLVVAIIGIKVTA
FT                   GE"
FT   tRNA            complement(861059..861132)
FT                   /locus_tag="LEGAS_R0013"
FT                   /product="tRNA-Arg"
FT   CDS_pept        861250..861768
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0842"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0842"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91490"
FT                   /protein_id="CBL91490.1"
FT                   /translation="MRKAFIALGVIFVALLVAFATFNQQPKYAGVSMPRADYRHLEQSR
FT                   RSIKTFISALDDFDYQDAKTMAVVEKSGNQIIKHNSNNLSSTDSQALRDALYGKTGIIT
FT                   IVQIAKKGHYNIDSSVASRFHDKFDTIITMSVNAMNKSSAQRADIVTQMKVDLNIEAAI
FT                   YRIGAKNEE"
FT   CDS_pept        861800..862375
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0843"
FT                   /product="Transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0843"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91491"
FT                   /protein_id="CBL91491.1"
FT                   /translation="MVKKEDARVLRTKKNIEETTITLLTTQPNFSITLLLRRADVTRGT
FT                   FYKYYQNKEHLISEVNHTLIQEFIQYTQGKFHVAKMIQAVSDRAAFYNAVLNLHSDSVY
FT                   VKTLMSRMRMQMQSQLGIIEDEERYRHQMFQWEIIIGGFWALISQWLLDNMNVTQTKLL
FT                   QEFIELLRVDTTGWTQTGLNLFDFDNIN"
FT   CDS_pept        862532..862831
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="LEGAS_0844"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0844"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91492"
FT                   /protein_id="CBL91492.1"
FT                   /translation="MAYAVIVTGGKQYKVAEGDTIFVEKLDATEGEKVTFDQVVLIDGK
FT                   VGAPFVEGAKVVGTVEKQGKQKKVITFKYKAKKNMHSKQGHRQPYTRVKIDSIA"
FT   CDS_pept        862860..863177
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="LEGAS_0845"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0845"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91493"
FT                   /protein_id="CBL91493.1"
FT                   /translation="MLMNQENLQMFAHHKGGGSSANGRDSAGRRLGTKVADGQDLTAGS
FT                   IIYRQRGTHIYPGVNVKKGGDDTLFALTNGVVRFERKGREKRQVSVYSREQYNEILAAA
FT                   K"
FT   CDS_pept        863320..864414
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="LEGAS_0846"
FT                   /product="Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0846"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91494"
FT                   /protein_id="CBL91494.1"
FT                   /translation="MTKYFEARIVKLQKLLKQLNLDGMIVYQGANMKYLTGFSGGTGDG
FT                   VVIIGRDSACLVTDARYEEAYKASLPESVNLKITRAYYEEAVSVAVSFDIKKLAFEADM
FT                   PYNIYDYIDELLPADISFDALPFAIEALREVKDEEELTALRKAAAVSVAAFKELIPFIK
FT                   PGMTERQVANELDRLQKKFGAEKASFDTIVASGYRAALPHGEATDKIIEKGELVTIDFG
FT                   YYVDDYTSDVTRTIAIGSISDELKQIYAIVKQANENAIAIVKPGISGSEVDRVARDYIS
FT                   AHGYGHDYNHSTGHGVGLDIHEGPALSSQSSDELQPGHLLTIEPGIYLSEKGGVRIEDD
FT                   IIVTLDGYENLTHDLTKDLIVIED"
FT   CDS_pept        864416..864862
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0847"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0847"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91495"
FT                   /protein_id="CBL91495.1"
FT                   /translation="MTHTRLDFLVFYRGNLVTGFDYIYIKRHEGHAFWQSRDKTQEAKD
FT                   IADIDFDFYNPHFNQAGKAFNWRYHEQWTDMTMSWDEFTDKAMSYINTWMTEYPGPSQT
FT                   KPSLNDEWGIRFKVPGEHERMIWGLNAYPANLQKFIDFLYSFAN"
FT   CDS_pept        864990..866342
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0848"
FT                   /product="5'-Nucleotidase-related"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0848"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91496"
FT                   /protein_id="CBL91496.1"
FT                   /translation="MGTETIHLLHTNDMHSHFENWPRILRFLLEKQKTYTQSYTFDIGD
FT                   AIDRLNPYTDATMGQGNIELMNEANYDGVTIGNNEGLVLSHEAMNHLYDGANFDVLLGN
FT                   LKEYPGLTQPIWAKNYKIITTTLGTKIAVLGLTAPYNLTYPSLGWKPYDVDETIDKLLP
FT                   ILRQKADVVVLLSHLGLPTDEHLGEKYDIDIIIGAHTHHLLEHGKMVSGTLLAAAGRYG
FT                   NYVGDVSLEISDDGHILSKKAITTPTYEMSEDDEDYHFIHGLLKKGQRALTTRYVTQIP
FT                   RDITTDEQSYDAMRALKQYFDAPAAMLSTGMFVEDFPKGQLNQYELLESMPHAINPMLM
FT                   TLKGQKIIELFEELDSQREWLSTLAMKGSGFRGKIFGYMRFDGIDRQKNGQILYQGKII
FT                   QPHQNYQIATLDHYKWVPFFPVIQDAPVKIELRILLRELMAQYYKKKYSNV"
FT   CDS_pept        866368..866898
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0849"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0849"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91497"
FT                   /protein_id="CBL91497.1"
FT                   /translation="MDRESLKTQTLLQQEERKMAYQVIRHENKISIDKLTLELVENFKE
FT                   AFNTEKLAIRYTPLLAQYDYLVGDISAEQLRLKGFYRNEKHVPNQDKIETLQDYLYEYV
FT                   NFGAPYFVLENINPRQLEQEDRPKNNRRTHKNNHKRSPEKEKNKTSVREKPQKKEQPSN
FT                   KKPSKRPFIIKQK"
FT   tRNA            complement(866968..867039)
FT                   /locus_tag="LEGAS_R0014"
FT                   /product="tRNA-Glu"
FT   CDS_pept        complement(867176..868216)
FT                   /transl_table=11
FT                   /gene="ilvE"
FT                   /locus_tag="LEGAS_0850"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91498"
FT                   /protein_id="CBL91498.1"
FT                   /translation="MSQKKAQPKDFNWSELGFEYHDLPYRFRAYFKDGKWSEGGLETDS
FT                   NIPVNEAATGLHYGQNIFEGLKVYRRQDGGANLFRPDRNAQRLQNSAARLMMAPVPEKL
FT                   FLRALQEVTKANKDFIPPYGTGATLYLRPFEFGGGPVVGVHPADNYVFEVYATPVGAYY
FT                   KGGLTPTAYVTNEYDRAAHGGTGAAKAGGNYGASMLAGDQAHAAGYSDVVYLDPRLHEN
FT                   IEELGSANFFGITKDGRFLTPKSPSILPSVTKYSLLEVAKELGLEAEETTISINDLDQF
FT                   TEAGAMGTAAVISPVGSITHHGNKHVFYSETEVGPWTQKLYDRLTAIQYGDEKGPENWA
FT                   VDVPLN"
FT   CDS_pept        complement(868273..869403)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0851"
FT                   /product="Integral membrane protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0851"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91499"
FT                   /protein_id="CBL91499.1"
FT                   /translation="MNQATPLTTAKHDKMSLSNKEKSPSSVRDVVFDVSTGISNAILAV
FT                   LGMGLLMSSIGNIIGYTPLVQAGLMGQKLLAPALGVGIAIMMRANILTTGAALIAATVG
FT                   SNAVYFTSAVAPQTHTATGWVADQAAGSIVLTSGQPISAVLAALLAVLVGNWLTGKTPL
FT                   DMMLVPLGATLAGTFFGLGTAAVTTPFLNWISESLASTMNVNPFLGSFIVSVVWFLFLM
FT                   TPASSAALAIAVMLDPLSGGAALIGTTAGFVVYTAMGWTQNNVGANIAQTIVTPKVQFP
FT                   NLLKSPLLMFGPAFIAGISAMVAVGVFNLKVPFAIAGLGLNGFIAPIALASSDPRALLL
FT                   VAIFGIVVPIVGSMAMYYALKKIGKTRPNDLHLDVV"
FT   CDS_pept        869817..870758
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0852"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0852"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91500"
FT                   /protein_id="CBL91500.1"
FT                   /translation="MLLLAVKGITESNRKFLSQYDVTVVTPDTITAQQIPEIVISYAWD
FT                   DAIGQKILANPNSKLKWIQTQSAGVDYLPLKKLKDFGVVVTNASGLKAIPIAQTVLSYI
FT                   LYFARGLNIYASRTHWEPYTNQYLVTELPVLVFGTGRIGQQIASHIRAFGGTVYGVNTT
FT                   GHMVDGFDEVYSMHDYQKALAKSRVVVDGLPGTPETDDFFNNHFFDQVNQLFLFINIGR
FT                   GTTLNQNDLLAAIDDSRVKYAALDVTTPEPLPKNHPLFDRPQVLLTQHTSWGEYVNAGR
FT                   TGGLFRLFEKNVPSFVKSGTIQYNIVNLDKGY"
FT   CDS_pept        870819..871535
FT                   /transl_table=11
FT                   /gene="glpQ3"
FT                   /locus_tag="LEGAS_0853"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0853"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91501"
FT                   /protein_id="CBL91501.1"
FT                   /translation="MKKIAHRGISAQAPENTRAAFKKMVALNVEWLETDIDMTSDGELI
FT                   LIHDDKVDRVSNGSGSVNDMTLIELQKLDFGRWFSEAYANERIVTLKWLIDFINHYQFN
FT                   VNFELKTALKSDTQHAYLTSVCQALRQVSSKVEIIVSSFDMTLLQKFHVLMPSIQLGVL
FT                   IEAQLPDNIVEIAKNIGATYVHPDVTFLTKEQTHKLIDNHLQVNVWTVNDMIVAEKLEK
FT                   WRVEAIFTDFPEVKAI"
FT   CDS_pept        871653..872981
FT                   /transl_table=11
FT                   /gene="folC2"
FT                   /locus_tag="LEGAS_0854"
FT                   /product="folylpolyglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0854"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91502"
FT                   /protein_id="CBL91502.1"
FT                   /translation="MEKASEKREARVAIRYKNIIKSLDNTWHVLDDTRVPIVRQVLGWL
FT                   DHPDQKLKIIHIAGTNGKSSTGAMMGAVLQANGYSYGRFSSPFILSAREQICIDDEMIS
FT                   KNDFVDYYERLIKCFKLNSVSADYLTYFEYFTIISLLYFVDHQVDFVLFEAGLGGLRDA
FT                   TNAIDTPLLTVFTKISVDHQNLIGRNLTEISENTAAIIKKGTWVIDYAGQDLTARKVLK
FT                   AQTEAVGAKWFEYKQDQIIIANTTPSGLDLIINGIPGYFLSMSGAFQVHNFSIVLQIKA
FT                   ALTAMGYTFIKDKTREGLANVKLVGRMNYHKTSNILFDAAHNVDGINGLVAALNAWHLK
FT                   IKPTLILGVLKDKDYHEMLDTIVPVVQQIITVTPNNKTRALSADELAAELLTNYQNIDV
FT                   EIASDATAAISLAMRVRESSQALIVVTGSFYTLSAIQKDHRMA"
FT   CDS_pept        873061..874191
FT                   /transl_table=11
FT                   /gene="dus"
FT                   /locus_tag="LEGAS_0855"
FT                   /product="tRNA-dihydrouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0855"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91503"
FT                   /protein_id="CBL91503.1"
FT                   /translation="MTVESPQNFFWDDVVKQAQLENKQAENQPFFSMAPMEAVTDTVFR
FT                   RVIAQAGGPDVYYTEFTNASSMVHPQAKFSVQGRLAVAENEKQPVAQIWGSRPEEIAGA
FT                   AKVLATMGYQAVDINMGCPDTTVIKNGAGSDLIRHQELAKEIISAAKKSGLAVSVKTRL
FT                   GFYQAEEFREWLPIILRQQVAVLTIHLRSRKEMSKAPAHEEYIDEILAMRDAIAPQTLI
FT                   QINGDIKTRQSGMQLVKNHPGIDGIMIGRGIFENPYAFEVKPKQHTLEESIALLKLQLD
FT                   LFDDVNANIAPKHFEALKRYFKIYLRGFAHASALRQLLMETHATEEVRDILDRELAKVY
FT                   AKVAADEHIYRDNGVASADVAAANQLKLARETKKYN"
FT   CDS_pept        874768..875022
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0856"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0856"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91504"
FT                   /protein_id="CBL91504.1"
FT                   /translation="MIALHILFGLMILVGVIMTSVSFQGDTEKLTKLQKFSLIFTTSAI
FT                   GLTVVAVTAMSSSIYIALAMFVALALYEYYAFLRKASQK"
FT   CDS_pept        875495..875692
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0857"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0857"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91505"
FT                   /protein_id="CBL91505.1"
FT                   /translation="MLYFKKYDIDVTNISFNRFENEIENGNISGDEDDVLEVVDNLIGT
FT                   FKKMKGIFEAGNLPISEKMD"
FT   CDS_pept        875844..877319
FT                   /transl_table=11
FT                   /gene="murE1"
FT                   /locus_tag="LEGAS_0858"
FT                   /product="UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--lysine
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0858"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91506"
FT                   /protein_id="CBL91506.1"
FT                   /translation="MKLTSKTIEQLLIEQQLLVSKPNIDLAFDFLHYDTRQVKANTLLV
FT                   VKGAFRPEYLTHTADIEGLITETILDVSLPQWQVTNVQKALAVLSMAFFDYPQKALWIG
FT                   AFTGTKGKTTAAYMAFNILKDATNNHTALFSTVDRITGTGPGDKKKSDLTTPESYELFK
FT                   DMRQAVDNGMTHLIMEVSSQAYLKQRVYGLRYNVGAFLNISPDHIGPNEHPTFEDYLAH
FT                   KMMLFDHSDQVIVNAESEHLKTVLGHATQTHDKVYTYSLAGQGGNYSYVSRESAIHESR
FT                   LIVEPSDLNELAGEYRLNLPGDFNESNAMAALIMTALAGAKHENMVHGLDVVFIPGRML
FT                   SLPIVGHGVAFVDYAHNYASMRALLNFAQNQYPEGKVLVVVGSPGNKGVSRRADFGRVV
FT                   SELADIVYLTADDPQFESPKAIADEIAENINNKQLEVHFEMDRIKAIFQAIKQSGERDI
FT                   VIVAGKGEDPYQKINGKDVPYIGDYAVVQSYHD"
FT   CDS_pept        877417..877767
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0859"
FT                   /product="Unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0859"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91507"
FT                   /protein_id="CBL91507.1"
FT                   /translation="MTNPIEESHKKSGKIPLRIDPELHEVLVTRANKEGRSLNNYLTKL
FT                   LEDGLQPKNFEDRQFVGQVISGENFDLPSRLVSISGIYYRYLIDNAITAKADAQYAIIE
FT                   ANGNILTLRELK"
FT   CDS_pept        877814..878629
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0860"
FT                   /product="putativs carbon storage regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91508"
FT                   /protein_id="CBL91508.1"
FT                   /translation="MIFFRIVPQNNAGLVETLGKYSRRKEAGLHFYVPFFQTIRNVSLA
FT                   MRPLRLPDYSVITADNADIKASVTLNYHVTDAVKYMYENTDSVESMAQLVRGHLRDIIG
FT                   RMELNEALGSTTKINVQLAEAIGDLTNTYGINVDRINIDELRPSVSIQEAMDKQLTADR
FT                   ERVATIARAEGQARSIELTTKATNDALMATAKAEADATKTRADAERYRIDTVQAGLAGA
FT                   DDKYFQNQSINAFTTLASSAANLVIVDGKEISQLGQLPVVGKLLEKGLK"
FT   CDS_pept        878878..880071
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="LEGAS_0861"
FT                   /product="Bifunctional phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0861"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91509"
FT                   /protein_id="CBL91509.1"
FT                   /translation="MFKEKNVLVMVSGSVAAYKSATLVRLLIKSGAQVRVGMTTAAQEF
FT                   ITSKTLSILSGNDVLTDLFVGHTSDVVHIDWAKWADIIFVVPATANIIGKLAQGIADDA
FT                   VTTTIMASIADKIIAPAMNDNMLTNPAVVRNIETLKKDGWFVIEPAVGFLAEGYSAQGR
FT                   LPEPVDILQQSAVRLRAKNGLLIGKKIIITAGGTHEALDPVRYLTNRSSGKMGYALARA
FT                   AAEMGADVILITTIAREDIFGVKKIFVNSAQEMFDASIQAFATADIFISAAAVSDFKPA
FT                   EKAIHKIKKQANGGLTLRLVQNPDILRTIGQSKKNHQIVIGFAAETQEILAHGQDKLIK
FT                   KNADMLIINDVSRSDTGFSSDDNAVTILIPGRLPETLSKASKIDIARAIMTQVITLK"
FT   CDS_pept        880202..880477
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0862"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0862"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91510"
FT                   /protein_id="CBL91510.1"
FT                   /translation="MTDEEESKASKYNIGDILLAPAYGNLEKPFTGQVEKIYENALLVE
FT                   ITENDPSDQPTVNEMNHRAIVRMDEIEVIKHAPVPAAEKIDGDIEE"
FT   CDS_pept        880708..882399
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="LEGAS_0863"
FT                   /product="arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0863"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91511"
FT                   /protein_id="CBL91511.1"
FT                   /translation="MANNEMVVASLAKVLTDFKPEEISMKLETPKSSEMGDVAFPTFTL
FT                   AKVLHQAPQQIATDIVAKINQTGFEKVVAIGPYVNFFLDKPVTSGKILRLILKEQSHFG
FT                   SNTDGNGNNVTIDMSSPNIAKPMSMGHLRSTVIGNALANITAKNGYVPVKINHLGDWGT
FT                   QFGKLIYAYKTWGSETEVKADPIATLLRYYVEFHEKAKNDDTLNDAGRAWFKKLEDGDS
FT                   EAHQLWQWFRAESLKEFTAIYDRLDITFDSFNGEAFYNDKMAKVVDVLEEKGLLVSSQG
FT                   AKIVDLSAINSSLTPAMIKRSDGATLYMTRDLAAAVYRKETYHFSKSLYVVGGEQREHF
FT                   VQMKAVLSLMGFTWADDVEHISFGLITFNGKKMSTRKGDVVLLKDVLDDAHELALKQIQ
FT                   EKNPALENKNIVAEQVGAGAVVFHDLMNDRTNNFDFNLEEVVRFEGDTGPYVQYTNARA
FT                   KSILRKSGVTIVDQNLDLDDVATWDIVTILNSFPETVQRAWQQREASIVAKYALNLSRS
FT                   FNRYYANSKILTNDQQLNARLALVQSVSIVLSESLRLLGVKSPEEM"
FT   CDS_pept        882436..882906
FT                   /transl_table=11
FT                   /gene="argR1"
FT                   /locus_tag="LEGAS_0864"
FT                   /product="Arginine repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0864"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91512"
FT                   /protein_id="CBL91512.1"
FT                   /translation="MISKQQRQELILDIIQNQPITSQEELLSELLKHRVETTQTTVSRD
FT                   IRALGIVRIKDINNDLRYQQLQDQGETPDLVVTENAIDAAIIEYAVFVKRVQFMTIIRT
FT                   TDSSGNAVAGIIDDANLPQVIATLAGFDTIYVTSPDEVSAEALTKRWSALIG"
FT   CDS_pept        882910..884970
FT                   /transl_table=11
FT                   /gene="pbp2A"
FT                   /locus_tag="LEGAS_0865"
FT                   /product="Penicillin binding protein 2A."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0865"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91513"
FT                   /protein_id="CBL91513.1"
FT                   /translation="MSWLKHIIKKINEKFSPFAKRWQFGRFLIIVFLSFFLIMSMYLVT
FT                   LAKTAHVKNLQATLAQTTTVYDDSGAKAGELYSQKGTYVKYSRISQNMRDAVISSEDRN
FT                   FYHEYGFSVKGIARSAVLNIKNKLLGSSTIAGGGSTLTQQLVKNAYLTQEQTITRKAKE
FT                   IFLSMQVEQDYTKNQILTMYLNNAWFGNGVWGVEDASQKYFGVHASELTTSQAATLTGM
FT                   LPSPALYNPIDHPQAATKRRNVVLSTMVATKRLSASQLKQSQAAPMILNDTYNSSNKYQ
FT                   YPWFFDSVISEAIKTYGLTESDVMNRGYKIYTTLNQQDQTNLQQNFNNSAMFNYNTDAQ
FT                   AASVVLNAKTGGVRALVGGREEEHTFRGFNYATQSKLSPGSSIKPIAVYAPALEKGYSI
FT                   DTSLPNTTRTFGTNGWEVHNALNVQTDDVPMYEALEHSYNVPAVYLLNKIGVNAGYASA
FT                   RKFGLPLSDKDKNLALSLGGLTVGVSPMQMAQAYTAFANDGVMSDAHFITKIVDATGKV
FT                   IVNHPKAKQKRVISSRVADNMTRMMLGTYTNGTGLGAAPAGFTIAGKTGTTENPNDTEN
FT                   SQSSKDSWAMAYTKDVVEATWMGLDDKSKNNSLPLGLTATMGPLVKTSLEEILPNTPGT
FT                   NFTVTNPNSGTDSNSKAFKWSDIGSDFSKGVDNAVEGANKTWQTIKGLFGN"
FT   CDS_pept        885036..885389
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0866"
FT                   /product="conserved hypothetical UPF0342 protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0866"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91514"
FT                   /protein_id="CBL91514.1"
FT                   /translation="MTVNIYDNANEMANVLKQTQEYTAWQKAFDDIQNNEEAKNLFGKF
FT                   QEVQVAVQKMMQVQQQPNPEQEKEWDIIAAEVQKNELITALLTAEQALNKLLTELNDII
FT                   TKPVADAYAQLRK"
FT   CDS_pept        885442..886074
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="LEGAS_0867"
FT                   /product="Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0867"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91515"
FT                   /protein_id="CBL91515.1"
FT                   /translation="MQNKFVQFLKEWVVPILVAVVVVALIRTFLFSFVRVNGPSMTPNL
FT                   QNGELVLLSKVSKYKRGDVVVFDARQEDPRIRSGEKDYVKRIIGLPGDTVSYQNSNLYV
FT                   NNKRVNQNYIGINEQTQGTEMSFGSTWSLKTLSSTDQWQEKDRNHSRVPAGEYFVMGDH
FT                   RSVSNDGRYFGFIDKQHIKGKVYVPFWNSNKTAKQNVNGQNKLFFAN"
FT   CDS_pept        886253..887164
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="LEGAS_0868"
FT                   /product="Aspartate carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0868"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91516"
FT                   /protein_id="CBL91516.1"
FT                   /translation="MRHFLNINSVNESDVLKLIQRALAFKSGVQPDQTNLTVSNLFFEN
FT                   STRTHSSFQMAENKLGFQQIRIEPQSSSMSKGESLVDTLKTLKAIGVDVAVIRHNVTSW
FT                   YESVLSAEGHAIPQLVNAGDGSGQHPSQSLLDLVTIYEQFGHFTGLNIRIVGDLMHSRV
FT                   ARSNAEILKRLGANMTFSGPENWLPKDFSQFGEFVAIDKEWEQLDVVMFLRVQHERITQ
FT                   TENQIFLTKQYHAKFGLNKLRYEQLKAQAIIMHPAPVNRDVEIADEFVEAPKSRIFEQM
FT                   TNGVFARMAILEYTMETNHATY"
FT   CDS_pept        887151..888419
FT                   /transl_table=11
FT                   /gene="pyrC"
FT                   /locus_tag="LEGAS_0869"
FT                   /product="Dihydroorotase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0869"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91517"
FT                   /protein_id="CBL91517.1"
FT                   /translation="MQLIKNAKILEDSHLVTRDVLIDGKKIVKVSENNNLKVDTFDAKG
FT                   AFLSSGLVDVHVHFREPGFDYKETIATGSQAAARGGFTTVIAMPNLNPVPETAERIAAQ
FT                   IKLNETNGTVHVKQYGAVSADLIASKISDISGMSAAGAVAFSNDGKGVQTADTMLQAMV
FT                   AAAKADKPLVAHLEDDSLLHGGVMNAGKQSKKLEIPGITGLAESSQLARDLMLAKATGV
FT                   HYHVAHISTKESVALVRIAKLQGVNVTAEVSPHHLLLSDTDIKGDNALFKMNPPLRSQA
FT                   DRQAVLAGLLDGTIDMIATDHAPHGTAEKNKPFREAPFGITGIETSFQLLYTHLVRSGV
FT                   MTLETLLQRMISAPIASFKLEAPTEIKPGETADLALFDLEHQKTISVDKFKSKGKNTPF
FT                   IGWQVYGNTLATWVDGQLVYQSL"
FT   CDS_pept        888453..889541
FT                   /transl_table=11
FT                   /gene="pyrAA"
FT                   /locus_tag="LEGAS_0870"
FT                   /product="Carbamoyl-phosphate synthase pyrimidine-specific
FT                   small chain"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91518"
FT                   /protein_id="CBL91518.1"
FT                   /translation="MKKRYIVLENGSVYEGESFGSDANVMAELVFNTGMSGYQESITDL
FT                   SYRGEMIVFTYPLIGNYGINRDDFESLRPAASAIVVHEIARRPSNWRQMMSLEEWAERM
FT                   NMPGITGIDTRALTRELRDNGVMKAALVNEVTDDIFSEIKKFVPSKKMVADATTKTQYQ
FT                   NPTDGVSIALIDFGLKNSILRSLAKRGVNVMVFPADVDAETILAANPDGILLSNGPGNP
FT                   QDVAYAIPTIQTLQEQLPLMGICLGHQLFAIANGAETYKLKFGHRGFNHAVRNLSKERL
FT                   DFTSQNHGYAVNRDSLSKTELVVTHEEINDHTVEGIRLKNHHAFSVQFHPDAAPGPHDA
FT                   EYLFDDFLNMIENAKKETTQNA"
FT   CDS_pept        889534..892713
FT                   /transl_table=11
FT                   /gene="pyrAB"
FT                   /locus_tag="LEGAS_0871"
FT                   /product="Carbamoyl-phosphate synthase pyrimidine-specific
FT                   large chain"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0871"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91519"
FT                   /protein_id="CBL91519.1"
FT                   /translation="MPKRTDIKKILVIGSGPIVIGQAAEFDYSGTQAALSLKEEGYYVI
FT                   LVNSNPATIMTDAEIADKVYIEPLSIDFIERILRKERPDAILPTLGGQTGLNMAKDLSE
FT                   AGILDDLNIELLGTKLSAIEEAEDREEFKALMERLNEPIPESTIATTLEEALEFADTHS
FT                   YPVIVRPAYTLGGTGGGIAETHEELTEIAANGLELSPVTQVLIERSIAGYKEIEFEVMR
FT                   DAHDNALVVASMENFDPVGIHTGDSIVTAPVQTLSDREVQMMRDAALKIIRALKIEGGV
FT                   NIQMALDPNSYKYYIIEVNPRVSRSSALASKATGYPIAKMAAKIAVGLNLDEIINPVTG
FT                   TTKAEFEPALDYVVFKIPRWPFDKFASADRSLGTQMKATGEVMAIGRNMEEALLKAVRS
FT                   LEIDAIGLDDITFDDLSDEDLLASLMPARDDRLFMIADLLRRGVTIEAIHDKTLIDEFF
FT                   LDKVLHIIEIERDLAHSIGDLDQLAYAKKNGFADATIANIWHKTTVEVRQLRTQASILP
FT                   VYKMVDTVAAEFESQTPYYYATYERENESIKTHKKSVIVLGSGPIRIGQGVEFDYATVH
FT                   AVKAIQRAGYEAIIMNSNPETVSTDFSISDKLYFEPLTLEDVLNVIDLENPIGVVVQFG
FT                   GQTAINLAQPLTENGVHILGTTVEDLNRAEDREAFDQVIKQLKLPQPIGKTATTVPGAL
FT                   AAAQEIGYPVLIRPSYVLGGRAMEIVTSDEELNDYMQRAVKVSNDHPVLIDSYLVGQEA
FT                   EVDVLSDGETVVIPGIMEHIERAGVHSGDSMSVYPPQYLSQKVQDEMTQAAINLAQAMN
FT                   TIGLMNVQFVIHENTAYVIEVNPRASRTVPFISKVTHIPLAQLATRVMLGEKLADMGFE
FT                   TGLVPADDMVHVKAPIFSFTKLPDVDSLLGPEMKSTGEVMGSDTTLPKALYKAFVASNI
FT                   KVPQYGNVLFTVADDDKEEALILAKRFNNLGFALFATSGTGAYLEVNDMPIEILDKISE
FT                   SNNNSVEALKSQKLQVVINTTQADDRAESDGRLIRNAAIENAVPLFTALDTVNAFLDVL
FT                   ESRSFTVNEMK"
FT   CDS_pept        892771..893697
FT                   /transl_table=11
FT                   /gene="pyrDB"
FT                   /locus_tag="LEGAS_0872"
FT                   /product="Dihydroorotate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0872"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91520"
FT                   /protein_id="CBL91520.1"
FT                   /translation="MIANNRLAVNLPGLNMKNPVMNSSGSVYFGIEDKGFGIEKTGALV
FT                   TKTVTMTPRAGNPQPWIIETPSGILNSVGLANPGIEKVISDILPAIHKKYCDDMPVMVS
FT                   IAGETVQEYVELARRLTHSGFVTAIEVNLSCPNVDRGGMAFGVDAQTASEVIAALRQAT
FT                   HLPLYAKLSPNVTDIKPIVKALETAGADGIVLINTVMGMSFDLAKRQARLARGIGGMSG
FT                   KSIHPIAVRFVYEAAQTVNIPIIGVGGIASVADALELMMAGASAIQVGGALTQKPEAML
FT                   EIIDAMTEALDKYEFTDVRAVTNTFRK"
FT   CDS_pept        893736..894428
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="LEGAS_0873"
FT                   /product="Orotidine 5'-phosphate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0873"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91521"
FT                   /protein_id="CBL91521.1"
FT                   /translation="MKRPVFIALDFPDAKTTRLFLNDFLKIADKPAIKIGMELFFAEGP
FT                   EFVRELHRQGFTIFLDLKLYDIPTTVGHAVASIAKLNVQYLTVHAAGGTKMLRQAVANK
FT                   GKEMKLLAVTQLTSFSEADMQATQLTSSSMTENVIHLAELAYQSGIDGTISAPLEAGFI
FT                   QKKTNDSFLRITPGIRLTGDSTDDQNRITTPEKARELGATGLVVGRSVTKSNDPVAAYQ
FT                   RVLLEWSN"
FT   CDS_pept        894429..895061
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="LEGAS_0874"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0874"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91522"
FT                   /protein_id="CBL91522.1"
FT                   /translation="MLNYAEQVANDLLTIGAVKFSPEKPFTWASGIKSPIYTDNRMTIG
FT                   YPKVRQNIYEGLAALIQESFGDVEIIGGVATAGIPHAAWVSEKLNKPMIYVRSKPKDHG
FT                   AGRQTEGAVTTGKKVVLIDDLISTGGSVLAAVEAIRKEGANVLGVVSIFSYELSEGLTN
FT                   FTNAKLTFKSLTTYSQLVATAIERGELNKSQLKTLQNWQQNPNKWQL"
FT   CDS_pept        complement(895111..895752)
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="LEGAS_0875"
FT                   /product="LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0875"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91523"
FT                   /protein_id="CBL91523.1"
FT                   /translation="MTIQIQESKQLQVLRFIHEAQITNGYPPTVREVGEAVGLSSSSTI
FT                   HGHIERLVKKGYLLKDASKPRARAIEVTDSGLEALGVSITPGRIPVLGLVTAGTPILAV
FT                   EEEATEFFPIPDNLMQFDGDMFMLNVRGNSMVNIGILDGDKVIVRKQDNADNGDVVVAM
FT                   NDDNEATVKRFFREADHFRLQPENDAMAPIILKSVSILGKVIGLYRDAIY"
FT   CDS_pept        896024..896263
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0876"
FT                   /product="Conserved hypothetical small extracellular
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0876"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91524"
FT                   /protein_id="CBL91524.1"
FT                   /translation="MTLNIGLVILIAVLTLIIGLAAGFFLARNSMKSYLAKNPPISEEM
FT                   MKSMMMSMGQKPSQKKLNQMMAQMKQQSEQAQKK"
FT   CDS_pept        complement(896275..896910)
FT                   /transl_table=11
FT                   /gene="plsC"
FT                   /locus_tag="LEGAS_0877"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0877"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91525"
FT                   /protein_id="CBL91525.1"
FT                   /translation="MKFYDFLRGVAIGLMWTVNGRIKYMNRNRIPTDDNYVLVGPHRTW
FT                   WDPVWYAVAAYPKHFIFMAKIELFKFPPLAWLIKSAGAFPVDRENVGPSVIKIPVNELK
FT                   HGNRSLIMFPSGSRHNDELKSGSLLIAKMSGKAIVPAVYQGPVSFGQLFKRNNTTINFG
FT                   EPIIIDRKDRLNKENIAKYTQMIQDAFDQLDHEVDPTFVYVDPKREKK"
FT   CDS_pept        896969..897730
FT                   /transl_table=11
FT                   /gene="2.1.1.-"
FT                   /locus_tag="LEGAS_0878"
FT                   /product="RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0878"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91526"
FT                   /protein_id="CBL91526.1"
FT                   /translation="MIEPILNTGERIDGLPSQNIHIIQNPDMFAYSLDAILLAHFADVK
FT                   GKGRGLTVDLGAGTGAVGLFYAPKVAGLIKLVEIQPELAEMAKRSIAMNGLQDRVSVLQ
FT                   SDMKAIFDDIQPGSAETVLSNPPYFPLNNTTKTNQDEHYELARHELTIDLPGLAQVANK
FT                   LLKNNGKFYMVHRPERLADIFSAFSARKLMIKRIQFVYGKSDREANMVLIEAIKAGRLG
FT                   GVRIMPPIVAYTQTNEYTNQVQNILYGQSWV"
FT   CDS_pept        897727..898008
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0879"
FT                   /product="URI-like endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0879"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91527"
FT                   /protein_id="CBL91527.1"
FT                   /translation="MIKPYYFYVLYTADGYFYAGFTDDVQRRFKTHQVRKGAKFTRVKS
FT                   RHPLQLIYDAQFDTKSDALRAEANFKKLTRKNKEKFLIAHQVNEKIWI"
FT   CDS_pept        898153..898929
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="LEGAS_0880"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91528"
FT                   /protein_id="CBL91528.1"
FT                   /translation="MAVISMKELLEAGVHFGHQTRRWDPKMDEYIFTERNGIHIIDLQK
FT                   TVKLVDEAYNFVRNASTDDANFLFVGTKKQASDAIAEEATRAGQYFINHRWLGGTLTNW
FT                   NTIKTRIQRLKDLEVMAEDGTFEQLPKKEVVLLNKQREKLDKFLGGVKDMPGLPDVLFV
FT                   VDPKKEEIAVKEANMLNIPVVAMIDTNANPEVVDVKIPANDDAIRAVRLITAKMADAII
FT                   EGRQGQDSAPEDAFVAGNENTESIEEITNIVEEGNN"
FT   CDS_pept        899054..899929
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="LEGAS_0881"
FT                   /product="Protein Translation Elongation Factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0881"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91529"
FT                   /protein_id="CBL91529.1"
FT                   /translation="MAITAAQVKELRDKTSVGMMDAKKALVEADGDLEKAIDLLREKGM
FT                   AKAAKKGDRVAAEGMTYVAVDGNKAAIIELNSETDFVAGNAEFNDLLKAVANAIVEFTP
FT                   ADVESALALEVKAGQTLNDMIVGTTQITGEKITLRRFSVVEKSESENFGAYSHLAGSIS
FT                   SLVVVEGASEAAAKDIAMHVAAIAPQYVSDDEVPTEVVEREKAVQLASEDLAGKPDNIK
FT                   EKMVEGRIKKFLAEISLLDQAFVKNGDQTVAQFIASQNGSVKSFVRYQVGDGIEKKVTD
FT                   LAEEVAKQLG"
FT   CDS_pept        900021..900746
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="LEGAS_0882"
FT                   /product="uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0882"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91530"
FT                   /protein_id="CBL91530.1"
FT                   /translation="MSSMKYKRVLMKLSGEALAGEKGQGIDLETVSEIAQDLKEVHDLG
FT                   TQIAIVVGGGNLWRGEPASKVGMERSRADYTGMLGTTMNALVLQDALERAGVDTRVQTA
FT                   ITMQQIAEPYIRGRAIRHLEKGRIVIFAAGTGSPYFSTDTTAALRANEINADAILMGKN
FT                   GVDGIYDSDPNKNANAVKYTELTHLEILQKGLKVMDSTASSLSMDNNMPLVVFNLNTPG
FT                   NLKRVVLGENIGTTVTGGK"
FT   CDS_pept        900746..901291
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="LEGAS_0883"
FT                   /product="Ribosome Recycling Factor, RRF"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0883"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91531"
FT                   /protein_id="CBL91531.1"
FT                   /translation="MAFNLTDAKTRMQGAQDALKRELGSIRTGRANPHILDRIEVEYYG
FT                   AMTPLKQVASISVPEARILLITPFDKSALEEIVRAINMSDLGLNPASDGNIVRLAIPQM
FT                   TEEGRKDLAKQVKAEAEKAKVSIRNVRRDAMDTVKKDKELPEDDVRNAEDDVQKLTDDN
FT                   IKAIDVIAAEKEKELLTI"
FT   CDS_pept        901380..902519
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0884"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0884"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91532"
FT                   /protein_id="CBL91532.1"
FT                   /translation="MRRYLRYWRETFNFRGGAYRLDYWLVQAVNNLIFALIIFIVGTIF
FT                   NEWTLSSHISSIFSLLIFVPNISLFIRRLRDSGLPQQIIAIILFSPFLIGIFSGITVAL
FT                   GLLIAVPVLLLLYLSGIIYLLLRRSAYWTPYLNVQQKINYTIVFVTIIVLIIGLQIFTI
FT                   KKQMTGINNIWQKALKQQVQQTQRESELIDKSASSQTNIESSLSSVLSSAASDTHHLEK
FT                   AQKPIPDISVKALPDDKVAASYRNLPEMRLGDNDFGTFTVQGHWEQDSSTLQWFLSIQE
FT                   QHVLILTSTMGQGFGVDISSLPFEKIVGQSYFQLKQQGDLQVWRIDGTYKEPTTDQIKA
FT                   MSYLEWHMPDGHIRVMYLISQSKPLLNTIINSVATTYSQ"
FT   CDS_pept        902660..902776
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0885"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0885"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91533"
FT                   /protein_id="CBL91533.1"
FT                   /translation="MEPRVSVLMSIILTLERIMGGFLVSERENNTQYFLKGM"
FT   CDS_pept        902896..903630
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0886"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0886"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91534"
FT                   /protein_id="CBL91534.1"
FT                   /translation="MEKKQTIYFELDVVKSRLVKDNNVLIQQTMNVTEYLNKLTKQTLI
FT                   MPFQVHNGDAISGAVQSVNARDDIVKIYQSLTTYLIMQAMTLQLYMAVGVGDIDTDLNY
FT                   TQDEALVNGSAVVLARNLAMPTLKLIATKQMDKKLGIQTDFKKAPILLKIATDHEKMSM
FT                   VEHILMLVYEFELNTDKKRLIYSTLQHSENWRDDLPKLIAIKNSGFKETDTLKQIENRA
FT                   RMLVTKADVQAVNNQLAVFEEK"
FT   CDS_pept        903631..904020
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0887"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0887"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91535"
FT                   /protein_id="CBL91535.1"
FT                   /translation="MKQELIDMTFIVVGWLVLSYFYGILISFTLSKIGQKKWQPVAGKK
FT                   TDPFIHGQLIGNIERTFAMLLISLGNVGAISMIVAIKGFARWGELSKLDSDVQSVAIDK
FT                   FIIGNLLSLGFPVLIAAIWFFVSQF"
FT   CDS_pept        904063..905007
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="LEGAS_0888"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0888"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91536"
FT                   /protein_id="CBL91536.1"
FT                   /translation="MTNTKLSLQDIILTLQQYWAKQGANLMQAYDNEVGAGTQSPYTFL
FT                   RANGPEPWHAAYVQPSRRPADGRYGDNPNRLFQHHQFQVVMKPSPSNIQELYLGSLEAL
FT                   GIKSLEHDIRFVEDNWENPSMGAAGIGWEVWLDGMEVTQFTYFQQVGGIEVDSVTAEVT
FT                   YGLERLASYIQDVPTVYDLEWGNGVLYGDIFKEPEYEHSKYAFECSDQEMLLRHFDEFE
FT                   AEATRLLSLGLVHPAYDYILKSSHTFNLLDARGTVSVTERAGYLHRIRTMARHVSKVFI
FT                   EARSKLGFPLLKDSDLREKYLGVNGKYAQKEGM"
FT   CDS_pept        905007..907070
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="LEGAS_0889"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0889"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91537"
FT                   /protein_id="CBL91537.1"
FT                   /translation="MMSTFLLEIGLEEMPAHLVTSSEAQLIARTTEFLSEHRLSVGHIQ
FT                   PYSTPRRLAVELIDISSESEALSEEKRGPSIERAKDDNGNWSKAAQGFARGQGMTPENF
FT                   EERDGYVWLTKHTPGVSAADILASIGEEVIAQMKFTTYMKWANNAFLYVRPIRWIVALL
FT                   DEKVIDFNILDVKTGRMTRGHRFLSNEHITIANAGVYVATLKAAYVIVDAATRKGIIQS
FT                   QLEDIANQNNWLLDLSSDAAQNLLEEVNNIVEWPTAFSGGFENKYLELPDEVLMTSMRE
FT                   HQRFFYVTNQANDLLPHFLSVRNGNSEHLDNVIAGNEKVLVARLEDAEFFYQEDKQKTI
FT                   DDNMTKVKKLVFHEKIGTVYEHMQRVGRLAASLADELQFDETQKADLARASEIYKFDLM
FT                   TGMVGEFDELQGIMGEHYAQLFGESAAVASAIREHYMPVSANGNIAETAVGAVLAIADK
FT                   LDTIVTFFSADLIPSGSNDPYGLRRAANGVVRTLQNKHWHVALRSLLSDFVKSNGEVTE
FT                   NADLTAIMTFILDRVRKLALDGDVRPDIVAAGTALTPDVDVVYIVDRTQTLANHADDDN
FT                   FRDIIEALTRVSRLAMKQPAEGLVDESLFENQTEQALFIATQKINLAALESQGGDAVYS
FT                   ALAELQKPIADYFDMTMVNADNELVKNNRYLQLHMIDKLISALGDLEQIVIK"
FT   CDS_pept        907119..908177
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0890"
FT                   /product="oxidoreductase YhhX"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91538"
FT                   /protein_id="CBL91538.1"
FT                   /translation="MLNIAYIGFGKSTNRYHLPYLKLRLDQFKVGRIVTPTLGKRPADQ
FT                   FEWETTGTIFSTDVQDIINDSTIDLVVVVTPSSSHYTMTKRLLEAGKNVLVDKPMAANF
FT                   DEAKILVDLARKQGLFIMPYQSRRFDSDFLTVKQVIGNGYLGRLVDLEVHMDHYRPNDG
FT                   IFEGPAIDGSLYGHGVHLVDQVVSLFGAPKSAMYDLRATRILEATLDDQIEVNMFYKNA
FT                   LKATIQTTELATIQYPKWQLRGTHGTFIKYDVDEQENDLKAGIMPGTVGFGVDAPQNYG
FT                   KLVYFNQSGDRIEKMVPSVLGDYGRIYDSVFDTLVNGAPKLVSDEQMLTVMKLLSTGVS
FT                   TDSNKLVSFSGN"
FT   CDS_pept        908311..910164
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="LEGAS_0891"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0891"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91539"
FT                   /protein_id="CBL91539.1"
FT                   /translation="MTEINLEQLKERQKHIRNFSIVAHIDHGKSTIADRILEQTHTVAE
FT                   RDMQNQLLDTMDLERERGITIKLNAVEVHYDANDGETYIFHLIDTPGHVDFSYEVSRSL
FT                   AAAEGAILVVDAAQGVEAQTLANVYLALDNDLEILPVINKIDLPAADAEKVRAEIEDLI
FT                   GIDASEAVLASAKKGIGIPELLEKIVVDLPAPTGDLTAPLRALIFDSAYDAYRGVVVNM
FT                   RVREGIVKPGDKIRMMNTGAEYEVNEVGVMSPSAQKRDYLMAGDVGYLTAAIKDIHTTH
FT                   SGDTITSVDHPASEPLSGYKPMTPMVYSGLYPSDNAKYTDLRDALEKLQLNDAALTFDP
FT                   ETSQALGFGYRVGFLGLLHMDVVQERLEREFDLDLVTTAPSVTYHVMTNDDELIEIENP
FT                   SEMPDASKIKYIEEPYVNAQIMVPNEYVGAVMELAQRKRGDFDTMEYLDETRVNVKYKI
FT                   PLSEIIFDFFDKLKSSTRGYASLDYDIFGYRQSDLVKIDILLNSEKVDALSFIVHRDFA
FT                   AERGRVITSKLKEIIPRQNFEIPVQAAIGAKILARTNIKAYRKDVTSKIHTGDPDRRAK
FT                   LLDKQKRGKARMKSVGTVEVPQEAFMAVLKTDDDTQYARGN"
FT   CDS_pept        910321..911340
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0892"
FT                   /product="alcohol dehydrogenase, zinc-containing"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0892"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91540"
FT                   /protein_id="CBL91540.1"
FT                   /translation="MRAIGFERALRIDQPNVFIEKNILQPKPSDHELLIKVAASAINPV
FT                   DTKMRITYQEDGQFRILGFDATGEVIGLGKNVSKFEIGDLVYYAGVQINPGANAQYQVV
FT                   NESLVGHAPVKISVAETAAMPLTAITAVEILQSFGFDVTENEGTGKSIFILNGAGGVGS
FT                   TLIQLAKYLGLTVITTASRPESVTWVKSLGADYILDYHQDLHEQLIQIKHDKVDYIAIL
FT                   QDTNKYWPLVLESIKPFGRIASIVETSGPIDIGPLKNIGAQFNWVFMFAKGNYGVNMSS
FT                   QGEALNKIADLLDNKVIKSTLTKTYKGLTVDNIKQATRDVESGHMIGKVVILHDEEPL"
FT   CDS_pept        911337..912212
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="LEGAS_0893"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0893"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91541"
FT                   /protein_id="CBL91541.1"
FT                   /translation="MSWQAVRVDTNTEAVEFVCDLLISVGADGVQIDEKNGISVIAYYE
FT                   ENDQLSYILANIQARLQSLSKIAVDPSPATVHVSGISQSDWENNWKKYYHAQRITRHLT
FT                   VVPSWETFKSQQSEEMPIIMDPQLTFGTGTHETTRLMMQALETVVRGGESMIDVGTGSG
FT                   VLAVAAKLLGVRSVLATDIDDISVKVAKENLMLNPIATDIKVITSDLLLNVDTQPVDLI
FT                   VANILADVIERLIPQTISRLKPTGYFLVSGIYDAIAPHIEEQLHINGFEIVQKSQMGEW
FT                   HSYITQIKEK"
FT   CDS_pept        912215..912958
FT                   /transl_table=11
FT                   /gene="rsmE"
FT                   /locus_tag="LEGAS_0894"
FT                   /product="ribosomal RNA small subunit methyltransferase E"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0894"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91542"
FT                   /protein_id="CBL91542.1"
FT                   /translation="MQRYFLENLINSDHITLTKDQDVFKHFGKVLRARVGSQAEFVSVD
FT                   LKVVIGEVIAIDEAKITLAVKSRLDSDVELPLNVTIIVSPLKNDRSDWLVQKATELGVN
FT                   RIVFAEMTRTVADWKKQEAKKAVRLQKIAQAAAEQSHRLLVPQIQFLTWQNVLDLPKQM
FT                   GLVAWEESARTGEVATLVKSINEVPIDTDVNLVFGPEGGLTILEIEALARHEYYPAGLG
FT                   PRILRAETAPLYALSAISVLRELNE"
FT   CDS_pept        913015..913452
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0895"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0895"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91543"
FT                   /protein_id="CBL91543.1"
FT                   /translation="MKKAFNKFYGYQWLSAILLGFLLPFFAQQIGFREIHQIIWLYLVI
FT                   NGSYTLYFGYAIRKHGYSPLLILLLPVIFGGVSTFWLKLVHTQYGFYFSLLYIVLSLFT
FT                   FFGDTRDDPDESLIPIESGFQDLASGIEQDFSLPIDGGFKS"
FT   CDS_pept        913587..915209
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0896"
FT                   /product="Putative drug resistance ABC transporter, two
FT                   ATP-binding subunits."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0896"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91544"
FT                   /protein_id="CBL91544.1"
FT                   /translation="MITVSEMSFSFAGPKLYQDVSLKLIPGNTYGIIGANGAGKSTFLK
FT                   LLQGELLPTEGTITIGDGERLSSLQQDHFAFDAFTVLDTVVQGHKRLYEVKTEMDAIYA
FT                   KPDFNDEDGVRVADLGAEFEELDGWNAEVEAGQLLSKLGISDTMHNTLMGELTENDKVK
FT                   VLLAQALFGNPDILVLDEPTNGLDVQTINWLEDFLADFPNLVIVVSHDRHFLNAVSTNI
FT                   LDVDFGKITPFVGNYDFWRESSELAQRLASQQNSKKEEQIKQLQEFVARFSANASKSKQ
FT                   ATARKKQLDKITLDDIKPSSRKYPFINFPLNREMGNDMIRVENISKTIDGEKVLDNISF
FT                   IGRPSDKIAILSRSDLATTTLMQIIAGTMMPDTGTVNWGVTTTQSYIAKDLNDNFENQD
FT                   VTILDWLRDFAEEEQKDNTSLRGMLGQLLFRGDDSLKAIKVLSGGEKVRITLAKMMLLK
FT                   ANVLLMDDPTNHLDLESIQSLNDAVVNFKGGIVMTSHDHEFLATTANHVIEVSAKGVVD
FT                   RVDTSYDEFISTESTQEKVAALY"
FT   CDS_pept        915294..916454
FT                   /transl_table=11
FT                   /gene="mvaS"
FT                   /locus_tag="LEGAS_0897"
FT                   /product="hydroxymethylglutaryl-CoA synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0897"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91545"
FT                   /protein_id="CBL91545.1"
FT                   /translation="MTIGIDKIAFYTPNYVLDLVTLAKARGDEPDKYTIGIGQNRQTVV
FT                   PNFEDVVTMGANAAIKIITADDREKIDLIIFATESGIDNSKSSALYMQTLLELSEFVRT
FT                   IELKQACYAGTYGLMQARDYVATHPGRRVLVVASDIARYGLSTSGEVTQGAGAIAMIVS
FT                   EAPKIVSINTDSVYMSRNVSDFWRPVDRQEALVDGHLSTDIYKEMFLTLWQRYQLKTNQ
FT                   QLNDFAGFAFHLPYTKMGKKALDQIINEATLAHQQKLTHHLKASQKFNREVGNLYTGSV
FT                   YLSLLSLLSYATDLKSGDKLAIFSYGSGAEAELYSVTLQNGFENHVPAKMTQQLLLKRQ
FT                   LVSVNQYETMFKSQLYDSHININSNAVKDTKLFQFLGWHNGERVYR"
FT   CDS_pept        916528..916800
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0898"
FT                   /product="Metabolic regulator, ACT domain"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0898"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91546"
FT                   /protein_id="CBL91546.1"
FT                   /translation="MAKAVVTVIGKDKPGIIAGVSKTLSDHNINILDVSQTIMSDIFTM
FT                   SMLVNLAQLDEEFNKLQDDLNLLGKRLTVEIHTQREEIFDAMSRV"
FT   CDS_pept        916855..918198
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0899"
FT                   /product="Uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0899"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91547"
FT                   /protein_id="CBL91547.1"
FT                   /translation="METTQITETINMVSEEHLDIRTVTMGISLLDTIAGTPQETAKNIY
FT                   QKITTYAKNLVKVTQQIEREFGIPITNKRISVTPIALIAGKATPDEMLYYAHALDDAAK
FT                   AVGVDFIGGYSALVQKGFANGDLSLIKSLPRVLTETDLVMSSVNIGSTKAGINLDAIKL
FT                   MGETIKAITDKSDTANAKMVVFANAVEDNPFMAGAFHGVSEADVVINVGVSGPGVVKRA
FT                   IEKVKGESIQVVAETIKKTAFKITRVGQMVGALAAERLGVEFGIVDLSLAPTPARGDSV
FT                   AEVLEEIGLEMVGTHGTTAALMLLNDAVKKGGVMASQRVGGLSGAFIPVSEDAGMIDAV
FT                   KAGVLSLAKLEAMTAVCSVGLDMIAIPGETDATTIAAMIADEAAIGVQNNKTTAVRILP
FT                   TNGAKVGDMIDYGGLLGTAPVMPVVEKSSADFINRGGHIPAPIHSFKN"
FT   CDS_pept        complement(918291..918725)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91548"
FT                   /protein_id="CBL91548.1"
FT                   /translation="MKIPIQTPLEQLHQNVLFLKNKSLHAISSFRQNILNNRDAHHINS
FT                   KQLKLSDTREIAIVPYESNAKVVDSNSFAYALESAMTESNSGIQQSSKIRNHITSFLHR
FT                   PARVLASIVIIVLIVYIAIMAGQSNSTNQQPIEQTPQKSK"
FT   CDS_pept        918885..919796
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="LEGAS_0901"
FT                   /product="tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0901"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91549"
FT                   /protein_id="CBL91549.1"
FT                   /translation="MKTREQQLYQVYIESERQYSPLTLKAYLSDIDEFVIFLTKNGGFI
FT                   NFKTVQILDVRVYLNDLYERKLARTTISRKISSLRMFYQFMIANQFVTDNPFDNVALRK
FT                   HENHLPEFFYETEMTTLFDVAYNPEDLLWQRNAAILEFLYATGARVAEIANLMTTQLDF
FT                   SQRLVLIHGKGNKDRYVPFGHFAAQALSQYLKETRPKLIAKQVPHDFVFVNHRGEPITT
FT                   AGITYILNELMKRSTLTGKIHPHMLRHTFATHLLNNGADMRTVQELLGHVNLSTTQMYT
FT                   HVTRENLQKNYQNFFPRAKKKL"
FT   CDS_pept        919850..920728
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0902"
FT                   /product="Galactose mutarotase related enzyme."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0902"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91550"
FT                   /protein_id="CBL91550.1"
FT                   /translation="MIKLENKNLKIMINEEGAELTSVWHKQAELEYIWIGDPKYWGRHA
FT                   SNLFPIVGRLRGDQYKVAGETYFMNQHGFARNTVFDVVEHNDNHALFRIHDTGSTMRVY
FT                   PFKFQLDIRYDLTDDNDLKIAYIVHNTDTEESLFFSVGGHPAFNLPLDGGKFSDYYVSI
FT                   EPEKLYDRVRLTGPYSNPNVPTPFNANIPLRLRQEDYHDDAIILKLDRQKTSFLLARLA
FT                   NQHGLRMTLDNAQFLGIWTPAGKEAPFIALEPWWGIADTVDSTGNFKEKFGVNVLAAGD
FT                   TFNGTYSLKFF"
FT   CDS_pept        921317..921919
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0903"
FT                   /product="resembles N-(5'phosphoribosyl)anthranilate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0903"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91551"
FT                   /protein_id="CBL91551.1"
FT                   /translation="MTKIKLCGNFRVEDADLLNKVNPDMAGIIFAPGQRRTVNLMTALK
FT                   IRDRLDGNIPLYGVFVNQNVMDMLTFFSTGLIQGVQLHGDESELEVTLLREKNVPVIQV
FT                   VKPQQALIKTAANYVLLDNEFGSGKTFDWRIVPPKPLRQTPLMLAGGLTTDNLQDAINQ
FT                   VQPEWVDISSGDEVSGIKNLEKMRALVDIVRQQTDRK"
FT   CDS_pept        922074..922784
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0904"
FT                   /product="transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0904"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91552"
FT                   /protein_id="CBL91552.1"
FT                   /translation="MLKALNKSWLFDLFGVLIVIFAAYTSGYFFDNLTQSVFFSKNEWA
FT                   KYVPFGIISVISSSLSIMSTRLTARLNKFGNIVGTVNTLVSGVIDFILGNNGAILTYPV
FT                   SFLLNAASIKGWRQYEDKHVNRATDFKKWLPFVVGGAIILSLGLNYLAFQNTSPLFWLA
FT                   SAVFSLSLIPNILNIFKIEDQWLFWIFYNFVQLVKATTQGNFANVGKYLYYIVNSGVAY
FT                   PIWRMARQNDIEDV"
FT   CDS_pept        922876..923475
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0905"
FT                   /product="Putative nucleotide triphosphate"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0905"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91553"
FT                   /protein_id="CBL91553.1"
FT                   /translation="MIKKIIVASNNSAKTREIQGVFAEFGVSIINYRELIDEKEFPTET
FT                   VSNQYLNALNKAQYIQQFLPNDNILADDTGAYFAAFPERFGLTTSRELKALGLKSIHEE
FT                   NDYLLHLYNSDVTRSAYLEALFVLVMPHGRIATSNGRGGVIVAQNERGNYSVGFDALFV
FT                   AENGKTFAEMPMYERVAYSHRGRAAKKLLQEIDQTF"
FT   CDS_pept        923831..926026
FT                   /transl_table=11
FT                   /gene="tex"
FT                   /locus_tag="LEGAS_0906"
FT                   /product="transcription accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0906"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91554"
FT                   /protein_id="CBL91554.1"
FT                   /translation="MTELVITELTQADTAKQVSQVLNITFKQVNATLTLLGDGATVPFI
FT                   SRYRKEMTGELDEVQIRDIQSTAKKVQDLADRKHTVLKAVQEQQQLTPDLQKAIQSAET
FT                   LQIVEDLYLPYKQKRRTKAMVARENGLQPLADFVLLHVTTDIPSALYINDALPTSEDVL
FT                   AGLHEILAEQIGENALYRQWLRTRMSTDGVLISSIKRSGKEKDEQEVYEQYYDYNEPIK
FT                   TLRDNKFRILAVNRGEKEGILSVKIDFTEARMIHFIQTKELKGQPASGLGYVILRAAIE
FT                   DAYKRFIQPAVAREIRQELTTQAQEQAIKVFGDNLYHLLMQAPLKEKIVMGFDPGFRTG
FT                   SKLAIVDGNGEFLKKQVIYPHKPANAQQRHEAGEIFESLIHEFDVQLVAIGNGTASRES
FT                   EEFVAAHLPNGVQYAIVNEAGASVYSASDAAREEFPDLHVEERSAISIGRRIQDPLAEL
FT                   IKIDPKSVGVGQYQHDLNAKSLDEQVDHVVETAVNQVGVNLNTASVALLTHIAGLNKIL
FT                   AQNIVTYRHENGEFTSRTQLRKVTRLGPKAFEQSAGFLRILSGKNILDNTDIHPESYPA
FT                   AKQLLELAHVTPQTLATQSANDALTMLDKADIADKLSIGMQTLHDVISSLQKPGRDGRS
FT                   EMVGALLKSDILHIEDLKSGMKMQGTVRNVVDFGAFVDLGVKHDGLVHISRLAKRRVKA
FT                   PSEVVAVGDIVDVWVVDIDEKRQRIGLTMISPEESNE"
FT   CDS_pept        926023..926592
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0907"
FT                   /product="acetyltransferase, gnat family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0907"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91555"
FT                   /protein_id="CBL91555.1"
FT                   /translation="MIIQPAKQIDQAAILKLEQTIFDDMALEIYEELSVADVQAAWTLA
FT                   VATSEKSRYHYSRAIVAKNDDNEVVGVLFGYPDTEEKILDNTLQTILADKYSYHRWLFS
FT                   DSEVFDNEWYLDSIVVTDAARGQGIGKQLIKNAEIRAKQESRETIGLNVDDGNPRAQKL
FT                   YAALGFESVGKIMIGKHAYTHMQKKL"
FT   CDS_pept        complement(926629..927513)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0908"
FT                   /product="YitT family protein, putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0908"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91556"
FT                   /protein_id="CBL91556.1"
FT                   /translation="MDNTNLARISIKDIIMIMIGTGFYGWSLININITNQLAEGGLSGI
FT                   TLILLALFNWNPAYTNLILNIPLLIIGYRVLGRRSLIYTIWGIISLSFWLYVWQKFPMP
FT                   PALHHDMLIAGLLAGIMSGIGLGVVFRFGGTSGGTDVIARIMEQKLGIQIGRTMFALDA
FT                   VVLLMSLIYIDVIHMMYTLIASFVFAQVVGLTQQGAYTARSFMIFTDYPEEISHAIMHE
FT                   LERGTSLLKSEGGYSHREQRVVYAVVDPSEVSTVQHIIQEIDPKAFVSIFTAQEQLGEG
FT                   FSYLRPKKKFFFF"
FT   CDS_pept        927616..928074
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0909"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0909"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91557"
FT                   /protein_id="CBL91557.1"
FT                   /translation="MADNDYKRPKFQKSTHNIRNFFILMAGIVIIGLGVFIYIGYSSSP
FT                   KTSEPISQSTANSSTINETIDSNVKESGDESNSSRATDSSQSSSSSSSSSPDKDSAHLK
FT                   GKSIKEAINWAKSHGRYYSWSITSGGDNAVVTSVTDDGHNISFIASEK"
FT   CDS_pept        928094..928909
FT                   /transl_table=11
FT                   /gene="thiD3"
FT                   /locus_tag="LEGAS_0910"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91558"
FT                   /protein_id="CBL91558.1"
FT                   /translation="MPHKILTIAGSDSLAGGGIQADLATFANYGHFGLSVITAIVTITP
FT                   TDFEIYPVDLKIIEAQLKSVLSLDDIVAVKVGLLPTPEIINLVTSYLAQINVPIVVDPV
FT                   MVFKETDQINIKSIADTLKTQLLPLATIVTPNLNEAQILANQRIDSVDDMKQAATTIAQ
FT                   YGCKNIVVKGGSKLPGNEAIDLLFDREAFYIFQQDKIQTSELYHNGAGCTLSAGLAANL
FT                   GYSLDMIHALKDAKDFVWQGIQNGVTLNSKFSDGNVWQGARRNNHETKI"
FT   CDS_pept        928893..929396
FT                   /transl_table=11
FT                   /gene="pdxU2"
FT                   /locus_tag="LEGAS_0911"
FT                   /product="Substrate-specific component PdxU2 of predicted
FT                   pyridoxin-related ECF transporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0911"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91559"
FT                   /protein_id="CBL91559.1"
FT                   /translation="MKQKFNTKQMTIVAVMIALNVSLSYIVRIPVPATNGFVNLVEAGI
FT                   FLTAILGGARNGLIVGGLSGLLLDLLAGYPQWMIFSLVIHGMEGLVVGYFGYQKKLPSQ
FT                   IIGLVIGSLIMIIGYLLAGTFLYNWTAGLASIVGNIAQAVMGLIIALALIPVFKRLPQI
FT                   NFRN"
FT   CDS_pept        929452..930645
FT                   /transl_table=11
FT                   /gene="menF"
FT                   /locus_tag="LEGAS_0912"
FT                   /product="Isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0912"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91560"
FT                   /protein_id="CBL91560.1"
FT                   /translation="MKYHFSRDLCDSDRAQLNRALDFFNITAYFKTVDGQEELFGFGAQ
FT                   QEADVPNKLNGTMIFGGYPFDQQVVENSKLMNGIWFVPIIFVKITQNIVIFESDTVENF
FT                   NEWLTKFKTIARSKVVSHVITSELDWTSRTQKLINTIISNDKLKKVVFGRQHQYALSDT
FT                   LLASTLVHALITQKNTYHVILKYQKEMFVSATPERLVKVTDGAVTTAAVAGTIRRGNTQ
FT                   TEDKLLGDMLLNSHKNQQEHRYVVNSIYQKIQNMTTSLNLPPQPILLQNRQLQHLYTPI
FT                   SARLIKKYTVLDIVNALHPTPALGGVPQKQALDYIRAHERSPRGLFAAPIGYYTSNNSG
FT                   EFVVGIRSMYINHAAHTATLFAGAGIVSDSNATQEYQETNLKLEPMRQLLKGDVNDN"
FT   CDS_pept        930635..932263
FT                   /transl_table=11
FT                   /gene="menD"
FT                   /locus_tag="LEGAS_0913"
FT                   /product="menaquinone biosynthesis protein MenD"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0913"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91561"
FT                   /protein_id="CBL91561.1"
FT                   /translation="MTINSLTKNTKHLLHALYQSGVRHFVVSPGSRTTPVALLLAEYAR
FT                   QNKNIKLYIDVDERSAGFFALGIAKRLLEPVALLGTSGTAITEYTSAVAEAHISHIPLI
FT                   VLSTDRPIELQDNGAPQTIPQHQIFGALTKKFVVFTLQDEQPDVTSYIDFMTQKLVHEI
FT                   VMAPKGPLQINLPLRKPLMPQLNEPTTIVVPPLKFDKTADSMPPMQLSESRVVIIAGPN
FT                   EGNDYQSEVLNFSKKYHVPVIADVLSRTRQKATIYGIDALIKANILTAIYQPDLVIRFG
FT                   ATPISARILEWLKSENIPVWFVGEDTLADHSRHVSRVSQVSPTSFLSQISVNNDADFYQ
FT                   QWQHLNQKKRHITGEASIAHVLDRVLPDQTAVFVANSMAIRDMDDVFTGQTTQNIYANR
FT                   GANGIDGIVSTALGMSSTSPRRSVLLTGDLTLFHDMNGLMMARQYHLPIDIIVINNNGG
FT                   AIFSFLPQATAESYFDMLFGTPLNLNVSKIADLYELAYVKIKTADELERVIKTPVTGTR
FT                   LIEFESNRSNNVKAHQQLMGGVQHE"
FT   CDS_pept        932256..933071
FT                   /transl_table=11
FT                   /gene="menH"
FT                   /locus_tag="LEGAS_0914"
FT                   /product="2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxy
FT                   late synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0914"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91562"
FT                   /protein_id="CBL91562.1"
FT                   /translation="MNRKIVTVAGYSYHVFHQINDETVTKWVLLHGFMGTHHDFDAIIN
FT                   ELPGEVMTFDLLGFGEKANIVDDPKRFEMAAQIADIQLILKTYNWSNINLLGYSMGGRL
FT                   ALGFAFSHNELINQLFLESASAGLNSALNRKKRRAADNERIKQILTDFHEFVLNWEKLP
FT                   LFATQKDLVATQRQAIRAQRLAQQPQNVANSLKHMGTGVQVNFWPKLTQLKTPTILLVG
FT                   ELDQKFNQIADDMVRLLPSGQKHVIENAGHNMHVEQPKQVIEVLKNVSY"
FT   CDS_pept        933058..934146
FT                   /transl_table=11
FT                   /gene="menC"
FT                   /locus_tag="LEGAS_0915"
FT                   /product="o-succinylbenzoic acid (OSB) synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0915"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91563"
FT                   /protein_id="CBL91563.1"
FT                   /translation="MYRIEALEMIPISLRLKQTFKTAHSTTKNRPLTLVKLTVSHSATG
FT                   KKTIGLGEIQSFADFSYTLENQSVSRDIVSTMINPMIQNLTFESPQQFAEKLERLTPFG
FT                   SFAKAGVEMAAWDAVGKLTNRSLAQMIGGTKQCVPVGIVLDVNADVSDIKRAIDKGYQR
FT                   IKIKIDAQLLDKQKLIERLNQFPNQQFSLDANSSFSRQTADFFNQLPENVTFIEQPFSE
FT                   KDFVDHAFFQKKTPHFLSLDESINSLDDIHTMIALHAAKAVTIKQAKIGGITAAFKAIQ
FT                   LASHAGIKPWIGGMLSSNLGRAVDLAMASLQNITFAGDISESSRYFEHDMTVETFEIAQ
FT                   GLMTVPTRSGLGVTLDDSFDVL"
FT   CDS_pept        934184..935368
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0916"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0916"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91564"
FT                   /protein_id="CBL91564.1"
FT                   /translation="MNNFKFQNKTSIRFGKDRLEAELHDAIAQFGNNVLLVFGSGSIKK
FT                   SGLYDRVMSLLSDMNVVELSEVSPNPKISSVRKGQTLVKNNDIDVILAVGGGSVIDAAK
FT                   VIASSKFYDADPWELVVDSAKRQTIEQLPLVDILTLSATGTEMNTGSVISNPDTHQKLG
FT                   TYGPKTPAVSFLDPQLTYSVSKWQTAAGSIDIFSHLTEQYFDNGANDVTSGIMEGLYRA
FT                   VIKNAPIALAEPDNYDARATLMWAATMSLNGLTSVGNQNGWTVHPIEHELSAYYDITHG
FT                   VGLGIMTPRWMKHALSDETLPRFAQFGRQVWGLTGTDKEVAQLAIQETFNWIKSLEVPT
FT                   TLPEVGIIDDTYFQNMAESAVMVGYLNHEAYVTLQAADVVHLFEEAMTDHDFSK"
FT   CDS_pept        935476..936171
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0917"
FT                   /product="SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0917"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91565"
FT                   /protein_id="CBL91565.1"
FT                   /translation="MDSIHLSPRLKAVADFVPLNARLADIGSDHAYLPVNLLLNDKISH
FT                   AIVGEVAKGPLDNAHHELKKRHLLAHADVRLANGLAAINETDNVDTVTIAGMGGILISN
FT                   ILNAGKKQEKTFKTLVLQPNTDEQIVRRWLAAQDYQIIAETIVQEESHFYEIIAAVVGE
FT                   QQQQLSDLDLIFGPYLRVEKTATFVAKWQKESERITLIFNQLKAAGKSDTDAYRQWQLR
FT                   YNQIQAAIS"
FT   CDS_pept        936168..936962
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0918"
FT                   /product="conserved hypothetical NIF3-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0918"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91566"
FT                   /protein_id="CBL91566.1"
FT                   /translation="MIIAQDLIHKIEAFAPKDLAESGDPVGLQIGDPHQVIHRVMTVLD
FT                   VRPAVVQEAIEQHVDFIWAHHEVMFLPAKNLDLSVPQNKMYADLIKHNIVVYATHTNLD
FT                   STVDGMNDWLAEAIGIQNAIPIKPNDDGKTGLGRIGCLPESMTVQAYAKKIRDVFGVKT
FT                   VRIIANDLNQSIQKVAVLGGDGGKFWPIAQAAGADAYVTADIYYHVGHDILAADFVVID
FT                   PDHHMEAIANKHMSEKVKLWFENDNTLTVFPTSINTDPYTYL"
FT   CDS_pept        937067..938302
FT                   /transl_table=11
FT                   /gene="pepT"
FT                   /locus_tag="LEGAS_0919"
FT                   /product="Peptidase T"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0919"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91567"
FT                   /protein_id="CBL91567.1"
FT                   /translation="MKNEKYPELTQLFLKYVAVDTRSDENSQTVPSSPKEVDFLSKLAE
FT                   ELQVIGLTNVRIMPDGYVFAELASNTDNKKIPTIGFIAHVDTADFNGTNVKPQIIENYD
FT                   GESNINLGNSGYILKPTEFPSLRKYVGHTLITTDGTTLLGADDKAGVAEIVTAAKYLVS
FT                   HPNILHGDLRFAFGPDEEIGIGADNFDTNAFGADFAYTVDGGPAGELEWETFSAASAII
FT                   DIQGRNVHPGTAKDTMVNAIQVAFDFHAQLPEADRPEHTTGREGFWHVMAIEGNPESAQ
FT                   LRYIIRDHDRQKFENRKQKLLDIVNQFNTNFGQERVTITLKDQYYNMGEILKDDMRSVS
FT                   LAKEAMLALNIAPIIEPVRGGTDGSKITFLGLPTPNLFAGGENMHGRFEYVSTTVMSQA
FT                   TDTILKIIALAK"
FT   CDS_pept        938435..939361
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0920"
FT                   /product="Lipase/Acylhydrolase with GDSL-like motif"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91568"
FT                   /protein_id="CBL91568.1"
FT                   /translation="MRKNLKILITFAIVILLGMIAFIWLKQTQPSVKNASPQKAAKLAK
FT                   VKHINLVTLGDSLTEGIGDDKGEQGYSGRIAKRIEIQYNIAVNMSNFGKSGDRSDQIQE
FT                   RLTAQPKFQHAVKQANVIVLTSGGNDLQQSLLKNVFAKTPTDLTTAVVSEQATYQTKLT
FT                   RLFHEIRTYNRQAPIFIFGNYNPLFVHFPQREDLNQDVQRFNTINSHAAKQDKNSYYVD
FT                   SFDLTFGQYRSKKMRQSLGQQAVKKATEDQNSNQAMTATLMGATHVNNTWISQTDNYHP
FT                   NNIGYNYMTTQLYHVMRKEQEKWLIKH"
FT   CDS_pept        939343..939954
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0921"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0921"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91569"
FT                   /protein_id="CBL91569.1"
FT                   /translation="MVDKTLKRPQFLKRKQSPWFWSFWSLLGIILLTGIFLFHIAAQPA
FT                   AMTDHRSKIATSDATFDVSLNKKQVNALVAYYLSDYHANGYSFRVENNIMMYGSAKFLG
FT                   ENFKFGMMLRPEITKNGNVILTAQKLAIGNLPLPISAVLQYVKTSYDAPKFVEINPKKK
FT                   QIFIDMTQLPVTQGMSFRAKVIDMKSDSFIFEGGLANGKK"
FT   CDS_pept        939941..940171
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0922"
FT                   /product="conserved hypothetical protein Upf0346"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0922"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91570"
FT                   /protein_id="CBL91570.1"
FT                   /translation="MAKSSRSFYSWLMTNRNTVSANEIQQFANNAFLDLTFPKQSFDFD
FT                   EISKYLEENTTYLMSMTTFDQAWELYHTAST"
FT   CDS_pept        940224..941078
FT                   /transl_table=11
FT                   /gene="rgbA"
FT                   /locus_tag="LEGAS_0923"
FT                   /product="GTP-binding protein RbgA"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0923"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91571"
FT                   /protein_id="CBL91571.1"
FT                   /translation="MAQIIQWFPGHMAKAFRLMRENLKLVDVIFELVDARIPESSRNPE
FT                   VDKLIGSKPRLLIMTKADLADPEQIRAWKARFESEGHTVLVLDTRDPRTPQLVIKAARR
FT                   AVASKKAAQTARGIQDQPIRAMITGIPNVGKSTLLNHLVMKNVAPTADRPGVTKKIAWL
FT                   KTPTKLDLLDSPGVLWPKFEDQVIGMKLALTGAVKDTIFAKDDAALFLIGFFRNYRPES
FT                   IIERYHLTEDIFDQENVQILLEITNKLGFKDNYEKASERLLNDLRKGKLGTFTLDLIVA
FT                   TND"
FT   CDS_pept        941071..941835
FT                   /transl_table=11
FT                   /gene="rnhB"
FT                   /locus_tag="LEGAS_0924"
FT                   /product="ribonuclease HII"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0924"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91572"
FT                   /protein_id="CBL91572.1"
FT                   /translation="MTETISSIRSLLKQIDDIFDVRLLKWRADSRIGVQTALKSWDKHY
FT                   AKLRQQEEAFQGRFSFERHYWDQGVTYIAGIDEVGRGPLAGPVIAAAVILPSDFHHIDV
FT                   IDSKQLSAKKREMLYHIIIEQAISIGVGIVDAATIDDINIYQAAKLAMTKAVKDLAPEP
FT                   EVLLIDAMSLDIPITQESLIKGDALSNSIGAASIIAKVTRDRLMTEYSVMYPGYGFANN
FT                   AGYGTKEHLDGLKKRGITPIHRQSFQPVHDQL"
FT   CDS_pept        complement(941946..942590)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0925"
FT                   /product="Transcription regulator, Crp family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0925"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91573"
FT                   /protein_id="CBL91573.1"
FT                   /translation="MSHSAFACIKAAPIFSQLPDVLIEELVNISIHQKKYAAGSYIYEP
FT                   DDDLSALIIVDTGKIDVLNVNENGQELLLYTLHSHQVDVESSLFTDALHHHFARAKIDS
FT                   SVCMIRRTDFQNLLQENPKLSLHMLNVYGERLTELEQRQISLSLQSADERLLKYLHEIA
FT                   AIQMNNTFELAITKKELAVSLHITPETLSRLFKKLVTNGTIILDKRKIILL"
FT   CDS_pept        942687..944033
FT                   /transl_table=11
FT                   /gene="nox"
FT                   /locus_tag="LEGAS_0926"
FT                   /product="NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0926"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91574"
FT                   /protein_id="CBL91574.1"
FT                   /translation="MKVIIIGATHAGTAAIKSITKRHSDVEVDVYEKNDNVSFLSCGIA
FT                   LTVQGEVKNIKDLFYSSPEILKEAGANIHMNHEVTHVDTTNKTVDILNLVTNETATESY
FT                   DKLVATTGSWPVVPPIPGIDDKRIVLSKNYTHAQELIRHANDSSIKRVVIIGGGYIGTE
FT                   LVEAFNVKGCEVTLIDNQPTVLNRYFDDEFTKNVAHLFTSHGIAVETGKTVQAFESTDE
FT                   AIIIKTDDGDFSADLVVMSVGFRPTTQLFQDQLEMTQNGALIVNDYMQTSDPDVFAAGD
FT                   SVAVHYNPTGENAYIPLATNAVRQGTLIGYNLVSPTIKYMGTQSTSGLKLYDLNMASSG
FT                   LTASHAKELGLDANSLTMTDNFRPEFMSSTEPVLMTITWEKGTQRILGVQLQSKYDISQ
FT                   SANTASVAIQNRMTLTDLAFVDMLFQPWFDRPFNYLNLLAQAALDKDEN"
FT   CDS_pept        complement(944378..944686)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0927"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0927"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91575"
FT                   /protein_id="CBL91575.1"
FT                   /translation="MSQINASIAVQVLPMTANKSEVIRIVDHVIAYIDHSGVNYQVGAF
FT                   ESTLEGDYNQLMDILKALPLVAAEITDIPVMVYSKINMTPNGDVLTIAQKTDKYLSK"
FT   CDS_pept        945018..945956
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0928"
FT                   /product="Integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0928"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91576"
FT                   /protein_id="CBL91576.1"
FT                   /translation="MLYFLGLFAGFILANQSPINARLGDSVKSPFISSLISFTIGTIFL
FT                   AVIYFVSGQHVANMTYIAATNPWWIWFGGVIGVVYLTSNILMFPKIGAIQTIILPIVGQ
FT                   VFMGVIIDSLGLFGVEQVPISLIKIIGVFILFIGIYIAVVLANKKVVNKFSTTGATQTT
FT                   AILNMWRIWGVFVGALSAIQQAINGRLGYLLGSAVASAVISFIIGTVIILIFILVREPH
FT                   SLAKAVPLKTKPFWLFIGGILGSLFVFSTTFLVPKVGAGMTVTLGLTGSILGSMVVSQF
FT                   GLWQSPKQQVTRIQIGGILFMILGVVLIKFG"
FT   CDS_pept        946004..947017
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0929"
FT                   /product="lipase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0929"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91577"
FT                   /protein_id="CBL91577.1"
FT                   /translation="MFQKIKKYLKWCVILLSTVIIIVTIAFTVSPWPSAYVIGRMFNGP
FT                   VKITDKSVFEQAKKNVTVKSDVRYESTVKNNTLDIYTPKKETKPVTTLIWVHGGGYVAG
FT                   DKSGLSEFATKLVNDTHVAVVSINYQTAPSAIYPSQVRQVNDAIKFLKMTPKYQQKLNL
FT                   SRVMFGGDSAGAQIALQYAAIQTNARYAKEMAMPAELENGQIKGTISYCGPLDLQQVTN
FT                   QQSKSLFMRWFINTVAWSELGDRNWRESYTLQQASLVKQITSQFPPTYITDGNAYSFQE
FT                   QGLAFEKRLQYLHVPVTSLFFNHVQKEVTHEYQFNYQTSLAQKCYEETRHFVMRYQ"
FT   CDS_pept        947289..948485
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="LEGAS_0930"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91578"
FT                   /protein_id="CBL91578.1"
FT                   /translation="MLDKTIYKQIFKASFNAPIDVEFWDGEQVSYGTGEPIAKIILHEV
FT                   IPIKDIMSHASLTFGEAYMDGKIEIQGNLQKLVNTVYSSKESFLNNSKFSKLIPKHAHT
FT                   EKISKADVQSHYDIGNDFYEMWLDPTMTYSCAYFASEDDSLEDAQWNKVRHILNKLHTK
FT                   PGETVLDIGCGWGTLMFIAAKEYNLEATGVTLSQEQYDFVSHKIEAEGLQDRVHVYLKD
FT                   YRELEQTYDHVTSVGMFEHVGKENLEEYFMQVKNRLVDNGTALIHGITGQHDGAGVDAW
FT                   INKYIFPGGYIPNIAENIGHIMTSSMQIDDVEPLRRHYQKTLEIWTENFHHVSEEVISK
FT                   YGERFYRMWDLYLQACAASFESGNIDVVQYLLTKGPSGTKLPMTRSYIYNADIAHNVK"
FT   CDS_pept        948715..950142
FT                   /transl_table=11
FT                   /gene="gnd2"
FT                   /locus_tag="LEGAS_0931"
FT                   /product="6-phosphogluconate dehydrogenase,decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0931"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91579"
FT                   /protein_id="CBL91579.1"
FT                   /translation="MMEADFGVVGLAVMGRNLALNIESRGYNVAVYNRSRERTDDLISK
FT                   HADKKFVPSYSIASFVQAIKTPRRILLMVKAGTGTDAVIDELLPQLTKGDMLIDGGNTY
FT                   FEDTIRRSEKLAQSGINFIGMGVSGGELGALQGPSLMPGGQREAYDLVAPVLRKIAARA
FT                   PEDDQPTVTYIGPNGAGHYVKMVHNGIEYGDMQLISESYDILKRLLKLDHNNLSSTFAH
FT                   WNDGELNSYLIEITADILTRKDDLGSDKPIVDMILDRAGNKGTGKWSSQSALAVGAPQS
FT                   LITESVYARYISAMKSDRVAASKVLSGPEFTFTGDVDATKEDIRQALYFGKIMSYAQGF
FT                   DQLRMASNHYNWDLPFGELAQLWRAGAIIRAQFLQRITDAYQTNPNLHNLLLDNYFKNI
FT                   AESYQAATRRVVAMAVSAGVPTPALSAAIAYYDSYRSEVLPANLVQAQRDYFGAHTYER
FT                   TDKPSGEMYHFSWYDEA"
FT   CDS_pept        950266..950385
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0932"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0932"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91580"
FT                   /protein_id="CBL91580.1"
FT                   /translation="MIKNYQSDLKSNEVSTKLLTYGFNEMLLKATPKWLIFIK"
FT   CDS_pept        950588..950707
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0933"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0933"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91581"
FT                   /protein_id="CBL91581.1"
FT                   /translation="MSKEKHGTGFWGKLSLLLAVGQLLFSLYHEIRSSRSRKK"
FT   CDS_pept        950770..950904
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0934"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0934"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91582"
FT                   /protein_id="CBL91582.1"
FT                   /translation="MLKKVIKFALASTLIVSGLVIGTTIFTVKGIDKLGDKLEDTIHN"
FT   CDS_pept        951077..951322
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0935"
FT                   /product="Putative stress-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0935"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91583"
FT                   /protein_id="CBL91583.1"
FT                   /translation="MIWSLIVGAIIGAIAGAVTNKGESMGWISNIIAGLVGSAIGQGLL
FT                   GHWGPSLAGMAIIPSIIGAVILVLIISMIFGSQVKR"
FT   CDS_pept        951514..952362
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="LEGAS_0936"
FT                   /product="2,5-diketo-D-gluconic acid reductase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0936"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91584"
FT                   /protein_id="CBL91584.1"
FT                   /translation="MNNNTVPVYNLNDGHILPQIALGTYQIRGMQGVDQILAAIQTGYR
FT                   LIDTSTNYDSEGAVGEAIRRSGIPRSSFYVTSKLPGQYHHREDALKMIEETLLRLRLDY
FT                   LDLYLIHWPLPKRDNYVEAWTALIEAQKRGLIRSIGVSNFEAAHLDRIIEATGVTPAVN
FT                   QNEIHPYWIQNSLLQANKDRGIVTEAWSPLGRGIGELKEPIILELAEKYHKNAGQIILR
FT                   WHLQRGVLPVPKAGSLQHQRDNLALWNFELTADEVIAISSLTKVDGRVDNQDPNTYEEF
FT                   N"
FT   CDS_pept        complement(952448..953404)
FT                   /transl_table=11
FT                   /gene="kdsD"
FT                   /locus_tag="LEGAS_0937"
FT                   /product="arabinose 5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0937"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91585"
FT                   /protein_id="CBL91585.1"
FT                   /translation="MTNYFDDAKITFDTEIAALQTVRETLDENFDEVVEAILNTKGRSI
FT                   FIAIGKSGIIAEKIAASLSSVGVPSFFIDAGTAYHGDLGRVSADDLVIFISNSGETQEV
FT                   VQTLFALKNIHQNELKTIALTGSEDATLAKNTDIFLKVDVAEEADPTKLAPTSSTTATL
FT                   VMGDALLIAVEKAKAFKRADFALYHPGGSIGKMLLRDVAHSMHTKIPYVQTTTPINDVI
FT                   YRISDFGVGMTLVKTPEEKVIGIITDGDIRKKFLYINQVKNSTAADYMTEGFISINQNA
FT                   RNSAAWKKMASNNISNLVVKDDDDSVVGIITIHDVLE"
FT   CDS_pept        complement(953388..954239)
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="LEGAS_0938"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0938"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91586"
FT                   /protein_id="CBL91586.1"
FT                   /translation="MAKITDVFQGYGFSNDRLTLLAGPCAIESYDTCAEVVETLKNLTD
FT                   KLDINYVFKASFDKANRSAIESERGAGMTAGLEVLQKIKDNYQVPIVTDVHESYQCEPV
FT                   AKVADVLQIPAYLSRQTDLLVAAAKTGLVVNIKKAQFMAPEDIKSAVNKVAQTNEHILV
FT                   TERGTMFGYHQLVVDMTSLIQMRDTGYPIIFDATHAVQIPSGYGNHSGGNRDYAFPLMR
FT                   AALAIGIDGIFAEVHPNPPEAISDQDSQLYLSKIQPILENANKLFHEHLDMKAVYDNDE
FT                   LL"
FT   CDS_pept        954692..955090
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0939"
FT                   /product="pyridoxamine 5'-phosphate oxidase family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0939"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91587"
FT                   /protein_id="CBL91587.1"
FT                   /translation="MVILSQNMQDMINDQFPFLATTSPDGSPQIGPKGSLHVLDDSHLI
FT                   YYEHTFRHAYENLLTNGLVAVAVVDRVAEKGFRFEGKAHIHENDDYASEILAKTKIYDR
FT                   FPRAAVVIIDVERIYKLDNTLDAGMRLA"
FT   CDS_pept        complement(955205..956086)
FT                   /transl_table=11
FT                   /gene="mleR"
FT                   /locus_tag="LEGAS_0940"
FT                   /product="Malolactic fermentation system transcriptional
FT                   activator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91588"
FT                   /protein_id="CBL91588.1"
FT                   /translation="MQINDLKYYNELYNKKNFTKVAKHFNISQPSISSAIKRLENFFQV
FT                   KLVIRGNTQSELVFTQSGEQLHQHTVSILNELNSAKHELDHLKSRTTTIGLPPILKNAY
FT                   FTKIAIAAREFDRQFNINNMAIYEAGSNYLKQALMAGEIDIALLGALNMPQDDELLIIP
FT                   FIRANFCVYISKNNPLSKKSHLYFSDLQKQAFVALDSSFVHNQAIKKMSQQAGFRPKYF
FT                   MKTNDIHFLMNLISENLGVAILTDIVKTTASDIVVLPLLDEPQPFFTGSIAFRKNHLLT
FT                   NEEKMLVDTLSK"
FT   CDS_pept        956229..957857
FT                   /transl_table=11
FT                   /gene="mleS"
FT                   /locus_tag="LEGAS_0941"
FT                   /product="Malolactic enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0941"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91589"
FT                   /protein_id="CBL91589.1"
FT                   /translation="MHAKGYEVLRNPFLNKGTGFTLTERKTLGLNGTLPSQVQTIDEQA
FT                   EQAYQQFQSKTAPLEKRIFLMNLFNENITLFYHLMDQHVSEFMPIVYDPVVADSIEQYN
FT                   DIYINPQNATFLSVDKPEDIKQSLINAADGRDIKLIVVTDAEGILGMGDWGVNGVDIAV
FT                   GKLMVYTAAAGIDPASVLPISIDAGTNNQSLLENERYLGNKHARIAGDAYLEFIDQFVI
FT                   AEQELFPESLLHWEDFGRANAQVILDKYKNKIATFNDDIQGTGMIVLAGVFGALNISKE
FT                   RLIDQTFVTFGAGTAGMGIVNQIFTELQEAGLSAKEAKKHFYLVDKQGLLFDDMSDLTV
FT                   AQKAFTRTRNEFNHAEELTTLSAVVKEIKPTVLIGTSTQPGTFTEEIVKEMATHTARPI
FT                   IFPLSNPTKLAEATAENLIKWTDGKALVATGIPAENVEYKGVTYKIGQGNNALIYPGLG
FT                   FGLVASTAKLLTQKTISAAIHALGGLVDSDQEGAAVLPPVSNLTEFSQKIAEVTAQSVV
FT                   NQGLNREKISDAKQVVRNAKWSANY"
FT   CDS_pept        957875..959146
FT                   /transl_table=11
FT                   /gene="mleP"
FT                   /locus_tag="LEGAS_0942"
FT                   /product="Na /malate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0942"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91590"
FT                   /protein_id="CBL91590.1"
FT                   /translation="MRRFREIKISGVSLPLYIIMIIILMVTIAYHKLPLNMLGLTLMLV
FT                   LLGHLFYYIGNKLPIFKSYLGGGSVFTIFAAAALATSGVIPSNVVSATKIFLNDTGLLD
FT                   FYIAALIVGAILGMNRNLLLKAAVRFIPVSFAAMVIGFFAVGLMGMLLGEGFGHSVMFV
FT                   SMPLMAGGIGAGAVPLSHIYAQGLQTSSGIMFSQLIPAVTLGNVMAVIGAALIAKLGAN
FT                   TKYDGHGVLLPISDDEKTKPLVALDANKIGVGMMVSFSFFLVGTILNNYVPKVHTYAFI
FT                   IILVILFKACNWVPQELEKSVVMFNTVIMNNLTHAVLAGIGLALIDLHVLAQSLTWKFV
FT                   VLTLTSVVAMGLASAFIGKLFGLYPVESAIAAGMSDNSMGGTGNVAVLSASNRMGMIAF
FT                   AQMGNRMGGAIVLVLGGILIHYFH"
FT   CDS_pept        complement(959373..960944)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0943"
FT                   /product="Putative drug:H( ) antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0943"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91591"
FT                   /protein_id="CBL91591.1"
FT                   /translation="MENVSQEKLDPKRWLSLIAVSLGVFMALIDTTVVNVALPSIQTNL
FT                   NASYSDLQWVISAYTIVFSVLLLIWAKLGDLYGRKLMFIVGLIIFTIGSGLDAVSTSIG
FT                   MLHIFRAVQAIGGSALMSLSFALIGTTFNGKERGIALGILSSIIGLSTASGPLVGGWLV
FT                   DAFSWQSIFTINLPIGIITIIMASLFISNQQTHHATGSVDYIGMLLSTGTIFSLVFGLV
FT                   QKEMNASWGWDKMQVAGYLIMAVILFILFIWRQRTAKNPMMDLSMFKSSSFTGAVLVAF
FT                   FLGAGLYGFFAYLSTFMQNYVGYSAWDTGLRQATISGFSLVLGPIAGMLTNRLRHGYML
FT                   ATSALFIGVGLFTLSALTTTTATFADFWPAFIIIGIGNGSINPPMTTAAMSSVAPRQMG
FT                   MASGMISTFMQVGVSFGVVFQGLHLADGYQAGLAKHLPEVTGASATTIATLHKALVDAG
FT                   PFSGHMIVMSKQLVKAPFAHELQIAVRKAFDQGFISIIRLDAMLLIIGGIVAAIFIKTG
FT                   GQGDSK"
FT   CDS_pept        complement(960944..961465)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0944"
FT                   /product="Transcription regulator (Putative)."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0944"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91592"
FT                   /protein_id="CBL91592.1"
FT                   /translation="MYELYILGQLLFTDRSAYKLRFVLENVLGINRKVSFGVLYPLLEK
FT                   METTGVIVMTNDLDWHGKKKLHVTAAGRTRFDTLMREPISKNAHMDDVYLFKLSNLSLV
FT                   DRTLAQQIIADFRAEKQSQCVQYAEYNQQLQLHHSEASFFKSAMQINKLQHALANTYLE
FT                   HLDIIESELE"
FT   CDS_pept        961688..962542
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0945"
FT                   /product="Metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0945"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91593"
FT                   /protein_id="CBL91593.1"
FT                   /translation="MKKRIALLSDVHGNSTALSAVVEDLKKRDVDTCWFLGDLVMPGPG
FT                   NNELFDLLAGINTDIYIKGNWDDCFLEVIKSHSTLDLSDESDVYIGILGQYVYEKLSTN
FT                   NRDKIKKFETCATRVINNLKISISHNLPDKNYGSALIPVAETSNFNELFINSSFDIAVY
FT                   GHVHHQLLRYSSQGQLVINPGTIGEPFFAHSKLNNDRRAQYAILEIDETGLADVDFRKV
FT                   TYNLDQEMSLARNISLAYAELYSEMIYDGRVYTHNQEILKKINQKNNYLNALRPFLDSF
FT                   SEE"
FT   CDS_pept        962547..963011
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0946"
FT                   /product="Acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0946"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91594"
FT                   /protein_id="CBL91594.1"
FT                   /translation="MENQFLFKKFKASNRDLYSQNINLRNKILREPLGKSLSADDLLIE
FT                   KNNQFYGILSNQKLIATLSSYETDNSVIRLVAVAVDTNFQKQGIGSLLLKQVIDDYQHR
FT                   GYGTFNLIARVSAHGFYLKNGFQDIFGPFKNRHLDVTDYGMQRVIECKQG"
FT   CDS_pept        963249..963776
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0947"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0947"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91595"
FT                   /protein_id="CBL91595.1"
FT                   /translation="MPTKTFLNLSAEKQHTMYDAMYAEFSTYTLAESKISNIVTTAHIS
FT                   RGSFYTYFDDIDDAYQWVLTDVITDIHQTIDKKDIVSSTEAFILKAKTSPHFDFLSHYY
FT                   IVNEAFLQQKTVKTAQHDFKLLDTNSTTDDISQWLVIQSVHQLIRAFFLNPDKQARIIT
FT                   TLHMLKNWRTVG"
FT   CDS_pept        963780..964835
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0948"
FT                   /product="ABC transporter permease component"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0948"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91596"
FT                   /protein_id="CBL91596.1"
FT                   /translation="MYLTLNEMHKEKLRYGLIIVVMTLISYLIFILSALAMGLANQNTS
FT                   AVNSWGINYVAMNNDANGNLSQSLLTNDDIDKTSLSANQAAIGVAPIIVKSHEARVSAM
FT                   FIGIQKNDLIYKQMQLIKGQLPKNRYDVLISSALTQKDLKIGDHIKLGMLAHDVKVVGY
FT                   VKNATYNMAPIIYGNLVNWGDVKGVNNTFYASGIVSNGAKKANTKNLKNYTKAQLFNKM
FT                   PGYTAQNSTFIFMIGFLLVISAVIVAIFLYILTIQKIPNFAVLRAQGVPGNYLVLNTIS
FT                   ETLIIMILSVLISSILCGVTAWFIPESVPMFFDIKLLVLSSLGLVLTGILGAIVPVRLI
FT                   TKIDPMSVIGG"
FT   CDS_pept        964841..965512
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0949"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0949"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91597"
FT                   /protein_id="CBL91597.1"
FT                   /translation="MSNLKLIDVTKLFGTGDSQVTALDHVNFTANSKELTLIVGPSGSG
FT                   KSTLLTILGGLQAATSGQILLNGRDLNTLSKKQADNFRLSHIGFVLQSYSLVPYLTVQK
FT                   QFELVKRIKPDNNLSAALFTQYLERLGITNLLSKFPDQLSGGQTQRVAIARALYTNPDY
FT                   ILADEPTSALDSQRVDEVAKLFKGIAKNENKAVVIVTHDLRMRAYADRVYEIIDGKVVV
FT                   E"
FT   CDS_pept        965848..966093
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0950"
FT                   /product="Putative stress-like protein."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91598"
FT                   /protein_id="CBL91598.1"
FT                   /translation="MIWSLIVGAIIGAVAGAITNRGESMGWISNIIAGLVGSAIGQGIL
FT                   GHWGPSLAGMAIIPSIIGAVILVLIVSAVFGIRAKR"
FT   CDS_pept        966118..966672
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0951"
FT                   /product="hypothetical stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0951"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91599"
FT                   /protein_id="CBL91599.1"
FT                   /translation="MKKWQKSLLSLLSIGYLIGLAIMLWPRVILTIMALLKRININITI
FT                   SSQTIVDYYGMTLIAITIIILLVILLMPSQKPDIQLSQTKRGRLALSNDGISHFIQTQL
FT                   SGEGLSNIKVKIKNTRHQRRFHIVADSIYQQYAITELPRLTNTLTDKIADLLAGVNTVP
FT                   IKVDMKVNQAAGGKRKATRVI"
FT   CDS_pept        966690..966899
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0952"
FT                   /product="hypothetical stress protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0952"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91600"
FT                   /protein_id="CBL91600.1"
FT                   /translation="MINKNNISMIWITGGTGFVLATLLMTVGFLSTIFIIIVTLVAAFG
FT                   GYLLEKNNINLSRIAENWRRKNQR"
FT   CDS_pept        966921..967442
FT                   /transl_table=11
FT                   /gene="asp1"
FT                   /locus_tag="LEGAS_0953"
FT                   /product="general stress protein, Gls24 family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0953"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91601"
FT                   /protein_id="CBL91601.1"
FT                   /translation="MVTENKNAQRSNVTTPKGELTFNDKVIQKVIGYAIENVPGLLGVD
FT                   GGFMANIKNKIVNNDNSVDGISVEVGKEQVAVDLNVIMAYGNNAHDIYKTLTEVIAKQL
FT                   TEITSLELVELNVEVIDIQTKSEFDADQVSLQDRVTDAGNTIKEKTSDGVNTVKETASK
FT                   VKNDEDVRVV"
FT   CDS_pept        967511..967630
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0954"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0954"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91602"
FT                   /protein_id="CBL91602.1"
FT                   /translation="MDKVLNNKLVDMNPVLNWAHADQFYFDTGHKLQNVLADV"
FT   CDS_pept        complement(967662..968489)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0955"
FT                   /product="Transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0955"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91603"
FT                   /protein_id="CBL91603.1"
FT                   /translation="MGIVSRNFASRLENGHNSIESEKLFAILKRLEVSPNEFQFIHYNN
FT                   SEYWFNNILNQIDNDASMKNTAGLMKKHVTFKKNLSLDSQILAAIAYIKIYIIGNNPLR
FT                   MSIDPAYPLKKHLTQTKDWSVFELRAFVDGIFIFRKDPSELLECMAKVHEVYKKYKGFT
FT                   EYSYIIEQSVASIVLNYVQIELTNFNYNSSNLQKITDNSCYSTLTDFTAKLTMNFARLI
FT                   IFLYLGSDQKSDEANCYEFIRMLQKLQHDDYTVFKEIYNYHLPLSQRYRKSRL"
FT   CDS_pept        968660..969868
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0956"
FT                   /product="Macrolide-efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0956"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91604"
FT                   /protein_id="CBL91604.1"
FT                   /translation="MFNTIIKTSLISLVFNLAITSLNFFFGLYFLQITGSAFIFGTLTI
FT                   IGPLVSLMLTPIMTRIVDTGSHKKILLIAQIISFVFLVVYWVVVRDHLDVGTLSYVYIL
FT                   MIIIRVSEELFIVTLKASTTQLVEKYDYQRLNASVQSATSVANILGPIVGGLAFSLLTL
FT                   PFFISLIIFLVGMSILFTRTLKLAPLHRLSATDKNSFLMVIKFVKARPEILSLVIIAMF
FT                   INLFASSITIGLPILVIKQLSLSKLVYSFLESLTSVAMIGGGILLTVHTIKDNLKMMYQ
FT                   SMLCFTIIIVLFGFPELITRNYLIIIGFLGILVVVFGLIVVVANTAMTTYLQIEVPENK
FT                   QGGVYSIINAISQLFIPLGGLCYGLLFDRFESYQVFISSGLVAFVIIIGLLLLTKKRII
FT                   KGI"
FT   CDS_pept        complement(970219..971640)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0957"
FT                   /product="aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0957"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91605"
FT                   /protein_id="CBL91605.1"
FT                   /translation="MKIINQHFINGKFVPSHGTEIQELYNPSTGEKIGEVSLGDQTDAR
FT                   NAINAAAAAYKKFSQTSIDERCAMLQRLYDSIMRKKDLLNIIAMKEYGSPAGATNGRTE
FT                   FSAQIFLEMKEELQHYPFEYKEGKATVVMTSLGVIGAITPWNADYTHIASKIAPAIATG
FT                   NTIVVKPSAISALQTQVFTECLADAEIPDGVINIINGRGATVGTEIVTNPKISKVNFTG
FT                   STTVGKMIWKETANSMARMTLELGGKSPIVILEDADLDDVISKALIIAFSNSGQACHAG
FT                   TRLIVPESKLDNVKFTLLNALPHFKVGLPTDPDIQIGPMVSEKQYQRVQQYIKIGMEEG
FT                   AHILSGGLGKPKGLENGYFVRPTVFTNVTSDMTIAQEEIFGPVLSVLTYANQSEAVKIA
FT                   NDTIYGLSGYVFGKNIANARKVANQIRSGRVLINKAYSDEPKAPFGGMKQSGVGRTSGH
FT                   YSIDDYLESKAILDK"
FT   CDS_pept        complement(972856..974235)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0958"
FT                   /product="Permeases of the major facilitator superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0958"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91606"
FT                   /protein_id="CBL91606.1"
FT                   /translation="MNFKQVRNISLVLAFGLLAPMLDTTMTNIAINNISHDLHTTLNSV
FT                   QWIITAYVLSTSIAVPFSGWLTQHFNGKYVFLVAQMMFGLSSIGAAMSTTVNVLIFYRI
FT                   FQGFAAGLIMPLVSNLLVNIAPRDYFQKLMMIVMLPIMIGPVFGPILGAIIVEYGNWQW
FT                   IFWINVPIMLIAAALNFWIVPSIPATDKTTKIDWLGITLLGFGSASLIYGLSRAGKLAT
FT                   FNNSDTWLFASIGLFALFIYVIWGIYKKKTAVLPLVLFKAPVYAASTVNLFLAGIITTG
FT                   PMLILPLYFQQGRGLSILQTGFWLLPQGIGMLLIRPLLLKLLDRIGARYVVWLSLSLSI
FT                   LGTMPFGWIDSKTNILVISVVLFIRGLGIGGVIMPLMTTILMGMDKKLVPQANIGARIF
FT                   QNLGGAFGSALVATIISSYLSTHHTSLANIIAYQHAFWWSVLLTGLMIIPSIFLPKYVE
FT                   K"
FT   CDS_pept        974345..974953
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0959"
FT                   /product="Transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0959"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91607"
FT                   /protein_id="CBL91607.1"
FT                   /translation="MEKEIQTRKRGITLENTIYDVTLKLFDEEGVDEVTFYNIARLANT
FT                   SRSVLYRRWTNPRSLLLAAVHHWAHKNSGYPEKIDLKNFPDMGSLRGDLIENARRNAIL
FT                   YDSFSKYLVKFSMYRMANGENISDDILIDAEEGAIALGKCFAQRAIKRGELETVPTKEV
FT                   LMLLGNLRRYYTFVAPDSAPTIEELIDNIVLPAWLASKK"
FT   CDS_pept        975303..975926
FT                   /transl_table=11
FT                   /gene="pepE"
FT                   /locus_tag="LEGAS_0960"
FT                   /product="Peptidase E"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91608"
FT                   /protein_id="CBL91608.1"
FT                   /translation="MKKLLLTAYGFSTPTIGAVALKMIHKNKVTKACIISTSWPKEKEK
FT                   HPQMNQIKNDLIDMNVTKVDFLDVEFEDAKKLYDYDLIFLNGGYPFYLLHFLKKSGADR
FT                   ILKEKFRSGSLIFGLSAGSIVMGPSINLMQYLYPEDNQFNDVDLTGLNLTHLQIYPHFK
FT                   EMLTRDATIKEKITEYENKTEIHITRLNNNQAVKIDNDTLTFLG"
FT   CDS_pept        976029..976160
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0961"
FT                   /product="conserved domain protein, possible pseudogene"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0961"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91609"
FT                   /protein_id="CBL91609.1"
FT                   /translation="MKHFSGQAVTSMIVTLFKALKMQKELQRIYSREFAKYDEIEEI"
FT   CDS_pept        976324..977121
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0962"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0962"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91610"
FT                   /protein_id="CBL91610.1"
FT                   /translation="MILIKIAHLLFRALKFVFIMTICYLVYIALLSDILTKGYHIIAYL
FT                   TIWLLSSYVIAPKVNRFISNHYLPNYFIGRSVTSDGLLGDPVNIAINGSEETMKNIFLE
FT                   SGWHIADNLTFKSSVKIVIASLLKNSYPTAPVSTLYLFNDKQSFAFEKEINNNPRRRHH
FT                   IRVWKTPSNWYLPGGYKTDWLCAATFDQKVGLSLYNGQITHKIIGNVDQERDFVLNTFK
FT                   NSNISYQINVVENFTTGYHSKNGGGDRIYTDGALPFVDLNKDI"
FT   CDS_pept        977619..978509
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0963"
FT                   /product="NADPH:quinone reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0963"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91611"
FT                   /protein_id="CBL91611.1"
FT                   /translation="MISIKQVDYNGIDSLEYVIEPIPKVTTNGVLVKMSVLPVVPTDLK
FT                   KENNPHATSEQFGKLPRTIGVSGVGTIVAVGSNRDQKLINKRVFLLNPAGAFSEYVLNE
FT                   NNNWLFVLPDCVSDNEAATLTATSLVLKKEIEKSTSSNIFITGANSVIGIYLLQQLNTV
FT                   NKKIYPIVTPLSKTYLNDFLPDIQVYTVSDIKEKFDSAIVADIAGNTEILKVLSDKIVD
FT                   LSIISIAIMTQNEFSNFKFVHESFDHSTYKHLIEALANHSLKAPIGEIFDDHDVKTAQH
FT                   FLEDNHSRGRILVKF"
FT   CDS_pept        978687..979316
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0964"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0964"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91612"
FT                   /protein_id="CBL91612.1"
FT                   /translation="MVRPEFTKNMSIKEFQSYYWYKTELQQICKKHSLPTAGTKAELIA
FT                   YIVKLLAGVPVSKIRVARKIRRKGMKADLITPSTRILMSGFSLNNEARAFFKAYYGLSQ
FT                   FRFKKSMAIKMREIEIAQDTLATVQDLMDAYEHPYEKLASNAEEQTYQWNNFIKSFMAD
FT                   DCTKLYHARMTVASILWTKVRDSNQPKLYRRELLKQYQLEIRQYLL"
FT   CDS_pept        complement(979531..979926)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0965"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0965"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91613"
FT                   /protein_id="CBL91613.1"
FT                   /translation="MFDEFDDKEITKNQDGSFTVTTSLPEAITTYFQASNSYDSNLLAK
FT                   CFAEDAILYDDGQNYHGPSAIKAHIIVANNDLLVKTDITNAIEKNSEMVITATLSGNFD
FT                   GSPVALDYYFTMKDQKIVMLKIILAGD"
FT   CDS_pept        complement(980106..980996)
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0966"
FT                   /product="acyl-CoA thioesterase 1, truncated"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0966"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91614"
FT                   /protein_id="CBL91614.1"
FT                   /translation="MRDVLSRLISRLFLNLQSIVLILIVFCNVKSHIFYLSFLFFKNIK
FT                   HKLLEKSAFKARFFYPENESNLPAILVLSGSEGGIEKAQAIAQLIANHGFATLAIGYFG
FT                   IENLTKDLSQIPLEIIENSISFFKSQKMINSKHIGIYGRSKGAEFALLAASYFNEIKCI
FT                   VVNSPSNVVYEGISHKGFPTLTSSWSYRGKSINYFPFVFKKFLLSKITHKEFPIINENG
FT                   SYEIPVEKISCNILCIASSKDEIWNALQASKRIQRRLAQNHFQHQFNSNYVENAGHMLT
FT                   IPFQPNNRYKNTDKN"
FT   CDS_pept        981297..981512
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0967"
FT                   /product="Transcriptional regulator, XRE family,putative."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0967"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91615"
FT                   /protein_id="CBL91615.1"
FT                   /translation="MLNNLEKLRKEHKVSQQDFAQYLGVTRQTISSLENGRYNPSILLA
FT                   MKIARYFGKSVENIFIYTEESDNHER"
FT   CDS_pept        981502..981879
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0968"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0968"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91616"
FT                   /protein_id="CBL91616.1"
FT                   /translation="MKDKENTINYKEIGIFILVLLAIIFILLKVVPTNFRYGILIAVGI
FT                   SLIVMPMTKKKIIDHDERNYQIDLQAKTFAFNILEIVFGLLLLSFSIMHITFIALVLTL
FT                   SAYLIIKMVNLLAFSYYHKNN"
FT   CDS_pept        981983..982228
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0969"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0969"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91617"
FT                   /protein_id="CBL91617.1"
FT                   /translation="MTQKVWLKPEQLENYIAQLQGFRNTYQSLLSILASSRQNFEFKPG
FT                   APNFQNTLQMSMKLHCYIHSLQSQTFEYRDLTNFIK"
FT   CDS_pept        982873..983184
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0970"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91618"
FT                   /protein_id="CBL91618.1"
FT                   /translation="MNQKRFLKVAQQENNDEGQIAEHKNITVVHYIMLLVAWLFIFTVR
FT                   LVQKEPTNDLFFMILLLALGHEAYLFKRKSSFFSIITIIILLIATIMTAWSIVGMIFK"
FT   CDS_pept        983181..983393
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0971"
FT                   /product="Transcriptional regulator, XRE family,putative."
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0971"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91619"
FT                   /protein_id="CBL91619.1"
FT                   /translation="MNSNHQLTLKNNLKVARAEQEFNQSELAKLVGVSRQTISNIETYE
FT                   YIPTAKLALLICIALNKKFEDLFYF"
FT   CDS_pept        984210..984932
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0972"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0972"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91620"
FT                   /protein_id="CBL91620.1"
FT                   /translation="MITINNKPTAYTPIFLGTTQHSLRLSLEILIMIGMKLNDEIMETY
FT                   NVTVSAIELRQLPNIGNEIAIDEITGSELSGFKAKFRQSDAQRQNTVSTELENLIELKN
FT                   VGQYQLLKGQKNMKQKLNVPELSNNNLILIRQLLEVTQQELATAMDISRKTVNRFEIGE
FT                   QKISDKFVNKVLSVYPQLSEAIEVQLGWVSLTFPDSTSKQVIADVLGFQENLFLERPTS
FT                   QNFYTREMAFAGEKNIYI"
FT   CDS_pept        984945..985154
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0973"
FT                   /product="transcriptional regulator, Cro/CI
FT                   family,putative"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0973"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91621"
FT                   /protein_id="CBL91621.1"
FT                   /translation="MKSPETQAVEQKFGTTLYLTGKGTRLFEKTLLKQNMNWRNFFEKT
FT                   RQYRGHLIRLDIAINDKWGLLDMN"
FT   CDS_pept        985329..985559
FT                   /transl_table=11
FT                   /locus_tag="LEGAS_0974"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:LEGAS_0974"
FT                   /db_xref="EnsemblGenomes-Tr:CBL91622"
FT                   /protein_id="CBL91622.1"
FT