(data stored in ACNUC29543 zone)

EMBL: FN869568

ID   FN869568; SV 2; circular; genomic DNA; STD; PRO; 4061825 BP.
XX
AC   FN869568;
XX
PR   Project:PRJEA49333;
XX
DT   17-SEP-2010 (Rel. 106, Created)
DT   31-JAN-2017 (Rel. 131, Last updated, Version 6)
XX
DE   Halomonas elongata DSM 2581, complete genome
XX
KW   complete genome.
XX
OS   Halomonas elongata DSM 2581
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Oceanospirillales;
OC   Halomonadaceae; Halomonas.
XX
RN   [1]
RP   1-4061825
RA   Pfeiffer F.;
RT   ;
RL   Submitted (20-MAY-2010) to the INSDC.
RL   Pfeiffer F., Max-Planck Institute of Biochemistry, Dept Membrane
RL   Biochemistry, Am Klopferspitz 18, D-82152 Martinsreid, GERMANY.
XX
RN   [2]
RA   Schwibbert K., Marin-Sanguino A., Bagyan I., Heidrich G., Lentzen G.,
RA   Seitz H., Rampp M., Schuster S.C., Klenk H.P., Pfeiffer F., Oesterhelt D.,
RA   Kunte H.J.;
RT   "A blueprint of ectoine metabolism from the genome of the industrial
RT   producer Halomonas elongata DSM 2581(T)";
RL   Environ. Microbiol. 13(8):1973-1994(2010).
XX
RN   [3]
RA   Pfeiffer F., Bagyan I., Alfaro-Espinoza G., Zamora-Lagos M.A.,
RA   Habermann B., Oesterhelt D., Kunte H.J.;
RT   "Revision and reannotation of the Halomonas elongata DSM 2581(T) genome";
RL   Unpublished.
XX
DR   MD5; 20786f26b09059f40506776da4e1043a.
DR   BioSample; SAMEA2272784.
DR   CABRI; DSM 2581.
DR   EnsemblGenomes-Gn; EBG00001459854.
DR   EnsemblGenomes-Gn; EBG00001459855.
DR   EnsemblGenomes-Gn; EBG00001459856.
DR   EnsemblGenomes-Gn; EBG00001459857.
DR   EnsemblGenomes-Gn; EBG00001459858.
DR   EnsemblGenomes-Gn; EBG00001459859.
DR   EnsemblGenomes-Gn; EBG00001459860.
DR   EnsemblGenomes-Gn; EBG00001459861.
DR   EnsemblGenomes-Gn; EBG00001459862.
DR   EnsemblGenomes-Gn; EBG00001459863.
DR   EnsemblGenomes-Gn; EBG00001459864.
DR   EnsemblGenomes-Gn; EBG00001459865.
DR   EnsemblGenomes-Gn; EBG00001459866.
DR   EnsemblGenomes-Gn; EBG00001459867.
DR   EnsemblGenomes-Gn; EBG00001459868.
DR   EnsemblGenomes-Gn; EBG00001459869.
DR   EnsemblGenomes-Gn; EBG00001459870.
DR   EnsemblGenomes-Gn; EBG00001459871.
DR   EnsemblGenomes-Gn; EBG00001459872.
DR   EnsemblGenomes-Gn; EBG00001459873.
DR   EnsemblGenomes-Gn; EBG00001459874.
DR   EnsemblGenomes-Gn; EBG00001459875.
DR   EnsemblGenomes-Gn; EBG00001459876.
DR   EnsemblGenomes-Gn; EBG00001459877.
DR   EnsemblGenomes-Gn; EBG00001459878.
DR   EnsemblGenomes-Gn; EBG00001459879.
DR   EnsemblGenomes-Gn; EBG00001459880.
DR   EnsemblGenomes-Gn; EBG00001459881.
DR   EnsemblGenomes-Gn; EBG00001459882.
DR   EnsemblGenomes-Gn; EBG00001459883.
DR   EnsemblGenomes-Gn; EBG00001459884.
DR   EnsemblGenomes-Gn; EBG00001459885.
DR   EnsemblGenomes-Gn; EBG00001459886.
DR   EnsemblGenomes-Gn; EBG00001459887.
DR   EnsemblGenomes-Gn; EBG00001459888.
DR   EnsemblGenomes-Gn; EBG00001459889.
DR   EnsemblGenomes-Gn; EBG00001459890.
DR   EnsemblGenomes-Gn; EBG00001459891.
DR   EnsemblGenomes-Gn; EBG00001459892.
DR   EnsemblGenomes-Gn; EBG00001459893.
DR   EnsemblGenomes-Gn; EBG00001459894.
DR   EnsemblGenomes-Gn; EBG00001459895.
DR   EnsemblGenomes-Gn; EBG00001459896.
DR   EnsemblGenomes-Gn; EBG00001459897.
DR   EnsemblGenomes-Gn; EBG00001459898.
DR   EnsemblGenomes-Gn; EBG00001459899.
DR   EnsemblGenomes-Gn; EBG00001459900.
DR   EnsemblGenomes-Gn; EBG00001459901.
DR   EnsemblGenomes-Gn; EBG00001459902.
DR   EnsemblGenomes-Gn; EBG00001459903.
DR   EnsemblGenomes-Gn; EBG00001459904.
DR   EnsemblGenomes-Gn; EBG00001459905.
DR   EnsemblGenomes-Gn; EBG00001459906.
DR   EnsemblGenomes-Gn; EBG00001459907.
DR   EnsemblGenomes-Gn; EBG00001459908.
DR   EnsemblGenomes-Gn; EBG00001459909.
DR   EnsemblGenomes-Gn; EBG00001459910.
DR   EnsemblGenomes-Gn; EBG00001459911.
DR   EnsemblGenomes-Gn; EBG00001459912.
DR   EnsemblGenomes-Gn; EBG00001459913.
DR   EnsemblGenomes-Gn; EBG00001459914.
DR   EnsemblGenomes-Gn; EBG00001459915.
DR   EnsemblGenomes-Gn; EBG00001459916.
DR   EnsemblGenomes-Gn; EBG00001459917.
DR   EnsemblGenomes-Gn; EBG00001459918.
DR   EnsemblGenomes-Gn; EBG00001459919.
DR   EnsemblGenomes-Gn; EBG00001459920.
DR   EnsemblGenomes-Gn; EBG00001459921.
DR   EnsemblGenomes-Gn; EBG00001459922.
DR   EnsemblGenomes-Gn; EBG00001459923.
DR   EnsemblGenomes-Gn; EBG00001459924.
DR   EnsemblGenomes-Gn; EBG00001459925.
DR   EnsemblGenomes-Gn; EBG00001459926.
DR   EnsemblGenomes-Gn; EBG00001459927.
DR   EnsemblGenomes-Gn; EBG00001459928.
DR   EnsemblGenomes-Gn; EBG00001459929.
DR   EnsemblGenomes-Gn; EBG00001459930.
DR   EnsemblGenomes-Gn; EBG00001459931.
DR   EnsemblGenomes-Gn; EBG00001459932.
DR   EnsemblGenomes-Gn; EBG00001459933.
DR   EnsemblGenomes-Gn; EBG00001459934.
DR   EnsemblGenomes-Gn; EBG00001459935.
DR   EnsemblGenomes-Gn; EBG00001459936.
DR   EnsemblGenomes-Gn; EBG00001459937.
DR   EnsemblGenomes-Gn; EBG00001459938.
DR   EnsemblGenomes-Gn; EBG00001459939.
DR   EnsemblGenomes-Gn; EBG00001459940.
DR   EnsemblGenomes-Gn; EBG00001459941.
DR   EnsemblGenomes-Gn; EBG00001459942.
DR   EnsemblGenomes-Gn; EBG00001459943.
DR   EnsemblGenomes-Gn; EBG00001459944.
DR   EnsemblGenomes-Gn; EBG00001459945.
DR   EnsemblGenomes-Gn; EBG00001459946.
DR   EnsemblGenomes-Gn; EBG00001459947.
DR   EnsemblGenomes-Gn; EBG00001459948.
DR   EnsemblGenomes-Gn; EBG00001459949.
DR   EnsemblGenomes-Gn; EBG00001459950.
DR   EnsemblGenomes-Gn; EBG00001459951.
DR   EnsemblGenomes-Gn; EBG00001459952.
DR   EnsemblGenomes-Gn; EBG00001459953.
DR   EnsemblGenomes-Gn; EBG00001459954.
DR   EnsemblGenomes-Gn; EBG00001459955.
DR   EnsemblGenomes-Gn; EBG00001459956.
DR   EnsemblGenomes-Gn; HELO_1605.
DR   EnsemblGenomes-Gn; HELO_1905.
DR   EnsemblGenomes-Gn; HELO_RNA16S1.
DR   EnsemblGenomes-Gn; HELO_RNA16S2.
DR   EnsemblGenomes-Gn; HELO_RNA16S3.
DR   EnsemblGenomes-Gn; HELO_RNA16S4.
DR   EnsemblGenomes-Gn; HELO_RNA23S1.
DR   EnsemblGenomes-Gn; HELO_RNA23S2.
DR   EnsemblGenomes-Gn; HELO_RNA23S3.
DR   EnsemblGenomes-Gn; HELO_RNA23S4.
DR   EnsemblGenomes-Gn; HELO_RNA5S1.
DR   EnsemblGenomes-Gn; HELO_RNA5S2.
DR   EnsemblGenomes-Gn; HELO_RNA5S3.
DR   EnsemblGenomes-Gn; HELO_RNA5S4.
DR   EnsemblGenomes-Gn; HELO_TRNA1.
DR   EnsemblGenomes-Gn; HELO_TRNA10.
DR   EnsemblGenomes-Gn; HELO_TRNA11.
DR   EnsemblGenomes-Gn; HELO_TRNA12.
DR   EnsemblGenomes-Gn; HELO_TRNA13.
DR   EnsemblGenomes-Gn; HELO_TRNA14.
DR   EnsemblGenomes-Gn; HELO_TRNA15.
DR   EnsemblGenomes-Gn; HELO_TRNA16.
DR   EnsemblGenomes-Gn; HELO_TRNA17.
DR   EnsemblGenomes-Gn; HELO_TRNA18.
DR   EnsemblGenomes-Gn; HELO_TRNA19.
DR   EnsemblGenomes-Gn; HELO_TRNA2.
DR   EnsemblGenomes-Gn; HELO_TRNA20.
DR   EnsemblGenomes-Gn; HELO_TRNA21.
DR   EnsemblGenomes-Gn; HELO_TRNA22.
DR   EnsemblGenomes-Gn; HELO_TRNA23.
DR   EnsemblGenomes-Gn; HELO_TRNA24.
DR   EnsemblGenomes-Gn; HELO_TRNA25.
DR   EnsemblGenomes-Gn; HELO_TRNA26.
DR   EnsemblGenomes-Gn; HELO_TRNA27.
DR   EnsemblGenomes-Gn; HELO_TRNA28.
DR   EnsemblGenomes-Gn; HELO_TRNA29.
DR   EnsemblGenomes-Gn; HELO_TRNA3.
DR   EnsemblGenomes-Gn; HELO_TRNA30.
DR   EnsemblGenomes-Gn; HELO_TRNA31.
DR   EnsemblGenomes-Gn; HELO_TRNA32.
DR   EnsemblGenomes-Gn; HELO_TRNA33.
DR   EnsemblGenomes-Gn; HELO_TRNA34.
DR   EnsemblGenomes-Gn; HELO_TRNA35.
DR   EnsemblGenomes-Gn; HELO_TRNA36.
DR   EnsemblGenomes-Gn; HELO_TRNA37.
DR   EnsemblGenomes-Gn; HELO_TRNA38.
DR   EnsemblGenomes-Gn; HELO_TRNA39.
DR   EnsemblGenomes-Gn; HELO_TRNA4.
DR   EnsemblGenomes-Gn; HELO_TRNA40.
DR   EnsemblGenomes-Gn; HELO_TRNA41.
DR   EnsemblGenomes-Gn; HELO_TRNA42.
DR   EnsemblGenomes-Gn; HELO_TRNA43.
DR   EnsemblGenomes-Gn; HELO_TRNA44.
DR   EnsemblGenomes-Gn; HELO_TRNA45.
DR   EnsemblGenomes-Gn; HELO_TRNA46.
DR   EnsemblGenomes-Gn; HELO_TRNA47.
DR   EnsemblGenomes-Gn; HELO_TRNA48.
DR   EnsemblGenomes-Gn; HELO_TRNA49.
DR   EnsemblGenomes-Gn; HELO_TRNA5.
DR   EnsemblGenomes-Gn; HELO_TRNA50.
DR   EnsemblGenomes-Gn; HELO_TRNA51.
DR   EnsemblGenomes-Gn; HELO_TRNA52.
DR   EnsemblGenomes-Gn; HELO_TRNA53.
DR   EnsemblGenomes-Gn; HELO_TRNA54.
DR   EnsemblGenomes-Gn; HELO_TRNA55.
DR   EnsemblGenomes-Gn; HELO_TRNA56.
DR   EnsemblGenomes-Gn; HELO_TRNA57.
DR   EnsemblGenomes-Gn; HELO_TRNA58.
DR   EnsemblGenomes-Gn; HELO_TRNA59.
DR   EnsemblGenomes-Gn; HELO_TRNA6.
DR   EnsemblGenomes-Gn; HELO_TRNA60.
DR   EnsemblGenomes-Gn; HELO_TRNA61.
DR   EnsemblGenomes-Gn; HELO_TRNA62.
DR   EnsemblGenomes-Gn; HELO_TRNA63.
DR   EnsemblGenomes-Gn; HELO_TRNA64.
DR   EnsemblGenomes-Gn; HELO_TRNA65.
DR   EnsemblGenomes-Gn; HELO_TRNA66.
DR   EnsemblGenomes-Gn; HELO_TRNA67.
DR   EnsemblGenomes-Gn; HELO_TRNA68.
DR   EnsemblGenomes-Gn; HELO_TRNA7.
DR   EnsemblGenomes-Gn; HELO_TRNA8.
DR   EnsemblGenomes-Gn; HELO_TRNA9.
DR   EnsemblGenomes-Tr; EBT00001613608.
DR   EnsemblGenomes-Tr; EBT00001613612.
DR   EnsemblGenomes-Tr; EBT00001613613.
DR   EnsemblGenomes-Tr; EBT00001613615.
DR   EnsemblGenomes-Tr; EBT00001613618.
DR   EnsemblGenomes-Tr; EBT00001613619.
DR   EnsemblGenomes-Tr; EBT00001613621.
DR   EnsemblGenomes-Tr; EBT00001613623.
DR   EnsemblGenomes-Tr; EBT00001613625.
DR   EnsemblGenomes-Tr; EBT00001613626.
DR   EnsemblGenomes-Tr; EBT00001613628.
DR   EnsemblGenomes-Tr; EBT00001613630.
DR   EnsemblGenomes-Tr; EBT00001613632.
DR   EnsemblGenomes-Tr; EBT00001613634.
DR   EnsemblGenomes-Tr; EBT00001613635.
DR   EnsemblGenomes-Tr; EBT00001613636.
DR   EnsemblGenomes-Tr; EBT00001613637.
DR   EnsemblGenomes-Tr; EBT00001613638.
DR   EnsemblGenomes-Tr; EBT00001613639.
DR   EnsemblGenomes-Tr; EBT00001613640.
DR   EnsemblGenomes-Tr; EBT00001613641.
DR   EnsemblGenomes-Tr; EBT00001613642.
DR   EnsemblGenomes-Tr; EBT00001613643.
DR   EnsemblGenomes-Tr; EBT00001613644.
DR   EnsemblGenomes-Tr; EBT00001613645.
DR   EnsemblGenomes-Tr; EBT00001613646.
DR   EnsemblGenomes-Tr; EBT00001613647.
DR   EnsemblGenomes-Tr; EBT00001613648.
DR   EnsemblGenomes-Tr; EBT00001613649.
DR   EnsemblGenomes-Tr; EBT00001613650.
DR   EnsemblGenomes-Tr; EBT00001613651.
DR   EnsemblGenomes-Tr; EBT00001613652.
DR   EnsemblGenomes-Tr; EBT00001613653.
DR   EnsemblGenomes-Tr; EBT00001613654.
DR   EnsemblGenomes-Tr; EBT00001613655.
DR   EnsemblGenomes-Tr; EBT00001613656.
DR   EnsemblGenomes-Tr; EBT00001613657.
DR   EnsemblGenomes-Tr; EBT00001613658.
DR   EnsemblGenomes-Tr; EBT00001613659.
DR   EnsemblGenomes-Tr; EBT00001613660.
DR   EnsemblGenomes-Tr; EBT00001613661.
DR   EnsemblGenomes-Tr; EBT00001613662.
DR   EnsemblGenomes-Tr; EBT00001613663.
DR   EnsemblGenomes-Tr; EBT00001613664.
DR   EnsemblGenomes-Tr; EBT00001613665.
DR   EnsemblGenomes-Tr; EBT00001613666.
DR   EnsemblGenomes-Tr; EBT00001613667.
DR   EnsemblGenomes-Tr; EBT00001613668.
DR   EnsemblGenomes-Tr; EBT00001613669.
DR   EnsemblGenomes-Tr; EBT00001613670.
DR   EnsemblGenomes-Tr; EBT00001613671.
DR   EnsemblGenomes-Tr; EBT00001613672.
DR   EnsemblGenomes-Tr; EBT00001613673.
DR   EnsemblGenomes-Tr; EBT00001613674.
DR   EnsemblGenomes-Tr; EBT00001613675.
DR   EnsemblGenomes-Tr; EBT00001613676.
DR   EnsemblGenomes-Tr; EBT00001613677.
DR   EnsemblGenomes-Tr; EBT00001613678.
DR   EnsemblGenomes-Tr; EBT00001613680.
DR   EnsemblGenomes-Tr; EBT00001613681.
DR   EnsemblGenomes-Tr; EBT00001613682.
DR   EnsemblGenomes-Tr; EBT00001613683.
DR   EnsemblGenomes-Tr; EBT00001613684.
DR   EnsemblGenomes-Tr; EBT00001613685.
DR   EnsemblGenomes-Tr; EBT00001613686.
DR   EnsemblGenomes-Tr; EBT00001613687.
DR   EnsemblGenomes-Tr; EBT00001613688.
DR   EnsemblGenomes-Tr; EBT00001613690.
DR   EnsemblGenomes-Tr; EBT00001613691.
DR   EnsemblGenomes-Tr; EBT00001613692.
DR   EnsemblGenomes-Tr; EBT00001613693.
DR   EnsemblGenomes-Tr; EBT00001613694.
DR   EnsemblGenomes-Tr; EBT00001613695.
DR   EnsemblGenomes-Tr; EBT00001613696.
DR   EnsemblGenomes-Tr; EBT00001613698.
DR   EnsemblGenomes-Tr; EBT00001613699.
DR   EnsemblGenomes-Tr; EBT00001613700.
DR   EnsemblGenomes-Tr; EBT00001613701.
DR   EnsemblGenomes-Tr; EBT00001613702.
DR   EnsemblGenomes-Tr; EBT00001613703.
DR   EnsemblGenomes-Tr; EBT00001613704.
DR   EnsemblGenomes-Tr; EBT00001613705.
DR   EnsemblGenomes-Tr; EBT00001613706.
DR   EnsemblGenomes-Tr; EBT00001613707.
DR   EnsemblGenomes-Tr; EBT00001613708.
DR   EnsemblGenomes-Tr; EBT00001613709.
DR   EnsemblGenomes-Tr; EBT00001613710.
DR   EnsemblGenomes-Tr; EBT00001613711.
DR   EnsemblGenomes-Tr; EBT00001613712.
DR   EnsemblGenomes-Tr; EBT00001613713.
DR   EnsemblGenomes-Tr; EBT00001613714.
DR   EnsemblGenomes-Tr; EBT00001613715.
DR   EnsemblGenomes-Tr; EBT00001613716.
DR   EnsemblGenomes-Tr; EBT00001613717.
DR   EnsemblGenomes-Tr; EBT00001613718.
DR   EnsemblGenomes-Tr; EBT00001613719.
DR   EnsemblGenomes-Tr; EBT00001613720.
DR   EnsemblGenomes-Tr; EBT00001613721.
DR   EnsemblGenomes-Tr; EBT00001613722.
DR   EnsemblGenomes-Tr; EBT00001613723.
DR   EnsemblGenomes-Tr; EBT00001613724.
DR   EnsemblGenomes-Tr; EBT00001613725.
DR   EnsemblGenomes-Tr; EBT00001613726.
DR   EnsemblGenomes-Tr; HELO_1605.
DR   EnsemblGenomes-Tr; HELO_1905.
DR   EnsemblGenomes-Tr; HELO_RNA16S1-1.
DR   EnsemblGenomes-Tr; HELO_RNA16S2-1.
DR   EnsemblGenomes-Tr; HELO_RNA16S3-1.
DR   EnsemblGenomes-Tr; HELO_RNA16S4-1.
DR   EnsemblGenomes-Tr; HELO_RNA23S1-1.
DR   EnsemblGenomes-Tr; HELO_RNA23S2-1.
DR   EnsemblGenomes-Tr; HELO_RNA23S3-1.
DR   EnsemblGenomes-Tr; HELO_RNA23S4-1.
DR   EnsemblGenomes-Tr; HELO_RNA5S1-1.
DR   EnsemblGenomes-Tr; HELO_RNA5S2-1.
DR   EnsemblGenomes-Tr; HELO_RNA5S3-1.
DR   EnsemblGenomes-Tr; HELO_RNA5S4-1.
DR   EnsemblGenomes-Tr; HELO_TRNA1-1.
DR   EnsemblGenomes-Tr; HELO_TRNA10-1.
DR   EnsemblGenomes-Tr; HELO_TRNA11-1.
DR   EnsemblGenomes-Tr; HELO_TRNA12-1.
DR   EnsemblGenomes-Tr; HELO_TRNA13-1.
DR   EnsemblGenomes-Tr; HELO_TRNA14-1.
DR   EnsemblGenomes-Tr; HELO_TRNA15-1.
DR   EnsemblGenomes-Tr; HELO_TRNA16-1.
DR   EnsemblGenomes-Tr; HELO_TRNA17-1.
DR   EnsemblGenomes-Tr; HELO_TRNA18-1.
DR   EnsemblGenomes-Tr; HELO_TRNA19-1.
DR   EnsemblGenomes-Tr; HELO_TRNA2-1.
DR   EnsemblGenomes-Tr; HELO_TRNA20-1.
DR   EnsemblGenomes-Tr; HELO_TRNA21-1.
DR   EnsemblGenomes-Tr; HELO_TRNA22-1.
DR   EnsemblGenomes-Tr; HELO_TRNA23-1.
DR   EnsemblGenomes-Tr; HELO_TRNA24-1.
DR   EnsemblGenomes-Tr; HELO_TRNA25-1.
DR   EnsemblGenomes-Tr; HELO_TRNA26-1.
DR   EnsemblGenomes-Tr; HELO_TRNA27-1.
DR   EnsemblGenomes-Tr; HELO_TRNA28-1.
DR   EnsemblGenomes-Tr; HELO_TRNA29-1.
DR   EnsemblGenomes-Tr; HELO_TRNA3-1.
DR   EnsemblGenomes-Tr; HELO_TRNA30-1.
DR   EnsemblGenomes-Tr; HELO_TRNA31-1.
DR   EnsemblGenomes-Tr; HELO_TRNA32-1.
DR   EnsemblGenomes-Tr; HELO_TRNA33-1.
DR   EnsemblGenomes-Tr; HELO_TRNA34-1.
DR   EnsemblGenomes-Tr; HELO_TRNA35-1.
DR   EnsemblGenomes-Tr; HELO_TRNA36-1.
DR   EnsemblGenomes-Tr; HELO_TRNA37-1.
DR   EnsemblGenomes-Tr; HELO_TRNA38-1.
DR   EnsemblGenomes-Tr; HELO_TRNA39-1.
DR   EnsemblGenomes-Tr; HELO_TRNA4-1.
DR   EnsemblGenomes-Tr; HELO_TRNA40-1.
DR   EnsemblGenomes-Tr; HELO_TRNA41-1.
DR   EnsemblGenomes-Tr; HELO_TRNA42-1.
DR   EnsemblGenomes-Tr; HELO_TRNA43-1.
DR   EnsemblGenomes-Tr; HELO_TRNA44-1.
DR   EnsemblGenomes-Tr; HELO_TRNA45-1.
DR   EnsemblGenomes-Tr; HELO_TRNA46-1.
DR   EnsemblGenomes-Tr; HELO_TRNA47-1.
DR   EnsemblGenomes-Tr; HELO_TRNA48-1.
DR   EnsemblGenomes-Tr; HELO_TRNA49-1.
DR   EnsemblGenomes-Tr; HELO_TRNA5-1.
DR   EnsemblGenomes-Tr; HELO_TRNA50-1.
DR   EnsemblGenomes-Tr; HELO_TRNA51-1.
DR   EnsemblGenomes-Tr; HELO_TRNA52-1.
DR   EnsemblGenomes-Tr; HELO_TRNA53-1.
DR   EnsemblGenomes-Tr; HELO_TRNA54-1.
DR   EnsemblGenomes-Tr; HELO_TRNA55-1.
DR   EnsemblGenomes-Tr; HELO_TRNA56-1.
DR   EnsemblGenomes-Tr; HELO_TRNA57-1.
DR   EnsemblGenomes-Tr; HELO_TRNA58-1.
DR   EnsemblGenomes-Tr; HELO_TRNA59-1.
DR   EnsemblGenomes-Tr; HELO_TRNA6-1.
DR   EnsemblGenomes-Tr; HELO_TRNA60-1.
DR   EnsemblGenomes-Tr; HELO_TRNA61-1.
DR   EnsemblGenomes-Tr; HELO_TRNA62-1.
DR   EnsemblGenomes-Tr; HELO_TRNA63-1.
DR   EnsemblGenomes-Tr; HELO_TRNA64-1.
DR   EnsemblGenomes-Tr; HELO_TRNA65-1.
DR   EnsemblGenomes-Tr; HELO_TRNA66-1.
DR   EnsemblGenomes-Tr; HELO_TRNA67-1.
DR   EnsemblGenomes-Tr; HELO_TRNA68-1.
DR   EnsemblGenomes-Tr; HELO_TRNA7-1.
DR   EnsemblGenomes-Tr; HELO_TRNA8-1.
DR   EnsemblGenomes-Tr; HELO_TRNA9-1.
DR   EuropePMC; PMC3187862; 20849449.
DR   EuropePMC; PMC3494270; 22821013.
DR   EuropePMC; PMC3783009; 24003073.
DR   EuropePMC; PMC5552945; 28349658.
DR   EuropePMC; PMC5843318; 29552065.
DR   EuropePMC; PMC5924526; 29597294.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00043; Plasmid_R1162.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; FN869568.
DR   SILVA-SSU; FN869568.
DR   StrainInfo; 12227; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4061825
FT                   /organism="Halomonas elongata DSM 2581"
FT                   /strain="type strain: DSM 2581"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:768066"
FT   CDS_pept        228..1694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="HELO_1001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1001"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40884"
FT                   /db_xref="GOA:E1V447"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1V447"
FT                   /protein_id="CBV40884.1"
FT                   /translation="MSLALWQQCLATLQDELSSQQFNTWIRPLQAEEEGESNQLRLLAP
FT                   NRFVRDWVSDKYAKRISELMRELAPAKPPKVVLTVGSRRAAPAPQPRELGDPVSAAPRS
FT                   PAVHTPPRGDVADESEIDQLREEGEAQQRRPTGERQVQVEGSLKHNSGLNHNFTFETFV
FT                   EGKSNQLARAASRQVSENPGGAYNPLFLYGGVGLGKTHLMHAVGNALDARRENARVVYL
FT                   HSERFVADMVKALQLNAINDFKRFYRSVDALLIDDIQFFAGKERSQEEFFHTFNALLEG
FT                   GQQMILTSDRYPKEISGVEERLKSRFGWGLTVAIEPPELETRVAILMKKADQAKVNLPH
FT                   DAAFFIAQKIRSNVRELEGALKKVIADSHFMGKTITQDFIRESLKDLLALQDKQVGVDN
FT                   IQRTVAEYYKIKLSDLLSKRRSRSVARPRQVAMALAKELTNHSLPEIGDAFGGRDHTTV
FT                   LHACRKVQALQDESADIREDYKNLLRLLTS"
FT   CDS_pept        1766..2869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="HELO_1002"
FT                   /product="DNA polymerase 3 beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1002"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40885"
FT                   /db_xref="GOA:E1V448"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E1V448"
FT                   /protein_id="CBV40885.1"
FT                   /translation="MKFSISREALLRPLTLVAGVVERRQTLPVLSNVLIQVEQDQVSLT
FT                   GTDLEVELIGRTVASQVDEAGSATVPARKLMDICKSLPDQAEIQLALEDNRAVLRSGRS
FT                   RFTLSTLPVAEFPNIEDGQSSVELSLPRGTLKRLIDATSFAMAQQDVRYYLNGMLLEFG
FT                   TNLVRAVATDGHRLAVASRSAEIQVEPSQKLIVPRKGIMELVRLLDDGEDPVSLTLGST
FT                   HIRAHTGDFTFTSKLVDGKFPDYERVVPKGGDKVLIAERTELRQVLSRTAILSNEKYRG
FT                   VRLNLEEGNLRVMANNPEQEEAEENVGVEYTGPAMEIGFNVGYLVDVLSVLDEDRVQLT
FT                   LADPNSSALLEEPGGGDALYVVMPMRL"
FT   CDS_pept        2939..4054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="HELO_1003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1003"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40886"
FT                   /db_xref="GOA:E1V449"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E1V449"
FT                   /protein_id="CBV40886.1"
FT                   /translation="MPLDRLAFQGLRNLQALELSPGPRINLFIGDNGTGKTSLLEGIHV
FT                   LGMGRSFRTRQLRHAIAHEEDGVTLHGRLSGEPPLPIGVRRRRDSDELEMRLAGERVGR
FT                   VSQLVETLPLQLINPDAFRLLEGSPAGRREFLDWGVFHVKHDFLDAWKRFRRALKHRNA
FT                   LLRHGRMSDASMGAWERELAHWGARLDELRRAWIDAFLPVFQETLEGLIALPGLQLRYA
FT                   RGWDRKRQLADVLEQSRETDRQMGFTQQGPQRADLGIRLGRRPAIEILSRGQQKLVVSA
FT                   LKLAQGRLLERLTGRSCVYLIDDLPAELDGEHRRVFCEWLAHMRCQAFITSVDPNALTG
FT                   SWDVDTPVSMFHVKHTEAGQGQLLPMDRQTS"
FT   CDS_pept        4066..6486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="HELO_1004"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1004"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40887"
FT                   /db_xref="GOA:E1V450"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E1V450"
FT                   /protein_id="CBV40887.1"
FT                   /translation="MSEQAYDSSSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVFELV
FT                   DNSIDEALAGHCSEIGVVIHPDESITVRDNGRGIPTEIHEEEGVSAAEVIMTVLHAGGK
FT                   FDDNSYKVSGGLHGVGVSVVNALSEELKLTIWRQGQVHEQIYRHGEAVAPLAVVGTTEQ
FT                   TGSRVHFRPSSETFQNIEFHYDILAKRLRELSFLNSGVAIRLTDERTGKEELFHYEGGL
FT                   RAFVDHLNTNKTVLNPVFHFNVEREDGVGVEVAMQWNDTFAENIFCYTNNIPQGDGGTH
FT                   LAGFRASLTRTLNHYIEAEGLLKKAKVNTSGDDAREGLTAIISVKVPDPKFSSQTKDKL
FT                   VSSEVKTAVEQEMGRQFSEYLVERPNEAKAIVNKMLDAARAREAARKARDMTRRKGALD
FT                   IAGLPGKLADCQEKDPSLSELYLVEGDSAGGSAKQGRDRRTQAILPLKGKILNVEKARF
FT                   DKMLSSAEVGTLITALGCGIGREEFDPDKLRYHSIIIMTDADVDGSHIRTLLLTFFFRQ
FT                   MSQLIERGHVFIAQPPLYKIKRGKQESYLKDEQALTDYLTTTALDGARLHVNADAPGIE
FT                   GEGLEKLVHQYRDVMNRIDRLSRVYPDVVLRKIVHAAKLEGEESLRDRVTMQNWIEYLQ
FT                   AEMDAIVSYEGGPRYTFRLEEDSERGFYLPAVTLAAHGVTSDYVWGVDFFTSADYRAIA
FT                   GLGETLDNLVEEGAYVARGERKKSVGSFYDALEWLMNEAQRGLSIQRYKGLGEMNPDQL
FT                   WETTMDPNTRRMLRVSIEDAVAADMMFNTLMGDEVEPRRDFIERNALVANLDI"
FT   CDS_pept        complement(6677..7237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gmhB"
FT                   /locus_tag="HELO_1005"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /EC_number="3.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1005"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40888"
FT                   /db_xref="GOA:E1V451"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1V451"
FT                   /protein_id="CBV40888.1"
FT                   /translation="MSAKLVILDRDGVINQDSDNYVKSLDEWIAYPTAIEAIARLHRAG
FT                   WRVAVATNQSGIARGYYDENVLADMHRYLRSLVHAAGGELAHIAYCPHGPDDDCQCRKP
FT                   LPGMLHEIRLALDLPSLEGSWMVGDSLRDIQAGEAAGCRQALVLTGKGKRTLDKHPEIE
FT                   ASRVEVFEDLAAFSDWLLAPPSV"
FT   CDS_pept        complement(7497..8498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1006"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1006"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40889"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V452"
FT                   /protein_id="CBV40889.1"
FT                   /translation="MKLLITGMAGFIGHAVAKRLAGQEYDILGVDNLSDYYDVSLKQAR
FT                   LDDLADAPNIRFERLDLADREAVAALFEAEGFDRVIHLAAQPGVRYSLENPHAYADANL
FT                   LGHLNVLEGCRHGRVEHLVYASSSSVYGANDKTPFATSDNVDHPISLYAATKKANELMA
FT                   HTYSHLYDLPTTGLRFFTVYGPWGRPDMAMFKFTRAVLAGEPLQVYNHGEMFRDFTYID
FT                   DIVEGIVRILDVVPKRDEKTVPASPDTSDAPYRLYNIGHGSPVALMDFVRAVESATGRE
FT                   AICDFQPMQPGDVPRTWADTEALFAATGHRPQIGVEEGVARFVEWYRDYYGV"
FT   CDS_pept        8710..9795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1007"
FT                   /product="probable glycosyltransferase, type 1"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1007"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40890"
FT                   /db_xref="GOA:E1V453"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1V453"
FT                   /protein_id="CBV40890.1"
FT                   /translation="MSQSTTRPPKRFAFVIEDLYGGGAQKSLLYTADQLRQRGHVVKVF
FT                   TLRERIEHRLPEGLEVENLAVVSRFTKATSTVLTEKWQASRIRRALVPWRPDVVISCSC
FT                   DKITRHLDLPNLYFWIKSDVSAKFSDPKQRERAFDKVRRFYHGRQVIAVSQGVKENLEG
FT                   VVGLEAEKIVPIYNPYEREPFVAMADEPAPVPEGDYLLCVAAIEPRKRHDRLLRAYAKS
FT                   GITTPLAIMGKGKPEHEQEVRRQIASLGLEDRVVWLGYHHNPYPFIRHAKAMVLTSDAE
FT                   GLPRVLIESLLLHTPVVSTDCPSGPREILTHELADFLVAPDDEDGLAEALRRMDQAPVT
FT                   IEPRHYQQFLKETVLPQFEVL"
FT   CDS_pept        complement(9857..10996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1008"
FT                   /product="probable glycosyltransferase, type 1"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1008"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40891"
FT                   /db_xref="GOA:E1V454"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1V454"
FT                   /protein_id="CBV40891.1"
FT                   /translation="MSQSNTSSHVPESPLSILFIMDHLDTGGAPIVVRNLIKEMSAQGV
FT                   RVTLLLLSSRPRHELPDDVLTIDVPFAPTSLYQRLRRYHLHAKKIEATLESAPVRERGP
FT                   FDLVMAHLHHAHQVVSRTSLAQTSWYCLHSDPVSAFLGNKRGLARRIKKYKVKRLYHGR
FT                   KLVTVSKEMLNRLSAHFGIHPEKGVSILNPLDIEHIRQLAHQSVSDIADDEFLVFVGRL
FT                   DLRAKRFDRLLEAYRQSGTELPLLIIGGGSSSEQVARLIRDMGLEDRVRMLGHRDNPYP
FT                   YMARSRALLLSSDYEGFALVLAEALSLGVPVISTNCPCGPAEILGNSLKDCLVPVDDTA
FT                   AFARAISRVIAAPPAIPHDICDNFQLATVARRYTSLTQA"
FT   CDS_pept        complement(11276..13348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="HELO_1009"
FT                   /product="glycine--tRNA ligase beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1009"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40892"
FT                   /db_xref="GOA:E1V455"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:E1V455"
FT                   /protein_id="CBV40892.1"
FT                   /translation="MKMAADTFLLELGVEELPPSAIDTLSDALADGIRQGLDDANVEHG
FT                   DIDAYASPRRLAVRVAALADKQPDREVERRGPSLAAAFKDGEPTKAAEGFARSCGVSVD
FT                   SLIHLETDKGTWLGYREQQPGEATTTLLPAIVEKAIAALPVPKNMRWGASRVEFSRPAH
FT                   WLVMLYGERVVEASALGLQAGRTTRGHRFHAPEPIELGHADDYLGAMENAWVLADREQR
FT                   RERIREQVLAEAEVQEATAVIDEELLIEVSGLVEWPVALTGSFDERFLEVPAECLVSSM
FT                   KANQKYFHLLDDDGKLKPRFITISNIDSQAPELVIQGNEKVIRPRLADAAFFYDTDRQR
FT                   PLVERVQELSSVVFQQQLGTLADKAHRSAAVAAFIAGRIDGDVGHARRASELAKCDLVT
FT                   EMVQEFPELQGTMGRYYATHDGEDAEVARALEEQYLPRFAGDEVPSTRTGLALALADRL
FT                   DTLTGIFGIGQRPSGTKDPFALRRASIGVLNILIKGELDLDLRELLELAAAQHQELPYA
FT                   EGLVDEVLAYMLDRFRAWGRDEGIEAEVYLAVRARPVTKPLDFARRLQAVHAFASREEA
FT                   AALAAANKRVSNILAKQDDEIAPEVDTSLLAEDAERDLAEALAQCREKVAPLFAEARYS
FT                   DALDVLAGLRNPVDRFFDQVMVMAEDAAVKRNRLALLASLQALFLEVADIAELQH"
FT   CDS_pept        complement(13345..14307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="HELO_1010"
FT                   /product="glycine--tRNA ligase alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1010"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40893"
FT                   /db_xref="GOA:E1V456"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E1V456"
FT                   /protein_id="CBV40893.2"
FT                   /translation="MTQSTPDVTTFQGLILALQQYWAEQGCVVLQPLDMEVGAGTFHTA
FT                   TFLRSIGPETWNAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVMKPSPADLQELYLGSL
FT                   KCLGIDPLVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECYPVTG
FT                   ELTYGLERIAMYVQDVDSVYDLVWTVAPDGSRVTYGDVFLQNEREQSAYNFEHADVPAL
FT                   FEAFDHQERECTKLLDASLPLPAYEQVLKASHTFNLLDARHAISVTERQRYILRVRTMA
FT                   RDVAHAYYESRKAAGFPLASEALRQELLANESPAEQGDA"
FT   CDS_pept        14403..15359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldD"
FT                   /locus_tag="HELO_1011"
FT                   /product="ADP-L-glycero-D-manno-heptose-6-epimerase"
FT                   /EC_number="5.1.3.20"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1011"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40894"
FT                   /db_xref="GOA:E1V457"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR011912"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V457"
FT                   /protein_id="CBV40894.1"
FT                   /translation="MIVVTGGAGFIGSNLVKALNERGRDDILVVDDLRDGTKFINLADC
FT                   TLGDYLDKDDFLARVRAALRGEPTHLPPIEAIFHEGACSDTTEWDGRFMLENNFEYSKE
FT                   LLHFCQLKGIPFLYASSAATYGGSEVFREEPEHEKPLNVYGYSKLLFDQYVRARHHEFE
FT                   SQVVGFRYFNVYGPREQHKGKMASVAYHHHTQISAGEDLKLFGAWDGFEAGMQSRDFIY
FT                   VGDVVDVNLWFLDNPEASGIFNLGTGRAEPFKAIGEAVIDYYGRGRIEYIDFPENLKGR
FT                   YQSYTRADIERLREIGYDREFHTVAEGVKAYLEWLNA"
FT   CDS_pept        15352..16368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaF"
FT                   /locus_tag="HELO_1012"
FT                   /product="ADP-heptose--LPS heptosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1012"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40895"
FT                   /db_xref="GOA:E1V458"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011910"
FT                   /db_xref="UniProtKB/TrEMBL:E1V458"
FT                   /protein_id="CBV40895.1"
FT                   /translation="MPEAAPGERILVVGPSWVGDMVMAQSLFKTLKARQPDARIGVVAP
FT                   AWSRPILERMEEVDEVAPLEVGHGEFGWATRRRLAAELRGRFDRALVLPRSWKSALVPF
FT                   LARIPRRTGFTGEQRYVLLNDRRRLDKSVLDQTVKRFVALGLPADEAAGGDFALPRPEL
FT                   RRDEANLERLRETLGLSSRPAIAMMPGAEYGPAKQWPLTYFRQLAEALVAEGHEVRVMG
FT                   GPKDAEAGDVIARGLEGAHNLCGRTRLGDAVDLLADCRQAVTNDSGLMHVAAATGTRVQ
FT                   AIYGSSSPDYTPPLTDNAEIHYLALECSPCFERTCPLGHTNCLNHLPPERLLRAIRG"
FT   CDS_pept        complement(16400..18064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opgB"
FT                   /locus_tag="HELO_1013"
FT                   /product="phosphoglycerol transferase OpgB"
FT                   /EC_number="2.7.8.20"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1013"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40896"
FT                   /db_xref="GOA:E1V459"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E1V459"
FT                   /protein_id="CBV40896.1"
FT                   /translation="MMPERSLPDWLREPRWWALLALGLALGHAAVTVTPLPYWMLPPIA
FT                   AGWLLLARTLHWGAPSRHAPARGWPWSLVPLIFWGVYVYLADSFGIVDLGAVFFHLQAG
FT                   ISEHGGGERTIVAILYTLAMLPVLAAFTWLVRHDHRWRLLERLLALVLLATNPLLYGIG
FT                   QRGAAIVAEEGAWLEQRYVDPVILEAPSSPPNLLVIYLESLEQTYADRERFGDVYAPLT
FT                   ALGDQGVVFEGVRQIDNTGWTMAGMIASQCGVPLMPAGLLHDSQLEPLERVVPGVSCLG
FT                   DLLAEQGYSLTYLGGASKRFAGKGRFYEGHGFSRVLGRDDLAPRVDNPDDLNSWGLYDD
FT                   DLYDLTVEEIRRLEKQEGPWGLVNLSLATHPPYGYPPDECRRRQGEFDGTDILYSVECS
FT                   ARMAHDLVKRLAGEGLLKNTLVVIASDHLSMRVSAWEQLTAGPRSNTFMLLGNDLAPRR
FT                   IKVEASTMDILPTVLEAMGFVIDWHRAGLGVSLLSEEPTLVEQHGLETLNDQLKRETAL
FT                   HERLWQGLDIEGMAPDDTSRAKSPWLSPEAPPAEAAE"
FT   CDS_pept        complement(18054..18821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1014"
FT                   /product="probable glycosyltransferase, type 2"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1014"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40897"
FT                   /db_xref="GOA:E1V460"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1V460"
FT                   /protein_id="CBV40897.1"
FT                   /translation="MTPITGIIITLNEADNVADCIASLQRVCEEVIVVDSGSKDDTVSL
FT                   AEAAGARVIHQSYLGDGPQKAFAVPQAQHDWILALDADERLDDDAVTAIQGLTLDDPRQ
FT                   AYRFRRRNFAGNHWIRAAGFYPDPVTRLYNRTTSGYLPKKAHSSVQAPSVVDLDVHIRH
FT                   FTYRDLSHWITRIDQLSSRDAWAMKERGKPPSRYRPVLHALSATLRKLILKGGIFQGPD
FT                   GFTVAMTTAFHAYMKYAKLNELHENERANSDDA"
FT   CDS_pept        complement(18818..19903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1015"
FT                   /product="probable glycosyltransferase, type 9"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1015"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40898"
FT                   /db_xref="GOA:E1V461"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E1V461"
FT                   /protein_id="CBV40898.1"
FT                   /translation="MTHFLNQQPPRLLVVRNDKLGDFMLAWPALACLKASEPAPHVSVL
FT                   VPGYTAPVARLCPWVDEVIIDPGDEAGRDARRDLLDRVRTANFDALLTLFSTPRIGWLG
FT                   WRAGIPLRLAPATKWAQLFYNHRITQRRSRSAKPEYVYNMELAEALLDALGLSRPERPA
FT                   PPYWPLSTHEQDAQRRRVTEELAIDPERPWVFLHAGSGGSAVNLTAEAYARLAQGVASR
FT                   LEESVSPVWILTAGPGEEANADALLQTLEGMALDAHRLPARNGLGDFALSLAAADLFIA
FT                   GSTGPLHIAGCLDRATAGFYPARRSATPLRWQTCNETSRRLAFRPPEGAGETDMHAIDL
FT                   EDAAERIARHLASSPTSEPST"
FT   CDS_pept        19958..21085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1016"
FT                   /product="probable glycosyltransferase, type 1"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1016"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40899"
FT                   /db_xref="GOA:E1V462"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1V462"
FT                   /protein_id="CBV40899.2"
FT                   /translation="MQICLSDGWGGLEMYPARIIPELARQGWEAHGLALEGSRVASSLV
FT                   DAGIDPLTVGSRGQALWRVRRILAYLKAHGIEVLHCHKSSDLRLGALLVSLRPQLRLFF
FT                   TDHMGVTRPKRDPFHRWSYGKVHRLFSISEATRRRNLNAFPLPAERIRRLYLSIDPAPY
FT                   VDDLDAGEKSALRAELGIPEGAVAIGLPGRFSRGKGQALWIEALGRLAEMAPDQAWQGV
FT                   LIGGLTVGEGSDEAVVAELRGRVAELGLESRVSFAGFRSDLPSCLKALDIVCVPSRNEA
FT                   FGLTVIEAMAAGRPVVGSSSGAIPELVSEETGRLAAPDAPEAWAAALVELLGDAGLRER
FT                   LGAAGRRRVQEEFTLSGHVAALVGEYAGQEAAPEA"
FT   CDS_pept        complement(21061..21771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdkA"
FT                   /locus_tag="HELO_1016A"
FT                   /product="3-deoxy-D-manno-octulosonic acid kinase"
FT                   /EC_number="2.7.1.166"
FT                   /db_xref="GOA:A0A1R4A444"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A444"
FT                   /protein_id="SJK83731.1"
FT                   /translation="MRLATYRTGKIGILYDADSLCDADGAPQIGPHLFDPEYWRQAGKV
FT                   VGEAPGRGASLFIAAGDEQWVLRPYRRGGLIARISTERYLWCGAERSRAFREMRLTAHL
FT                   HALGLPVPRPVAAGVTRHGLTYEAGLITVRLPDARALAECLSEADEALLHRVGRTIRRF
FT                   HDAGLDHVDLNARNLLVDPEGAIWLIDLDRCRLRTPGGWQDANLERLARSLAKFDAPSA
FT                   IAAVREGYASGAAS"
FT   CDS_pept        21770..22867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opsX"
FT                   /locus_tag="HELO_1017"
FT                   /product="ADP-heptose--LPS heptosyltransferase OpsX"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1017"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40900"
FT                   /db_xref="GOA:E1V463"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E1V463"
FT                   /protein_id="CBV40900.2"
FT                   /translation="MKHPLPVRPAHIGVLRLSALGDVCNLVPTVRALQRQWPEARITWI
FT                   IGKGEHSLLAGLSGVEFIVYDKSTGLAGMRELWRRLGDTRFDVLLHMQQALRASVLSLG
FT                   LKADLRIGYDKARAKDAQHWFTHRQLAPHPQAHVLESFLDFARLLGVEDLSLDWSLPVP
FT                   ESARKEAAGFTSGAPYILMSPCANPRLRNFRNWSAEGYAAVVEHVWVQHGLKTVLTGGG
FT                   STQEREMGQRIAAQSQPGAVIDAIGESSLKGLLALIDGARAVIAPDSGPVHMANAMGTP
FT                   TVGLFATTNPERAGPYCWRDFVVNRYPDAVRAYLHKDPETLPWGQRVRHPDAMSLIQAD
FT                   DVIDRLEALLATTSARKQTEFPDET"
FT   CDS_pept        22857..24287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hldE"
FT                   /locus_tag="HELO_1018"
FT                   /product="D-beta-D-heptose 7-phosphate kinase /
FT                   D-beta-D-heptose 1-phosphate adenosyltransferase"
FT                   /EC_number="2.7.1.167"
FT                   /EC_number="2.7.7.70"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1018"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40901"
FT                   /db_xref="GOA:E1V464"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1V464"
FT                   /protein_id="CBV40901.1"
FT                   /translation="MKLDLTALEHSRLLVVGDVMLDRYLHGGTSRISPEAPVPVVRVEE
FT                   DEDRPGGAANVALNIASLGARAALAGLVGDDGNADRLVHRLEDAGVSTHFVRSPDIPTI
FT                   TKLRVMSRNQQLIRLDFEEGLGKVDTQGLAAQVEEALPDADLVILSDYGKGTLTDVAAL
FT                   IARVRDAGKRVLVDPKGSDFSKYRGASVITPNLAEFEAVAGPCPDDATLAARGEALRAE
FT                   LELEALLITRSEKGMTLIREGAEPLHLPTRAREVFDVTGAGDTVIGVLGLALAAGHGFP
FT                   EAMTLANLAAGLVVAKPGTATLSIAELYTAVHGDKLAEFGVIEEAPLCEAVRAAQARGE
FT                   RVVMTNGCFDILHAGHVAYLEHARQLGDRLIVAVNDDASIARLKGASRPINPLARRMQV
FT                   LAGLGAVDWVVPFAEDTPQRLIEAVLPDVLVKGGDYQPEQIAGGEAVRAAGGEVKVLGF
FT                   EDGVSTTAMISTILDRER"
FT   CDS_pept        24287..25582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="waaA"
FT                   /locus_tag="HELO_1019"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.4.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1019"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40902"
FT                   /db_xref="GOA:E1V465"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:E1V465"
FT                   /protein_id="CBV40902.1"
FT                   /translation="MAGGHPWTRRLYSAALLALAPLLWWRVWREHRAGRSRGERLGWIP
FT                   ASSDADRPLWLHCASVGEVQAAQPLIEALRKRYPQHRLVITTMTATGAERAVALAEAAS
FT                   DEAGGEVSHYFLPLDFPCAARRFVARLRPRLAIFFETELWPNLLASCARRGVPVAVVNG
FT                   RLSARSFRTYRRLRRLMQEALSHVDWLGAKSRQDAERFAALGMAEDATSVTGSLKFDIA
FT                   LNDEAFKVSERLHTLLGGRPVWVAGSTHPGEDEALLTAHARVREIRSEALLILVPRHPR
FT                   RFEAVAELCAARGLACARRSKGEAPGSETAVYLGDTMGELRALYGAADLAFVGGSLVPV
FT                   GGHNLLEPAAMGVPVLTGPELANFEDVAETLREHQALVEVADGEALAAALLRLFDEPAE
FT                   RQRLAEAGRTVVEANRGALARTLDGLETLLSR"
FT   CDS_pept        complement(25595..26269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="HELO_1020"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1020"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40903"
FT                   /db_xref="GOA:E1V466"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1V466"
FT                   /protein_id="CBV40903.1"
FT                   /translation="MTQDELKDAVAAAALDEIRPLLGRNIVIGVGTGSTANRFIDKLAT
FT                   LRGDFRGAVASSEATAERLRGHGIDVFELNETGTLPVYVDGADEVNAHLHMIKGGGAAL
FT                   TREKIVAACSERFVCIADASKRVERLGDFPLPVEVIPMARSYVARELVKLGADPVYREG
FT                   VVTDNGNQILDCYEFMIDDPESMEARLNAIVGVVTNGLFAARGADVLLLGTDQGVERLT
FT                   PQ"
FT   CDS_pept        26464..27978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="HELO_1021"
FT                   /product="L-threonine dehydratase"
FT                   /EC_number="4.3.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1021"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40904"
FT                   /db_xref="GOA:E1V467"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:E1V467"
FT                   /protein_id="CBV40904.1"
FT                   /translation="MLEATVKKILQARVYEAARETPISPAPFLSRRFNNQILIKREDLQ
FT                   PVHSFKIRGAYNRMAQLSDEQKAKGVIAASAGNHAQGLAMAAKQMGVKAVIVMPRITPE
FT                   IKVQAVRAWGAKVVLKGDAFAAAAAHAQELIEEHGYTYIPPFDDVDVIAGQGTVAMEIL
FT                   RQHGGRLDAIFVPVGGGGLIAGIAAYVKYLRPEIKVIGVESEDSACLKAALESGERVTL
FT                   DQVGVFAEGVAVAQIGEAPFAIMRDLVDDVITVNTDEMCAAVKDIFEETRAVSETSGAL
FT                   SLAGLKKYIQSTGASGETLICINSGANTNFDRLQHIAERTELGEQREAILAVTIPERPG
FT                   SFKKFCRTIGKRMVTEFNYRYADPEQAHIFVGVQVKPGGEDRQAVIDKLRGAGYPVEDL
FT                   TDNELAKLHIRHLGGGRPKEHFEEEVYRFEFPERPGALMNFLTHLPQDWNISLFHYRNH
FT                   GAAYGRVLVGMQVPNGDRSHVEGYFDDIGYRYWKESENPAYRLFMA"
FT   CDS_pept        complement(28442..29062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1022"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1022"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40905"
FT                   /db_xref="GOA:E1V468"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1V468"
FT                   /protein_id="CBV40905.1"
FT                   /translation="MNFMQDPAAPTTRRELRRELRRRRRELDPREQAAASRRLCHALRR
FT                   LPEVFRARHVALYLPNDGEIDPTPLLPWLARRSARAYLPVLRPLAPNTLWFVHYHGDTP
FT                   MVTNRFGISEPDTRHGAHRARRRAAWALDVVLLPLVGFDDDGQRIGMGGGFYDRTFAFT
FT                   RRPGPRPRLIGLAHDCQRVERLPTASWDVPLDAIVSDRRILRP"
FT   CDS_pept        complement(29304..29603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zapA"
FT                   /locus_tag="HELO_1023"
FT                   /product="cell division protein ZapA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1023"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40906"
FT                   /db_xref="GOA:E1V469"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:E1V469"
FT                   /protein_id="CBV40906.1"
FT                   /translation="MSDSSRPTIEITLLERQYVIACPPDEESKLERAARYLDRAMQGIH
FT                   AQGKVVDREKVAIMAALNIANELLETQDEQRAGEQSLSELSQRLEKALADAPGR"
FT   CDS_pept        29736..30317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1024"
FT                   /product="UPF0149 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1024"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40907"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:E1V470"
FT                   /protein_id="CBV40907.1"
FT                   /translation="MSLINERQDFSTIADTFLLHGSMQSPAFLDGRLCASLALHDLDAE
FT                   GWLETVCVNLGVEQPRDEPSAERLLGWRRQTLEALSAAEMNYEPLLPDELFSLAERAQG
FT                   LQEWTLGFLEVVRDAGDEPRKQWSEALREAIDDLGGLADIETDLEDNAENENDLFALTE
FT                   HARMAAMLLYTEQHPGKPQVEQVDEPGPTH"
FT   CDS_pept        30352..31692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="HELO_1025"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1025"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40908"
FT                   /db_xref="GOA:E1V471"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1V471"
FT                   /protein_id="CBV40908.1"
FT                   /translation="MPLDAPPRPSPIDLDEYRRRRRRLIDALPTDAAVLLPGASLVIRS
FT                   RDSEFPFRQDSDFHYLTGFPEPDALLVLLPGRAEGECVLFCQDRDPAMETWTGRRLGAE
FT                   GAVRVHGVDQAFENAERDAHLLELLEGRVTLYLPLGDASALRLAERLRGELLTRPCQAV
FT                   QPPLLAFADVTPMLHEQRLVKSDAELALLRHAGEISAHAHCRAMRACRPGLAEYQLQAE
FT                   LEHEFRWRGGSGPAYASIVAGGRNAGILHYIDNREPLCDGDLVLIDAGAEFDLYAGDIT
FT                   RTFPVNGRFSPAQRALYEVVLEAQERAIAAVRPGTTLKALHRGVVRDLAAGLVALDILG
FT                   DDGEETPESIVARRFYPHGTSHWLGLDVHDVGDYRQDGEPRCLTPGMVITIEPGLYMPD
FT                   DEDLPAAFRGIGIRIEDDVAVTAEGCEVLTRAAPKQVADIEALLDEK"
FT   CDS_pept        31758..32981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiH"
FT                   /locus_tag="HELO_1026"
FT                   /product="2-octaprenyl-6-methoxyphenyl hydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1026"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40909"
FT                   /db_xref="GOA:E1V472"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1V472"
FT                   /protein_id="CBV40909.1"
FT                   /translation="MSESISAEAPRRVDIAIVGGGLVGASLGAALAPLMRDRALSVAVI
FT                   EAASVSDGLDAPWQPSFDARASAISRGTANHFDSLGVWSSMAERASPIRCIHVSERGRL
FT                   GATRLRAEEFGEEAMGHVIPNAWMGRVLHRRLAELPLAWHCPARVESIQPRAGGHWLEL
FT                   SDGARLEAGLTVLADGGRSGLKERLGIESREHPYEQAAVIATVELDRPHDGMAYERFTP
FT                   SGPIALLPMAGQRMALVWTFAAGGERGALALSDADFLARLQASFGDRAGRFRRVGKRHA
FT                   YPLSLVTASETVRPGLAVMGNAAHALHPVAGQGFNLALRGVMDLVAAIEAGLARGDAPG
FT                   EAATLNDFEARRSGDRDNVIRFSDGLVRLFGYDHPLLSHARAAGLVGLNLLGPLRRTLA
FT                   RRAMGMER"
FT   CDS_pept        33018..34253
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="HELO_1027"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinolhydroxylase"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1027"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40910"
FT                   /db_xref="GOA:E1V473"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1V473"
FT                   /protein_id="CBV40910.1"
FT                   /translation="MKTDTAGNEVMIVGGGMVGATLACLLGQAGVSVMLLDARPGPVDA
FT                   ETAGRGPADLRVSALTPVSQRLLDGLGVWASMRGRRVTPYHHMRVWDGEGSGEVSFSAD
FT                   QAGLPVLGHIVENDVVVAALEARLAELPSVRRRFATRVVGFETHHDAPLVCLEDGERLS
FT                   APLVVAADGARSPLREMAGIETRSHDTGQVALVTSVCTERPHGGVARQAFLADGPLAFL
FT                   PLTLDGDDRHCSIVWSTSPDEAERLSALPAEALGAELEAGIGACLGRVTPTDRAMCLPL
FT                   TQRHAERYTLPGLALVGDAAHSIHPLAGQGANLGLMDVAVLAEELLEARRRGIALGDEA
FT                   WLARYARRRRGDNAAMLRLMDGFRLLFGARHPALTLARNLGLAGVDRLGPVKRLLMQQA
FT                   AGRRGRLPDTCL"
FT   CDS_pept        complement(34266..35597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="HELO_1028"
FT                   /product="CtpA family serine protease"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1028"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40911"
FT                   /db_xref="GOA:E1V474"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:E1V474"
FT                   /protein_id="CBV40911.1"
FT                   /translation="MPTLCWAHSNGTARDRMPLSPTLRRRLGAILLPIALLAAPLPVVA
FT                   ANETEDDLPVAEIQAFAEVFERIKRAYVEEVDDATLLHNAMRGMLSELDPHSSYLDAEA
FT                   YENLRESTQGEFGGVGIEVGKRDGQITVITPIDDTPASRAGLQAQDTILRINDTPTEGM
FT                   SLQEAVDLMRGDPGTDIRLTIIRQGEDAPRNITLEREVIRTQSVKSDTLAPGYGYLRIS
FT                   QFQARTGDQVVNALNELTDDGPLQGLVLDLRNNPGGVLQAAVDVADAFLDDGRIVYTEG
FT                   RLADSELSFYANRATTAPDVPLVVLINGGSASAAEIVAGALQDQRRGVVMGTESFGKGS
FT                   VQQIMPLGENEALKLTTARYFTPSGRSIQAQGIKPDVEVVRGRLEVAQDNGLRVREADL
FT                   EGHLSGNGKDAESGELNARLRDDYQLGEALNLLKALNVLDERKR"
FT   CDS_pept        complement(35654..36811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1029"
FT                   /product="peptidase M23 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1029"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40912"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:E1V475"
FT                   /protein_id="CBV40912.2"
FT                   /translation="MSESFPRRNGARCLLPLVLWLAVSPAIAVTDEREARQRLDAIGER
FT                   IQSVTQELDATGQERDEASEALRKIETQLAETHSRLDDIQAQRRSLNDEVIELEEERER
FT                   LEAERQEQIAALEQQIDALYRLGLTPQLKLLLNQDDPSRLDRLQTYLNHLAEARNARLE
FT                   ELDRLDKALDDNQQALDERGQQLEQLAAELEKRSAELASQMDERKALVAKLDERYATKE
FT                   ARLSALDQDRAHAEQVLQQVQERLARLERPPPSTAIGETRGDLPWPVQGKVTSAFRQGR
FT                   GVHRDGMLIRTAAGTPVEAVHAGRVVFADWMRGFGNLLIIDHGDGVMTLYAHLQHFSTE
FT                   VGAAIETGQTIGVVGASGGQSSPGLYFEVRRAGDPIDPQSWVARR"
FT   CDS_pept        complement(36808..38382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="HELO_1030"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /EC_number="5.4.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1030"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40913"
FT                   /db_xref="GOA:E1V476"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:E1V476"
FT                   /protein_id="CBV40913.1"
FT                   /translation="MTDTSTPTPRPVALIILDGYGHNPDAAHNAVQAARTPVMDRLWAE
FT                   RPHALLHTDGRYVGLPDGQMGNSEVGHMNLGAGRIVYQDFTRITKAIEDNELADNAILT
FT                   DAIDAAVNAGKAVHLLGLLSPGGVHSHEDHILAMAELAAQRGAKRIYLHGFLDGRDTAP
FT                   KSALASIERANAKLAELVGADNGFVASLIGRYFAMDRDNRWERVEQAYRLVTEGHGEYR
FT                   AASAEAGLQAAYERGETDEFVTSTAIVSSGTPITMEDGDAALFMNFRADRARELTRAFV
FT                   EDDFDGFERRAHPRLANGSLVTMTQYAADIPAPAAFPPADLPNTLGEVMEQRDLTQLRI
FT                   AETEKYAHVTFFFSGGREAEFQGETRILVPSPQDVKTYDEKPEMSAVEVTDRLVDAIES
FT                   DAFDLIVCNYANGDMVGHTGDFDAAVAAIEAVDTCVGRVVEAIEKAGGACLITADHGNA
FT                   EQMVHPETGAPQTAHTTFQVPLVYVGERPRKLLDDGSLCDLAPTLLAMMDQPVPEEMTG
FT                   RILIEPQ"
FT   CDS_pept        38591..39013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yibN"
FT                   /locus_tag="HELO_1031"
FT                   /product="rhodanese domain protein YibN"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1031"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40914"
FT                   /db_xref="GOA:E1V477"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E1V477"
FT                   /protein_id="CBV40914.1"
FT                   /translation="MIDQLFEFVQNHPLLVGAFLLVLLAWALYEVRSSGANGVSTSEAT
FT                   QLVNREDAVVLDIRETKEFKAGHIAGARNIPQSRIDDRIAELDKFKDKPVIVVCKHGQS
FT                   SGAVQGKLAKAGFERALKLKGGMTQWQSDGLPLVKK"
FT   CDS_pept        39061..39576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secB"
FT                   /locus_tag="HELO_1032"
FT                   /product="protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1032"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40915"
FT                   /db_xref="GOA:E1V478"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/TrEMBL:E1V478"
FT                   /protein_id="CBV40915.1"
FT                   /translation="MAEDNNQGNGANGQAADQQDKPQVQFALQRIYIKDLSFEAPNSPS
FT                   VFQQPFKPKVGLDLDTTHQKVGEDLYEVVVKVTAQVTHSEEGTTSFLAEVEQAGMFRIG
FT                   GLEGAQLDHTLGAFCPNVLFPYARECVDSLVNRGGFPPLMLAPVNFEAIYAQRKQREAQ
FT                   QQGEQATQ"
FT   CDS_pept        39603..40349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmE"
FT                   /locus_tag="HELO_1033"
FT                   /product="16S rRNA (uracil(1498)-N(3))-methyltransferase
FT                   RsmE"
FT                   /EC_number="2.1.1.193"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1033"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40916"
FT                   /db_xref="GOA:E1V479"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1V479"
FT                   /protein_id="CBV40916.1"
FT                   /translation="MSAKHSMGKAPRIHVAAELQAGGDVVLPDGAARHVARVLRLGPGA
FT                   PVIIFDGQGNEAEAILTEAGRKQVVARVERVAAGRGESPLAVHLGQAISKGDRMDYAIQ
FT                   KAVELGVAEITPLYTEHGDVRLKGEREAKKLAHWQAVAASACEQCGRATLPPVYPPRSV
FT                   VDWLAERDEPLCLVLHPGTPGGLDRHDDPVRAALLIGPEGGLSHAEVDAAADAGFASLT
FT                   LGPRILRTETAPVVALSLLQNRFGDL"
FT   CDS_pept        complement(40354..41094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1034"
FT                   /product="GntR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1034"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40917"
FT                   /db_xref="GOA:E1V480"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V480"
FT                   /protein_id="CBV40917.1"
FT                   /translation="MTLRAFADEKALKSQTKKEILADKLIDMVLTGLLRDGDELPSERE
FT                   LAQLFSVSRETVRGALAQLTAHGLASVSHGSKSRICASAATIERFQHHPGRQQEAEVNQ
FT                   FDVDSVFESRLVVESAIARRAARYIDESGLQQLGQLLEAQSQLFNSPVHFQLSDQNFHK
FT                   LISEYARNEILLRYSQELYAFGLSIRRQVMVEAGSIEQSYREHCRIVEALSAGDPDAAE
FT                   RAMLAHLDSVYRTTREKLDAPTSS"
FT   CDS_pept        41348..42322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1035"
FT                   /product="TRAP transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1035"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40918"
FT                   /db_xref="GOA:E1V481"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V481"
FT                   /protein_id="CBV40918.1"
FT                   /translation="MYKKLLGLSALGLVVASTQVQADEIVFAIGGTPQSLQGQTAQEFT
FT                   RRLQERLGDEHQVELYDSGQLGNEQQLVQKLRLGTVDLAAISSIMSSIDSRFALFDMPF
FT                   LVKDRDHLKRLDQEIIMKDLAEGIGDKGLRIVSTWENGFRHITNNERPIETPEDLNGLK
FT                   LRTPQSEWRTRMFETWGANPTPMAFSEVFVALQTGVVDGQENPLSNINGAKFQEVQDYL
FT                   SLSNHVYSPIWLTAGKGNWEKLPEDVRTAITEVGAETQGWALARGAELDENLVGTMREA
FT                   GMEINRVDRDAFVEASAPVYQAYAERVDGGQELIDRAMTLAEE"
FT   CDS_pept        42328..42945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1036"
FT                   /product="TRAP transporter small transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1036"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40919"
FT                   /db_xref="GOA:E1V482"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V482"
FT                   /protein_id="CBV40919.1"
FT                   /translation="MTMVSGAQEAPSPPRIEGSSAMTLLERCRLGLERLLEVFTVTLLL
FT                   ALTIIVLGAVAFRTLGSSIPWYDEVASVGLAWLSFYGANLAALKRAHMGFPGLVAKAPM
FT                   PLRTILFLSSEVIVVGFFLVVGFYGYRVLEVLAWDTLVALPSVHLDVTQSVIPISAALF
FT                   ILCELLSLPMAWRKMRSGVNGEEEEIEAAIRQAEDDLKEHRA"
FT   CDS_pept        42942..44222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1037"
FT                   /product="TRAP transporter large transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1037"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40920"
FT                   /db_xref="GOA:E1V483"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V483"
FT                   /protein_id="CBV40920.1"
FT                   /translation="MTLLIIIASLFALVLINVPIAVAIGVVGVVGVYLNMGAEALVNVP
FT                   LTLFNGATKFPLIAIPLFIFAGALMNTSGISLRLINLVTALVGFVRGGLAMVNVGVSLF
FT                   FAEISGSAVADVAATGSVLIPEMKRRKYHPDFSAAITSSSASLAIIIPPSLSMILYGAI
FT                   ADTSIVKLFVAGIVPGLIGAAGLAGACYYYAVKYDLPREAAFSLSTLGKAFREAFWALL
FT                   LPVIILGGIFGGFVTATEGAGIAVLAALLIGGLVYRELNLKILYRAVIEGVIQTSVVML
FT                   LVATSAVLGLFLTEMQLPQQLAQQITSITRDPVLVLALLNVLLLMLGMFLHGAAAIILV
FT                   VPIVMPLVQQIGIDPIHFGLILTLNLAIGQQTPPVASVLATSCSIAKTDIWNTTRVNLP
FT                   MILVLFVVLMLVTYVPAIPMTLVNLFY"
FT   CDS_pept        44237..45268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA2"
FT                   /locus_tag="HELO_1038"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /EC_number="1.1.1.262"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1038"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40921"
FT                   /db_xref="GOA:E1V484"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:E1V484"
FT                   /protein_id="CBV40921.1"
FT                   /translation="MTNTSPVIAVTLGDPAGIGPELIARLFAETPLFEGVHTVLVGDRW
FT                   LWQEGQRVAGQSHRLPEIEDFAAARHHDGPVFLAVDSVAEGEVGYAEETAAGGASVLAV
FT                   LSRCLEAAQAGEVDAICFAPLNKLSMKKGGLRHEDELHFFAERLGVEGYFCEFNTLGSL
FT                   WTSRISSHIPLKDAASYVTRERIVAASELIHDSLKLAGFDAPRVAVAAFNPHGGEGGTC
FT                   GREEIDVIAPAVEQCRAQGYPIDGPFPADTIFIKARDGEYDAIVTMYHDQGQIAIKLMG
FT                   FKQGVTVQGGLPIPITTPAHGTAFDIAGQGKADMGPTRNAFSIACRMGANLRRQRLADA
FT                   THA"
FT   CDS_pept        45289..46461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1039"
FT                   /product="mandelate racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1039"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40922"
FT                   /db_xref="GOA:E1V485"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034619"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1V485"
FT                   /protein_id="CBV40922.1"
FT                   /translation="MKINNIRTRVFEWKGHTVPPRPHFCSNAMDELWDRGDSMGTFRFH
FT                   GWTTVEIETDNGLVGLGNVALAPRIAKAIIDQYLAPLVIGQDPFDYEYLWQRMYRATHA
FT                   WGRKGIGMAAISGVDIAIWDLMGKAVGQPVFKLLGGRTKEKIPCYASKLYRTDLKSMQE
FT                   EAQSYLDQGFTAMKMRFGYGPKDGPAGMRANLDSVAAVREVIGEDVDLMLECYMGWNLE
FT                   YAKRMLPRLERYQPRWLEEPVLADDIDGYAELNQLTCIPISGGEHEFTHYGFRQLLEKR
FT                   AVSVVQYDTNRVGGITAARKINAIAESFSVPVIPHAGQMHNYHLTMSTLASPMAEFFPV
FT                   HDVEIGNELFYYLFKGDPEPVDGFLDLSDDEPGLGLSLNEGYFDQFHIIE"
FT   CDS_pept        46470..47462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1040"
FT                   /product="DUF1238 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1040"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40923"
FT                   /db_xref="GOA:E1V486"
FT                   /db_xref="InterPro:IPR009645"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1V486"
FT                   /protein_id="CBV40923.1"
FT                   /translation="MRLIQYLEEGQPRAALVESDDAVRPIRLAGGTYALARLAIASGQS
FT                   LSAVIEMHLDDELVDYQQLIDECRLLPPLTHADPAHCLVTGTGLTHLGSADIRSAMHAK
FT                   AQADESELTDSMRMFKLGVEGGKPAAGEAGAQPEWFYKGDGDCVAAPEAPIPVPAFAED
FT                   AGEEPELAGLYVIGDDGRPWRVGYAIGNEFSDHVTERFNYLWLAHSKLRHCSFGPELLI
FT                   GELPEHLEGTSRIVRDGKTLWEKPFLTGEVNMAHSLTNLEHHHFKYPGFRRPGDVHVHF
FT                   FGTATLSFADGIQTCNGDCFEIALPAFGRPLRNPLSFEYGVIDMPVHSL"
FT   CDS_pept        complement(47583..48542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1041"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1041"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40924"
FT                   /db_xref="GOA:E1V487"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037405"
FT                   /db_xref="UniProtKB/TrEMBL:E1V487"
FT                   /protein_id="CBV40924.1"
FT                   /translation="MDRLSSANLCGWLRFKHLTLLTTLAQSRNMHAAARAMHLSQPAAS
FT                   KMLRDLEGYFGFALFDRLPRAMQPTELGEHVIHHAWRLLNDADRLVDDINDLSEGGYGQ
FT                   LLIGAIVAAAPEILPAAIARLKRQRPRLSISLKEQTSDQLLIELEYKRLDLVIGRLTHA
FT                   CQHNQFDFEPLRDEPLRVVVRKGHPLAEGDGMPDLATLSRWPWILHPMTSPMRGVFEAA
FT                   LAEEGVASPNDTVETTSIQVTLQLLQTSDMLAVLPRSVLRRPLESGQYVLLKRIIGKPL
FT                   NYYGIITRRDEPLSIAAQELIEHLRRLAAQSPEDETRQ"
FT   CDS_pept        48753..49886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1042"
FT                   /product="probable oxidoreductase (iron-containing alcohol
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1042"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40925"
FT                   /db_xref="GOA:E1V488"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1V488"
FT                   /protein_id="CBV40925.2"
FT                   /translation="MSSLIHYLTRVRFGRGAIGHLADELEALGIRNPLIVTDRGLTDNG
FT                   MIDTLIIHGGLAGKPAIFDTTPTNPTEIAVEEALSVYRAQECDGVVAIGGGSSIDLAKG
FT                   VALLATHAAPLRQYAAIEGGVERITDKVLPLVAIPTTAGTGSEVGRAALITLRDQRKLG
FT                   FVSPHLIPTLALCDPDLTRSLPPGLTAATGMDAIAHCVETFLSPRENPPAEAIALDGLA
FT                   RATRHLRSVVADGEDMESRSEMMMAALEGALAFQKGLGAVHSLSHALGGLQDLKLHHGT
FT                   LNALLLPAVLRFNAPTCDAKYQRLRTVLELPDKADLAEYFTELTRALDLPTHLGELGVD
FT                   PSMFPQLAQWALEDHSTATNPRAADRMDFQRMLEEAW"
FT   CDS_pept        50121..51098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1043"
FT                   /product="TTT family transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1043"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40926"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1V489"
FT                   /protein_id="CBV40926.1"
FT                   /translation="MNKINKCYLLSGAALLALAMSGSALAAYPEKPITIIVPWAAGGGT
FT                   DATARTIANALEEQLGETVNVVNRTGGSGVVGHTAIAMAEPDGYTLGLITGEINMMHWQ
FT                   GLTQLTYEDYTPIGQINYDYAGVQVASDAPYDGLGDLVAAIGDEPKGTFKASGTGQGGV
FT                   WHLAFAGFLMDQGLEPDRVTWIPSQGAAPAMTELAAGGIDIVPSSVPEARSMIEAGKAE
FT                   SLGIMAPERIDGFPEVPTVEEAIGSDYAIGEWRGIAGPKGMDPEVVETLEKALDTAYHS
FT                   DTYQNFMAQQGFGTEWRDAADFGDLMERMDTKFGKIVEQVGLAK"
FT   CDS_pept        51123..51587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1044"
FT                   /product="TTT family transporter small transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1044"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40927"
FT                   /db_xref="GOA:E1V490"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1V490"
FT                   /protein_id="CBV40927.1"
FT                   /translation="MKDVILGLGFMVMGGVIYGIAQDYPTLPSLQYGPSLFPSLIGGGF
FT                   FIGGLILAIGSARSVVGIVRGADAHRLVDIRGLAVSFLPCLLVIFYVLCSDLLGAALTM
FT                   TLIMVTLMRLRGVSWLLAIGVSVVAAVAITLVFSRYLLIPLPEGQLGLWG"
FT   CDS_pept        51591..53105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1045"
FT                   /product="TTT family transporter large transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1045"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40928"
FT                   /db_xref="GOA:E1V491"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1V491"
FT                   /protein_id="CBV40928.1"
FT                   /translation="MDAFLQGLDLVFNLQTLLVVAAAAVFGVFVGAVPGLTATMAVALL
FT                   VPITFYMDSTPAIAAIVTTSAMAIFAGDIPGTYLNIPGTPASAAYVGESHLLARQGRAR
FT                   ETLGTNLVCSIFGGLFGTLVLVFISPTLAEVALNFSSYEYFWLALLGLSSSIFIAIGSK
FT                   TKAFLSLMFGLLLSTVGLDMMSGTPRFTFGIPDLMAGINFIPVMIGMFALNEIMSFYGS
FT                   RNEERRVRVKGSDAVFGRAPGHLRRYWRNLLRGSTLGTLIGALPGAGADIAAWISYALG
FT                   KSRSKQKEKYGTGHIEGIVDASSANNSGISGAWVPALVFGIPGDSITAIVIGVLYMKGM
FT                   NPGPTIFMEGGGLVYALFIVFFVANLIMLPIGFLAIRCSKVFILTPRKVLMPIILCFCI
FT                   VGAFAINNTIIDVWLMLLVGMVAFVLARCDFPMAPAILGLVLGSTLENSFMSSMLKSGG
FT                   DLLSFVSRPISASLGALVILIWLTPLLTKAYRKWCPIRKDTAARPS"
FT   CDS_pept        53102..54157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1046"
FT                   /product="homolog to lactate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1046"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40929"
FT                   /db_xref="GOA:E1V492"
FT                   /db_xref="InterPro:IPR003767"
FT                   /db_xref="InterPro:IPR036111"
FT                   /db_xref="UniProtKB/TrEMBL:E1V492"
FT                   /protein_id="CBV40929.1"
FT                   /translation="MIRYSHTRLQALLSARFVEAGVSNDVAETTARVLVEGDLLGHHTH
FT                   GVKLANGYLKDLSTGHAGGNPSRLTIERSSPVAALYDGHYLLGPYLVNHALEACAGVAR
FT                   EFGVGMVSLRRSHHIACLAAYLLPLVERGLIPIIMSSDPAVASVAPYGGTRPVYTPNPI
FT                   AIGIPGREQPMLIDVSMSTVTNGTVNKAHASGVRLAHSVILDGYGAPSDDPSAFFGDPP
FT                   GSILPLGGQAFGHKGFALGLMVETLTAALSGFGRKDAPQGWGAAVMVMVIDPVCFGGRE
FT                   AFLDETDYLARRCWESGEVEAGQHVRLPGQAGLTRRDEFLREGIPLPADVVTELEKALG
FT                   GPAMAAEVAAL"
FT   CDS_pept        54183..55079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR2"
FT                   /locus_tag="HELO_1047"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1047"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40930"
FT                   /db_xref="GOA:E1V493"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V493"
FT                   /protein_id="CBV40930.1"
FT                   /translation="MHDIRTIGVLGTGIMGGPMAARLARAGWPLKVWNRSREKAMALAD
FT                   AGDVTLVCEPHAAATDVDALIVMLSSGPVCNEILLGEHGALTAMRPGSLLLVMSSIPVG
FT                   TARQQAGAARRHDIAYLDAPVSGGERGAIEGNLAIMVGGGASAFARAESLLGVLGSPVH
FT                   VGPEGCGQLAKLANQLIVANGIATVAEALLLAERGGADPARVCEALQGGFADSTILRVH
FT                   GQRMLEGYHEPGGPAKWQSKDTRTAMAFADSLALELPVSRLVDRLFNELVEHGDGNLDH
FT                   SALIRELRRINRLPVEG"
FT   CDS_pept        complement(55145..56116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1048"
FT                   /product="GntR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1048"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40931"
FT                   /db_xref="GOA:E1V494"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V494"
FT                   /protein_id="CBV40931.2"
FT                   /translation="MAKTLNEQLYEALSTGITKGHLEPGLVLLEGPIAEIFGVSRSPVR
FT                   QTLARLHDEGMISRFEGRGYLIGQQPAKRVRRSLTAADFRATGGKASIERLDSWRHLSE
FT                   SVERDVVLCSMKGPLELNELQLAKSLGVSRTVTHRILLQLQSLGLIEKVKYSSWEVVPL
FT                   DGKRLNQLYEARRQLEPFMVERASRRMPREDLVGYLARLNDAEERYPDIPGTLLDALEH
FT                   DLHHDVLQMGENREIFTMLRRTRPILLVSKHLLGASVAMPLEDPFFADHRRVFEAMLSE
FT                   RHSQAGHALHTHLARSEAKVQERLKAFHDDGEVAKPSYLNWA"
FT   CDS_pept        complement(56167..57696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1049"
FT                   /product="dehydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1049"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40932"
FT                   /db_xref="GOA:E1V495"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:E1V495"
FT                   /protein_id="CBV40932.1"
FT                   /translation="MELINDRPAVIRLNTHDNVGVAARPLPEGMPVDDRGHVAAHNIDA
FT                   GHKVALSPIAAGGEIVKYGQVIGVASRAIGIGEHVHTQNLEMRERDTTLQGFKPFPRTP
FT                   ITEQERRFDGYHRADGQVGTRNYIGILSTVNCSATVAKMVASSLNESGELAALGYDGVV
FT                   PVTHGSGCAMNTESEGFAFLERVLAGYARHPNFAFVLIIGLGCETNQVKQLVAKSGLDD
FT                   GSRLAYFNIQEAGGTRASVRLACERLVKMARECPSVERRPAPLSHLTVALQCGGSDGYS
FT                   GITANPALGHAADLIVAHGGRVILSETPEIYGAEHLLLDRSVDASVAGKLLERITWWKH
FT                   YTRINGAELNNNPSPGNKAGGLSTILEKSLGAVAKSGSSSLNDVLEYAEPCQQPGFNFM
FT                   DSPGYDPVSVTGQIAAGANIVCFTTGRGSVSGFKPAPCLKLATNTSMFEAMQEDMDINC
FT                   GTIIDGAADIDDVGREIFERIIAVASGKLSASEDLGYGDNEFVPWLVGAVT"
FT   CDS_pept        57999..59303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1050"
FT                   /product="L-galactonate dehydratase"
FT                   /EC_number="4.2.1.146"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1050"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40933"
FT                   /db_xref="GOA:E1V496"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1V496"
FT                   /protein_id="CBV40933.1"
FT                   /translation="MTTITRLDVRDIRFPTSRDLDGSDAMNAAPDYSATYVILDTDSDG
FT                   GHQGHGLTFTIGRGNEVCVAAVRSLASRIVGLDLETITADMGRFWRDLTGGDSQLRWLG
FT                   PEKGVIHLACAAIVNAVWDLWAKREGKPVWKLLADMTPEELVRCLDFRFVSDALTPGEV
FT                   LSILRRNAAGKPDREAHVRDAGYPGYTTSAGWLGYSENKMRYLAREALESGWEHFKQKV
FT                   GGDLEEDRRRAQILREEIGWQRSLMMDANQMWDVDEAVANMRSLAEFAPLWIEEPTSPD
FT                   DILGHAEIRERLAPLTGVATGEHCHNRVMFKQLLQAGAIDYCQLDAARLGGLNEVIVVL
FT                   LLAAKYGVPVCPHGGGVGLCEYTQHISLFDYIAVSGSLEGRLLEYVDHLHEHFVDPVRI
FT                   ERGRYRVPESPGYSITMHADSLERYRFPDGDAWQQ"
FT   CDS_pept        59487..60539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1051"
FT                   /product="TRAP transporter substrate-binding protein
FT                   (probable substrate D-galactonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1051"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40934"
FT                   /db_xref="GOA:E1V497"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V497"
FT                   /protein_id="CBV40934.1"
FT                   /translation="MKTTKMTRLTSLIGSALLSLTALQANAASEMPPIPDISGDVVQAD
FT                   GDFKIKFSIGTTESGAQYRGLEYFEKIVEQRSDGHIQVELFPGAQLGDDLQAVSALQSG
FT                   TLEMTAPSTSPLVSMFPKFALFDLPFLFPRPEVADEVLDGEIGQQMLEEASTNGLVAIG
FT                   WAENGYRQLTNSQQAVSSPEDLAGLKIRTMQNPIHLDIWRTLGANPTPMSFAELFTALE
FT                   QGVVDGQENPWITIQSSKFNEVQDYATESNHVYTPFITLVSERFWNRLPADYQQLLREA
FT                   ATQMGEYERHVSRAMNDQIKQELVDSGMQITELTPEQVKAFQEKVAPVYDNWRDQIGGE
FT                   LIDEVRAVSQ"
FT   CDS_pept        60601..61086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1052"
FT                   /product="TRAP transporter small transmembrane protein
FT                   (probable substrate D-galactonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1052"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40935"
FT                   /db_xref="GOA:E1V498"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V498"
FT                   /protein_id="CBV40935.1"
FT                   /translation="MNVSRPSPGPLALIKTTLEIAVGLLVIGVVFCVAANVFGRFVLNY
FT                   SYAWAEELSRVLFIWLVLLGAGLGSIDGEHVAVDYFKQKASSPLKTLFGLLSIAIIYVV
FT                   CLCILLGFQDQVSGFTSATPMLKIPKTVLYSAMPVMAVLTLIANTLALYHLLRRRPQ"
FT   CDS_pept        61083..62339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1053"
FT                   /product="TRAP transporter large transmembrane protein
FT                   (probable substrate D-galactonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1053"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40936"
FT                   /db_xref="GOA:E1V499"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V499"
FT                   /protein_id="CBV40936.1"
FT                   /translation="MILWSILVGLVICIVIGLPISFGLAAISLFIFFYADYSLSPIVAQ
FT                   AVNGLDSFPLLAIPLFILVGEVMSQGGIAKRLVRLASALVGFIAGGLGQVAVLTSMFFG
FT                   GISGSAVADASAVGSMMIEPMKQHRYSGSLATAIVVAASVVGIIIPPSIPMILFGVVTN
FT                   TSISELFMAGIVPGVLITLGLAVTTFLQARKTGKGQPFDIRELWLALKESVLALLLPVI
FT                   IVGGILSGVFTPTESAAVALIYAIVVSMFVYRSLTLKRFFRLCITTGRLTGVVMLLLAF
FT                   ASVLAWLLTANMIPQQLVVSLSAITENKLLLLLLLSLFLLVVGFFMDLTPAMVVLAPLM
FT                   TPVVVKLGIDPVYFGVLMSFILGLGLITPPVGTVLYVGCGVGRVGMEQLVKSLLPFYLT
FT                   LLLLLAAFLIFPGLILWYQ"
FT   CDS_pept        62365..63792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1054"
FT                   /product="FAD-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1054"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40937"
FT                   /db_xref="GOA:E1V4A0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A0"
FT                   /protein_id="CBV40937.1"
FT                   /translation="MASDPVTLNEFLTERLGAGGVVDDPNDLLRYITDWAGDHRGKPLL
FT                   VARPRTTEEVAEIVAHCHCHGIPMVAQGGHTGLVGGAQPDAERPELVISLERLSRIREI
FT                   DPLNFTISVDAGCVLQSVKDAAMEHDCDFPLSLGAQGSCQIGGNVSTNAGGLNVLRHGM
FT                   MRQLVLGLEVVLPDGRVWNAMHALHKDNRGYDIKQLFIGAEGTLGIVTGAVLKLTPRAQ
FT                   ATRTALVAVPDVAAALALYGQARRSCCDLLSAFELIPRACLELAFEAAPDLPDPFDTVY
FT                   PVYVLLEVAASGSVDLDAMIEHLFEHGTTAGMVLDGVLAGSDAQAERLWQIRERMVEGQ
FT                   QLRGEHLRTDIALPISSLGDFFHTASRAMAARSPETMVIAYGHIGDGNLHFNLLPPADL
FT                   DLAAKKTLLHDLEAALFSLVDDYHGSISAEHGIGRVKQTSFLNGLDATERELFEGIKAL
FT                   FDPDELMAAGRILPRTR"
FT   CDS_pept        63824..64996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylX2"
FT                   /locus_tag="HELO_1055"
FT                   /product="2-keto-3-deoxyxylonate dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1055"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40938"
FT                   /db_xref="GOA:E1V4A1"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A1"
FT                   /protein_id="CBV40938.1"
FT                   /translation="MQSINLRHCLPDDMDHALLVGRAWRETPHPGPAIVVVRGGEVLDI
FT                   SSRIPTMADLLDLDDPVSFARDVSGVSLGSVTTLLSNSLDDDSATTRLLPPCDLQAIKA
FT                   CGVTFAVSLLERVIEEQAGGDPQRASELRREIQTLIGGDLSRIRPGSPQAMALKEKLQA
FT                   RGAWSQYMEVGIGPDAEVFSKAQILSSMGFGDSVGLHPASRWNNPEPEIVLAVDSQGQV
FT                   KGATLGNDVNLRDIEGRSALLLSKAKDNNASCAIGPFIRLLDDRFTLDTIRQAQVSLRI
FT                   EGNDDGFVLEDTSDMREISRDPLELVSQTHGAHHQYPDGFMLFLGTMFSPIADRDGPGQ
FT                   GFTHHLGDSVTIATPSLGALVNRVDRSDQLPPWTYGLRDLFAHLALHDQK"
FT   CDS_pept        65048..66625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1056"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1056"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40939"
FT                   /db_xref="GOA:E1V4A2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A2"
FT                   /protein_id="CBV40939.1"
FT                   /translation="MTLEGKQLIGAQAVSAEGAVIQAVNPATNERLDPGYPAAGKAEVE
FT                   RACELAWAAFDTYRETGLEARATFLETIADEIEAIGEPLIERAVAEAGLPQARIQGERG
FT                   RTCGQLRLFASVVRAGEWLDVRIDPALPDRQPMPRVDLRQRHVALGPVAVFGASNFPLA
FT                   FSVAGGDTASALAAGCPVVVKAHSAHPGTSELVGRAIQRAVQKCELPEGVFSLLYGSGR
FT                   EVGQGLVKDSRIKAVGFTGSRSGGTALMAAAQARPEPIPVYAEMSSINPVFLLPEALKS
FT                   RAAALGEAFVGSLTMGAGQFCTNPGLVIAEKGEGLDAFVAAAGEAVKGAAAQTMLTPGI
FT                   HEAYSKGVESLVASDKAREVARGPVGEGANQCQAGLFVASAKDFLADEALQAEVFGATS
FT                   LVVECADQDEVKRVAEHLEGQLTATLQMDDADAETARGLLPILERRAGRVMANGWPTGV
FT                   EVCHAMVHGGPYPATSDSRTTSVGSAAIHRFLRPVCYQNLPEALLSEALKDGNPAGVSR
FT                   LVDGKREA"
FT   CDS_pept        66731..67471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1057"
FT                   /product="YitL family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1057"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40940"
FT                   /db_xref="InterPro:IPR014464"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR040764"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A3"
FT                   /protein_id="CBV40940.1"
FT                   /translation="MSDSHHRSASRAGHSRREPMRRAREPRASVGDVAYLPVVTVNETG
FT                   AFLDWGHAHDLLLPFGEQRFRPTVGRRVLVMIAEDDRGRPFASQRLDRYLDDHAEGLSA
FT                   GDAVALVIAEQTDLGYKAAVDGRFWGLLYHDDVTRPLRRGQRLKGHVKRVRDDGRLDLS
FT                   LLPTGSARLDAVGETVLKALRESGGYLPLGDKSSAAEIKARLGVSKGAFKQAIGRLYKQ
FT                   GRISLEPTGIRLVPGGNQDSHGTS"
FT   CDS_pept        67623..68582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gshB"
FT                   /locus_tag="HELO_1058"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1058"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40941"
FT                   /db_xref="GOA:E1V4A4"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A4"
FT                   /protein_id="CBV40941.1"
FT                   /translation="MNDRPLKVGVVMDPIADLSYKKDSSLAMLWAAQDRGWSLHYMEQE
FT                   DLFLRDGRAHARWRELEVYRDPEHWYALGESRVAPLAELDVVLMRKDPPVDGRFLDAVH
FT                   LLGFAEREGVLVVNPTRALLECNEKLFAQQFPQCCAPTLVSSRDTEIRAFHAEHGDVIL
FT                   KPLDGMGGSGIFHVGPEGRNLGAVIETLTERGTRQAMAQRYLPEIKDGDTRILLVEGEP
FT                   VPYGLARVPMAGETRGNLAAGGRGVSRELTDRDRWLVEQVQPMIREKGLMFVGLDVIGD
FT                   YITEINVTSPTCVREIDDQRGTDIAGSLMDAISRRLAG"
FT   CDS_pept        68764..69321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="algH"
FT                   /locus_tag="HELO_1059"
FT                   /product="UPF0301 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1059"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40942"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A5"
FT                   /protein_id="CBV40942.1"
FT                   /translation="MQSLKNHFLMAMPHLEDPNFAGTLSYLCDYDEKGTMGVIVNRPLE
FT                   LTLDALFEQLELEGSDSPHRNVPVYYGGPTHKDRGFILHEGGSEDWDSSLQVADDIALT
FT                   TSMDILQALAVGRGPERFLVCLGCAGWESGQLESELKDNAWLTVEGRADILFEVEPEQR
FT                   LGASAGILGVDLNLMTREAGHS"
FT   CDS_pept        69384..69815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yqgF"
FT                   /locus_tag="HELO_1060"
FT                   /product="probable pre-16S rRNA nuclease YqgF"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1060"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40943"
FT                   /db_xref="GOA:E1V4A6"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A6"
FT                   /protein_id="CBV40943.1"
FT                   /translation="MSSQRLILGFDFGTRRIGVAVGNELTRSARALDPLPARDGIPDWT
FT                   RVARLVDEWRPDLFVVGLPLNMDGTESDMSTRARKFGKRLFGRYGIPCEMADERGSTRE
FT                   AKAIARDAGHRGNYRDDGVDGLAAVLILEGWLADQEGLP"
FT   CDS_pept        complement(69812..70456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1061"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1061"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40944"
FT                   /db_xref="GOA:E1V4A7"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A7"
FT                   /protein_id="CBV40944.1"
FT                   /translation="MNLQRAYILLAIFYTVLLAVGVIALLMGGGTTFSLVQLTIGAVTV
FT                   AGLWGYFLGRQVMSWRTWRPFACLLALGIAVNVWLLFTTSPSSAELTWLLANIIFTALP
FT                   TLLLFRYGNRDQDVWATPGELEGGRTLSELLERQGELKVEKRDASRPATVNVRREGEHY
FT                   RASVIRGQGDEEERFEESFQRPSTLAFFIERFTCVEVGDFEEKYRGEKEVA"
FT   CDS_pept        complement(70574..71602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrB"
FT                   /locus_tag="HELO_1062"
FT                   /product="aspartate carbamoyltransferase"
FT                   /EC_number="2.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1062"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40945"
FT                   /db_xref="GOA:E1V4A8"
FT                   /db_xref="InterPro:IPR002082"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A8"
FT                   /protein_id="CBV40945.1"
FT                   /translation="MSSHLLSVDSLSRDDVDHLIRVAARMEPVAQRRKVTRVLEGAVLG
FT                   NLFFEASTRTRVSFHAAFCRLGGSVCDTTGFTFSSMAKGESLYDTSRVMSGYCDAIVMR
FT                   HPEQGSVAEFAQATNVPVINGGDGPGEHPSQALLDIYTIDKEFALRGKQLAGAHILLTG
FT                   DLKFGRTVHSLIKLLSLYAPMRITLVSPPGLEMPQHLVELVASRGHRVETRENLAGDFS
FT                   DVDVVYTTRIQKERFTAEMSEGFSLSRDYTVDKAFMDQRVNDHAIVMHPLPRDSRPDAN
FT                   DLDVDLNGDPRLAIFRQTDNGIPMRMAIFATLLQVEDLVEKDMRDVPWFVPKTVGVDDV
FT                   ER"
FT   CDS_pept        complement(71646..73097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1063"
FT                   /product="YjiR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1063"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40946"
FT                   /db_xref="GOA:E1V4A9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4A9"
FT                   /protein_id="CBV40946.1"
FT                   /translation="MTASTRYDDVADLLARRIAQGTYTVGDRLPSIRELCREQGISVTT
FT                   AQSAYARLEEMGLAAARPRSGHYVLPRPRPRDLPTVSRPAQRPLEVAQWDQVLAMVGSA
FT                   PSADQPRRLGAGTPALDAATLKPLGRLLSGLHRDPDPRDLGYDSLAGHPPLRQQVARLA
FT                   TTSGCLLHPDDVVITTGCQEALAIALRMLAAPGDVVAVDSPSFYGAMQILEAHGLKVME
FT                   IPTDPRRGISLEALELALDQWPIRAIQITPTCNNPLGYTMPESRKRELIRLARRYDVAI
FT                   IEDDIYGDLAFESPRPKAIKAFDDEGRVLLCSGVSKSLMPGLRVGWIAPGRYRDRALHE
FT                   KYVSTGASATQPQRAVAAFIEKGHYQRHLREIARRYQRQRDIMTDWVSESFPDGTRISQ
FT                   PRGGFLLWVELPGPIDTPRLNERLAAERLHVAPGPMFSASGKYRHCLRLNYAERPTASL
FT                   EAAIRRVGELAGEMLEYPDSEATLS"
FT   CDS_pept        73528..74397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1064"
FT                   /product="PhzF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1064"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40947"
FT                   /db_xref="GOA:E1V4B0"
FT                   /db_xref="InterPro:IPR003719"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B0"
FT                   /protein_id="CBV40947.1"
FT                   /translation="MPSPLSRYYLLDVFTDTPLAGNPLAVFLDAGSMEASDMQAFANEL
FT                   NLAETVFVGARQAENDFPIRIFTPSRELPFAGHPTIGTAHLLAAQGLVDTTQPLILRAP
FT                   VGPLEVRFEGELARFTTAVPVEVGASSLGRAAAATLLGLEASAIAGDPVQASCGLPFHL
FT                   IPLDSEASLAKVVPDIGQWTQHVSPSGVDQVYLYVENGESLATRTFIREFAGLKEDPAT
FT                   GSAASALAGYLGTRDRLDDRQWRIRQGVDMGRPSEIIARARRDGEQVRVEVAGQACLVG
FT                   EGAFYPRD"
FT   CDS_pept        complement(74411..75628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1065"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1065"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40948"
FT                   /db_xref="GOA:E1V4B1"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B1"
FT                   /protein_id="CBV40948.1"
FT                   /translation="MLRLTSTATIALLATLTALGPLATDMYLPAMPSMAEALSTGPDEI
FT                   QLTLSLYMAGFALAQLFCGPISDRFGRRPVMIAGFGLFLFASLMCMLASNIETLLIGRF
FT                   LQAFGGATGPVLARAAVRDIFGPIEASRVLSYMASTMALAPALAPVIGAGLLLFFGWQA
FT                   IFTLLALYAVAMLLLLIFAMPEPLPAERRQSIQPSAILANFRMLLTQRTFIGYTLTNAT
FT                   SFAGLFAFLSGSSFVLIDFMGLTPFQYGIGFMLIVAGFFVGSLVSGRYSHRLGRDRLLQ
FT                   YATLMCALAGTAMASLAFAGVYAAWAVIGPHILFLVGFGILMPQSMAGALAPNPQCAGS
FT                   ASSLFGFLQMTVAALIGTLVGQFHDGTSQAMALTIGLAGVLSMASFWCLARPASRQAET
FT                   RPSPAK"
FT   CDS_pept        complement(75801..76445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maiA"
FT                   /locus_tag="HELO_1066"
FT                   /product="maleylacetoacetate isomerase"
FT                   /EC_number="5.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1066"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40949"
FT                   /db_xref="GOA:E1V4B2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR005955"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034330"
FT                   /db_xref="InterPro:IPR034333"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B2"
FT                   /protein_id="CBV40949.1"
FT                   /translation="MTTLYGYFRSSAAYRVRIALNLKNLAYDQAPINLVKGEQRDDAFL
FT                   AHNPQGLVPMLMTDNGIRLTQSLAICEYLDERYPEPALLPGELEERARVRALAQVVACE
FT                   IHPLDNLRVLKYLVNELGVEDDAKQTWYRHWIHQGFSALESMLSRESGSGDFCHGDAPT
FT                   LADICLVPQVFNAERFECDLSAYPRIRRITENARALDAFRLAAPGEQPDAN"
FT   CDS_pept        complement(76465..77484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1067"
FT                   /product="fumarylacetoacetate hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1067"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40950"
FT                   /db_xref="GOA:E1V4B3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="InterPro:IPR041072"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B3"
FT                   /protein_id="CBV40950.1"
FT                   /translation="MKLASLNQGRDGELIVVSRDLTRAVRATDIAPTLQAAIENWDALA
FT                   LRLEQRYAQLNDGQAEAAFELDQTALHSPLPRTYNWADGSAYLNHVQLVRQARGAEMPE
FT                   TFWTDPLMYQGGGDRFIAPTEDIEAVSEEHGIDFEGEIAVITDDVPMGVGAETAADHIK
FT                   LVMLVNDVSLRGLIPGELAKGFGFFQAKPASSFSPICVTPDELGDAWRDGRVHLPLSVH
FT                   LNGDKFGEPEAGPDMIFGFPELVAHAARTRHLGAGAVIGSGTVSNPDANGGPGKPVTDG
FT                   GVGYSCLAEVRMVEKILHGDSKTPFMRFGDRVRIEMFDREGQSIFGAIDQQVVKYQPH"
FT   CDS_pept        complement(77540..78847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="HELO_1068"
FT                   /product="homogentisate 1,2-dioxygenase"
FT                   /EC_number="1.13.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1068"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40951"
FT                   /db_xref="GOA:E1V4B4"
FT                   /db_xref="InterPro:IPR005708"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR022950"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B4"
FT                   /protein_id="CBV40951.1"
FT                   /translation="MTTSLDYQCGFRNHFATEALPGALPQGQNSPQRCPYGLYAEQLSG
FT                   SAFTAPRHHNLRSWLYRIRPSVVQSGYEPLEVGKVATSPLDNPAADPNQMRWDPVPLPE
FT                   APTDFIDGLLSVAVNGNADAQRGCGVHVYACNRDMTERFFYNADGELLIVPQQGGLRLR
FT                   TELGELDVSGGEIAMIPRGVKFQVRLAADCDAARGYICENYGMPFELPGLGPIGANGLA
FT                   NPRDFESPVAAYEDREGDIELVAKFSGRFWTTRLDHSPLDVVAWHGNYAPYKYDLARFN
FT                   TINTVSFDHPDPSIFTVLTSPSDTDGMANIDFVIFPPRWMVAEHTFRPPWFHRNLMSEF
FT                   MGLIHGTYDAKAEGFRPGGASLHNCMSPHGPDAETFEKASAAELTPQYLGNTLAFMFES
FT                   RYVFHPTQTALDADFRQRDYVDVWSTLRSHFDPATR"
FT   CDS_pept        78962..79420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1069"
FT                   /product="MarR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1069"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40952"
FT                   /db_xref="GOA:E1V4B5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B5"
FT                   /protein_id="CBV40952.1"
FT                   /translation="MTDENLSTDFDLEHFLPYRLDRLADRVSEALAQLYEAHYDLNVAQ
FT                   WRVLAWLHHRHELTAKQICAATRMDKARVSRAVQVLEGRGLIVRRPSPRDQRLHDLRLT
FT                   EDGQALMVELVPQVRAWEAELVAPLTTEEYRRLLDMMGRLEQRLQDGE"
FT   CDS_pept        complement(79450..80286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iclR"
FT                   /locus_tag="HELO_1070"
FT                   /product="IclR family transcription regulator IclR"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1070"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40953"
FT                   /db_xref="GOA:E1V4B6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B6"
FT                   /protein_id="CBV40953.1"
FT                   /translation="MTEGRRRTAGRPATGKSSGGHSQSLVRGLNLLERLAGSPGGLALS
FT                   EIAEQSELAPSTTHRLLQALQSQGYVTQDNELGVWKIDVKTFRIGNSFLEARDFVGTSR
FT                   PFLRRLTNQTGETANLGVRDGSTAVFLAQSESPQMMRMITRLGSRAPLHASGVGKALMA
FT                   WLPDDEFERILDERGLARVTNNTLHDPVALRESMAEIRERGYACDREEHAVGLHCVAAC
FT                   IHDEHGTPLAAISVSGPVARIPESRLLELGELVRDAASDITARLGGRVPAPDEIPA"
FT   CDS_pept        80533..81912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1071"
FT                   /product="response regulator/sigma-54-interact/HTH domain
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1071"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40954"
FT                   /db_xref="GOA:E1V4B7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B7"
FT                   /protein_id="CBV40954.1"
FT                   /translation="MQQQDQEHVEGASPDGLTGRLAQAAVLVIDDEPGMRNFLVKTLRL
FT                   YCREVVEAEDVEQAEARMRQASFDVVLLDNVMPGRNGIEWLAERHRQGAIADTIVVTAY
FT                   ADLDTAIEAMRAGARDFILKPVRSNQVLNAVRRCIELGQLKRENALLRHELQSVDIWRR
FT                   RRSELIGDSEEIEEVRRTLDRVTNMPTPILIRGESGTGKEVAARHLHAASERASRPFVA
FT                   VNCAAIPADMLEIELFGHTRNAFAGAEEHREGLLVSAQGGTVFLDEIGELSAAAQLALT
FT                   RVLEDRTVRPVGGEQEVPLDLRFVCATSKDLAHEVAAGRFREDLYFRVNVIEIKMPPLR
FT                   LRGADTLALAELFMSEISRQLGLARLEIDASTRAAILRHRWPGNIRELLNFIERSLIFG
FT                   RFPLETLAPPPETEIETLEVVERRQILDALEATHGNRAEAARRLGVSRKTVDRKCAAWG
FT                   L"
FT   CDS_pept        81914..83923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1072"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1072"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40955"
FT                   /db_xref="GOA:E1V4B8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B8"
FT                   /protein_id="CBV40955.2"
FT                   /translation="MKRVLPAWARSVRVRLLVIALLPMLVLLPLLLGMTVLRWSGKVDD
FT                   LLTVKVNGDLTIAHQYMARLRENSGDRIEALGASVAFAEGMARPETGSASDFLERRRRA
FT                   LGFDFLYVTTRDGRIIPSDTPSGTDFAAQDWPVVRAALEGTTRSAVDIFDHEQLTALAP
FT                   SLAERARVPIVPTRAAVPTSRSVVENGMVLHAAAPVRLPDGRRAALVGGRLLNRNLDFI
FT                   DTINDLVYRDRSLPEGSQGTATLFLDDVRVSTNVRLFEGARALGTRVSAEVRSQVLERG
FT                   EVWLDRAFVVNDWYISAYEPIVDSHGERVGMLYVGFLEAPFRQARISSIILIAVIFLAI
FT                   TAISVPIFLRWARRIFRPLERMNDTIGRVESGDLGARIGTGGGRGEISRVARHLDDLLD
FT                   QVQERDRRLRDWAGELNDKVEERTRDLQEANRRLERTTEQLVMSEKLAAVGEITAGVAH
FT                   EINNPVAVIQGNLDVARQSLGSRVDEVATEFDLIDDQVHRISAIISKLLQFARPGEFSG
FT                   SANRLVPAEVIDDCLVLTRHLSSKAGVTVERDDRSMASILVERTELQQVIINLVVNAIH
FT                   AMPEGGTLTLETEDRDVEGVPGVAIIVTDTGRGMMPEVLKRIFDPFFTTKRSQGTGLGL
FT                   SISQTLMGRAGGWIEAASEEGAGSRFTVWIPAFQ"
FT   CDS_pept        84169..85905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1073"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1073"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40956"
FT                   /db_xref="GOA:E1V4B9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4B9"
FT                   /protein_id="CBV40956.1"
FT                   /translation="MSNANSRGMFSFLMKEHIVAKPGFNRWLVPLASIAIHLCIGSVYA
FT                   WSVFNPALTQQFGVVAPAAGDWDLSSVVWIFSVAIFTLGLAAAFGGKWLEEVGPRMVGV
FT                   VSAFCWGGGFLVGSLGIVSHQLWLIYLGYGVIGGCGLGLAYVSPVSTLIRWFPDRRGMA
FT                   TGMAIMGFGGGAMIGAPLIGYLLNTFAEAPTYLGSADAMNLVTEAGRRFAETANGQVEV
FT                   VVASAAQAAELPGGGEAGVYAVGTGDTGAAATFVTLGVVYFVIMMVASFSYRVPPADWK
FT                   PEGWTPPEERDDKAMITRNHVHINQALKTRQFWQMWIMLCFNVTAGIGVIGVAKTMMTE
FT                   IFGSTMPGIVTAAFASTYVLMISVFNMVGRFFWASTSDYIGRKNTYHCFFVLGTLLYMS
FT                   IPFLASAVSSNPSVIYLAGFYAATMVIFTMYGGGFATIPAYLADVFGTLHVGGIHGRIL
FT                   TAWSTAGVLGPFAITFLRDMSRHNAITELVAKIDPAVFREAFGAPVAQLDALVEANTVT
FT                   IARLMEIVPPGTVDPTSSLYNTTMYAMAALLVIAFFANLFIRPVGERHHVENTHPEAAP
FT                   AK"
FT   CDS_pept        complement(85985..87331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1074"
FT                   /product="NCS2 family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1074"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40957"
FT                   /db_xref="GOA:E1V4C0"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR017588"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C0"
FT                   /protein_id="CBV40957.1"
FT                   /translation="MSTPDAATEANRPKVRSTHDVNAMPPLSRAIPLGIQHVLAMFVSN
FT                   VTVPIIIAGAADLSEAQTTLMIQAAMFVAGVATLVQSLGLGPIGARLPIVMGTSFGFVP
FT                   VLIPIAVGMGVPAALGAALCGGVAMALVGLFLPWVRFLFPPVVTGTFVIMIGTLLMPVG
FT                   FAYAAGGFGAEDFGAAHNLILAALVLVIILGLHQFGRGIWSETAPLIGLVIGFIIAAAM
FT                   GYVDFGSVAQADWFSLPVPFAIGVEFHLAAIVPVVLLAVVTCAESIGDIVGTTSGGMDR
FT                   EPTKKELSGGVMADGLASVFAAIFNAYPQISFSQNVGIVALTGVVSRYVVAIGGGFLML
FT                   AGLLPKLGGLVSGIPNAVLGGTVLIMFGMIASAGIKMLSHIDFNKRNMVIIGVSLSAAI
FT                   GLPAQEGIYVDFSENVKAIIESGLIPGALCAIVLNLVLPRQDRVFRDDV"
FT   CDS_pept        complement(87394..88749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1075"
FT                   /product="8-oxoguanine deaminase"
FT                   /EC_number="3.5.4.32"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1075"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40958"
FT                   /db_xref="GOA:E1V4C1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C1"
FT                   /protein_id="CBV40958.1"
FT                   /translation="MTSNEQTLWIKHPLACSETDAAGGVVVQGSRIIEAIPAGANPQSR
FT                   VDATFDASRHVLLPGLVNTHHHFYQTLTRAYSPALNKELFPWLTTLYDVWANLDEAQMA
FT                   LASELAMVELLMSGCTTVADHHYVFSGALTRAIDIQVETARRLGVRAALTRGSMSVGRD
FT                   DGGLPPQSVVQDEATILDESARLIDAYHERGDGAMVTLALAPCSPFSVSRELMQESARL
FT                   AETRDVRLHTHLAETEDETAYCQRLFGMRPLDYLEATGWLGDRTWLAHGIHFNDDEVAR
FT                   LGAAGTGIAHCPSSNMVLGSGMCRTLDLEAAGCPVGLAVDGSASNDHSNLAEEMRQALL
FT                   LGRLRYSPSQVTHDDVIRWATRGSAACLGRTDIGGLAPGQQADLALFSLDEARFSGADH
FT                   PIAALLLCGAHRADRVMVAGQWRVTEGRPVDVDLDALLARHDEAAAALRRAL"
FT   CDS_pept        89214..89771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1076"
FT                   /product="homolog to spore coat protein U"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1076"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40959"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C2"
FT                   /protein_id="CBV40959.1"
FT                   /translation="MSRWQCVLLFKRGVLIPSLIPSLLAGSAFAQSVTGTVDVSIELAA
FT                   ACEVNGSTATSGVDFGSLEFGSHTTLFSEADSEVLNGGDAIEVLCSPGVTPSFQITGGA
FT                   NDVESGAQNHAMANGSGSFVPYSIYTDAARTSALESGTPYDLSGTADGITPQTLSLYGR
FT                   AYGQPGLAAGSYSDTLNVELSF"
FT   CDS_pept        89789..90304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1077"
FT                   /product="homolog to spore coat protein U"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1077"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40960"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C3"
FT                   /protein_id="CBV40960.1"
FT                   /translation="MAALLVSLTPVQEGVAQTAPQTSFQVAATISEGCLVDSEIPGDGA
FT                   SLGSLGSLDFGTASSLSQQTRTSMLVDTAGVTLSCTPGIALIMRIDGGLHASGGVRHME
FT                   SDAGAGLAYALFADASYQQAIGIDASIAVDTLSDPNNISLPIYGRLTLPGARPSGVYTD
FT                   RLAVTLEW"
FT   CDS_pept        90304..91068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1078"
FT                   /product="probable usher pathway chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1078"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40961"
FT                   /db_xref="GOA:E1V4C4"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C4"
FT                   /protein_id="CBV40961.1"
FT                   /translation="MTMRRRSLALKGLLMAGLLVMALPASAGALLIWPIHPVIENGRSA
FT                   TALWLENRGSEPTLIQLRIFEWQQREGKDQYQSQDDLVGSPPMMEIAPGQQQLVRLIRR
FT                   TPPPPSGEEQAWRVILDEVPTSSASDGPAGQTRAGVELQMRYSLPLFDYGEGAAPEDGA
FT                   EASEVASMLGWRIIRENGRRYLEVRNRGERHARLTEVVFGQGATVTKGLLGYVLADSYR
FT                   RWPLEETTPGDTLFARVNGGETVRLARWSPAP"
FT   CDS_pept        91094..93457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1079"
FT                   /product="outer membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1079"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40962"
FT                   /db_xref="GOA:E1V4C5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C5"
FT                   /protein_id="CBV40962.1"
FT                   /translation="MQRLQRLCRDGLCLGWLAVSPHAVGQDLPPPPVADAAQEREALLH
FT                   LELVLNQRPTGRVVSVTRRGGHLLVTPEAFGAIRLPERLASMEHLDLTYLEEVEAHYDA
FT                   PRQRLEVTVPTAWLPRQQLGGRQAGASSEALSSPGALVNYDLHVSKARQGTTRASLWHE
FT                   ARLFGLGGSWRSSGAWREALESMPDGSSDESAYVRYDTTWRHDDQQRLLSYEAGDVVTR
FT                   PLSWTRAVRLGGVQVSRDFAIRPDLITYPLPSFSGDAEVPTTLDLFVNGNRVERRDIEP
FT                   GPFTLSDVPSISGAGEATLVTEDIQGRREVRTLPFYVTNELLRPGLASFSIAAGALRRG
FT                   YGQRSFDYDEAAASVSQRIGVTDQLSLGGHAELADSLALGGAGVTLGLWRAGTLEMAYQ
FT                   YSDSEFGTAAANSLGYQYRGRNVSLGARHERREAGFADLSDVLARQIPEQARTRTQVTA
FT                   STSLGRWGSMAAGYFEVDDGVSTRLLNLSYQRPLWRNAHLSLSANREIGGAGGWGGLLQ
FT                   VTLALDHGRGVVSAGMDRDAEGNAAQQLQYSRAAPLEGGWGWNLGVRHREGQTVYRQAD
FT                   VRHRGERASWRLGLQGAGEDDTYFGGLSGSAVFMAGRSFLANEVNDSFVVVSTDGEAGV
FT                   PVRYENQTVGHTDEDGYLLVPWGTAYYPGKYEIDPLALPVEVATPEVKRRVAVEPRSGY
FT                   LLSFDLPRRTSASLRLVDADGKDLPLGAKVRSSSGERAVVGWDGMTYLETVSTGMRLRV
FT                   TLPDGSECLAPLSLPDEVSGRLDLASVTCRMEEM"
FT   CDS_pept        93457..94467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1080"
FT                   /product="homolog to spore coat protein U"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1080"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40963"
FT                   /db_xref="InterPro:IPR007893"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C6"
FT                   /protein_id="CBV40963.1"
FT                   /translation="MGNAGVIRLGWRSLVTFCLLLAVVCGTNSALACDVVAPNPLASFG
FT                   VASSLTVAGSAQQTSAQPNAGVECSAPILSVLGSDYVNATITSANGGQLQVATGDTIDY
FT                   DISADPGGEVPLTLGTTYDYYNATLLDLLGLLGSSDPIELPMYFRTLPGSADNVAAGLY
FT                   IDTLTVNWNWSVCEGIGIGGLCLGRDNGSGTSTVTLQLEVLPDCVIDAPDLDFGSAPLV
FT                   AGFSPVTRTLSVRCTKGQAYSVGLSDGQHAASGQRRMASSGEFLRYELYKGASGLSRWG
FT                   RQGAERRDSTQADNAPGNHDGVTAQGFIYRGIIDDAQSTPPAGVYTDTVVVDIEF"
FT   CDS_pept        complement(94509..95759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="HELO_1081"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1081"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40964"
FT                   /db_xref="GOA:E1V4C7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C7"
FT                   /protein_id="CBV40964.1"
FT                   /translation="MAKTSLDKSKIKILLLEGVHQSAVDNFLNAGYTNIEHLSTSLDEE
FT                   TLIEKIRDVHFIGIRSRTQLNERVFAAAEKLVAVGCFCIGTNQVDLDAALVRGIPVFNA
FT                   PYSNTRSVAELVLAEAIMLLRGIPEKSASAHQGGWLKSAKNSHEARGKTLGIIGYGSIG
FT                   AQLSVLSEALGFDVIYYDVVTKLGMGNARQVGSLEELLARADIVTLHVPDLPSTRWMIG
FT                   EEQIGLMKPGSILINASRGSVVVIEALAEALQAGRLNGAAIDVFPVEPKGNNEEFVSPL
FT                   RGLNNVILTPHIGGSTLEAQENIGIEVSEKLVTFSDNGTTITSVNFPEVALPAHPGKHR
FT                   LLHIHENVPGVLSEINRVLSEEDINILGQYLQTNERIGYVVIDVDKEYGPRALEALSKV
FT                   THTLRVRVLYSETSFEG"
FT   CDS_pept        96030..96314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseB"
FT                   /locus_tag="HELO_1082"
FT                   /product="exodeoxyribonuclease 7 small subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1082"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40965"
FT                   /db_xref="GOA:E1V4C8"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C8"
FT                   /protein_id="CBV40965.1"
FT                   /translation="MAGQDKQRQDSEETAPEDFAATVERLEALVERLESGELSLEASLT
FT                   AFEQGVRLTRDAQRRLDEAELKVRTLTEGEEGGIDLKPFASPEEDDGEY"
FT   CDS_pept        96304..97182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispA"
FT                   /locus_tag="HELO_1083"
FT                   /product="farnesyl diphosphate synthase"
FT                   /EC_number="2.5.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1083"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40966"
FT                   /db_xref="GOA:E1V4C9"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4C9"
FT                   /protein_id="CBV40966.1"
FT                   /translation="MNIERLMAADRRRVDECLETLFARGESAPSEQLDAAMRHGVLVGG
FT                   KRLRPVLLYATGRALGASDEALDGPAMAVELVHAYSLVHDDLPAMDDDDVRRGRPTVHR
FT                   AYDEATAILAGDALQTLAFEVLADTGHPRLAAMVGTLARAAGRDGMAAGQALDLDAVGG
FT                   HPDLTALATMHRHKTGALIHAAVRLGGLVAVPEDDERLLALERYAAAIGLAFQIRDDVL
FT                   DVTGDTAVLGKTSGADAARDKPTYPTLLGLKGADDKARSLVDEAVSALAPLGEAGSVLA
FT                   NLARYMIERDH"
FT   CDS_pept        97197..99164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dxs"
FT                   /locus_tag="HELO_1084"
FT                   /product="1-deoxy-D-xylulose-5-phosphate synthase"
FT                   /EC_number="2.2.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1084"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40967"
FT                   /db_xref="GOA:E1V4D0"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D0"
FT                   /protein_id="CBV40967.1"
FT                   /translation="MKLFDDIPVERPATPLLDTLETPAALRAMNEAQLVQVADELRAYL
FT                   LYSVGVSGGHFGAGLGVVELTVALHHALETPHDRLVWDVGHQAYPHKILTGRREAMQSI
FT                   RQFGGLAAFPRRSESEYDTFGVGHSSTSVSAALGMALAARTRGEKRRVCAVIGDGALSA
FT                   GMAFEALAHAGHVDANLLVILNDNEMSISENVGGMASYLAKILASKPYTSMREGGKKVL
FT                   SHLPGALELARRTEEHMKGMVSPATLFEEMGFNYIGPLDGHDLPTLVQTLRNMRDMDGP
FT                   QFLHVKTRKGRGFLPAEADPIGYHAITKLEKNGETPPPFKPTQPAAAPGAKNEATSPKP
FT                   RNDISRPKPRKYCNVFGDWLCDMAAVDERLIGITPAMREGSDLVRFSQEYPERYYDVAI
FT                   AEQHAVTLAAGLACEAMKPVVAIYSTFLQRGYDQLIHDVAVQELDVTFAIDRAGVVGED
FT                   GPTHHGALDLSYLRCVPGMVVLAPADEAECRALLSAAYHHPGPAAVRYPRGTGPGTLIP
FT                   EHLEALPIGKAETRRRAGGEGPKVALLAFGSLNGPAAEVAERLDATHLNMRSVKPLDRE
FT                   AVLAAADEHDLLVTLEENVVAGGAGSGVGELLAAEGRRTALLHLGLPDVFVEHGKPAEL
FT                   LAECGLDAEGIEASIRRRLG"
FT   CDS_pept        99283..100053
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="djlA"
FT                   /locus_tag="HELO_1085"
FT                   /product="co-chaperone protein DjlA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1085"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40968"
FT                   /db_xref="GOA:E1V4D1"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D1"
FT                   /protein_id="CBV40968.1"
FT                   /translation="MLAMVLIGGVLGFLIGGPLGLLIGGGLGYWLVRRLRRSMLGRLAG
FT                   VQAQFLESTFAVMGCMCKADGRVTEAELDASRQLWDRLRLSEEQRAKARADFTRGKSED
FT                   FDLEAELAKIRQIVGSQPALRQVFLQVQLAAIAADGQLHPAERDMLMRVVRGLGCSEAE
FT                   IAQIEAMLRGAAEGGGAPHETSLEDAYQVLGVSSEASDAEIKRQYRRLMSENHPDKLAA
FT                   KGLPENMREVAKERTSEIGNAYERIRKARSADAA"
FT   CDS_pept        100292..101845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1086"
FT                   /product="NhaC family sodium/proton antiporter domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1086"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40969"
FT                   /db_xref="GOA:E1V4D2"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D2"
FT                   /protein_id="CBV40969.1"
FT                   /translation="MSFGPFSLLPPVLAIVLALATRNVIPALFCGVWLGATMLSGGNPA
FT                   AGLYASFNDFIIPSVGDEWSVTVLIYCGLFGVLIMVLQRTGGAQAIARAISERVASRRG
FT                   AQGATLGLGVLIFFEDYFNALTVGSVMRPITDRMRVSREKLAYIVDSTSAPMCLLGPVS
FT                   TWVVFVMGLIGTQLTEMNISGSEYLIYLSSIPLNFYAWLALGLIAFIVITQWDFGPMAR
FT                   AEHRARTTGEVLAKDATPPSDREVAEMEVIPEAQARKRNMLVPIGVLVLMIPPMFLWTG
FT                   NYPENDLVTAVGEANGGLSILIATFVAVVVGLVMGMQQKLFDFRESMDIVVSGIKSMTL
FT                   VYIILTLAWSIGSVTSELGTADYLVTLAEANIAPSLVPVLLFLIGALVAFTTGTSYGTF
FT                   AIMIPIAMPVAMAMDLSLSLAIAAVLSGGIFGDHCSPISDTTILSSAGSSCDHIDHVRT
FT                   QLPYAISAGLAGILAFFVAGLTDSALIGGLAGAGALVTTVVLLRLLWGGVKSRDEALAD
FT                   "
FT   CDS_pept        complement(101945..102235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1087"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1087"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40970"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D3"
FT                   /protein_id="CBV40970.1"
FT                   /translation="MKAKLMTASLLFAALPLAAQADPATERTLQLNEPLAAVSQHAPAT
FT                   QAQADASSDIVAEGGSDAMAKARLKLRAQQQHETHIADSGDSLAPAREATT"
FT   CDS_pept        complement(102359..102994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="HELO_1088"
FT                   /product="GTP cyclohydrolase 2"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1088"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40971"
FT                   /db_xref="GOA:E1V4D4"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D4"
FT                   /protein_id="CBV40971.1"
FT                   /translation="MTIRYIAASRLPTPWATFTMHGFEDEATGKDHVVLTLGEVGDGQP
FT                   VLGRVHSECLTGDALFSMRCDCGYQLQEALKRIAEAGRGVLLYLRQEGRGIGLLNKIRA
FT                   YHLQDQGADTVEANEQLGFSADLRRYDLCLPMLEHLGIDSLRLMTNNPRKVEALTRVGV
FT                   DVVERVGLTTGLNPHNEHYLSTKAGKLGHMMALGDFTPASDVDIERKP"
FT   CDS_pept        103112..104188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="HELO_1089"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /EC_number="4.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1089"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40972"
FT                   /db_xref="GOA:E1V4D5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D5"
FT                   /protein_id="CBV40972.1"
FT                   /translation="MSERMELENDRLLRALARQPVDRTPVWMMRQAGRYLPEYREVRAQ
FT                   AGSFMDLCRDRDRACEVTLQPLERYPLDAAILFSDILTIPDAMGLGLYFETGEGPKFRK
FT                   PVRTPEAVEALSVPDAERDLDYVMNAVATIRRELNGRVPLIGFSGSPWTLATYMVEGAS
FT                   SKDFRHVKAMLYDTPDTMHRLLDLLARAVTDYLNAQIRAGAQVVQIFDTWGGALSTPAY
FT                   EAFSLRYMKQIVDGLIREREGRRVPVILFTKNGGQWLEAQADSGADALGLDWSTELSGA
FT                   RARVGQRVALQGNLDPNVLFAHPRAIRDEVARILASYGSGPGHVFNLGHGISQFTDPER
FT                   VTAFVEALHELSPAYHQG"
FT   CDS_pept        104273..105133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="HELO_1090"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1090"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40973"
FT                   /db_xref="GOA:E1V4D6"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D6"
FT                   /protein_id="CBV40973.1"
FT                   /translation="MSTSLDSGWFTEVFDSQGSAFSLKVTGKLHDVQSDYQHLEVYATE
FT                   TFGNLMVLDGCVMLTDRDNFLYHEMIAHPALFTHADPKRVVIIGGGDCGTLREVLRHPG
FT                   VERVTQIDIDEEVTRAAERFFPALTESNDDPRAELAFIDGVRWVDEAEAESVDVLIIDS
FT                   TDPVGPAEGLFTTDFLRRCHRLLRSGGVMVQQSESPLYHSGSIIHSLRRDMREAGFDSV
FT                   ATLPFPQPVYPSGWWSVTLAGKGREVNDFREQDAREAGLPLDYYTADIHRGALALPPFM
FT                   RRALD"
FT   CDS_pept        complement(105155..105646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1091"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1091"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40974"
FT                   /db_xref="GOA:E1V4D7"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4D7"
FT                   /protein_id="CBV40974.1"
FT                   /translation="MRQFLFPRHPLPRRTLLFCHAIIQLGLLVAGGLWLAPRTPWLADT
FT                   TWLAAWPRLALGGGVLLLAMVGVRLIAELWLLPYHLAGLRPGFAPGDVVTRSFDRRPAV
FT                   HDSERAWTSSARSVSMDDEVIGSARVSQPASRQRHAGNEPTLNPGDGEAEPYSRHEPRL
FT                   "
FT   CDS_pept        complement(105834..106760)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1092"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1092"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40975"
FT                   /db_xref="GOA:E1V4S6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4S6"
FT                   /protein_id="CBV40975.1"
FT                   /translation="MRYTLRQLEVFVAVAQHESVSQAARALALSQSAASTALAELERQF
FT                   DCRLLDRIGKRLKLNALGFQLLPKAVALLDRAEEVEELLRGQQGIGTLDVGATLTIGNY
FT                   LATLLISDFMQRHPGSRVRLQVRNTRTIVDEVRQHELDLGLIEGQCEEDDVITQPWVED
FT                   ELAVFCSPHHPLANQGPVELDRLLREAWIMREQGSGTRLTLEQAARHRRGRFNTLLELE
FT                   HTEGIKRAVESGLGIGCVSKLALRDAFRRGSLVQIPTPELDLSRQFAFIWHRHKYLATG
FT                   MREFLKQCRHMTEGIRSSDQIDLPYYS"
FT   CDS_pept        106906..107682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpr"
FT                   /locus_tag="HELO_1093"
FT                   /product="ferredoxin--NADP reductase"
FT                   /EC_number="1.18.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1093"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40976"
FT                   /db_xref="GOA:E1V4S7"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR033892"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4S7"
FT                   /protein_id="CBV40976.1"
FT                   /translation="MSKFAEEEVLSVHHWNDTLFSFRTTRERSLRFKNGQFVMIGLEVE
FT                   GKPLMRAYSVASPNYEDHLEFFSIKVPDGPLTSRLQHLQVGDKIMVSRKPTGTLVTDDL
FT                   LPGRNLYLLSTGTGLAPFMSLIQDPEAYERFEKIVLVHGVRTVSELAYADFISKELPAH
FT                   EYLGEEISEKLVYYPTVTREDFHTTGRLTDHIRTGKLFEDTGLPTIDPKQDRAMLCGSP
FT                   AMLDETSSLLDELGFNISPRMGDPGDYVIERAFVEK"
FT   CDS_pept        complement(107890..108885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1094"
FT                   /product="TRAP transporter substrate-binding protein
FT                   (probable substrate D-glucuronate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1094"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40977"
FT                   /db_xref="GOA:E1V4S8"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4S8"
FT                   /protein_id="CBV40977.1"
FT                   /translation="MTTRRRFCTWGAGTLLLAGLGVRSSFAAEARTLRLSHNLTTAHSV
FT                   HQAMQVMRDRVLELTDGTLSIDIYPNAQLGNQRESVELVQAGILDMAKTNASELEAFDP
FT                   IFSLLNIPYLFESGEHYYRVLEGDIGRDILGATAGKGFRGLTYYDSGARGFYATRPIES
FT                   PADLKNLKIRVQPSPTAIEMVELMGASPTPLAFGDLYTALQQGVVDGAENNPTALVTAR
FT                   HGEVAKFFTLDEHTRIPDMLVISEASWQSLSSAHRRALRLAAAESMASQKAAWQSASDA
FT                   AVSTAKEEMGVEFIEVDTAAFAERTRPIRDRVASQSSRARRWIEAIEAQA"
FT   CDS_pept        109032..109556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1095"
FT                   /product="TRAP transporter small transmembrane protein
FT                   (probable substrate D-glucuronate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1095"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40978"
FT                   /db_xref="GOA:E1V4S9"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4S9"
FT                   /protein_id="CBV40978.1"
FT                   /translation="MPSVQHSRSLIARSREAANRVLAILLLVIFALLVAVVTVQVLSRY
FT                   LTDSPTIITDEIARFLLIWLGLLGAAYASGAMRHLAIDFLPERLPDIARRWLKIALQAI
FT                   ILLFAGYVMMFGGGELVRQTLANGQTTPMLGIAMGWVYIALPLSGAFIAFFSLLEIVAL
FT                   ARAPHPSGDDV"
FT   CDS_pept        109553..110851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1096"
FT                   /product="TRAP transporter large transmembrane protein
FT                   (probable substrate D-glucuronate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1096"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40979"
FT                   /db_xref="GOA:E1V4T0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T0"
FT                   /protein_id="CBV40979.1"
FT                   /translation="MTLIDSAVLFGTFFLLLALGLPIVFAIGIASLVSIATSFALHDAA
FT                   LIVSQRMLSGLDSFTLLAIAFFILAGALMNRGGIAIRLIDLARLIVGRLPGSLAHCNVV
FT                   ANMLFGAISGSAVASCAAVGSVMTPLQRSEGYDPGYAAAVNIASSPAGLLIPPSSTFIV
FT                   YSLVSGGTSIAALFLAGYLPGLMMGLGLMLVAGIIAKRRGYSADVAERQPILPTLLHAL
FT                   PSVLLMVIVIGGIVAGVFTATEASAIAVIYTLILTMAIYRTITFRALPAIVLEAAMTTA
FT                   IVLPLISVSGAMSWAMSLESIPQQISAALLSLSDNPLVILLLINLILLAIGMFMDITPA
FT                   LLIFTPIFLPIVTQFGMDPVHFGVLMAFNLCIGICTPPVGSALFVGSSIAGVSIGRVGV
FT                   PLLPMFVVLFAMLMAITYLPQISLFLPNLLLGD"
FT   CDS_pept        110875..113244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1097"
FT                   /product="glycoside hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1097"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40980"
FT                   /db_xref="GOA:E1V4T1"
FT                   /db_xref="InterPro:IPR000322"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025887"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T1"
FT                   /protein_id="CBV40980.1"
FT                   /translation="MRFLSDWSLEAVDTDRLVLNAGDRKVVVFVFGETLFRIFVHRHDT
FT                   PRPTRTWSIDPDGTLAWEGRERLSGEGFTPPAWRLTEHEDGISVESERLKLVIARPFKL
FT                   TWYARTDGEWTPIAEDRPTGGVAVARRGNGVEHYLRRYDDERYYGLGEKSGDLERSGRR
FT                   FEMRTLDAMGYRAETTDPLYKHVPFTITRRSDGLAYGLFYDNLATSRIDLGNELDNYHA
FT                   PYRAFRAEDGDLDLWFLLGERVLDVVKEFTRLTGGVAFGPKWSFGYSGSTMHYTDAPNA
FT                   QERLGEFIALCREHDIPCDSFQLSSGYSSIGDKRYVFTWNRDKVPDPAAMVRTFREAGM
FT                   HLIANIKPCLLTDHPAYGDAAEKRLFVTDSDTGDAEVSPFWDANGSHLDFTRQATVDWW
FT                   KGNVDEKLLALGIDSTWNDNNEFEIEDREARLDGFGDPLPASVAKPVLSLLMVRASQEA
FT                   QIAHAPSRRPFLITRSGGPGLQRYAQTWSGDNRTEWPTLRYNQRMGLGLALSGISNVGH
FT                   DVGGFSGPRPDPELFVRWVQNGVMHPRFTIHSWNDDGTVNEPWMYPEVLDAVRDAIRLR
FT                   YRLLPYLYTVAWRAHAELEPMIRPTFLDHEDDPATFEENDEFLLGEELLVATVVEPGAR
FT                   TRQLHLPDNGCGWYAFEGGAWLAGGRQLVVDAPLEHLPLFVRAGGIVATSDRLAHVDPA
FT                   QDDVRALRVYPFVESGSRTVLLFDDDGESTLGEGGGTLVTHVTLSCDANAIRLDWQHEG
FT                   DYRPAYQGFRIELPTGDSRPLYVNGCKVAPGESCPL"
FT   CDS_pept        complement(113309..113647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK1"
FT                   /locus_tag="HELO_1098"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1098"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40981"
FT                   /db_xref="GOA:E1V4T2"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T2"
FT                   /protein_id="CBV40981.1"
FT                   /translation="MKLVTAIIKPFKLDDVRESLSEIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKLEVAVDNDMTEQVIDAITQVANTGKIGDGKIFVTPLEQVIRIRT
FT                   GETDKDAV"
FT   CDS_pept        complement(113803..115044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1099"
FT                   /product="AmtB family transport protein (probable substrate
FT                   ammonium)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1099"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40982"
FT                   /db_xref="GOA:E1V4T3"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR019879"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T3"
FT                   /protein_id="CBV40982.1"
FT                   /translation="MTELAYALDTFYFLVCGALVMWMAAGFSMLEAGLVRSKNTAEILT
FT                   KNIALFAIACTMYLLVGYYLMYSSSAGGILPSLGFLLGGENSVDAVMAGGDDAPYYSAR
FT                   ADFFFQVVFVATAMSIVSGAVAERMKLWAFLIFSVILTGFIYPVSGYWTWGGGWLAEIG
FT                   FSDYAGSGIVHMAGASAALAGVLVLGPRKGKYGKDGAIYAIPGANMPLATLGTFILWLG
FT                   WFGFNGGSELKVSDVTSANNMAQVLVNTNAAAAGGVIAALILAKAWFRKADLTMALNGA
FT                   IAGLVSITADPLSPSALGATLIGGFGGLLVVVSIVCLDKLKLDDPVGAISAHGVVGIWG
FT                   VLAVPLSNGEASFGAQIIGIFGIFVWVFVASLIVWLILKAVMGIRVSEEEEYEGVDLAE
FT                   CGLEAYPEFNVAKK"
FT   CDS_pept        complement(115090..115428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnK2"
FT                   /locus_tag="HELO_1100"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1100"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40983"
FT                   /db_xref="GOA:E1V4T4"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T4"
FT                   /protein_id="CBV40983.1"
FT                   /translation="MKLITAVIKPFKLDDVREALADNGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKVEVAVDDDRLDTVLDAICNAANSGKIGDGKVFVTPLEDVIRIRT
FT                   GERGADAV"
FT   CDS_pept        115721..116062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1101"
FT                   /product="BMFP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1101"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40984"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T5"
FT                   /protein_id="CBV40984.1"
FT                   /translation="MVSQDRISRLAQQIGERLQGASQAPEDVQKGVQQVVKGAFDRLEL
FT                   VSREDFDILMDVLQRTRGRVEALEKQVAALEEALDASAAADEDAEEVREAEVGSDSPEE
FT                   DAGAGETGR"
FT   CDS_pept        116155..117660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="comM"
FT                   /locus_tag="HELO_1102"
FT                   /product="ComM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1102"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40985"
FT                   /db_xref="GOA:E1V4T6"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T6"
FT                   /protein_id="CBV40985.1"
FT                   /translation="MTLAIIRTRAGLGLEAPEVLVEVHLTNGLPGITLVGLPETAVKES
FT                   RERVRSALVNAGFEFPLRRITLNLAPADLPKDGGRFDLPIALGLLVASGQIPPEALAEV
FT                   ECVGELALDGGLRPASGVLPLAMATRQAGRRLIVPRANADEAALAGDLEVLPAEHLLEV
FT                   VAHLLGQETIAAHRLQAPPRRDTSEPDLREVRGQHQARRALEVAAAGGHNLLFAGPPGT
FT                   GKTMLASRLPGILPPLGEDEALEVAAVRSVSGLPLAEQWGRRPFRAPHHTASAVALVGG
FT                   GSRPKPGEISLAHHGVLFLDELPEFSRQVLEVMREPMESGQIHIARANHERRYPARFQL
FT                   VAAMNPCPCGHLGDPRQACHCTAAQIQRYQARLSGPLLDRIDLQVEVPALPAEQLTSRE
FT                   SGEDSATVRERVLAARERQWSRGALNAYLAGPDLEAACALGADDRAWLAEVLERLQLSA
FT                   RAFHRVLRVALTLADLAGAPRPTREHLIEAIGYRQLDRLLKGG"
FT   CDS_pept        117923..118900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="HELO_1103"
FT                   /product="CRISPR-associated endonuclease Cas1"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1103"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40986"
FT                   /db_xref="GOA:E1V4T7"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019857"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T7"
FT                   /protein_id="CBV40986.2"
FT                   /translation="MDDLSPSDLKTILHSKRANLYYLQHCRVLVNGGRVEYVTDEGKQS
FT                   RYWNIPIANTTSLLLGTGTSITQAAMRELAKAGVLVGFCGGGGTPLFAANEVDVDVAWL
FT                   TPQSEYRPTEYLQYWVRFWFDDEKRLDAARCFQLARLDRIEHLWGESRFQRDTGFTPSK
FT                   TELKALLTSSREAIGQAVDTTALLTEEARLTKKLFRLASHATDYGDFTRVKRGQGVDPA
FT                   NRFLDHGNYLAYGLAATATWVLGIPHGLAVLHGKTRRGGLVFDVADLVKDAIILPQAFL
FT                   SAMKGDEEQEFRQACIERLTRTESLDFMIDTLKAVALDLGGPEA"
FT   CDS_pept        118897..122238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas3"
FT                   /locus_tag="HELO_1104"
FT                   /product="CRISPR-associated nuclease/helicase Cas3"
FT                   /EC_number="3.1.-.-"
FT                   /EC_number="3.6.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1104"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40987"
FT                   /db_xref="GOA:E1V4T8"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR013395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T8"
FT                   /protein_id="CBV40987.1"
FT                   /translation="MNVLLVSQCNKNALKETRRILDQFAERRGERTWQTPITLEGLDTL
FT                   RKLLRKTARKNTAVACHWIRGHDHSELVWIVGDAKRFNPQGAVPTNTTSRDILRREDEN
FT                   DWHSGEDILLLASMSALLHDLGKASAAFQQRLQGKLEGRNLYRHEWVSLRLFQAFVGDD
FT                   DDATWLARLAEGRYQEADWLENMERDGLDAEPAAIFRRLPPLAAALGWLIVSHHRLPLK
FT                   PPDDLSNPATRWGSQNVTLQMEQLGDVLSLIDAQWNEISTTQDPQRITPYWTFHHGLPL
FT                   STWRWRERAAKQAKRLLARLSDDTNWLDSPYVMHLSRLCLMLADHHYSSLEDPARRVQG
FT                   EPGYPLVANTVRKTGQPNQLLDEHILGVEKHASTIARALPTVESHLSRLARHKGFRKRS
FT                   EHPRFRWQDQAFDLAQSLRERSQCQGFFGINMASTGCGKTLANGRIMYALADPEQGARF
FT                   SIALGLRTLTLQTGQALRERLHLGEDELAVRVGGSANKALFEHYEKDAEASGSASTQGL
FT                   IDEDAHVVFEGHIDTHPVLRRLGDEPGTRSLIAAPILVCTVDHLVPATESTRGGRQIAP
FT                   MLRLMSSDLVLDEIDDFDINDLPALTRLVHWAGLLGSRVLLSSATLPPALVHGLYEAYR
FT                   SGREAYQHHRGEPGQPVNICCAWFDENDRQHQDCADGDAFSAAHAAFATRRLKRLAENP
FT                   VRRRGELLSLPALGKRPEEIRPGLAELLRTQAAQLHERHHSRDPVTGKRVSFGLIRMAN
FT                   IDPLVDVARSLFQQGACSGQRIHLCVYHSRHPLVMRSEIERRLDRTLQRAEPERVFEQA
FT                   DIRRLLDGSDEADHLFIVLGSPVTEVGRDHDYDWAIVEPSSMRSIIQLAGRVWRHRDKP
FT                   CDTPNIQLLDTNLKHLEDPGRLAFQRPGFETDEAWRLNHHSLNALLVPDEYQIIDARPR
FT                   VLARETLFPRDSLVDLEHQRLVTQMLEPPTQPLTKKERRLGMEPSPPPLGAYSWYAVPR
FT                   MHLTGVLSQRQRFRQPTQTDVALALLPDEGGGTWTLHRVEDGAKRGETLYVAVEESLMA
FT                   RIDLEHEQGERIQPWGADDYLTALADLAEDLDIPLDKAARTFGIVSAPESTHGWRYHPV
FT                   LGFVKK"
FT   CDS_pept        122631..124007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csy1"
FT                   /locus_tag="HELO_1105"
FT                   /product="CRISPR-associated protein Csy1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1105"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40988"
FT                   /db_xref="InterPro:IPR013397"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4T9"
FT                   /protein_id="CBV40988.1"
FT                   /translation="MPTMSGGWQELRELIEAFLKDRFDTKAEKLATDDPKYQALVEQFQ
FT                   RDSWLQDAARRVSQLQVVTHSLKPIHPDAKGSNLYTPPEFLSKHQGVGSHLLPADFDGD
FT                   VVGNAAALDVYKFLKIEYDGKSLLERVLEGDTELARALSDNSEQSQAWMKAFAGITEPR
FT                   GEHASHTRAKQVYWLTGDDAVDDGDFHLLAPLYATSLAHQVFQTINRDRFSDEAKEARK
FT                   AKREGKLGEQEVHDYPNIASQKMGGTKPQNISQLNSERGGNNYLLASLPPAWSSRDIRP
FT                   PLKADSVLSRGGMFGRRKEVRALVGDLKRFLETNPNIDMHTRDLRDDYTAMIMDELVLF
FT                   TMQMHSLEPGWSADENCRLAEEEVFWLDPGRAQEDAEFRKARHAADWPDEIRQRFANWL
FT                   NEALGGKLPLGDVEFRHWKKELGQDASHQRLLDKDRRWMAALVEELDELEELKGREDDE
FT                   "
FT   CDS_pept        124000..124959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csy2"
FT                   /locus_tag="HELO_1106"
FT                   /product="CRISPR-associated protein Csy2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1106"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40989"
FT                   /db_xref="InterPro:IPR013398"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U0"
FT                   /protein_id="CBV40989.1"
FT                   /translation="MSDVKNLLVLPRLRVQNANAISSPMTWGFPAMSAFVGMMHALERK
FT                   LVEADIQVSLDRVGVVCHDTEAQATEGGYTRAFHLTRNPVDKAGNTAAIVEEGRIHLDI
FT                   TLIFAIAGKVVEGERQDIAHQISEMVAGMRVAGGSVMPNRSVAANYQKSAWVALDDEPS
FT                   EREKQFKKLKRRWLPGFSLVLRDDRLAEHTRTLQAQDENATALDAWLDLSRLNHECHVD
FT                   PESEEVRWQVRRPYRGWLVPMPVGYGAISKQFEPGSVENARDTQIPFRFVESIYSIGEW
FT                   ISPHRLTCPEDMLWYVDNDLDAGLYRLNNDYVQRAHRA"
FT   CDS_pept        124977..126008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csy3"
FT                   /locus_tag="HELO_1107"
FT                   /product="CRISPR-associated protein Csy3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1107"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40990"
FT                   /db_xref="InterPro:IPR013399"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U1"
FT                   /protein_id="CBV40990.1"
FT                   /translation="MAKKDDALKTASVLAFERKLDPSDALLYAGQWSQRDALEDWQAVS
FT                   VREKSVRGTISNRLKAKEQDPAKLDAAIENPNLQTVDVATLSHDADTLMARFTLRVLGG
FT                   AGTPSACNNADYQAKLQQAVADYVKTEGFSELARRYAHNLANGRFLWRNRVGAEQVEVR
FT                   IRRMEKGHVDKEWTFDALSLSLRGFESDTHTAELAQDIADALAGERHLILEVIAFAHVG
FT                   NGQEVFPSQELILERGRGDKSKTLYSVDGVAAIHSQKLGNAIRTIDTWYPAPEDGSDLG
FT                   PIAVEPYGSVTTQGTAYRQPKQKVDFYSLLDNWMLKDQVPETEQQHFVMATLIRGGVFG
FT                   EAG"
FT   CDS_pept        126012..126581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="csy4"
FT                   /locus_tag="HELO_1107A"
FT                   /product="CRISPR-associated endonuclease Cas6/Csy4"
FT                   /db_xref="GOA:A0A1R4A442"
FT                   /db_xref="InterPro:IPR013396"
FT                   /db_xref="InterPro:IPR042564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A442"
FT                   /protein_id="SJK83732.1"
FT                   /translation="MDHYLDIRLRPDPEFPASMLMNALYSKLHRALYDLGADDIGISLP
FT                   DHKTGVRTRTPGDRLRLHARKERLEQLMALSWLAGMRDHVETTDIAPVPAAARHCRVTR
FT                   RQFNTGGPSRVKRYARRHDISEDEARQCMSVPAKRKISLPFVQVNSRSSGQRFALFIEH
FT                   GELQDAPMTGHFNHYGLSREATVPWF"
FT   CDS_pept        complement(127152..128090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="HELO_1108"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1108"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40991"
FT                   /db_xref="GOA:E1V4U2"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U2"
FT                   /protein_id="CBV40991.1"
FT                   /translation="MFSHRPALSSTLALLGGATLMAPLAAQADALEQQRQDLEGFQVIA
FT                   HRGASGHAPEHTWPAYDQALAMGADYLELDVHMSADGRLVAIHDTTLDRTTEGQGPVKE
FT                   RSLDELKTLDAGSWFNEAHPEHADDAYAGAEILTLDEVIDRYGQDVRYYIETKSPKDYP
FT                   ELQDALVSKLEAEGLVQSGSVVIQSFSQTSLKEVHDLNPDIPLVQLLWYSPGEDGQTLE
FT                   EWTGVTPSPADITDADFQAIADYADGVGPNYLYDGQPVIDADFIDQAHANGLLVHVYTI
FT                   NEKDQMRQLLDWGVDGLFTNFPDRLKDVREE"
FT   CDS_pept        128217..128837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1109"
FT                   /product="DUF4202 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1109"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40992"
FT                   /db_xref="InterPro:IPR025255"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U3"
FT                   /protein_id="CBV40992.1"
FT                   /translation="MSASSAYQRALDALDALHAEDPRRVEVEGQSSSKELVPKELMPKE
FT                   LWHAGRMSAWLERLEASPDELVRLAVRGQHLQRWQVPRDEYPEGRVGYLTWRRDQGQRA
FT                   GETTAKLMREAGFDEEDAEQVARMIRKQGLGRDAGTQAVEDCACLVFLENYFADFSRQV
FT                   EHDHLIRIVRKTWGKMSPQARELALELPMSDEAREIVEAALRT"
FT   CDS_pept        128948..129226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1110"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1110"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40993"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U4"
FT                   /protein_id="CBV40993.1"
FT                   /translation="MAYHIKTAFRGTNPILQICDVSSGSVRMAWEYPKDDLERGEDPEL
FT                   LAMRREEAIHDLFRRLFLLTTEQYLKGELEPMPGLGAWRRAPRPGAK"
FT   CDS_pept        complement(129299..130555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1111"
FT                   /product="SDF family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1111"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40994"
FT                   /db_xref="GOA:E1V4U5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U5"
FT                   /protein_id="CBV40994.1"
FT                   /translation="MSEQDPTARPNLWQRIPLWQKILAGLVLGVLAGALMGERASLFKP
FT                   LGDIFINAIKMLIVPLVFSTLVVGITAMRDPQKMGRIGLRTIALYLLTTAFAIAIGLLA
FT                   SWIFQPGVGLDMTFDSSVEPKEAPTLVEILVGLVPQNPIDALANGNILQIIVFAIGLGI
FT                   SLTLIGEKGEPVVKVFESFAEAMVKLTNIVMSFAPFGVFGLIAHVAGSYGLEVLLPLAK
FT                   VIGVAYLASVLHVLLVYSGLLALLGRLNPLRYLQGILDALVVAYSSASSSGTLPVSLRC
FT                   ARNNLGVSEGVAGFVLPVGATINMDGTAIYQGVVAVFIAQLLGVDLSMTDYGMIILTGT
FT                   LASIGTAGVPGAGLVMLSIVMAQIGLPLEAIAVIAGIDRILDMARTCVNVAGDLMVTTL
FT                   VGKSEGELDEDVYNAKSWR"
FT   CDS_pept        complement(130703..131464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1112"
FT                   /product="alpha/beta hydrolase fold protein (homolog to
FT                   dienelactone hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1112"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40995"
FT                   /db_xref="GOA:E1V4U6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U6"
FT                   /protein_id="CBV40995.1"
FT                   /translation="MRPIATLTLGSLLLAGFADTALAEETDGQRIDYQVNDEAFTGYLA
FT                   SAPDEARGTVLIVHDWDGLTDYERQRADMLAAEGYDAFAIDLYGKGNRPVETDAKKAET
FT                   ARLYDDRERMRRLTLAGLEEARRQGVAQPTVVMGYCFGGAVVLELARSGQAEDVRGYAT
FT                   FHGGLNTPEGQAYSADTPPILIAHGGADTSISMSDVAALAEELEAAGAPYEIEVYSGAP
FT                   HAFTVIGSDAYQQRADEKSWAAFHDLLGEVL"
FT   CDS_pept        131650..132885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1113"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1113"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40996"
FT                   /db_xref="GOA:E1V4U7"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U7"
FT                   /protein_id="CBV40996.1"
FT                   /translation="MNKRILAMAVAASSVAFTGLAQAEVKIGFLGGFTGGIESLTPPIY
FT                   DGAELAVKQINEQGGLLDGEEIVMPTGDTTCSDASAASNAADRMVNTEEVTAIVGALCT
FT                   GATIAAANNAAVPGGVTMVSPASTAPAVTNIDDNDLVFRTVPSDGFQGKMLAKLLLDKG
FT                   IEEVVVTYVNNDYGSGLDKAFTTAFKEGGGTVAENLPHEDNRSDYRAELGRLSSTGVPN
FT                   LVVLAYADTSGQTVVRQAYESGMFTQFIGADGMVGDSLVKAIGADVLDGMIATRPGSPE
FT                   LPGTEIFNEDAKAAGIDPSAVFAAQAYDAAFLLGLAIEQNGNAERAGLSEALRSVASAP
FT                   GEVILPGEWKKAKELIAAGTEINYEGASGTHEFDENGDVPGVVLEMVVQDGAFTSQGYV
FT                   SEEGEPSEDSGS"
FT   CDS_pept        complement(132994..134313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1114"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1114"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40997"
FT                   /db_xref="GOA:E1V4U8"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U8"
FT                   /protein_id="CBV40997.1"
FT                   /translation="MTQSHPPRQQRADSVAAPRRFPLRESVIFLALLAAVLVVYAAMGS
FT                   AYGTRMLVEAACYAILALGLTIQWGYAGQFNAGVMGFVALGGFCAMFFSIPVNEAFWSS
FT                   ELPGELGLALLYMVAAIVLVVAVSRLDRIGVPKPLRTFITVVLGVVLYMAVISNFREVA
FT                   GQIESRVDFIGGLALPAWFGWIIGGALAGGVGYFIGHVCLGLRSDYLAIATIGIAEIIK
FT                   AFLKNADWLTRGTATVSPLPWPVPGPGDVGFTLARALYLSVTAVIIAAIFFLLHRAYNA
FT                   PWGRMIRAIRDNEVSAAAMGKDINKRRLEIFVLGCILMGIGGAVLASFNSLFDPQGYLP
FT                   LNHTFLVLVMVILGGPGNNLGTIFGAVVVYIIWLMSEPLALFLMQLAVDIGSATFGWDA
FT                   PTNLDSRALQARVFVIGLLISLVLRFAPKGMLPEKVRHHG"
FT   CDS_pept        complement(134310..135317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1115"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1115"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40998"
FT                   /db_xref="GOA:E1V4U9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4U9"
FT                   /protein_id="CBV40998.1"
FT                   /translation="MNELVFFINNVVIAGSVSGSIYAMGAVGVTLIFSIMRFAHFAHGD
FT                   MMTFGAFMVLLLTTLFPQAGAAIGVPTPILMLPLAMVLTAGLAVGIDRTFYRPLRAHGV
FT                   KPIVMVIASLGVTLMLQGLIRLFAGTGGSSLYVDDRKEIFRLPIPIEGVRMPVVITEPQ
FT                   LYLFVLTIICVVALHFFLSRSRLGKAMRAMSDNPDLAQASGINTNTIVAVTWMLAGGLA
FT                   AIAGTLLSLDVTFKPDLSFFLLLPIFAAAIVGGVGHPFGAVAGGFVVGFAESLAVFNWS
FT                   VLLRPFRDSLPEWLALPSNLSFVGTEYKIVVPFFILVAILVWRPTGIFKGKVIT"
FT   CDS_pept        complement(135358..136062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1116"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1116"
FT                   /db_xref="EnsemblGenomes-Tr:CBV40999"
FT                   /db_xref="GOA:E1V4V0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V0"
FT                   /protein_id="CBV40999.1"
FT                   /translation="MPLLDARNVHGGYGGMNILNGVDMAIEANEVGVIVGPNGAGKSTM
FT                   LKAIFGLLNVSQGEILLNGEPIQNQPPNQLVKRGMGFVPQEHNIFPSLTVKENLQMGAY
FT                   LKPDNVKRMLARIYEFFPPLYDKRHQPAGELSGGQRQMVAMGRALMAEPDLLLLDEPTA
FT                   GLSPRYMNEIFARVKEINAAGVGVLMVEQNAKQALGIADRGFVLAAGQNRFTDTGAALL
FT                   ADPDVAKSFLGG"
FT   CDS_pept        complement(136149..136982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1117"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1117"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41000"
FT                   /db_xref="GOA:E1V4V1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V1"
FT                   /protein_id="CBV41000.1"
FT                   /translation="MTGALGCVPRLTTTNNIDGTTMSAIIDVQHVRKAFGGLQVIDDCS
FT                   IQVAQGSVTGLIGPNGAGKSTLFNIIAGALPLDSGQVWLDGEDITNRPANELFHKGLLR
FT                   TFQIAHEFANMTALENLMMVPPRQSGEHLFSTWLKPRAVGREEAEVCRRALEVIDFIGL
FT                   HHVRNELAGNLSGGQKKLLELGRTMMTDARIVLLDEIAAGVNRTLLGDLMRNIERLNRE
FT                   MGYTFLVIEHDMDMIARLCDPVIVLAQGSVMMEGSIEEIRNDKRVIEAYFGADVA"
FT   CDS_pept        complement(136990..138435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1118"
FT                   /product="NSS family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1118"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41001"
FT                   /db_xref="GOA:E1V4V2"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V2"
FT                   /protein_id="CBV41001.2"
FT                   /translation="MSTNNIWTHKGTFLLAAVGSAVGLGNLWRFPYLAGENGGGAFLLI
FT                   YAVTLFAVGVPILIAEILLGRSSRRSPIMGMRFLSRTHGTSRAWESIGWLGAASAFIIL
FT                   SFYSVIAGWALHYTWRMITGSLAGADAATIASGFDALLASPALLTLYHTLFIAASGLIV
FT                   GLGIHRGIENGLRVLMPALLAILLVILAYSAMQGDMNAAARFLFTFQLSDLSVAGWLAA
FT                   MGQSFFTLSLGMGAIMAYGAYMPGEASLSRTALAIVVIDTAVALIAGLAIFALVFGADL
FT                   APDEGPGLMFVTLPLAFAEMPGGSLVGGAFFILVLGAAISSAISMIEPVAAFLVERFDL
FT                   NRAQAVAAMVITSWALGLLSVFSFNVWAEHSPFHELLGLSAFGLLELLTHIFMPLGGLM
FT                   ISLFAGWALTHGEVMKELRTSEGWFQTWRFLVRFVSPAAVAFVFLQAIPQLDGYLLPLI
FT                   GAVVIVGVFAASRIFLAESHQNP"
FT   CDS_pept        complement(138586..138906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1119"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1119"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41002"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V3"
FT                   /protein_id="CBV41002.1"
FT                   /translation="MHKHIDWDDPGANGVLRFYADHPDDTPEPHVGSIITGLYRGTTVR
FT                   VRVEARVEDTSIGDVVALIAPDNGRRQQSVGDLELGDTVRLADTDRAMEPNHPHEDEEE
FT                   QD"
FT   CDS_pept        139068..139412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1120"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1120"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41003"
FT                   /db_xref="InterPro:IPR021719"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V4"
FT                   /protein_id="CBV41003.1"
FT                   /translation="MPLRTLTAATLALMFTGLLAGCAGSASTSNAPPRDEAPKPPTMSQ
FT                   SEDACGAQRLQDHVGDAYTEALGERLEQESGAATVRVKRPGQAYTMEFRADRLDVSLDD
FT                   AGVIQAIRCG"
FT   CDS_pept        complement(139503..141329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="HELO_1121"
FT                   /product="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1121"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41004"
FT                   /db_xref="GOA:E1V4V5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V5"
FT                   /protein_id="CBV41004.2"
FT                   /translation="MIENLRNIAIIAHVDHGKTTLVDKLLQQSGTLDRKAEGQERIMDS
FT                   NDQEKERGITILAKNTAIRWQGPDERDYHINIVDTPGHADFGGEVERVMSMVDSVLLMV
FT                   DAVDGPMPQTRFVTQKAFDQGLKPIVVVNKIDRPGARPDWVIDQIFDLFDNLGASDEQL
FT                   DFPIIYCSALNGVAGPEPDQLTDDMTPMFKAIVDIVEPPKVELEAPFQMQISALDYNSY
FT                   VGVIGLGRITRGSVKPNQQVTIVTKEGNTRRGKIGQVMTHLGLERVQTEEATAGDIICI
FT                   TGIENLAISDTLCDPADVEALPALTVDEPTVSMTFQVNDSPFAGRDGKFVTSRNIRDRL
FT                   EQELIHNVALRVEQGDSPEKFKVSGRGELHLSVLIESMRREGFELAVGRPEVIIREIDG
FT                   VSQEPYEEVIIDCEEEHQGAIMEELGYRKGELKNMNPDGKGRVRLDFIIPARGLIGFRG
FT                   QFLTLTSGTGILTSRFDHYGPLKPDASVERRNGVLVSMVSGKALAYALFALQDRGKLII
FT                   EHGTEVYEGMLVGINNRAEDMVVNPTKAKKLDNMRSSGSDEALVLTPPIRFTLEQAIEF
FT                   LDDDELVEVTPNHIRLRKKLLSENERKRAKKK"
FT   CDS_pept        141528..142412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1122"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1122"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41005"
FT                   /db_xref="GOA:E1V4V6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V6"
FT                   /protein_id="CBV41005.1"
FT                   /translation="MLDIKFYVLIDAIATHGTVHEAAAAIGVTQPAATHRIREMERRLG
FT                   VSLFLREGRRLVLTASGERLVAAARDVLPKLRNAEIEAWQLARHGEPPIRLGIGPYDTL
FT                   SRIVPHLYDHQYGDIDLVSLPMPEMTGALLARRVDMIPMIEVPVQRGLDYRELFEEPLM
FT                   AVMPPSHPYADSDAVPPEVFDRERHFTYSVAPEAGHEFEHFFQPAGIYPSHMVQVESVN
FT                   LILDLVAAGKGVSILSRWAVRDAARSGRVVMRPLAGELPRIPWYLAFADEPRVAEVAIP
FT                   LALLLREQYRQTT"
FT   CDS_pept        142549..143445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1123"
FT                   /product="hydroxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1123"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41006"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V7"
FT                   /protein_id="CBV41006.1"
FT                   /translation="MPTSALRDERSATPQAPGTPSLARLVDLQQYPIDRQESDAYRHAV
FT                   EQVRAQLRQDGCALLSRFIRDDVVETLRQESEALAPLAYYSDNNVNPYVTQDDPSLPED
FT                   HPVRCFQHYTNGFVAKDLIPEDAIVKTLYRDPAFQRFIADCLEEPVIYEFADPIAGLVI
FT                   NVMPDDTELPWHFDTNEFIVSLMTRRPHSGGEFQYAPNIRRPGEENFAAVQRILEGDHT
FT                   EVESLTLNTGDLQLFKGRYSMHRVASAQGQRLCTLLGYAKTPNMMGSLEHTEKIYGRVT
FT                   QAHIDAHNQHRHDNLMG"
FT   CDS_pept        143518..144786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1124"
FT                   /product="peptidase M24 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1124"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41007"
FT                   /db_xref="GOA:E1V4V8"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V8"
FT                   /protein_id="CBV41007.1"
FT                   /translation="MSQIVALADVPRDGRSYVDGDFRRQSIDDELLSRVERYRLDRLRQ
FT                   QMRHHEMDALILFDPINIRYACGVRNMQVYSQRNPARYLYVAADGPVVLYEFSACMHLA
FT                   KDARLLDEVHPARAVMPQYSGPRCPQHTAAFVDDMRSLFARSATQGKRLGIESAPTAAV
FT                   SALGEAGFELIDAAVAVEGAKSIKSLDELSLIHRSVTLTESAMAHMEAALRPGMSENEL
FT                   WSIFNQHVLATGGEYAETRLLASGARTNPWFQECSDKIIAPGELVAFDTDIVGCFGYYT
FT                   DFSRTFHVPGCGGPTQEQKRLYRMAADQLESNIALLAPGMSFREYSRRAWPIPRGYREN
FT                   RYLDIVHGCGMTGEWPLIAHDMDWDDVGYDGDIEPGMTLCVEAYIGHRDGREGVKLEEQ
FT                   VLITERGIDRLSTYGYDDELLGS"
FT   CDS_pept        144816..145685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1125"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1125"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41008"
FT                   /db_xref="GOA:E1V4V9"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4V9"
FT                   /protein_id="CBV41008.1"
FT                   /translation="MKSITSLLVALGALGVATTASADETLTIGTNNWSENIAVSHLWQQ
FT                   LLEERGYRVELTTTGKSIIFSALAQRDIDISLEVWLPNGDAQYLEPYQDRIDVHDAWYH
FT                   GAQDELVVPAYLSDIDTMEDLKANASRFEYQGEPTIMGIESGSAIAGETETAIERYELP
FT                   FRQLNSSSPAMLASLEEAYRKEEPIAVTLWQPHWAYAQYDLKAIEDPEEAYGGGDDIKW
FT                   MSTAGFAEEHPEITDVLDGWYMSHGQLSDLMLTIEDVGSPEEGVRRWIADHPALIEKWL
FT                   GDFEDADA"
FT   CDS_pept        146059..147465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="HELO_1126"
FT                   /product="glutamine synthetase"
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1126"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41009"
FT                   /db_xref="GOA:E1V4W0"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W0"
FT                   /protein_id="CBV41009.1"
FT                   /translation="MSDKTLALIEEHDVKWVDLRFTDTKGKEQHVTIPARDVDEEFFEN
FT                   GQMFDGSSINGWKGINESDMILRPEDGTGFLDPFTEDATLVLRCDIIEPATMQGYERDP
FT                   RSIAKRAEAYLQSSGLGDTAFFGPEPEFFVFDEVHWKADAEGAMYKITSEEGAWATDRH
FT                   VEGGNLGHRPRVKGGYFPVPPVDSFHDIRGVMCSTLEAIGQTVEVHHHEVSNAGQNEIG
FT                   VKFNTLVKKADELQEMKYVVHNVAHAYGKTATFMPKPVVGDNGSGMHVHQSFWKDGQNQ
FT                   FAGDEYAGLSEMALYYIGGIIKHARALNAFTNASTNSYKRLVPGFEAPVMLAYSARNRS
FT                   ASIRIPYTASPKGKRIEARFPDPTANPYLCFAAMLMAGIDGIKNKIHPGDAMDKNLYDL
FT                   PPEEGKAIPTVAESLDQALEALDADRSFLTEGGVFTDETIDAYIELKSEDIERLRMTTH
FT                   PIEFDMYYSC"
FT   CDS_pept        147673..148254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1127"
FT                   /product="DUF4124 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1127"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41010"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W1"
FT                   /protein_id="CBV41010.1"
FT                   /translation="MDRPTIAILLWLVVVNQAMGGQVLYRTTDARGHVFFTDDPARGGE
FT                   PVELAPISVVPALPASSTATRAASSDAAGDAPSRTYDVFTIAAPDDDTTLPTGFAGKVR
FT                   VRLELRPALREGHGLRLLLDGDIVRPAAREPVIELVNLVRGEHRLQAELLDERGRVLRR
FT                   TPEVTLHVQRASVNLPQNPNCPASRGQDDR"
FT   CDS_pept        148427..149473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrB"
FT                   /locus_tag="HELO_1128"
FT                   /product="PAS domain protein / sensor histidine kinase
FT                   NtrB"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1128"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41011"
FT                   /db_xref="GOA:E1V4W2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W2"
FT                   /protein_id="CBV41011.1"
FT                   /translation="MYQRLMEHLTTAVLLLDGGLRLQWMNPAAEALLALSRSRVTGQPL
FT                   PELVVGEEDIGELLAKARDEFHPFTQREARLTLVTGDVLTVDYTVTPLSRDELLLEVEP
FT                   RDRLLRISREEALQTRQETIKVLARGLAHEVKNPLGGIRGAAQLLERDLESPQLTEFTR
FT                   IIIEEVDRLRDMVDAMLGPNQVERHEPLNIHKVLERVRSLLTVEHPSVTIIRDYDPSLP
FT                   DLVGDESQMIQAMLNVARNAVEAMTESDVPAPSLMLRTRARRQFTLGAERHRLVCEVSI
FT                   IDNGPGIPERLRETLFYPMVSGRAEGSGLGLSIAQSILHQHQGLIECDSAPGHTEFRLL
FT                   IPLEKSHE"
FT   CDS_pept        149466..150872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ntrC"
FT                   /locus_tag="HELO_1129"
FT                   /product="response regulator/sigma-54-interact/HTH domain
FT                   transcription regulator NtrC"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1129"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41012"
FT                   /db_xref="GOA:E1V4W3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W3"
FT                   /protein_id="CBV41012.1"
FT                   /translation="MSEAARVMIVDDDRAIRWVLERALAQPDLEVECVERADRVLPRLL
FT                   EEPPDVLVTDIRMPGIDGLDLMARVREAHPDLPVIVMTAHSDLDSAVASYQGGAFEYLP
FT                   KPFDVDEALALVRRAVAHARERQRPVTPPEGLETEIIGEAPAMQEVFRAIGRLAQSHIT
FT                   VLINGESGTGKERVAQALHQHSPRGSRPFIALNMAAIPRDLIESELFGHEKGAFTGATA
FT                   QRQGRFEQADGGTLFLDEIGDMPAETQTRLLRVLADGEFYRVGGHTPVKVDVRIIAATH
FT                   QHLEELVDDGRFREDLFHRLNVIRIHLPKLADRREDIPRLARHFLAEAAKELATDVKVL
FT                   TEEAEEHLTRLAWPGNVRQLENTCRWLTVMASGREVLVEDLPPELRDGEGGGASGDWRL
FT                   AFRDWADRALAAGHTHLLEEAVPDFEKILIETALKHTGGRKGEAAELLGWGRNTLTRKL
FT                   KTLMPEMAED"
FT   CDS_pept        complement(150962..153154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1130"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1130"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41013"
FT                   /db_xref="GOA:E1V4W4"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W4"
FT                   /protein_id="CBV41013.1"
FT                   /translation="MSFKPLSLAGLLGLSSGVLAFGQPALAAQTFNRIASFSVAKNLEE
FT                   GAAPDSVTSAEIITASADGNTLIYSDSPHGGIGFIDITDPAAPQAGGFMAMQGEPTSVS
FT                   ALHGVALVGINTSESYTSPSGELRAIDVADQQPIRSCQLGGQPDSVAISPDDGWAAIAI
FT                   ENERDEDANDGRIPQMPAGYLMIFPLEQGVPDCDNGRKVALTGLAEIAPSDPEPEFVDI
FT                   NDDNRIAVTLQENNHVVIVDAASGRVVSDFSAGTVDLADIDTAEDGRLSFDERLQGIKR
FT                   EPDAVHWLDTERLVTANEGDYEGGSRGFTIFNADGSVAHESGAAFEHAVAAAGHYPEGR
FT                   SDAKGVEPEGLEVGTYDGQRYIFVLSERGSVVGVYRDTGEAPELVQLLPSGSGPEGAVA
FT                   IPGRQLLATSNEEDLGADGGPLSHVMIYQRAEGDAAYPEITAALDADGKPITGWGALSA
FT                   LASDPEDADRLYAVNDSAYANAPTIYTIDKASQPARITAASVVTRDGEPATGLDLEGIA
FT                   PDGAGGFWLANEGNAEKEIPHALLHVDSQGAIQAQVPLPESVLERQTRYGAEGIVRIDG
FT                   KLWVALQRPWQGDPENTAMLLAYDPATQQWGGVRYPLDRPQGDGWVGLSDLAAKDDALY
FT                   LIERDNQVGEAAHIKQVTRVAFDQLQPAELGGELPTVRKDVVLDLIPLLRDTGGYVLEK
FT                   VEGLTFDAAGQAYVVTDNDGVDDASGETRFFPVALD"
FT   CDS_pept        complement(153301..155118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1131"
FT                   /product="peptidase M24 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1131"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41014"
FT                   /db_xref="GOA:E1V4W5"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR032416"
FT                   /db_xref="InterPro:IPR033740"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W5"
FT                   /protein_id="CBV41014.1"
FT                   /translation="MSREAPTSPAERLAALRDAMREHDIDAWWLPSSDPHNSEYLPEHW
FT                   AGRAWLSGFDGSVGTLVVTRHAAGVWVDSRYWVQAEEQLAGSGIELMKLHPGQGDAPMQ
FT                   WLAENLESGATLGFDANVVTLASARRLEEALSPAGIRLRGDLDLLDSIWPDRPSLPKAP
FT                   LYAHDSTYLDESRAERLARVREAMAEHEADWHPISTLDDIAWLTQLRGDDVDFNPVFLA
FT                   HLLIGRETATLFVAPGKLDDTLRESLAGDGIQVAPYADWASRLAELPETSRVLVDPARL
FT                   TLGTRQALPDGATLVEAFQPSTLAKGRKSDSDLEHVRHAMEEDGAALCEFFAWLEDALA
FT                   RGETVTELTVDDKLTAARAARPGFVSRSFSTIAAFNANGALPHYHATPEAHATIEGNGL
FT                   LLIDSGGQYPGGTTDITRVVPVGEIDAAHRDDYTLVLKGTIALSRAHFPRGIPSAQLDA
FT                   IARAPLWTSGRDYGHGTGHGVGYFLNVHEGPQVIAWHAPVAAHTAMQPGMITSIEPGVY
FT                   RPGKWGIRIENLVANRPAAESEFGDFLRFETLTLCPIDTRCIEPSLLDASEIDWLDAYH
FT                   AEVRERLAPKLEGDALAWLEKRTQPLARG"
FT   CDS_pept        complement(155122..156693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1132"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1132"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41015"
FT                   /db_xref="GOA:E1V4W6"
FT                   /db_xref="InterPro:IPR000109"
FT                   /db_xref="InterPro:IPR005279"
FT                   /db_xref="InterPro:IPR018456"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W6"
FT                   /protein_id="CBV41015.1"
FT                   /translation="MHSTSPTPDSASRSDNGFFGHPRALGSLFFTEMWERFSYYGIRPL
FT                   LVLFMAASLYDGGLGFSRADASAIVGIYAGAIYLSALPGGWLADNWLGQRRAVWYGSIL
FT                   IALGHLAIALSALWGATMFFIGLLLIVLGSGLFKTCITVMVGGLYDEGDPRRDGGFAIF
FT                   YMGINIGGLLAPLFTGLLMREHGWHWGFGIGGLGMLAALLIFRLWAIPAMRRSDTLRGR
FT                   EASWDAPAVRRRGVGRVVAALSALTALFVALVATGVITLDPVAIAEGMTSVIIVCALAF
FT                   FIYLLCFAGLDNRERARVVVAFLLIVASAFFWASFEQQPTSYNLFAHDYTDRALFGWEI
FT                   PTVWFQSFNAIFIVLLGPLFGWLWPALGRRGLEPSSAAKFTLGLLFAAAGFGLMMLAAR
FT                   QVISGDTLVSPLWITASLLLLTLGEMCLSPVGLSTMSELAPMRIRGQLMGLWFTSLALG
FT                   NLVAGLIGGHVNADELQQLPDLFGRSALALVLCALVLALLTPLIKRMLKGGMNAEPTQP
FT                   THSTGA"
FT   CDS_pept        157061..158020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgL2"
FT                   /locus_tag="HELO_1133"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1133"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41016"
FT                   /db_xref="GOA:E1V4W7"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W7"
FT                   /protein_id="CBV41016.1"
FT                   /translation="MSATASAEHLPRRVTITEVGPRDGLQNEPVVLRTAEKLELVHALL
FT                   NAGVTAFELTSFVSPRAVPALADADELTAALRDRRDVHLSALVPNPRGAERALAAGVDA
FT                   VVLFVSASETHNAKNVNRSVEASLEGFEAVARTLEGSGIELRGAIATSFGCPFEGDVAV
FT                   GDVGRIAQRFASLGVRHVSLGDTTGMATPPLVTERIRHLREVAPEIVPTLHFHNTRGIG
FT                   LANVMQGLALGVDRYESSIGGLGGCPFAPGASGNIASEDLVYLLDEMGIDTGLDLGGMI
FT                   EAARVATRLMGRSLPAQVSKAGPRLALSDCAAVPTARG"
FT   CDS_pept        158023..159228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1134"
FT                   /product="CoA transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1134"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41017"
FT                   /db_xref="GOA:E1V4W8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W8"
FT                   /protein_id="CBV41017.1"
FT                   /translation="MSDTPPHAEGALQGIRVIDLTRVISGPFCTQMLGDHGAEVIKIEP
FT                   PGRGDIVRSQGNMVNGFSWYFAQFNRNKRSLTLDLRQEEGRAVLIRLLEDADVLVENFR
FT                   PGVMGKMGLDDATLRERFPHLVVGRINGFGSTGPYRDRPAYDFIAQAMSGFMGVNGPAD
FT                   GEPMRAAPPISDMVASQNLAFGISAALVRRERTGQGDIVETALTNGLISMMGYLAAEYF
FT                   ATGEVPRRTGNDHPMLYPYGLFQASDGEVAIAPSNDIMVERFLGALDMRSLLDDERFAD
FT                   NRRRMANREALREILNRVIERHSVAEWIAHLNEAGVPCGRVQNLRETFEDPQVQAQQMA
FT                   LELDQGEHGKVPTTGFPVKMSEAPAALHHPVPGLGEHSEAILAELGLSDAELAELRDKG
FT                   VT"
FT   CDS_pept        159294..160292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1135"
FT                   /product="TTT family transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1135"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41018"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4W9"
FT                   /protein_id="CBV41018.1"
FT                   /translation="MPISTHKTLRSLGASAVLGLGLAISLPSQALPIDECIAPADPGGG
FT                   WDFTCRSVGKLMRELDLVDGSVQVTNMPGGVGAVAFSNVAGKRADDSNLIVATSTVGVT
FT                   QIAQGRYPGGADTMRWLAMLGTDVGVILVDDESPYETLDQLLQAIVDDPASVAMAGSSG
FT                   AGGWDHIRALRLAKAAGLPGDRIGSLRWVQFDGGGPAVTQMMGGHVDAVSTDLGEIAGF
FT                   IESGDVRVLAVLAEEPLPEPFEELPTAVSQGYDVTGYNWRGFYTGGEVSDEDYAAMVDT
FT                   LKTLYESDEWKDVAAQNGLVPLWRGGKEFNDFVRESIDDVEAISREIGVIQ"
FT   CDS_pept        160289..160753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1136"
FT                   /product="TTT family transporter small transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1136"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41019"
FT                   /db_xref="GOA:E1V4X0"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X0"
FT                   /protein_id="CBV41019.1"
FT                   /translation="MSEAVSSERADLGDRIAGAVLAVLALGAWWHAGSFVTGFMQPVGP
FT                   GVFPRLVSVPLGLLALYLIVRPGLNHRWPGAAALCRQLGVLLLLGAYAAFLEPWGFVPS
FT                   TLVATVVLMRLFGARWRQALPYGVLLGLALYVLFEFALGIPLPDMPGLSV"
FT   CDS_pept        160763..162259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1137"
FT                   /product="TTT family transporter large transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1137"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41020"
FT                   /db_xref="GOA:E1V4X1"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X1"
FT                   /protein_id="CBV41020.1"
FT                   /translation="MEILDFLAHGFAVALQPEHLLLALIGCTIGTLIGALPGLGPVNGV
FT                   ALLIPLAFNFGLAPTSAMILLVSVYYGCMYGGRISSIVLNIPGDEPAMMTTLDGYPMAR
FT                   AGRGGEALGLSAVASFVGATVATIGLTLFAPLLVQVAIRFGPAEYFALFVLAFATIGGV
FT                   TSGSFTKSFIAACLGLLLGTVGIDPVSSVARYTFGWYELYDGIDYIVALVGLFAVSECL
FT                   LFLERDHDKATASLRIGSAIPGMRRSVACASTIGRGSVIGFISGVLPGAGASLGSFLSY
FT                   VLEKRWWGARGKFGEGDPRGVAAPEAGNNAAAGGALIPMLSLGIPGSGTTAILLALLLS
FT                   MNITPGPLLFEQQSDMVWGLVAALFIGNVMLLVLNIPLVGLFAKVLQAPSWFLMPMVTL
FT                   VAFVGIYSLNNSPFDLYMMLAFGVLGYVLRKLDIPTVPVVLGLLLGGQMEFNLRRAMSI
FT                   SGGEWSILWNSGISIGIYLFAVTLLMAGLVYALLIRKRLE"
FT   CDS_pept        162333..163670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1138"
FT                   /product="deoxynucleosidetriphosphate triphosphohydrolase"
FT                   /EC_number="3.1.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1138"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41021"
FT                   /db_xref="GOA:E1V4X2"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023293"
FT                   /db_xref="InterPro:IPR027432"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X2"
FT                   /protein_id="CBV41021.1"
FT                   /translation="MTQMTWERLLDPARLHDERGVARGEIGRSPFHKDHDRIVFSGSFR
FT                   RLGRKTQVHPLTDNDHIHTRLTHSLEVGCVGRSLGMSVGEELRHRLPADITPADLGVIV
FT                   QAACLGHDIGNPPFGHAGEYAIRDWFKRAEADGSGLLEGLSDMEREDLLTYEGNAQGFR
FT                   IVTQIEYNQFRGGMRLTGATLGTLLKYPWTVAHGGAAGKFGCYQSELPLLQQVAERLGL
FT                   LPQGENRWCRHPLAWLVEAADDICYALLDLEDGLEMGILRFEEVAEVLIQIAGGEPPDY
FT                   ATMQSEGVSQRRRIAALRGAAMEQAVNEVAKVFVQHEGELLNGTLRHDLLELCHPDLDW
FT                   GVKSAKDLARKRIFRNERKAKLEIGAYTTLGILLEAFIGAAHELHHTGHSNFKHQRVLA
FT                   LIGENTPLPSWTLYDSYRRMLDFIGGMTDHYAVDLAQEMGGRLRGD"
FT   CDS_pept        complement(163683..164492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1139"
FT                   /product="RimK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1139"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41022"
FT                   /db_xref="GOA:E1V4X3"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X3"
FT                   /protein_id="CBV41022.1"
FT                   /translation="MKLITFDVFRTLGIPGVRYIKPERMFDHIEEIRQADWLLFPEYWQ
FT                   VNSLLYGLGARIFPSPASYHLGHDKVEQTRAFLALAPEHVPPTEILGTSPASLAKVEAR
FT                   FGYPFIAKRIKSSMGEGVRLIASRQELLAHVAEETVLYAQQRLPIDRDLRIVLVGGELI
FT                   AAYWRVTPLGGYRANVSQGGSIERTAIPEAAIDLARRLARELDIDHAGFDIAMVDGHPY
FT                   VLEFNRLFGNQGIADSSKRIGAAVLRVLGAQDDDRDPDGEPPLRLTA"
FT   CDS_pept        164584..165315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rna"
FT                   /locus_tag="HELO_1140"
FT                   /product="ribonuclease I"
FT                   /EC_number="3.1.27.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1140"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41023"
FT                   /db_xref="GOA:E1V4X4"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X4"
FT                   /protein_id="CBV41023.2"
FT                   /translation="MLLLGASPARAEVPSIEAQGFDHYTLALTWHPGFCASRSRPPREC
FT                   RDPGLRRGTEEGFVLHGLWPSLPQRLRERGVERRRWWRQGCFIERPRPDGGFCRHPSLE
FT                   LSDELTRELDGVMPGRASCLGRYQYAKHAACLDVTAEDLFDTSVALVEAVNASAFTDFL
FT                   VIHRGGEVRRNALIEAFEAAFGKGTGRALRLECAGRGNRLLTEVRIGIAARSLENFPAA
FT                   DSLVRLDRGNCATRVRIAAFD"
FT   CDS_pept        complement(165293..166201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1141"
FT                   /product="NERD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1141"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41024"
FT                   /db_xref="GOA:E1V4X5"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X5"
FT                   /protein_id="CBV41024.1"
FT                   /translation="MAWLEYLLPLIFLFPLVATAVIVVGLRNLHDARVSSPFDAHRLRE
FT                   PGQSLRDRLDRAFASLFLNGALGPIITLVPLVYGMGRMIFARQQNWLEWGIYGALSTLL
FT                   VLVFCLRLIRDFQRIRRLKLGLACELAVGQELARLIRPEAHPYYVFHDVPGAGDDTLDH
FT                   VAVTPHGVFAIETRARTPAVLPSGEERNVVVVESERLRFPGWKERRPLRETRRAVRWLA
FT                   SWLEREVGQAVPVQGVLALPGWHIEDATAASDLLVVSGEDLADQLPQRHPGELDAATHD
FT                   AVIRALRQRIATTALNRTPQS"
FT   CDS_pept        166277..167155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npdA2"
FT                   /locus_tag="HELO_1142"
FT                   /product="NAD-dependent deacetylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1142"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41025"
FT                   /db_xref="GOA:E1V4X6"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X6"
FT                   /protein_id="CBV41025.1"
FT                   /translation="MGNRGDGMAHEEIEALAAFMTRTPGLAVLTGAGVSTASGIPDYRD
FT                   DEGDWKRSPPMQHQVFMDSHAARQRYWARALVGFRALHEARPNPAHRALAELEARGLVT
FT                   GVITQNVDGLHRRAGSRRVIDLHGRADVVRCMACGARRMRHDLHDELGELNPDWLELGA
FT                   SVGPDGDADLERDFSDFRVPSCQRCGDGIWKPDVVFFGDSVPRDTVTEAFSLLDECRGL
FT                   LVVGSSLMVYSGYRFARRAARDNKPMACLNLGRTRADDLFDLKVTASAETGLTALAEAL
FT                   EEMAPRPADQA"
FT   CDS_pept        complement(167389..167763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yciH"
FT                   /locus_tag="HELO_1143"
FT                   /product="SUI1 family protein YciH"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1143"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41026"
FT                   /db_xref="GOA:E1V4X7"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X7"
FT                   /protein_id="CBV41026.1"
FT                   /translation="MASLQDQLHGLVYSTEHGDTCPECRQPLDDCRCAEAAEEERLATL
FT                   DGIVRLRRETKGRKGKGVTLVEGVPLKTEELKALAKALKKRCGTGGALKDGVIEIQGDQ
FT                   REVLKGELEKQGFKVKLAGG"
FT   CDS_pept        complement(167864..169045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1144"
FT                   /product="flavin-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1144"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41027"
FT                   /db_xref="GOA:E1V4X8"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X8"
FT                   /protein_id="CBV41027.1"
FT                   /translation="MKRRPYAGTDYRRALNIADLERIARRRLPHFVYEYLQGGADDERT
FT                   LRHNRDAFDNYLFEPRTLTRVGPRDLSTTLQGRPHALPLVIGPTGYNGMLTRHGDIKLA
FT                   TAASRKGIPFVLSNVATTSLEDIAALEGLDAWMQIYFYRDRDYVRKLVERCRSAGYSTL
FT                   VVTTDSAIYGNREWDLRNFRKPMQPTLRNLFHLVSRPRWIADVLVPDGMPTFKNLGDLL
FT                   PPGKQSVQGASAIIGQQLDPTLNWDDIAWLRDLWPGRLIVKGILAPAEAERAAEIGVDG
FT                   VVLSNHGGRQLDHALSPMDVLPEARSRAGKRCQLFIDSGFRRGTDVVKALALGADAVWL
FT                   GRATLYGLAAGGQAGVEHALDILHREIDRTVGLLGVDRIDDLDASVLARHRGR"
FT   CDS_pept        169180..169917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspR"
FT                   /locus_tag="HELO_1145"
FT                   /product="GntR family transcription regulator RspR"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1145"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41028"
FT                   /db_xref="GOA:E1V4X9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4X9"
FT                   /protein_id="CBV41028.1"
FT                   /translation="MNTTLQALWQETRDSDSVRQRLHEVLRQSIIRMELAPGQALSEKE
FT                   LAETFAVSRQPVREAFIRLSEAGLVEVRPQRGTFVVKISQQAVLEARFVREAVEVAVAR
FT                   EAANRGLAPPVLAELRELIERQRRCSEPADHDRFFLLDESFHRTLSLGIGQQAAWKVTE
FT                   EVKAQLDRVRYLSVPESTPIDKLIEQHVAIVDAIEWRDADAAAEAMRIHQSEILQSLPD
FT                   LVRRFPEMFQSARTPSLAEETQA"
FT   CDS_pept        169914..171125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspA"
FT                   /locus_tag="HELO_1146"
FT                   /product="mannonate/gluconate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /EC_number="4.2.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1146"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41029"
FT                   /db_xref="GOA:E1V4Y0"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1V4Y0"
FT                   /protein_id="CBV41029.1"
FT                   /translation="MKIERAYTIVTAPGRNFVTLKIVTDEGTYGIGDATLNGREMAVVA
FT                   YLEEHVIPALIGRDPQRIEDIWHYLYRGAYWRRGPVTMSAIGAVDMALWDIKAKVAGMP
FT                   LYQLLGGKSRERVMVYGHATGKDIEACLDEVARHVEEGYRAVRVQAGVPGIASIYGVAK
FT                   KPGERYEPADAELPAEHVWNTAKYLNHAPKLFAAVRERFGDDLHVLHDVHHRLTPIEAA
FT                   RLGKEVEPFNLFWLEDCVPAENQESFGLIRQHTTTPLAVGEVFNSLYDAKALIENQWID
FT                   YIRAPLTHAGGITHVRRLADLAGLYHVRTGFHGPTDLSPVCLGAAIHFDTWVPNFGIQE
FT                   YMPHEAVTDEVFPHDYRFEDGHFLVGETPGHGVDIDEEKARKYPYRRASLPVNRLEDGT
FT                   LWHW"
FT   CDS_pept        171138..172160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspB"
FT                   /locus_tag="HELO_1147"
FT                   /product="L-gulonate dehydrogenase"
FT                   /EC_number="1.1.1.380"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1147"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41030"
FT                   /db_xref="GOA:E1V4Y1"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y1"
FT                   /protein_id="CBV41030.1"
FT                   /translation="MQAFQVNAPQDYRLVETEIPDAAPGEVLVRVAFAGICGSDMHIIH
FT                   GDNAFVRFPRITGHEFAGLVEAVGEGVEGVAIGDRVCVDPVISCGRCYPCRIDRPNVCT
FT                   ALEVIGVHRNGGFEERVNVPAGNVHRLPEGLGLDAAALVEPYTIAANVLDRMQPHPGDR
FT                   LLILGAGVIGLTILQVARALGIEDVTVSDVIDARLATARELGATRTFNGAEQDVEAEIQ
FT                   ALTDGEGMPLIADAACVPALLPQMLRMASPAGRIGLLGFTPTPSDLSQLEVIKKELTLV
FT                   GSRLNNRKFPEVIELMASGRLDPLALISHRLPFDDMPGAIEMLDHHPERARKVLIQIGA
FT                   "
FT   CDS_pept        172230..173198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1148"
FT                   /product="TRAP transporter substrate-binding protein
FT                   (probable substrate D-mannonate/L-gulonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1148"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41031"
FT                   /db_xref="GOA:E1V4Y2"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y2"
FT                   /protein_id="CBV41031.1"
FT                   /translation="MIKRLLTSAVLGAAILGSQASLAADYTLKFGHLANEEHIWHQAAV
FT                   KFKEEVEANSDGQIEVQLFPNEQLGAEMDVINSIQLGTADMTITGESLQNWAPKAAMMA
FT                   VPYAFRDSAHLKKAVEGEIGDQIEAQITERANLVPLAWFERGPRQLTSNRPITSPDELD
FT                   GLRLRVPNVPLFVDTWEALGARPTPMAFSEVFTSLQQNTIEGQENPLSLIESASFDEVQ
FT                   DYVNLTGHVRSWIYVVIGKNKLASLPEDLQQVVRDAAQEMQSYEAGLFETDQKRLRESL
FT                   EERGMEFVEVDTEAFAEKARPAVLESLSDEQRELYEAIQDL"
FT   CDS_pept        173274..173858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1149"
FT                   /product="TRAP transporter small transmembrane protein
FT                   (probable substrate D-mannonate/L-gulonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1149"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41032"
FT                   /db_xref="GOA:E1V4Y3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y3"
FT                   /protein_id="CBV41032.1"
FT                   /translation="MDPNHKVAEQEALEQLDPLASVPTFQGALGRLIGWVDTLFTVLAV
FT                   LALVAIAGTVLLQIAARLFLPFSVSWTEELSRYLFIYMVALSVGVVLRQHRNVSVELFH
FT                   HTLGLRARAVFQVLICLLVVGFAWMVLPHAWQYAMNGAWQTSPTLKVPMLYIFFSTVVM
FT                   FALLLVYGAIGFLEGLVAIFRSPERPDAETP"
FT   CDS_pept        173858..175138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1150"
FT                   /product="TRAP transporter large transmembrane protein
FT                   (probable substrate D-mannonate/L-gulonate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1150"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41033"
FT                   /db_xref="GOA:E1V4Y4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y4"
FT                   /protein_id="CBV41033.1"
FT                   /translation="MEVIILFSTFLVLLLIGMPIAFSLGIASLAYLLLEGISLTVVPQR
FT                   LYAGIDTFVLLCIPGFVLAGNLMNVGNITENIVRFSNALLGHIRGGLGLANVGGSMIFG
FT                   GISGTAVADSASIGSVMIPGMARSGYDKPFAAAVTAASSTVGPIIPPSVPMIIAGSLSG
FT                   VSVGRMFLAGAIPGLLLGLAMMVTVYILAVRRGYPKEARVPFLQLLREARTAFWALLMT
FT                   AIILYGIIGGFFTPTEASIVASLYALVVGMYVYKGLTWRKLPAILTDTVFTSAALLLMV
FT                   GLANLFGWILTSEQIPQMIAGLILTISENPLVVILILNLILLFVGTFMETIAALIILFP
FT                   ALLGVATGVGMDPVHFAVMAVLNLMIGLTTPPVGVCLFVVSGIGKLPMLTVARAILPFL
FT                   FCNLMVLLLVAYVPSISLWLPDLILGQ"
FT   CDS_pept        175170..176654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rspD"
FT                   /locus_tag="HELO_1151"
FT                   /product="fructuronate reductase"
FT                   /EC_number="1.1.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1151"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41034"
FT                   /db_xref="GOA:E1V4Y5"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR023027"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y5"
FT                   /protein_id="CBV41034.1"
FT                   /translation="MQDVTRLPASTGSGRIGIVHLGLGAFHRAHQAVYLERYRQRSGDD
FT                   AWGVSSANLRANVALVDALREAGHRYHVAEYADSERVTAREIGVIEETHFTGQDKSAGR
FT                   DGHWGRDLEALLVRLASPETRLVTLTVTEKGYFLSPASGELLVDDPLIAADIAAPEAPR
FT                   TAPGLLVEALYRRRHAGLPPFTVLSCDNMPDNGKRTRAAVIQLAARRDAELAAWIEREV
FT                   AFPCSMVDRIVPAMTGTDFARLAELGIEDPNAVVGEAFSQWVVEDDFPQGRPAWEADGV
FT                   EMVADVAPFETMKLRMLNGSHSLLAYLGALDGIETVAEAVSRDDLVVLLRRYMLDEAAP
FT                   TLAMPEDTDLEAYAEQLLERFANDSLRHRLQQIAMDGSQKLPQRWLHGAQARLAVGGDI
FT                   SCTDLGVAAWIRYTAGADLAGRSHAVDDPLAERLADLHARHGDDVAALVPAFLAVEDVF
FT                   PPGLAAEPRFAEAVMAAYTTLTQQGLAGALAALARA"
FT   CDS_pept        176670..177848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uxuA"
FT                   /locus_tag="HELO_1152"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1152"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41035"
FT                   /db_xref="GOA:E1V4Y6"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y6"
FT                   /protein_id="CBV41035.1"
FT                   /translation="MEHTWRWFGPADPITLDEIRQTGATGIVTALHEIPNGETWPVEAI
FT                   AERQRMIEAAGLRWSVVESVPVHESIKKGLPERERYIAAYQQTLRNLAACGIDVVCYNF
FT                   MPVLDWTRTDLAWRLPDGGLALRFDQLAFAAFDLYLLARPGAEDEYSDAERAEARAYLD
FT                   GLDEAARERLVKTVIAGLPGAEEHYTLARFREVIAGYAAIDADALREHLGYFLEAIVPV
FT                   AEETGVRLAIHPDDPPRPMLGLPRVVSGPADIQWLLERVPSPANGLTLCTGSYGVRADL
FT                   DLVEMARRFGPSIHFAHLRATQRDAVEPRTFHEAHHLGGDLDMVGVVQALVDEERRRER
FT                   DGGPRLPLRPDHGHHILDDQQRDTAPGYPLYGRLKGLAELRGVELAVRRLTA"
FT   CDS_pept        complement(178039..180174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1153"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1153"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41036"
FT                   /db_xref="GOA:E1V4Y7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y7"
FT                   /protein_id="CBV41036.1"
FT                   /translation="MTDSKSTVGRNATRLRWSRSTITLLCGTTLVVPLSVNAQEASTVD
FT                   DDGQETYRLAPIIVNAQAIADDNANTTVARELWMGGKVATSIHDTPASVSVITEKEIEQ
FT                   RDADNTEEVLQYTPGVLTGYWGTDNRNDYYKIRGFDATTYRDGMTLGSMRGVREEPYAY
FT                   ERVEVLRGANSTLFGPADPGGSINFVSKRPKFERFGEGYLGYGSFDHREAGIDVGNTLN
FT                   ADRTLAYRFTGKVQDSDREYDYSKNDKQFFMGGLTWEPTAYTTATVIFDYLKRDNTPNS
FT                   GGYPFDKEYDRSNFFGEPDYNFHDVERSSITGMLTHDFDNGLTLRGNLRYSDLTDDYGY
FT                   VYITDSVGRTGTMVDRGYIGRDREAQEVIGNAILQYDTSVGPVDSSTLGGIEYSDSSSK
FT                   TTSVYAPGAPIDVSNPAYQGAPSSLTPYSANDQDNRTRSVFLTQNLSFYDHVIVTVGVR
FT                   NDSMDLSSKDITGTTASDDISETSYRGALTYKITDEVSTYYSYVESIAPPTIGVRPERG
FT                   KQHELGMKYAPLGMDALFSAAVYELNKDNVSIAVVQGDGTIEQETIGESRVRGFDLEAK
FT                   AELTDNLSLTGGYSYMDQEVIRGTLQDGTSIEGNKFATAPKQTASLWTHYSLPDTGASF
FT                   GLGARYVDSYDFDAANTSKSESATLFDASFGYQFTRNADLAINVSNLLDKQYVVNSGTA
FT                   NFYNTGREIKAKVSYRW"
FT   CDS_pept        180500..181504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1154"
FT                   /product="ViuB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1154"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41037"
FT                   /db_xref="GOA:E1V4Y8"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y8"
FT                   /protein_id="CBV41037.1"
FT                   /translation="MKRTAAYLSFSAEQVLPLIREAATTWELPVTEVAGTLRVTLEYGE
FT                   IRVASEGAGTSVRVASEDAGNLQMLRDLLTGQLSAHDLNPVWEGGSAGRQPANQSIARV
FT                   ADIERLSPSYRRVTIEGQDLARFADGGLHFRLLFGPDGMGWPETDENGVTQWPGGASAW
FT                   HRPVYTTREIVCDGEAARLSFDVFLHAGGRVTGWTEQVSPGDEVALMGPGGGTGQKTAE
FT                   WQALVGDETALPVIARMLASAPQTMQGEAVIVVPDEGDIQGLAHPEGVTLRWALRSNGE
FT                   SPLEALAALELPQRERHVFFAAEKTEAQSARAALIERGLAKHEFLAATYWVQD"
FT   CDS_pept        complement(181557..182705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylX1"
FT                   /locus_tag="HELO_1155"
FT                   /product="2-keto-3-deoxyxylonate dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1155"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41038"
FT                   /db_xref="GOA:E1V4Y9"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Y9"
FT                   /protein_id="CBV41038.1"
FT                   /translation="MSVSSYLPDDDQQALLVGRAWRDDARGPVLVVVRHGQVFDISEHC
FT                   ACMADLLDRDDAAAFVSGVEGELLGSAEELFDNSRHASPRAPYLLAPCDVQAIKACGVT
FT                   FAVSLLERVIEEQASGDPARASELRSELQALIGGDLSRIVPGSEEAMALKTELQARGAW
FT                   SQYMEVGIGHDAEVFTKSQPLSAVGFGSRVGLHPASRWNNPEPEIVLVVDARGTAKGAT
FT                   LGNDVNLRDIEGRSALLLGKAKDNNASCAIGPFIRLFDDAFTLDTVRQARVSLHIEGQD
FT                   DDFELHDSSDMRQISRDPLELVQQTIGAHHQYPDGFMLFLGTMFSPIQDRDGAGQGFTH
FT                   HIGDSVTIATPSLGALVNYVDRSDRLPPWTFGIRQWQAYMKK"
FT   CDS_pept        complement(182833..184032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1156"
FT                   /product="ROK family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1156"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41039"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z0"
FT                   /protein_id="CBV41039.1"
FT                   /translation="MPTSFQPHRSGDLHFLKRLNRSAILELVRRSPGLTRADIATQAQL
FT                   TKATVGSGVQSLLKQGWLREGELQKSSGGRPGRALHLDEQRFAILGAEVGVHGLRLVAC
FT                   TLSGRILASHHERLSPSSPEVTAELLAGLLKTLQQSPALDGYHLLGLGVALPGPVAPNA
FT                   PLLRVAPNLGWKDIRFLDLLRSHLPQLEGAWLMDNEAKSAAFGEFYFRTGQVPDSLIYV
FT                   SAGTGIGSGMIEGNQPLLSRGFQGLAGEIGHTVLQPGGLYCHCGNRGCAETLVSGWSIR
FT                   AALGVAEDEDLLEALRPRLHEEAVQLTLRRAGEALGTLLLNLHHTQNPSELVLGGSLVQ
FT                   LGPSFLDPALSYFKTHQNRLLGSSQQVPLRVIDDSTFIAARGAAAQVLAHVIHGPSDLI
FT                   "
FT   CDS_pept        184318..185088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galD"
FT                   /locus_tag="HELO_1157"
FT                   /product="D-xylose/galactose 1-dehydrogenase"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1157"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41040"
FT                   /db_xref="GOA:E1V4Z1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z1"
FT                   /protein_id="CBV41040.1"
FT                   /translation="MSEDAGRYPSLEQRVVFITGGGSGIGAGLTRAFHGQGAVVAFVDI
FT                   DDAASQALVEELKAETGRAPHYYHCDIRDVAALQSVIAEVGQTLGAIRTLVNNAANDDR
FT                   HSWDDIDVEYWDERMSLNLRPMFFAAQAAARQMIEAGGGSVINFGSISVRMALGDLSCY
FT                   MTAKAAVHGLTRSLARDLGPHDIRVNTLVPGSIITERQLEKWIGPEEEASIQERQSLKF
FT                   RLEAHHVAPAVLFLASTDSQAISGQELAVDGGWG"
FT   CDS_pept        185134..186423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1158"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1158"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41041"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z2"
FT                   /protein_id="CBV41041.1"
FT                   /translation="MNALRQFTGGHSRRRCLVAAIAAVSALGSIAAAADTTVQVLRVEV
FT                   SDAEKQYYDEVVAEYEAQHPEVNVEFDYIANEAYKTRLPTLLQSEQRPDIFYSWGGEGL
FT                   RDKVEAGFVRDLTEPMKDGWKELYPESAVSTFTLDGRIYGAPLYATVVGFWVNTALTEQ
FT                   AGVDIDEIETWQDLESAVVALREQGITPAVVGAKDGWPMHFYWGYLATRLVGGDGIEAA
FT                   KAGDDGGFTNESFIRAGEMLQEFAELEPFQSGFMSTTYERASAMFGDGEAALHLMGDWD
FT                   YIPSKERSMSGEGVPDEDLEFIRFPDVEGGAGNDHSFGGMNGFAVTEGASDEAVDFLRF
FT                   LLNEENQRKAAKRGIFVPVAKGSEEALATPYARKVAEILADSTFHQVFLDQALGTSVGA
FT                   TVNNISTDLAQGVITPEEAVDRVAEAWQFR"
FT   CDS_pept        186507..187442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1159"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1159"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41042"
FT                   /db_xref="GOA:E1V4Z3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z3"
FT                   /protein_id="CBV41042.1"
FT                   /translation="MTTINPPAVRKRGTADRIKKNVVSGKLSAVLILLPPALILFSLFV
FT                   ILPLIDAAFYSGFSWNGYGSPSDFVGTQNYQRLLDHSVFHTALWNTAKLIIVSLVIQMP
FT                   LALGLALLVYRKTPTNTLFRLVFFLPYILAEVAAGLIWSFVFDGDYGITASILQSLDQE
FT                   SVYVLADRQWAFPAIMTVIVWKYFGFHMMIYIAALQSVPEDLIEAAKLEGAKPRQIARH
FT                   VQIPMIKHALVVSGFFAIIGSLQIFDIIIPLTNGGPSNTTHTIVTYLYTFGLSRLNIGF
FT                   GSAAAVVLFVLAIGIAFFYQRTTGNKEGQA"
FT   CDS_pept        187439..188269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1160"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1160"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41043"
FT                   /db_xref="GOA:E1V4Z4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z4"
FT                   /protein_id="CBV41043.1"
FT                   /translation="MNRATTTRNTLRVILLILVAGLVVGPLLASFFGGFKTNAELRTNP
FT                   LWLPDNWNPEHYISILLDGSFWRYLGNSFFISSMTVLLTLVVGAAAAYVFAQIRFLGSK
FT                   MILSYLLLGLMFPFAAAILPLFIKVRDLGLLDSYWAVILPQTAFGLSLAILLFKAFFDQ
FT                   LPRELFEAAYVDGCSYLRFFWSFTLPLSTPILATVGVFVFVQSWNNFLLPLVVLNDRSL
FT                   YTWSLGMMQFQGEYLTQWNMILAFVSLTIMPAVIFFLAAQKYIVAGLTGGSVKG"
FT   CDS_pept        188282..189889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xynB"
FT                   /locus_tag="HELO_1161"
FT                   /product="beta-xylosidase"
FT                   /EC_number="3.2.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1161"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41044"
FT                   /db_xref="GOA:E1V4Z5"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z5"
FT                   /protein_id="CBV41044.1"
FT                   /translation="MKDKVRNPILPGFNPDPSICRVGGDYYIATSTFEWYPGVQIHHSR
FT                   DLANWELASRPLERTSQLDMRGNPDSCGIWAPCLSYADGLFWLIYTDMKRYEGNFKDGH
FT                   NYLVTAPTIEGPWSDPVYLNSSGFDPSLFHDEDGRKWLLNLQWDYRQREGGDRFGGILL
FT                   QEYDVEQQRLVGPICNIFAGTPMKLTEGPHLYRRDGWYHLLVAEGGTGYEHAVTMARSR
FT                   EIAGPYEVHPDNPVLTSRQDSDNPLQRAGHADLVDTPSGETWMVHLCGRPLPGTRRSPR
FT                   GRETSLQKVEWGADGWLRLAHGGNTPALEVSMPGVEQLAPAAEEVHDFTSGALPEAFQW
FT                   LRTPQPERLFSLSERPGYLRLFGRESVGSWFEQALVARRQDSIHCSAETTLEFEPEDLQ
FT                   QFAGLIAYYNRFKFHYLAVTRGDGGDKVLSVMSCRDAWPSGTLEIVDSDDVALDPALPV
FT                   RLGLDIREAELQFRYAQGDAAWQPVGPVLDASLLSDEGSGRAHGYFTGNFLGMAAHDIS
FT                   GRGIPADFSGFRYCRENR"
FT   CDS_pept        189939..190976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1162"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1162"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41045"
FT                   /db_xref="GOA:E1V4Z6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z6"
FT                   /protein_id="CBV41045.1"
FT                   /translation="MAEVALVEIEKTFRGKTTVISNLDLEIEDGSFTVLVGPSGCGKST
FT                   LLRMIAGLETVTRGAISIGGHDVTTAEPSDRDIAMVFQSYALYPHMTVARNIDFGMRLA
FT                   KVPAQERQAKVDEAAKLLNLEDLLERKPAELSGGQRQRVAIGRAIVRNPGVFLFDEPLS
FT                   NLDAALRNRMRVELAELHQRLDATMVYVTHDQIEAMTLADRIVVLNAGKIEQVGAPMEL
FT                   YQRPETLFVAGFIGSPKMNLITGAVAEAYGATTLGIRPEHIEVGHDRGEWRGRVRVVEK
FT                   LGSDAFAYVDSEEVGALTVRLPGDVDTRSGDILELTPRHELLHPFDQQGMRLPDDVVEN
FT                   ARAIA"
FT   CDS_pept        191242..192585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lamB2"
FT                   /locus_tag="HELO_1163"
FT                   /product="maltoporin"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1163"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41046"
FT                   /db_xref="GOA:E1V4Z7"
FT                   /db_xref="InterPro:IPR003192"
FT                   /db_xref="InterPro:IPR036998"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z7"
FT                   /protein_id="CBV41046.1"
FT                   /translation="MGSYHHASRYFMRALLFGAGCAASTLTMAEGLASNVDFTGYARSG
FT                   VGNTVGGGDQACFKANGASAKYRLGNECDTYAELGLGATLYEKEDKKFYFQSMIGYSTD
FT                   QLNDYEGSESDETKVSVRQMNVQADNIIEALPGATLWAGKRFYRRHDIHINDFFYWDVS
FT                   GPGAGIENIDVGTGKLSLAWLRATNEADRAYPDANNRISNDTLDIRWSDIPTNPDGSLV
FT                   LGYDYGRAQLTEEQEDYYDGSQAEKGHMFTIQHTQKNWFGGTNKLALQYATDGIINAGD
FT                   TKGRMAGSTTHRDAPGGDMWRVINHGNVWLSPDKLDLMYAAVYEDQSFDDDSGRTWISA
FT                   GIRPTYYWTENMSTALELGHDYIDPEADDGIGSRSLTKFTLAQQWAAGVGGYARPVIRL
FT                   FATYANWDGDPLQEDGGSAAISAGDAGGAIDIDDNDGLTVGVQMDVWW"
FT   CDS_pept        192661..194067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1164"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1164"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41047"
FT                   /db_xref="GOA:E1V4Z8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z8"
FT                   /protein_id="CBV41047.1"
FT                   /translation="MTDRKPLSRSAYILIICCIAAIGGFLFGFDSGVINGTVDGLQSSF
FT                   NSDSVGTGFNVASMLLGCAVGAFFAGRLADRFGRRTVLIVSAIFFLVSAWGSGIAGDSM
FT                   EFVVYRVLGGMAVGAASVMTPAYISEVAPSRYRGRLATIQQVAIIGGLFMAFLSNYVLA
FT                   YVSSSAVAELWFGFATWRWMFWIELLPASVFLVALLFIPESPRYLISSGRQSEARRVLG
FT                   LVMPEQEVGDKLDEIHTTLDRDHKPRLSDVVNRATGKVHGIVWVGIGLAVFQQLVGINV
FT                   VFYYGAVLWQSVGFSEGDALLINVISGAVSIGACLLAIALIDKIGRKPLLWVGSVGMAI
FT                   TLACLVFAFSTATLVDGNLQLSDDMGVFALLAANIYVFSFNVSWGPVMWVMLGEMFPNQ
FT                   MRGSGLAIAGLFQWLANFGITMTFPIMLASIGLAGAYGFYALCAALSAFFVLRWVQETR
FT                   GKELEEMAYE"
FT   CDS_pept        194172..195065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1165"
FT                   /product="homolog to xylono-1,4-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1165"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41048"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:E1V4Z9"
FT                   /protein_id="CBV41048.1"
FT                   /translation="MVTDTRVQVAVELDMSLGESPLWSVARQTLHWVDINHGVIHVWQP
FT                   DRHAAPSRIELDEKVGCIALCEEGLLAATASGIIRLRLPFDGRTERLADNPEWHDGKGN
FT                   RFNDGRCDAAGRFWAGTIAADEVTPSAALYCFEGGELVQRWSGLGIANGLAFSPDRRWL
FT                   YHTDSLTRRILRYPFDVETGRTGEPRVWADLDALGLPGVPDGAAVDSQGCYWSALYGGG
FT                   RIVRFSPAGRLEASFELPCPHPTMVAFGGPDLRTLYITTATQHLNDEERKRWPAAGSLL
FT                   RMPAPVAGLAEPVATS"
FT   CDS_pept        complement(195073..195792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1166"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1166"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41049"
FT                   /db_xref="GOA:E1V500"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1V500"
FT                   /protein_id="CBV41049.1"
FT                   /translation="MSASSPSALPASAPSSSAPLCLLFDSDGTLVDSEILLAEVMGDVL
FT                   PEYGLPFTARQYMEAFRGVRFHDIVATQQRRHGPLTEDSLARLEAAMRTRMQARMTEEL
FT                   VAIDGMPDALDALAAYPKAVVSNGPDSKIRCAMASAGLAHHFGDHLFSAYTLEVWKPDP
FT                   GLYLKAAEAMGFPPERCVVIDDAAVGVEAGLAAGMQVIHLNHFPDEEATPEGAIALHHA
FT                   SELPEVIARLASARQAL"
FT   CDS_pept        complement(195866..197173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1167"
FT                   /product="TRAP transporter large transmembrane protein
FT                   (probable substrate D-mannuronate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1167"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41050"
FT                   /db_xref="GOA:E1V501"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V501"
FT                   /protein_id="CBV41050.1"
FT                   /translation="MIPMDAVFILPWLLFGLLGVLIVAGVPIAMALVLTAAGMILLDPR
FT                   LTYWVMFQRMYNGMDSFVLLAVPLFLLAGNLMNAARITDRLITLCMRLVGHFKGALAHV
FT                   NVMVSMLFAGVSGSSTADSAGVGTVLIPAMQREGYPSHFSVAVTAASSVMGIIIPPSIN
FT                   MIVWGALTNTSIAGLFLGGILPGLMIGVAQLALNVGYVRRYQVPVRRRASLVELARSSK
FT                   DGLLAAGIPVVIIGGITLGLVTPTEAAVIAVLYALALGTLVYRELNLSKVLDASTDTVR
FT                   LCSLSLFSLVGAAIFGYLISFYQIPPKLMAGVDISDPVMLLLVMTAVMLVIGTFMDSLP
FT                   AMAIMAPIFQPLAMQAGVHPVQFGVIGVMALGLGLITPPYGLCLMISAKIGGIPLLQAL
FT                   GTTLLYLAIMLGVILLLILYPDLILMLPRLIAPDFV"
FT   CDS_pept        complement(197170..197772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1168"
FT                   /product="TRAP transporter small transmembrane protein
FT                   (probable substrate D-mannuronate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1168"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41051"
FT                   /db_xref="GOA:E1V502"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V502"
FT                   /protein_id="CBV41051.1"
FT                   /translation="MRRLLHGLTHLNRGLERCLHWLLLALLFGFIALIVYQIVSRNLPL
FT                   MPRLYWTEEFSRFAFQWMIMLGTAIGVLHADHFVLEAFPRGSRASLVTRWIRDLSCLAV
FT                   GLIFVIHGKDFALSGLRREATASGLSMIYVYSAFSVSGLLIILFSAQRLLHALLDGVPR
FT                   MEASLDTPDAVEEALEAHAGHGDELDPSLSSTDGRTP"
FT   CDS_pept        complement(197832..198833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1169"
FT                   /product="TRAP transporter substrate-binding protein
FT                   (probable substrate D-mannuronate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1169"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41052"
FT                   /db_xref="GOA:E1V503"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V503"
FT                   /protein_id="CBV41052.1"
FT                   /translation="MLTTRTQSGRFLKQLVIGATLATTLGATGIAQAVELRFGHGGTED
FT                   TAYHLGATRFKELVEDKSDGDIGVQIMGNSVLGHETEMFEQQMAGALDLSIINPGLITD
FT                   FSSTANVFSIPFLYRDQAHWQAVLDGDVGREIADQITEETGVKVLAFFGGGKRQIVSSR
FT                   PLESLDDLKGMKLRTNPTKPLIAAWSALGTEPTVMAWKEIYTGLQLGAIDGLLNEAEWI
FT                   HRMRFHEVAPHIGLSEHDITVRLLTMSQMSWDRLDESQQQAVMEAAREAASYARQVQLE
FT                   QDAEALDLLVEEGATLHELDRQRMQEIVSEPLAEVVEEMGLTELRQKIANVE"
FT   CDS_pept        complement(198937..199914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ghrB"
FT                   /locus_tag="HELO_1170"
FT                   /product="probable 2-ketogluconate reductase"
FT                   /EC_number="1.1.1.215"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1170"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41053"
FT                   /db_xref="GOA:E1V504"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V504"
FT                   /protein_id="CBV41053.1"
FT                   /translation="MTKRILVYRPLNEDQLARLERDFHVDYLPETSAEDPAFLDALANA
FT                   HGLVGASLPITPALLDRAPHLEAIASISVGYDNYPVDELTRRGILLCNTPDVLTETTAD
FT                   TGFLLIMCAARRAIELAGMVQRGEWRESIGKELFGTDVHGKTLGMVGFGRIGAAIARRG
FT                   ALGFGMRVLYSNASPKPELEAELGARHRELDDLLAEADIVCVTVPLNADTQHLIGAREF
FT                   ALMKPSAIFVNVARGKVVDETALIEALRAGRPHAAGLDVFEREPLPETSPLPHMPNVVA
FT                   LPHIGSATHETRTAMADRAVANILAALSGERPPSPVNELELKGS"
FT   CDS_pept        complement(199911..200906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kguK"
FT                   /locus_tag="HELO_1171"
FT                   /product="probable 2-dehydro-3-deoxygluconokinase"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1171"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41054"
FT                   /db_xref="GOA:E1V505"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1V505"
FT                   /protein_id="CBV41054.2"
FT                   /translation="MTRPSSPELLSFGEAMTLFVAETTGDLAEVERFRRRIAGADTNVA
FT                   IGLARLGFHVGWLSRVGDDSFGRYLRTTLEHEGLDCRHLITDADHATGLVFKERALDGA
FT                   DPRVEYRRRGSAASQLAPADADEVDFSALRHLHATGIPPALSPSCRELSYHLLGEARRH
FT                   GASLSFDPNLRPSLWSSEREMRETLNDLAAHTDWVMPGLAEGQLLTGQETPHDIAGFYL
FT                   DQGAEAVFLKLGPEGGYYRGRLGGEEQAFSVPGIAVAEVVDTVGAGDGFAVGVISALLD
FT                   GVSPRQALQRGCLIGAEAVQVSGDMEGLPHRDRLEHLEAALDDTSRRSAT"
FT   CDS_pept        complement(200903..201958)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxS"
FT                   /locus_tag="HELO_1172"
FT                   /product="LacI family transcription regulator PtxS"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1172"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41055"
FT                   /db_xref="GOA:E1V506"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1V506"
FT                   /protein_id="CBV41055.2"
FT                   /translation="MPATSRPATILEVARDAGVSKTSVSRYYSGERERLSASMQQRIAH
FT                   AAERLGYQPNPMARGLKGGPSGLVGMLVADIRNPFSVAVMHGVEQACRRQGLSLMVCNT
FT                   DNDPTLERQNLALLTSYRIEGLIVNAAGRHGEALAELAGGGLPLVLLDRSLEGIDADEV
FT                   GLDNDRAIDMALDHLTERGYRRVLFVTEPPARASSRQARMARFESGRSSRGLEGEVLSL
FT                   ELDDAASLDRRLSAFLEAATQQPTAILCGNGQVTLAVTRTLQARRVPLGEIGLMGIDEL
FT                   DWCQLVTPGITTLAQPTDAIGQAAVDRLRARQAERTTPEPRHERFTPTLIIRDSTCRPG
FT                   VDAPHFDETRP"
FT   CDS_pept        complement(202082..202912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1173"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1173"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41056"
FT                   /db_xref="GOA:E1V507"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1V507"
FT                   /protein_id="CBV41056.1"
FT                   /translation="MTCLSTTELASWNEAASEAMAHCHADDFPAKLLEAIDTLVPLEST
FT                   LIILEDSRRAPELLYKRGIPPHNRERVIDRYFSRGYLLDPFCLAVDQGLAEGFYHLDDI
FT                   APDNFFNSEYYRVYYLEAGSVEDCYYILDLTPERRISISLYNGLTATPLTSTQRAILQT
FT                   LDPMVRTLARYHWQNLDERVDTLPPPFAPSPGGGKLREAFLRFGEDRLTMREREICHLL
FT                   LRGHSAKSSARELSISPETVRLHRKNLYAKFDIGSQSALFAIFLDWLDGWSIEG"
FT   CDS_pept        203083..204495
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1174"
FT                   /product="pyridoxal phosphate-dependent aminotransferase"
FT                   /EC_number="2.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1174"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41057"
FT                   /db_xref="GOA:E1V508"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1V508"
FT                   /protein_id="CBV41057.1"
FT                   /translation="MSNIPDVSHFSSLDNKRLIESDKAHYMHGYHAFDEHRQHGSLNIT
FT                   QGDDAYIRDAQGQQYLDAVGGMWCTNIGLAREEMAQAIAEQTRQLAYSNSFCDMANDRA
FT                   IQLSEKLAELAPGDLDRVFLTTGGSTAVDTAIRLVHYYQNCRGKHEKKQIITRINAYHG
FT                   STYLTMSLGGKQADRPEEFDFLTDGIHHLSCPNFYRAPEGVNEAEFLEGLVAEFENKIL
FT                   EIGPERVGAFLAEPIMGSGGVIIPPAGYHRRMWEVCQRHDVLYISDEVVTSFGRLGHFF
FT                   ASEAEFDIQPDIITTAKGLTSGYQPLGACIFSERIWEVIAEPGAGRCFSHGFTYSGHPV
FT                   ACAAALKNIEILEREALLPRAREVGRYFEQRLRTLEDLPIVGEVRARCFMACVEFVADK
FT                   TTRTLFPEALNIGEWVHLRAQKRGLLVRPIVHLNVMSPALTLTHEQVDFVVDVLRESIL
FT                   ETLEDLRAAGHW"
FT   CDS_pept        204586..205995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1175"
FT                   /product="APC family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1175"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41058"
FT                   /db_xref="GOA:E1V509"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1V509"
FT                   /protein_id="CBV41058.1"
FT                   /translation="MEDNKNKVLRCRDVTLYTVSAMLFMDQIALAASLGSSSLFWWAYV
FT                   LILLFLPMAMMTSELGTTYPSNGGVYHWVRSAFGFRWGARVSWLYWINNALWMPSVYIL
FT                   FASMFSAFYFPGMGLWSEILLGCSLALVTSLCTSLSLRIGKWLPNIGAVLKLISVLVLL
FT                   FGGLRYGIQEGFANPFTFEAALPSSPAAIAALGVMVYGIMGTELACCSAAEMIHPRRDI
FT                   PRAILASGLLIATFNVLGTIGVLAAVPADQADVTTLFAESLFNMYGRDGLGGLVANLVG
FT                   GFVLFTFFTNMVTWSMGTNRAAVEAAKAGEFPDVFGIVHPRHGTPVGSALLASAVSIVV
FT                   MVTYGLVANTSEGLFWTLLSIFAMIFMIPYVLMSLAFIKLRLSSDRPRPFRLPLGNRLA
FT                   CVWAAIVGLHVLAGIVLFVVTPGEPMDWDYAGKIILGVLLALVVGEMVIGVGRRQHKRR
FT                   QSEVPEAIGAG"
FT   CDS_pept        complement(206071..206745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1176"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1176"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41059"
FT                   /db_xref="GOA:E1V510"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:E1V510"
FT                   /protein_id="CBV41059.1"
FT                   /translation="MRPLCLLFDCDGTLVDSEPLLADEMATSLNAVGLPFQAADYIGEF
FT                   RGARFRHIVAELERRHGSVDAQRLEPLEREMRANLNRRLATDLTPIEGATEALAVLASI
FT                   PMGVVSNGPTNKIRTSLHATGLDELFGEHLFSAYDAQCWKPDPGLYLHAARQMGFAPAD
FT                   CVAIDDSLVGVQAALAAGMTVIHLNRFPDVEETPEGALSITSMFQLPTVISRLTQAQAM
FT                   AN"
FT   CDS_pept        complement(206907..207764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1177"
FT                   /product="HTH/PAS domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1177"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41060"
FT                   /db_xref="GOA:E1V511"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:E1V511"
FT                   /protein_id="CBV41060.2"
FT                   /translation="MCASRSLARTRPELADFLRSRRERLSPEMLGLPRGNRRRTPGLRR
FT                   EEVAALAGVGVTWYTWLEQGRDIGVSTGFLDSLARVLRLDAAERRHLYLLVHQRPPTES
FT                   KRTWCTMPSLAQRLLDDLPHRPAYVLNLRWDVLAWNTAADRIFDFSAQPPERRNLLWML
FT                   FVDDATRRLFDTWEQQAPRLVSSFRQDYASAPEDSDIEQLVRELEDVAPEFKTWWRQQD
FT                   IHGPCLGRRSLFIPDIGTLDFEHMTLTLDEDRHLRLVYYAACESHSRAGAFEDWLKTPP
FT                   ITPG"
FT   CDS_pept        207876..209072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1178"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1178"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41061"
FT                   /db_xref="GOA:E1V512"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V512"
FT                   /protein_id="CBV41061.1"
FT                   /translation="MLNRELSTAMMVAVGAFALGMASYATAGLIPMIEIELSVSVSLAA
FT                   QLVTAFTLAYGLGSPLLVAVLPAHRQRIGLLGSLAVFVIANVASALANDIVTLVVLRAV
FT                   AGIGAGVYLALGIAAAASLAGERRRGKAIAIVMGGMASGTVLGVPVSLLLAERLGWQAA
FT                   FWLIAMLGGVTLLGMLWRLPTLPDTPSVSMRSKLAVMADRRVVAILGVSLLAAIASLGM
FT                   YTFIAPFVAAYAESETISVTPYLWVWGIGGVVGSFLVGAVVDRVRGPKVTLGIMLLLAT
FT                   ALILLPVLAPYRLAMTMLPLVVWGAVGWALQVPQNDELFKARSMAGDGHLAIALNESAL
FT                   YLGSAIGSAVGGVILAMQWPVWGLAVGAAAIAMLGAVLQCALVVQEGRRVRELDAPVA"
FT   CDS_pept        209147..209596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1179"
FT                   /product="GNAT family acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1179"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41062"
FT                   /db_xref="GOA:E1V513"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1V513"
FT                   /protein_id="CBV41062.1"
FT                   /translation="MPTFSRVAPQELPMPLLLLADPSEHHIATYLEGALCYLASEQGQP
FT                   VGACVLNVNRDGVLELFNIAVAIEAQAQGIGSALLEHVIADARAQGYARIELGTGTFGH
FT                   QLAFYQRAGFRVESVIRDHFLDHYDEPIHERGIQHKDMLRLALTL"
FT   CDS_pept        complement(209661..210725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaA"
FT                   /locus_tag="HELO_1180"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1180"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41063"
FT                   /db_xref="GOA:E1V514"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR006412"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1V514"
FT                   /protein_id="CBV41063.1"
FT                   /translation="MALISMRQMLDHAAEHGYGVPAFNVNNLEQMRAIMEAADETDSPV
FT                   IVQASAGARKYAGAPFLRHLILAAVEEFPHIPVAMHQDHGTSPAVCQRSIQLGFSSVMM
FT                   DGSLGEDGKTPTSYDYNVDVTRRTVEMAHACGVSVEGELGCLGSLETGMAGEEDGVGAE
FT                   GKLDHDQLLTDPEEAADFVKATHVDALAIAIGTSHGAYKFTRPPTGDTLSIQRIKEIHA
FT                   RIPETHLVMHGSSSVPQEWLEVINEFGGEIPETYGVPVEEIVEGIKHGVRKVNIDTDLR
FT                   LASTGAVRRFLAKNPAEFDPRKFLKVSTAAMKEVCKARYEAFGTAGNASKIKPINLEEM
FT                   FLRYERGELDPRVK"
FT   CDS_pept        complement(210811..211980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgk"
FT                   /locus_tag="HELO_1181"
FT                   /product="phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1181"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41064"
FT                   /db_xref="GOA:E1V515"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:E1V515"
FT                   /protein_id="CBV41064.1"
FT                   /translation="MNVRKMTDLDLRGKRVLIREDLNVPVKHGKVTSDARLRACLPTIR
FT                   AALEAGARVMLMSHLGRPTEGEPAEEFSLAPVADHLGELLERRVRLVKDYLDGDVELAD
FT                   GEVVLLENVRFNSGEKKDDEALAKRYAALCDVYVMDAFGTAHRAQASTHGVARFAPEAC
FT                   AGPLLADELSALEKALATPARPMTAIVGGSKVSTKLEVLTALAEKCDRLIVGGGIANTF
FT                   IAAAGYNVGKSLHESDLVEQAKALMARVEIPLPSDVVVATEFSESATAVTKPVDQVQDD
FT                   EMILDIGPDTAARLGEQLKAAGTILWNGPVGVFEIDQFGRGTEALSQAIAESPAFSIAG
FT                   GGDTLAAIDKYGIADRVSYISTGGGAFLEYVEGKTLPAVAALEAAADKA"
FT   CDS_pept        complement(212017..213051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epd"
FT                   /locus_tag="HELO_1182"
FT                   /product="D-erythrose-4-phosphate dehydrogenase"
FT                   /EC_number="1.2.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1182"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41065"
FT                   /db_xref="GOA:E1V516"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V516"
FT                   /protein_id="CBV41065.1"
FT                   /translation="MAHRIAINGYGRIGQCVLRALIERREPDLEVVAINELSGLDTIAY
FT                   LTRYDTTHGRFPGHVEADGDHLVIDGRPIRVLSESEPSRLPWDELGIDLVLECSGSFKD
FT                   RATAERHLSAGAGRLLFSQPAESDVDATIVTGINDADLTASCRIISAASCTTNCLVPVL
FT                   TVLDEALGLEHGVTTTIHSAMNDQPVIDAYHQTDLRLTRSAMHSIVPVDTGLARGINRL
FT                   MPHLAERFECLHVRVPTINVSAMDLALCVRTDTTAETVNDLLHEASHTRLSGLLGYTEE
FT                   PMASIDFNHDPRSGIVDATQTRVAGGRLIKMLCWFDNEWGFANRMLDVAGRIARLGAAP
FT                   PTDA"
FT   CDS_pept        213281..214333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbaB"
FT                   /locus_tag="HELO_1183"
FT                   /product="fructose-bisphosphate aldolase, class I"
FT                   /EC_number="4.1.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1183"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41066"
FT                   /db_xref="GOA:E1V517"
FT                   /db_xref="InterPro:IPR002915"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041720"
FT                   /db_xref="UniProtKB/TrEMBL:E1V517"
FT                   /protein_id="CBV41066.1"
FT                   /translation="MTDIPQLLGDEADSLLNHECRGVPAESLYKPGPDFIDRVMADSDR
FT                   SPQVLRNLQSIYNHGRLGGTGYVSILPVDQGIEHSAGASFAPNPLYFDPANIVELAIEG
FT                   GCNCVASTLGGLASVARRYAHKIPMMVKLNHNETLTYPAVYDQTLFGQVEQAHAMGCAA
FT                   VGATIYFGSPESRRQITEISEAFERAHQLGMVTVLWAYLRNPEFKKDGSDYHVASDLTG
FT                   QAIHMAATIKADIVKQKLAENNGGYRAVGFGHTHDKVYDELTSDHPIDLARYQVANCYM
FT                   GRIGLINSGGGSKGHSDLGEAVRTAVINKRAGGMGLISGRKAFQKPMAEGVELLNAIQD
FT                   VYLDDRISIA"
FT   CDS_pept        complement(214430..216448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA2"
FT                   /locus_tag="HELO_1184"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1184"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41067"
FT                   /db_xref="GOA:E1V518"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E1V518"
FT                   /protein_id="CBV41067.1"
FT                   /translation="MPSRFELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFL
FT                   VHNPADPHWPDRDRFVLSNGHGSMLLYSLLHLSGYELGLEQLQNFRQLHAKTAGHPEYG
FT                   YAPGIETTTGPLGQGLANAVGMAIAERTLAAQFNRPGHTIVDHHTYCFVGDGCLMEGIS
FT                   HEVASLAGTQQLGKLIAFYDDNGISIDGEVEGWFTDDTAKRFEAYGWHVVPNVDGHQPD
FT                   EVKAAIELARQHSDKPSLIICKTVIGFGAPNKQGKESCHGAALGEDEVAAAREQLDWPH
FT                   APFHVPEDIYQGWDASEAGRTRQADWQARFERYAEAHPELAREFLRRQKGELPAELTSE
FT                   ALIEQAQDKAETTASRKASLACLNELGPQLPELLGGSADLAPSNLTVWNGAKVIGPEGS
FT                   REGAPDGNYLHYGVREFGMAAIANGIALHGGFVPYTATFLIFMEYMRNAVRMAALMGVR
FT                   SIYVFTHDSIGLGEDGPTHQPVEQLTTLRSTPNMSTWRPCDAVETAAAWNAALKRQSGP
FT                   TALVLSRQNLPHQARDKQQLADIQRGGYILKDSDGTPELILIATGSEVGLAMDAATALA
FT                   DKGRRVRVVSMPATDVFDAQDAEYRQRVLPAEIGNRLVIEAGHPDLWYKYVGLEGRVIG
FT                   MTTFGESAPAGDLFKHFGFTVDNVVDEAEQMLDDAED"
FT   CDS_pept        complement(216462..217409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talA1"
FT                   /locus_tag="HELO_1185"
FT                   /product="transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1185"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41068"
FT                   /db_xref="GOA:E1V519"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:E1V519"
FT                   /protein_id="CBV41068.1"
FT                   /translation="MASRLDALKQHSLVVADTGDLDAIRRYQPQDATTNPSLILKAFDM
FT                   PGYQPLIERELAALPAQGDKQERAARAVDHLAVAMGSEIAGVVPGRVSTEVAARLSFDT
FT                   QASIRKAHELIELYAQRGIGRDRVLIKLASTWEGIRAAEVLEKEGINCNLTLLFSDAQA
FT                   QACFDAGVFLVSPFVGRVTDWYKKESGRDFTPENDPGVQFVRGVCERVSQGGYDTVVMG
FT                   ASFRTADQVLALAGCPRLTISPALLEELATTPGTVKAKVLMTRNGGPRPTSLSESGFRW
FT                   EHNQDAMANDKLAEGIRRFDEDQSRLEQRIADRL"
FT   CDS_pept        complement(217500..218153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1186"
FT                   /product="DhaL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1186"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41069"
FT                   /db_xref="GOA:E1V520"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:E1V520"
FT                   /protein_id="CBV41069.1"
FT                   /translation="MQYLNTTHGTDILEALVDVIVENRNYLSEVDGAIGDGDHGINMAK
FT                   GFRLCGESIQGQSLGLSKALGTLATTLMGSIGGSMGPLYGSLFLGMSNAIKECEALDAR
FT                   AFGDMLTGGLNALQGISDAQVGDKCLLDTLVPAVDDYRRAADNGEDFPAALDALRQGAE
FT                   RGCESTRELEARIGRAARLGERSRGHLDAGAVSCRLLLVTLADSTERHLEKAAA"
FT   CDS_pept        complement(218178..219167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1187"
FT                   /product="DhaK domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1187"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41070"
FT                   /db_xref="GOA:E1V521"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="UniProtKB/TrEMBL:E1V521"
FT                   /protein_id="CBV41070.1"
FT                   /translation="MQRIINDPDNVVDDAVRGYLRASPSLYAATDHPRVLKYAGETPDK
FT                   VGVVTGGGSGHEPAFLGYVGEGLCDAVAIGEIFSSPTADAFLDAFRAADRGRGVACLYG
FT                   NYAGDNMNVKMARQMAEMEGIDVKTVIARDDVASAPADQRDQRRGVAGEIMMWKVGGAA
FT                   AARGDDLSEVIRLAQKAVDACSSIGIGLSSCTIPANGKPNFSIEPGHMELGIGHHGEPG
FT                   IEVAPLTDAASIARSMCDPVLADQDFTGGEVAVLVSGLGATPNMELNLLYAHIADRLEA
FT                   ENVTVHRADIGNYFTSLEMMGATLTVMKLDDELKPLIDAPARSLAITR"
FT   CDS_pept        219541..220038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiB"
FT                   /locus_tag="HELO_1188"
FT                   /product="ribose 5-phosphate isomerase B"
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1188"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41071"
FT                   /db_xref="GOA:E1V522"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:E1V522"
FT                   /protein_id="CBV41071.1"
FT                   /translation="MSDSTMAARAAVRIALGGDEAAFELKEALIEHVRSLGFEAVDFGT
FT                   YNAEPVLYPDIAVRVARAVAAGEVERGVLVCGTGIGVAISANKVPGIRAAQAHDTYSAI
FT                   KARSSNDAQIVALGARVVGVELAKSIVTAFLGADFGGGASSEKVARIADYEREFSRGSP
FT                   SA"
FT   CDS_pept        220112..221095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1189"
FT                   /product="LsrR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1189"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41072"
FT                   /db_xref="GOA:E1V523"
FT                   /db_xref="InterPro:IPR007324"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1V523"
FT                   /protein_id="CBV41072.1"
FT                   /translation="MNERVENADIALMTEIATLYYVEGETQEVIANRLGISRVKAGRLL
FT                   KRAHAEGIVDVRVRQHPSVSAEIEQELIRRFGIKRALVALDHADPDVQRSGVASLVADH
FT                   LSRTLHDGSIVAVGMGRNVGAVADNVFEQGERKCSFVCAIGGSLRAGEYMNPDHICRRL
FT                   AMKFGGDSETLYAPALVQNPELRDAMYENSTVRQTLDRARRADTALIGVGDLSEDSNMV
FT                   RMGWFSPQEIAEARLSGTVGDMMGYDFIDLHGQPARTPMQGRVIGLTIGDLARIPDVVA
FT                   IASENTKAAGILGALRTGVIDTLATSVTNAHTILRLDEATPAAETG"
FT   CDS_pept        221339..222451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1190"
FT                   /product="probable oxidoreductase (zinc-containing alcohol
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1190"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41073"
FT                   /db_xref="GOA:E1V524"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V524"
FT                   /protein_id="CBV41073.1"
FT                   /translation="MNDTLTQSATADVTIPDTMDAIVAYAPGDYRLEQVAVPEIGEKEI
FT                   LIKVEACGICASDLKAFEGAPSFWGDADQPAYIKAPMIPGHEFIGHVIKMGPGVQGFEI
FT                   GDRIISEQIVPCWDCRFCNRGQYWMCERHDVYGFQHNVNGGMAEYMKFPAEAVNHKLPD
FT                   SLPMEKAVLVEPYACSMHAVKRAQIELGDVVVLAGSGTLGLGMIGPIKKSGPAKLVVLD
FT                   LNSERLELAKQFGADVVLNPLEDDVVSIVKEMTGGYGCDIYIEATGASKSVEQGLSMLR
FT                   KLGRFVEFSVFKEPVTVDWSIISDRKELDVLGAHLGPYCYPLVIEGIENGDCPTQDVVT
FT                   HTLPLKRFHDGIELMKHDKQALKVVLIPGE"
FT   CDS_pept        222514..223161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1191"
FT                   /product="DUF2291 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1191"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41074"
FT                   /db_xref="GOA:E1V525"
FT                   /db_xref="InterPro:IPR014582"
FT                   /db_xref="InterPro:IPR036215"
FT                   /db_xref="UniProtKB/TrEMBL:E1V525"
FT                   /protein_id="CBV41074.1"
FT                   /translation="MSSRVDAGPLPRAGKGRGRVAIIAVVVVVLAAMALDTTVVPIGAQ
FT                   QEEGFSAERYGAEHFPIVRDSVEKRAVEASELAAAVAEDKAAAGERYGVAAGIGPVVPV
FT                   TFSGVVGEGKAGIYAVDVEGVPEDLTIRVQTGPAINGTDLRDATGDIEFGQFTNQIEYQ
FT                   NAGAAINGEMKEQVLSGIDTDDLSGETVAVTGVFKLINPNNWLVTPVSLSVQ"
FT   CDS_pept        223174..224739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1192"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1192"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41075"
FT                   /db_xref="GOA:E1V526"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V526"
FT                   /protein_id="CBV41075.1"
FT                   /translation="MTDESAMSHNDKLSPEEASGEAILSARHVAKSFGNVHALKAVNFD
FT                   VHRGQVTTLFGENGAGKSTLMKILSGVIRPTSGEILLEGRAVSFASISEAQRLGISIIH
FT                   QELSLAPNLSVRDNIFMGRELGGATGVDYAEEERQTRLLMEELDEPIDPLTPVEELRLG
FT                   QQQIVEIARALSANSRILIMDEPTSALSATEVEVLFRVIRDLKQRGVSIVYISHHLEEA
FT                   LTITDHAVVLRDGVMTAYAPRRDIDLEWIVRNMVGEGFDLGSPPAGYEMGEVALSLREV
FT                   SVPDATVPGRSAVDRLSLDVRAGEIVCIYGLMGAGRTELLESVAGRISSAQGEVVLEGH
FT                   DVSHLSIAERIEHGLVLVPEDRQRDGLVQTMSVGENLSLASIGAFTRGLFTSRRREQEV
FT                   VTSSIRNVHIKTDGGEAGIGSLSGGNQQKVVIGKMLATHPRVVLLDEPSRGIDIGAKAE
FT                   VFGLLSEGARQGLAVVFSTSEVGECLSIAHRVVVMSRGRIVAEFGAGVSKEEIMAASGE
FT                   AVAA"
FT   CDS_pept        224767..225909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1193"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1193"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41076"
FT                   /db_xref="GOA:E1V527"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:E1V527"
FT                   /protein_id="CBV41076.1"
FT                   /translation="MTDTSQAAGSRNGGLDLGRLLLEGRAFFALIAIIIIFSILSPVYF
FT                   SVDNFLTMSSHVAIFGLLSIGMLLVILTGGIDLSVGSTLGFAGVFAGFLMQGVSFEVFG
FT                   VVVYPPVWAVVVLTCAMGALVGAINGVLIAYFKVPAFVATLGMLYVARGVALLMTDGLT
FT                   YNNLGGSPELGNTGFDWLGFNRLFGVPVGVLVLAAVAIVALLALIRTPFGRWVYSTGGN
FT                   ARAAELSGVPVKRVQVSVYVLSGICAAIAGLVLSSQLTSAGPTAGTTYELTAIAGVVIG
FT                   GAALTGGRGNVRGTLLGAFVIGFLSDGLVIIGVSSYWQTVFTGAVIVLAVLLNSIQYSG
FT                   RKKQRSTSSGGEVSSPQREAKSRGAEPAAESTAVNPASQS"
FT   CDS_pept        225928..226884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1194"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1194"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41077"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1V528"
FT                   /protein_id="CBV41077.1"
FT                   /translation="MLMKGKRLLIAALAVTAPLVAGAAAAQDKGLISIIVNDTSNPYWF
FT                   TEGKIAEATAEELGYEANVSSHKGDTNTESNQVDTAITNQAEAIILDPANADGSIGAVR
FT                   KAVDAGIPVFIVNAEINQQGLAKAQLVSNNAQGAALGAQQWVQSVGDEAKYVELKGAPS
FT                   DNNAATRSNGYETVLSQYPSLERVGSDVANWDRTQGYSKMQSMLQANPDVDGVISGNDE
FT                   MALGAIAALKEAGKLDDVVVGGFDGSPDAVEAVRAGEMAYTVLQPVAIFAEEAVRMADT
FT                   FVRTGETGIEGEKKLFDCMLVTAENVDQYTDPFVLEQ"
FT   CDS_pept        complement(226979..227461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH2"
FT                   /locus_tag="HELO_1195"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="2.5.1.78"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1195"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41078"
FT                   /db_xref="GOA:E1V529"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E1V529"
FT                   /protein_id="CBV41078.1"
FT                   /translation="MNQSNTDHAPRIAFIQASWHSDIVGQAQEAFTTTLAEQHGIERER
FT                   VEVFSVAGAYEIPLQAKLLARSGRYAAIIGAGFVVDGGIYRHDFVAQAVIDGMMRVQLD
FT                   TEVPVLSVVLTPHHFHEHATHTAFYHEHFLTKGREAADACALTLENLSQARKLTEA"
FT   CDS_pept        complement(227891..229909)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tktA3"
FT                   /locus_tag="HELO_1196"
FT                   /product="transketolase"
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1196"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41079"
FT                   /db_xref="GOA:E1V518"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E1V518"
FT                   /protein_id="CBV41079.1"
FT                   /translation="MPSRFELANAIRALSMDAVQKANSGHPGAPMGMADIAEVLWNDFL
FT                   VHNPADPHWPDRDRFVLSNGHGSMLLYSLLHLSGYELGLEQLQNFRQLHAKTAGHPEYG
FT                   YAPGIETTTGPLGQGLANAVGMAIAERTLAAQFNRPGHTIVDHHTYCFVGDGCLMEGIS
FT                   HEVASLAGTQQLGKLIAFYDDNGISIDGEVEGWFTDDTAKRFEAYGWHVVPNVDGHQPD
FT                   EVKAAIELARQHSDKPSLIICKTVIGFGAPNKQGKESCHGAALGEDEVAAAREQLDWPH
FT                   APFHVPEDIYQGWDASEAGRTRQADWQARFERYAEAHPELAREFLRRQKGELPAELTSE
FT                   ALIEQAQDKAETTASRKASLACLNELGPQLPELLGGSADLAPSNLTVWNGAKVIGPEGS
FT                   REGAPDGNYLHYGVREFGMAAIANGIALHGGFVPYTATFLIFMEYMRNAVRMAALMGVR
FT                   SIYVFTHDSIGLGEDGPTHQPVEQLTTLRSTPNMSTWRPCDAVETAAAWNAALKRQSGP
FT                   TALVLSRQNLPHQARDKQQLADIQRGGYILKDSDGTPELILIATGSEVGLAMDAATALA
FT                   DKGRRVRVVSMPATDVFDAQDAEYRQRVLPAEIGNRLVIEAGHPDLWYKYVGLEGRVIG
FT                   MTTFGESAPAGDLFKHFGFTVDNVVDEAEQMLDDAED"
FT   CDS_pept        230250..231470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="HELO_1197"
FT                   /product="S-adenosylmethionine synthase"
FT                   /EC_number="2.5.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1197"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41080"
FT                   /db_xref="GOA:E1V531"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:E1V531"
FT                   /protein_id="CBV41080.1"
FT                   /translation="MSEYSLFTSESVSEGHPDKIADQISDAVLDAIIARDKNARVACET
FT                   MVKTGVAIVAGEITTSAWVDLEDLVRRVILDIGYTSSDVGFDGETCGVLNLIGKQSVDI
FT                   AQGVDRAKPEDQGAGDQGLMFGYATDETESYMPAPIHYSHRLVERQSELRRQGLLPWLR
FT                   PDAKSQVTFRYDEHGKPCAVDAVVLSTQHDPDIEPDELREMVRREIIEQVIPAEWLSET
FT                   TKYHINPTGKFVIGGPVGDCGLTGRKIIVDTYGGMARHGGGAFSGKDPSKVDRSAAYAG
FT                   RYVAKNLVAAGLAERCEIQISYAIGVAEPTSVSINTFGTGRISDERIVELVREHFDLRP
FT                   NAITRMLDLQHPMYQLTAAYGHFGREPFEHRYTWTDTQGEEHVETFTAFPWEKLDRVDD
FT                   LRAAAGL"
FT   CDS_pept        231614..233299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligB"
FT                   /locus_tag="HELO_1198"
FT                   /product="DNA ligase (NAD) LigB"
FT                   /EC_number="6.5.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1198"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41081"
FT                   /db_xref="GOA:E1V532"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR020923"
FT                   /db_xref="UniProtKB/TrEMBL:E1V532"
FT                   /protein_id="CBV41081.1"
FT                   /translation="MLRLVVLAVWIFWPTTLLANCPDWSKGHAERELAALHDRLDAWER
FT                   AYRRNGSSPVSDDIYDQAQARFEAWQDCFPDISVDPAPTLDPPDGELSHPVPQSGLAKL
FT                   DDVVEAGAWLARRDDVWLQPKVDGVAVTLVYEQGELSQAISRGDGLSGQDWTAKARFIP
FT                   DVPDRLPTQQRLVLRGELYLKLDGHVQAERGAAGARSVVAGWLARDSLDGAKARQIGLF
FT                   VWDWPDGPKALPERLARLAELGFPDTTDWTLPAESLEAVLSQRDDWYRTPLPFATDGVV
FT                   LKQGQRPGGEARTEAPPDWAAAWKYPPRSVLARVRGVEFRVGRTGRITPLLHLVPETLA
FT                   GRSIRRVTVGSLGRWQTLDIRPGDVVTISLAGQTIPRLDSVAWRAAERPEVEPPPASDY
FT                   NALSCWHPSPGCKGQFLERLAWLGGPEALDLAGVGAGTWRSLVEAGLVKDLLDWMSLSA
FT                   ETLQAASGIGEVRGRQLVEVFATARQRPFDAWLEALGAPSGALADEATEWSTLASRDLE
FT                   QWRALPEVGETRAEALHDFFANAEVRGLAERLGEEGIAGFQASR"
FT   CDS_pept        233376..234785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahcY"
FT                   /locus_tag="HELO_1199"
FT                   /product="S-adenosyl-L-homocysteine hydrolase"
FT                   /EC_number="3.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1199"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41082"
FT                   /db_xref="GOA:E1V533"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:E1V533"
FT                   /protein_id="CBV41082.1"
FT                   /translation="MNQPAVSAPTHVDYKVADITLADWGRREIRIAETEMPALMAIRAR
FT                   YRDSQPLAGARIAGCIHMTIQTAVLIETLIDLGASVRWSSCNIFSTQDHAAAAIAAAGI
FT                   PVFAWKGETEEEFWWCIEQTVAGPDDWTPNLVLDDGGDLTALLHDQRPELLDAIHGISE
FT                   ETTTGVHRLLDMWREGSLKVPAINVNDAVTKSKNDNKYGCRHSLNDAIKRGVDHLLAGK
FT                   QALVMGYGDVGKGSAASLRQEGMIVKVAEIDPLCAMQACMDGFEVVSPYRDGINRGMDS
FT                   IDRDLLRKIDLVVTATGNIDACDAAMLRSLKAGAVVCNIGHFDSEIDTAYMRRQWHWEE
FT                   VKPQVHKVYRDSDPGEYDPESRDYLILLSEGRLVNLGNATGHPSRVMDGSFANQVLAQI
FT                   HLFERGFADLPEADKREALGVRVLPRHLDEEVARYMVEGFGGVITRMTEAQAEYTGVPA
FT                   EGPYKPDSYRY"
FT   CDS_pept        235015..235845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1200"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1200"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41083"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1V534"
FT                   /protein_id="CBV41083.1"
FT                   /translation="MPNPMPVRTLFVSDVHLGTRDCQAELLARLLRRVRPERLYLVGDI
FT                   VDLIAMRKRAVLPPAQQRLVARLLRLARSGCEIIYIPGNHDAAFRRLCGLKVHRVRIEH
FT                   RMVHATADGRRLLISHGDEFDTHVRMAPWMMALGDGMHQFVLALNRWCNRGRRLLGMPY
FT                   WSLAAALKRRSGAAQRYVAQFEQAALHQAAREGLDGYVGGHIHKAGFRARDGVLYCNDG
FT                   DWVEHCTALMEAPNGRLQLIDWRGEVIAREPAMANGLKSGEAVPDAVGAATRGA"
FT   CDS_pept        complement(235869..236417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1201"
FT                   /product="TetR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1201"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41084"
FT                   /db_xref="GOA:E1V535"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1V535"
FT                   /protein_id="CBV41084.2"
FT                   /translation="MPWRDDHKPRTRHQILDAAATLFTRHGFKGTTIDDVMRQAGLTRG
FT                   AFYAHFASKGELYAAALRHAARNNAAHLQNADPRERVLGYLSEAHRRGEDVNCPLACLV
FT                   SDVAQQDDQVREAYTRLFSGFVAHCQTAGEEALENRRRALQQAVTMIGGMAIARTLNDD
FT                   ALAEEVLDACRALANIENA"
FT   CDS_pept        236528..237187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1202"
FT                   /product="glutathione S-transferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1202"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41085"
FT                   /db_xref="GOA:E1V536"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E1V536"
FT                   /protein_id="CBV41085.1"
FT                   /translation="MTQPVHIVGPQFSTFVRSVQLCCEEKSIPYTLGTEAGGRSLAIHS
FT                   PEHYALHPFGKVPILLHGERRLIETPSICRYLDAAFDGPALQPAETWARAQTDQWTGIL
FT                   AGYVDQALVRRYLLEFVFPKGEGGTVREDAVADARPGVVKVLTLLEEQLAEEEYLVGGD
FT                   FTIADAIAAPMLDYLAGLPGAEDLFAETPRLVAYIERVRGRPAASRVLVAPDLGRG"
FT   CDS_pept        complement(237184..238116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1203"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1203"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41086"
FT                   /db_xref="GOA:E1V537"
FT                   /db_xref="UniProtKB/TrEMBL:E1V537"
FT                   /protein_id="CBV41086.1"
FT                   /translation="MPLEPGTLMGPLWTLLAFVGLGWLAARRLSVDPRPIATLLIYLIA
FT                   PLTFFRGLVLGGPTPAYLLVTGALFLCASLVALTVNRLARHALPDEESAVLAFSAGTGN
FT                   TGYFGLPVALVLLPPAGVTLYLFGVLGVTLYEFTLGFYLSARGRFSARQSLLKILRLPL
FT                   IYAFLAALAVEALGIGVPDAIMEGLEVFPPTYTLLGMMIIGMTLGRVTLRQFDWRFLGA
FT                   CVAVRYLLWPLLALGVVLGLQAMVGIPAEFAMALLLIGVVPMAANVVVVAMELGIAPEK
FT                   GALAVLITTLAAPLLIPLYLGWMAPLVGG"
FT   CDS_pept        238336..239178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metF"
FT                   /locus_tag="HELO_1204"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /EC_number="1.5.1.20"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1204"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41087"
FT                   /db_xref="GOA:E1V538"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:E1V538"
FT                   /protein_id="CBV41087.1"
FT                   /translation="MSAQQSPLDISFEFFPPNTDAGRDKLMRARDALATRDPRFFSVTY
FT                   GAGGSTQHRTLSAVKAVRECGIDTAPHLSCVGSEKAQLRDLLKRFQEDGVKRLVALRGD
FT                   LPSGMGGVGELRYANELVEFIREETGDHFEIAVAAYPESHPQAPSFERDLENFARKMHA
FT                   GADIAITQYFFTAEAYFHFVDRARALGVEAPIVPGIMPITNYTKLARFSDACGAEIPRW
FT                   IRKQLEAYGDDSEAIAAFGEEVISGLCQRLLDGGAPGLHFYTLNQAEPTLKVLDNLRT"
FT   CDS_pept        complement(239292..241475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1205"
FT                   /product="TRAP transporter 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1205"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41088"
FT                   /db_xref="GOA:E1V539"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:E1V539"
FT                   /protein_id="CBV41088.1"
FT                   /translation="MSHTPQSRDEASSDDVPTVNAEGVDEVAVEANRRLYNGWQWLLFG
FT                   TLAIAYSLFHLVSLNIYPLETWSFRILHIAGALILGYGLYAGTQFADDDGRRSAAWMRW
FT                   LSYALLIPALYALVRVVMMQQEMSAGAMRIAPEVEAWHFGYPLILATVAGILLSWSYRQ
FT                   VRERLSPADLVLMVCAMAVAGYLLVMFNSPLRASTGTSFAPMGISYAAIAGSLLILELT
FT                   RRVAGLALVIISAIFLAYVFAGPYLPGFLGYPGLSVGRFFSQVYTDAGILGPTTAVSST
FT                   YIILFIIFAAFLQASKVGDYFVNFAFAAAGRARGGPAKVSIFASGLMGMINGTSAGNVV
FT                   STGSLTIPLMKKVGYPARSAGAIEAAASTGGQIMPPIMGAGAFIMAEVTGIPYTEIAVA
FT                   AIIPAILYFLSIYCMVDFEAARKGMRGMRSDEIPRFRRLVKQVYLFAPIIILIAALFMG
FT                   YSVIRAGTLATASAAVVSWLSPNKMGLRAILTALQLAGSMSIQIIAVCACAGLIVGVIA
FT                   LTGVGARFSSLLLGLAGVSQLLALFFAMCISILLGMGMPTTAAYAVAASVVAPGLIEIG
FT                   IQPLVAHFFVFYFAVVSAITPPVALASYAAAGISGDRAMSTSVASFKIGLAAFIVPFMF
FT                   FYSPAMLMEGSWMQILRVGATATLGIVLLSATVQAWFFGPVKAWQRIVMLIGALCMIYG
FT                   GLMTDVAGLAIGIVLFLLQRGRNDGGTRSVASG"
FT   CDS_pept        complement(241563..242540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1206"
FT                   /product="TRAP transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1206"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41089"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:E1V540"
FT                   /protein_id="CBV41089.1"
FT                   /translation="MTIKTCLITGTLTGAMLIAGTAQADRADWPENFTVGTASQGGTYF
FT                   VYGSGWANLIADKLGLSGGGEVTGGPNQNLALVHNGDVAFGLTTMGPAADAVAGESSLA
FT                   PGVPMDNVCALFPMYETPFSITTLADSGIESISDIPEGASIGFGPAASTSDTYFPAMLE
FT                   TLGVEFDRRNGGWNDLGGQLQDGLIDVIAFAAGIPIPAVSQLEVQTDVNIIEFTEEEQA
FT                   KIMEEFPVSAFEIPASTYETLEKDARAVSMWNFTIAGCDLPEDFVYEVTKLSMENNDKM
FT                   RDIHRSAEFSVPENLKYNTVLPFHPGAVRWYEENGYEIPEDLKL"
FT   CDS_pept        243139..243954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1207"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1207"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41090"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1V541"
FT                   /protein_id="CBV41090.2"
FT                   /translation="MASMLMMGSVVTTPAIATEESQDLPIAVQMYTMRDHGSTEEQFAA
FT                   VNRAGIKAIETVGDHGVSAERMNELLEAYDLDIIASHVGLDEMRSDSNEVVDFNKAVGN
FT                   DTIVIPYLEEDARPDSASGWKELGKELGSMAEKLDKEDMALAYHNHDFEMQEYGDKTAL
FT                   ELLFDAAGPALKSEIDLAWVERAGLDPAEYVTRFDGRLFAVHAKDNAPQGEATEEGGFT
FT                   SLGNGVLDWETILPAVEEAGAKWYIIEHDHPLDPEDVITVGNRFLKNNL"
FT   CDS_pept        244102..245001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1208"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1208"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41091"
FT                   /db_xref="GOA:E1V542"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1V542"
FT                   /protein_id="CBV41091.1"
FT                   /translation="MVRHPLSRRRFLCNTATGTLGVLALGSLGPGALADKMPKDSALKG
FT                   NIHHSVARWTFDFLSLEELCQLVRRIGFSAIDLVGPDQWHILKRHGIDSSMCNGAEPNL
FT                   EDGWSDKSFHSALVDSYRRHIDLVSDAGYKNLICFSGNARGMSPEDGLANAEEGLKKIL
FT                   EKAEKRGVTLHMELLNSKIDHPDYLCDNSAWGIELCKRLDSPNFKLLYDIYHMQISEGD
FT                   VIRTIRENHQYFGHYHTAGVPGRHELDESQELYYPAIMRAIKETGFEGYVAQEFMPDRE
FT                   SKEDKKRSLESAIKTCDV"
FT   CDS_pept        245038..246723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lacA"
FT                   /locus_tag="HELO_1209"
FT                   /product="GMC family oxidoreductase (homolog to lactose
FT                   dehydrogenase flavoprotein subunit)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1209"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41092"
FT                   /db_xref="GOA:E1V543"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1V543"
FT                   /protein_id="CBV41092.1"
FT                   /translation="MTERHYDAIVVGSGISGGWAAKELTEKGLKVLLLERGRNIEHIKD
FT                   YKNADKEAWDYPHRDQPTQEMKEKFPVLKRDYPLNESTMGMWADEQDNPYIEEKRFDWF
FT                   RGYHVGGRSLLWGRQSYRWSPMDFEANLREGVAIDWPIRYEDMAPWYDYVERFAGIAGS
FT                   RQGLDVLPDGQFLPPIELNCVEEDVAKRIEKAFGGTRHLIHSRVANITQPKPEQNRVNC
FT                   QYRNKCWLGCPYGAYFSTQSSTLPVAMNTGNLTLRPFSIVTQVLYDKDKKRARGVEVID
FT                   AENNQTYEYTADVIFLNASTFNSTWILMNSATDVWPDGLGSSSGELGHNVMDHHFRCGA
FT                   SGDVEGYEDKYYFGRRPAGFYIPRFRNVGEDSRQYLRGFGYQGSASRQRWDREIAELNI
FT                   GADLKQTLSQPGGWTIGMTGFGEMLPYHENRISLDRSITDKWGLPVLAMNVEIKQNERD
FT                   MRKDMVQDAVDLLEAAGVKNVQGEEDDYAPGMGIHEMGTARMGRDPATSVLNRHNQVWD
FT                   APNVFVTDGACMTSASCVNPSLTYMALTARAVDHAVSELKKGNL"
FT   CDS_pept        246723..247277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1210"
FT                   /product="homolog to lactose dehydrogenase small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1210"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41093"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:E1V544"
FT                   /protein_id="CBV41093.1"
FT                   /translation="MNRRELLKMITVVTGTAMIGGNALFAYSADAKGKGRFEARDTRLL
FT                   DEIAETILPRTDTPGAKDARVGEFMTVFVTDCYTPQEQEIFHDGLAKLDALSRAEYDRD
FT                   FLSLDGSQRETLVSRLDEEAKAQVAADDTPHYFTMIKQLTLFGFFTSEVGAKEVLRFVA
FT                   VPGRYDGCAPYEPGQPAWATT"
FT   CDS_pept        247326..248111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1211"
FT                   /product="DUF1080 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1211"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41094"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:E1V545"
FT                   /protein_id="CBV41094.1"
FT                   /translation="MMEYLRPFAPRGLMLIACGSLVSAACVAADDGGQELEPWQQAEKT
FT                   EVWEPVPEPVQAPAGGVPSDATVLFDGTNLDAWEAEDGGAAQWRVENRAMTVKPGSGGI
FT                   RTREDFCDVQLHLEWRTPEDIAGMDGQDRGNSGVFLQERYEIQVLDSYENETYPNGQAA
FT                   SIYKQHIPLVNASRPPGEWQSYDVIYTAPRFDDAGELESPAYVTVLHNGVLVQNHVEIQ
FT                   GTTEWIGAPSYDEAHGCAPLYLQDHDAAVSFRNIWIREL"
FT   CDS_pept        complement(248129..248383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1212"
FT                   /product="DUF2387 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1212"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41095"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:E1V546"
FT                   /protein_id="CBV41095.1"
FT                   /translation="MATQKRFIAGAICPRCAEMDRIRSWEQNGIRYRECVSCDFFEQLP
FT                   IEEETPPELETRISQSREEPTSQSDDLQTVRILDPGQRH"
FT   CDS_pept        complement(248444..250492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="HELO_1213"
FT                   /product="oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1213"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41096"
FT                   /db_xref="GOA:E1V547"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:E1V547"
FT                   /protein_id="CBV41096.1"
FT                   /translation="MSTNPLLDAHSLPPFAEIKPEHVVPAIETLLAENREAIEALVARA
FT                   EREAPTWDTLAAPLEALNDRLSRAWSPVSHLNGTMNNPALREAYEQSLGMLSDYTTWLG
FT                   QHEGLFRAWQALKDGPAWAELDEGQCRTVDNALRDFRLAGVDLPADKKQRYGEIQARLS
FT                   SLANTFSNQLLDATQAWHLVLNDDSRLAGLPESALATLAANAEAKGQQGYRITLDFPSF
FT                   FPVMTHADDRELRREVYTAFVTRASEKGPNAGEFDNAPVMEEILALRRELAELLGFATY
FT                   ADYSLATKMADSPQGVIDFLNDLAERAVPQAREEYAELADFAREQLGLPELAPWDVGYV
FT                   SEKLRESRYAISDEQLRPYFPAPQVVNGLFKVVEKLYGVTFEEDTEAPRYHPDVRFFHI
FT                   MEKGTPIAGFYLDLYAREGKRGGAWMDECRIRREEDGTLQLPVAYLTCNFTRPVGDAPA
FT                   LLTHDEVTTLFHEFGHGLHHMLTRQTIADISGINGVAWDAVELPSQFMENYCWEREGLD
FT                   LIAGHVETGEPLPDELFDKLLAAKNFQSAMGMVRQLEFSLFDFRLHLEASAPSAADIQA
FT                   LLDEVRNSVSVVPRVDFNRFQNGFGHIFAGGYAAGYYSYKWAEVLSADAWSAFEEAGIF
FT                   DPETGRRFRTEILERGGSRDAAELFRAFRGREPSVEPLLRHSGIRAA"
FT   CDS_pept        250740..252080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1214"
FT                   /product="NSS family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1214"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41097"
FT                   /db_xref="GOA:E1V548"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E1V548"
FT                   /protein_id="CBV41097.1"
FT                   /translation="MNETLERWSSRRAFILAVTGAAVGLGNIWRFPYITGENGGAVFLL
FT                   LYVAFVILLGVPVMMAEILIGRAGRRSPMQSLGHLASEAGASGHWRWVGLFGAFTVFCI
FT                   LSFYSVVSGWSIEFLVEAVNGEFVGRSAAEIGAGFDAFLADPALMAFNHTLFLVMTMLV
FT                   VAAGVTKGLERLNNFLMPLLYLLLLVLAGHAATTSGFGEAVSWLFKPDLSAVTPMVMVH
FT                   AMGHAFFTLAVGACALMAYGAYMPDHQSLSRAAASVAVLDVTVALLAGIAIFSVVFSQG
FT                   MDPGEGPGLMFVTLPVAFAELPFGAFWLSLFFLLLLLATWTSSINLAEPMVATLQGWGL
FT                   GRGKAAAVVGLTVWSLGLLSVLSFSTMADVQILFGMNAFALVSTIPPEIFLPMGGLLIA
FT                   IFAAWVLPAPVASRALDAGPLGFSVWRNLVRWVSIPLTLVVLVSGLI"
FT   CDS_pept        252097..252645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="HELO_1215"
FT                   /product="YrdA family protein YrdA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1215"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41098"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:E1V549"
FT                   /protein_id="CBV41098.1"
FT                   /translation="MSETTTLRAWRGITPQLGERVYIDPQCMVLGDVELGDDCSVWPMA
FT                   VIRGDMHRIRIGARTSVQDGSVLHITHASDFNPDGFPLTIGNEVTIGHKAILHGCTLGD
FT                   RILVGMGAIVMDGAVVEDEVIIAAGAVVPPGKHLAGGHVYAGNPAKALRPLKEKERAFF
FT                   PYTAGNYVKLKDEYLEAAG"
FT   CDS_pept        252758..253429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1216"
FT                   /product="DUF457 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1216"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41099"
FT                   /db_xref="GOA:E1V550"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V550"
FT                   /protein_id="CBV41099.1"
FT                   /translation="MADFRTHLSVAAGGGGLLALAGWQADLWSSLQTLPVMVLTAFGGI
FT                   LPDIDSDHSHSVRLIFGVAAVLAVAAGALLLRPWLAPGALLMTCGGLYIGVRYVLAPIF
FT                   KRFSVHRGIWHSLLAAGLCGLATSAASYRLLEQPAWLAWVEGLALVLGCLIHLLLDELY
FT                   SVDLAGTRIKRSFGSAFKLFDYREPVNSVLMLLLACGTIPWLPPWSALGELWVQGSALW
FT                   R"
FT   CDS_pept        complement(253405..254787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1217"
FT                   /product="response regulator/sigma-54-interact/HTH domain
FT                   transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1217"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41100"
FT                   /db_xref="GOA:E1V551"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V551"
FT                   /protein_id="CBV41100.2"
FT                   /translation="MHDNADVPVMIIDDEAHLRITAGQTLELAGYTPRPFESAEAALAE
FT                   LETDFAGVVVSDIRMPGMDGMALLREVRRRDPDLPVILITGHGDISTAVEAMREGAWDF
FT                   LEKPFAGERLVEMVRRGSEKRRLSLENRALKAELEAQQSAPGPRLVGRTPVIQRLAAMV
FT                   QRISRVEADVLLFGETGTGKDLVARAIHERSPRGGRPFVAINCGAVPESTIESELFGHE
FT                   KGAFTGALERRIGKFEHAGGGTVFLDEIESMPLALQVKLLRVLQERTIERLGSNQPVPL
FT                   DIRVIAATKIDLKAAAEAGEFREDLYYRLNVVTLPIPPLRERREDIPLLFQHFAAVAAS
FT                   RSSMEAPPLDAAGISALLAHDWPGNARELRNLAERYVLLGVTCDYRLDMLMEGVDNNGA
FT                   ELSLPEQVELFEKQLISQALARHHGHVTDVCEHLGLPRKTLYDKLKRHNLKAEHYRHSA
FT                   DP"
FT   CDS_pept        complement(254780..256699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1218"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1218"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41101"
FT                   /db_xref="GOA:E1V552"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1V552"
FT                   /protein_id="CBV41101.1"
FT                   /translation="MVGSHRLTRRQRALRGLFAGLGLAGLALCMWQTAQVAREQALQDL
FT                   RHDAENELRLSAAGLVGHLSRHDYLPELLASREMVKRFLSSPDSQNAMPLNLLLDRFRA
FT                   TAGVSDIYLLDHQANTLAASNWHRPNTFIGENYHYRRYYQEAIQGRRGHFYGLGVQSMT
FT                   RGYYFSAPVWLDETAPNATPDGVMVLKVTLDAVEQSWAEQDAELLVTDRDGIVFMASQP
FT                   ELRLTAMTPLSDDEREALHDSRRYADEPLPHAGIQELERRDSRTRLVDFSSGPLQGQRY
FT                   LSLTRAMPDFEWDMQILKPLTPVVNAQWISALLAGGFYGLVALGGGIGWQRLRLRRERE
FT                   RFAERERRTLARVRDELERNVAKRTHDLVTTNQRLSDEIEERRRAEDSLRETRDELVQA
FT                   AKLAVLGQLAAGINHELNQPLSAIRAYAENARAFIERGRAETADANLEQIIELTERMSE
FT                   ISAQLRQFSRKSGDTLTAVSVPSCFDYALRLFQARLNELGVTVERHWQAEDIWVRADPV
FT                   RLEQVLVNLIGNALQAMADTATPHLVLTIDSTPEQVQIRVADSGPGIAEPQLSRVFEPF
FT                   FTTKSAGSGLGLGLSISGRIIDDLGGRIEADNAPGGGAMFTITLPRAPGPEARRATEEP
FT                   STHA"
FT   CDS_pept        complement(256703..257476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldR"
FT                   /locus_tag="HELO_1219"
FT                   /product="GntR family transcription regulator LldR"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1219"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41102"
FT                   /db_xref="GOA:E1V553"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V553"
FT                   /protein_id="CBV41102.1"
FT                   /translation="MSYQPVRQPRLADVITERLEGLILEGSLKPGQRLPPERELAERFG
FT                   VSRPSVREAIQKLAARGLLASRQGGGTFITEALHNGYGDPLLDMLSRHSEFHLDLLEFR
FT                   DAMESLSAYYAALRSTPTDRAMLLERFEELEACFAKRDPASEAKADAAFHLAIAEAAHN
FT                   VMLLHTIRGIFHQLERSIVDNLGHLLDKPDARQQLMAQHRALLDAILEGRAEDARTRSH
FT                   EHLVYVEEGLLEVARAETRAQRSLRRAQAMPTAPS"
FT   CDS_pept        257783..258937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="HELO_1220"
FT                   /product="L-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1220"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41103"
FT                   /db_xref="GOA:E1V554"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:E1V554"
FT                   /protein_id="CBV41103.1"
FT                   /translation="MIISAATDYRQAAKRRIPPFLFHYADGGAYAEHTLRRNVEDLADI
FT                   ALRQRVLRDMSTLSLETELFGESLAMPVALAPVGLTGMYARRGEVQAARAAASKGIPFT
FT                   LSTVSVCPIDEVASAVDRPLWFQLYVLKDRGFMRHVLERAREAGIKTLVFTVDMPVPGA
FT                   RYRDAHSGMSGRHAAIRRMLQAVTHPSWAWDVGVHGRPHDLGNVSDYRGQPTELEDYIA
FT                   WLGDNFDPSISWKDLEWIREFWDGPMIIKGILDPEDARDAVRFGADGIVVSNHGGRQLD
FT                   GVPSTARALPAIADAVKDDLAILADSGVRSGLDVVRMIAMGADTVLLGRAFVYALATAG
FT                   EAGVAHLLELFEKEMRVAMTLTGARSISDLGIDSLVAGSSRSES"
FT   rRNA            259529..261061
FT                   /locus_tag="HELO_RNA16S1"
FT                   /product="16S rRNA"
FT   tRNA            261158..261234
FT                   /locus_tag="HELO_TRNA1"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon=GAT"
FT   tRNA            261344..261419
FT                   /locus_tag="HELO_TRNA2"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon=TGC"
FT   rRNA            261627..264513
FT                   /locus_tag="HELO_RNA23S1"
FT                   /product="23S rRNA"
FT   rRNA            264599..264712
FT                   /locus_tag="HELO_RNA5S1"
FT                   /product="5S rRNA"
FT   CDS_pept        265061..266044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="HELO_1221"
FT                   /product="bifunctional biotin--acetyl-CoA-carboxylase
FT                   ligase / transcription regulator"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1221"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41104"
FT                   /db_xref="GOA:E1V555"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V555"
FT                   /protein_id="CBV41104.2"
FT                   /translation="MTIGDLIRLLSDGEFHSGEQLGERLGVSRAAVWKQLRKLESLGIP
FT                   MEAVKGQGYRLAEPLELLDGSVIVAGLPREARRCVTRLFVEEVLPSSNQFLRERFGQGA
FT                   GHGEVCLVEQQSAGKGRRGRPWVTPWGRTLMLSVGWRFESGIAALEGLSLAVGVVLSQV
FT                   LESHGVKPLLKWPNDVLLETETGGLGKLAGILVEMSGDAAGPCEVVVGIGINVDLSAAF
FT                   REGIEQPVSAVRDQAPDLARNQLAIELLARLMPLLAGFEHSGFASWQAEWNARHAFAGQ
FT                   EVDVIQGERREVAVAEQVDESGNLWVKDASRRWKLAGGEISVRGRV"
FT   CDS_pept        266041..266880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaX"
FT                   /locus_tag="HELO_1222"
FT                   /product="pantothenate kinase, type III"
FT                   /EC_number="2.7.1.33"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1222"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41105"
FT                   /db_xref="GOA:E1V556"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:E1V556"
FT                   /protein_id="CBV41105.1"
FT                   /translation="MILDLDIGNTLSKWRLKDADSSEIRSRGAVWTREEWRPGADIPDL
FT                   DVVESVRISSVARQAVLARTVSLLRHRVGGVHVARSTPEALGVTNGYEEPARLGVDRWM
FT                   GVLAGYQLAGGCCSVDCGSAITMDFVLPGGRHLGGYILPGLRLMKESLQLGTRNVAIDP
FT                   DSEADELLEPGVRTVEAVNHGIYMAAVSAVNRIYSEVCDQQGVALPLLVTGGDARVVSR
FT                   GIQAPHAVWPDMVYGGLEACFPLTAAERAGRMSGAPSVPRPVSLEKIRAGLAFSMLL"
FT   tRNA            266998..267081
FT                   /locus_tag="HELO_TRNA3"
FT                   /product="tRNA-Tyr"
FT                   /note="anticodon=GTA"
FT   tRNA            267129..267202
FT                   /locus_tag="HELO_TRNA4"
FT                   /product="tRNA-Gly"
FT                   /note="anticodon=TCC"
FT   tRNA            267233..267307
FT                   /locus_tag="HELO_TRNA5"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon=GGT"
FT   tRNA            267455..267530
FT                   /locus_tag="HELO_TRNA6"
FT                   /product="tRNA-Trp"
FT                   /note="anticodon=CCA"
FT   CDS_pept        267603..267971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="HELO_1223"
FT                   /product="protein translocase subunit SecE"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1223"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41106"
FT                   /db_xref="GOA:E1V557"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E1V557"
FT                   /protein_id="CBV41106.1"
FT                   /translation="MKHNAEVQESRHDGLKWAVVVILLVLAVVGNAYFADMALLYRVLG
FT                   VVALSVVAALVALTTTKGRELLELARNAKKEIQRVVWPTRPETIQTTAIVLVAVLVVGL
FT                   VLWLIDTLLGWAMSGVIG"
FT   CDS_pept        267980..268513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="HELO_1224"
FT                   /product="transcription elongation factor NusG"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1224"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41107"
FT                   /db_xref="GOA:E1V558"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E1V558"
FT                   /protein_id="CBV41107.1"
FT                   /translation="MSKRWYVVHAYSGFEKHVMRSLTERVKLYGMEDRFGEILVPTEEV
FT                   VEVRDGKRRKSERKFYPGYVLVEMEMADDTWHLVNETPRVMGFIGGTKEKPAPITQREA
FT                   DAILSRVKDGTEQPRPKTMFEPGQSVRVIDGPFADFNGVVEEVNYDKSRLQVSVLIFGR
FT                   STPVELEFAQVEKE"
FT   CDS_pept        268596..269027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="HELO_1225"
FT                   /product="50S ribosomal protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1225"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41108"
FT                   /db_xref="GOA:E1V5J6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5J6"
FT                   /protein_id="CBV41108.1"
FT                   /translation="MAKKVQAYIKLQVAAGKANPSPPVGPALGQHGVNIMEFCKAFNAE
FT                   TQNLEPGLPTPVVITVYSDRSFTFITKTPPAAVLLKKAAGIKSGSGEPNKNKVGTVTRE
FT                   QLEEIAQAKEPDLTAADLDAAVRTIAGSARSMGLNVEGL"
FT   CDS_pept        269030..269722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="HELO_1226"
FT                   /product="50S ribosomal protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1226"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41109"
FT                   /db_xref="GOA:E1V5J7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5J7"
FT                   /protein_id="CBV41109.1"
FT                   /translation="MAKLTKRAKLFREKVDPNKAYSLDEAVALLSELSNVKFKESVDVA
FT                   INLGVDPRKSDQVVRGATVMPNGTGKDVRVAVFTQGANADAAKEAGADIVGMDDLAEQV
FT                   KKGQLDFDVVIASPDAMRVVGQLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVRF
FT                   RTDKNGIIHTTLGKVDFDAAAIQGNLEALIADLKKLKPSTSKGVYFKKVSLSTTMGPGL
FT                   TVDHSALV"
FT   CDS_pept        269982..270485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="HELO_1227"
FT                   /product="50S ribosomal protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1227"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41110"
FT                   /db_xref="GOA:E1V5J8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5J8"
FT                   /protein_id="CBV41110.1"
FT                   /translation="MPLALEGKKAIVAEVSEAAKDALSVVVADSRGVSVDKMTDLRKQA
FT                   RENGVQIRVVRNTLARRALEGTQWECLNESFVGPTLLAFSTDHPGAAARLFKEFGKTEK
FT                   EFEVKALAYEGEFIPASDLDRLATLPTHDEAIAKLMSVMKEASAGKLVRTLAALRDQKQ
FT                   EEAA"
FT   CDS_pept        270575..270949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="HELO_1228"
FT                   /product="50S ribosomal protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1228"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41111"
FT                   /db_xref="GOA:E1V5J9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5J9"
FT                   /protein_id="CBV41111.1"
FT                   /translation="MALTKEDIINAVADMSVMEVAELIEAMEEKFGVSAAAAVVAGPGA
FT                   GGEGEAAEEQTEFDLVLTGAGDKKVNVIKAVREITGLGLKEAKGAVDGVPATLKEGMSK
FT                   EDAEEAKTKLEEAGASVELK"
FT   CDS_pept        271183..275262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="HELO_1229"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1229"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41112"
FT                   /db_xref="GOA:E1V5K0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K0"
FT                   /protein_id="CBV41112.1"
FT                   /translation="MAYSYTEKKRIRKDFGKLPQVMDVPYLLAIQLDSYYDFLQQDRSP
FT                   EERLDVGLHAAFRSVFPIESFSGNAALEYVSYRFGTPAFDVKECQLRGVTYSAPLRVKV
FT                   RLIIYDKDSSNKAIKDIKEQEVYMGEIPLMTENGTFVINGTERVIVSQLHRSPGVFFDH
FT                   DKGKSHSSGKLLYSARVIPYRGSWLDFEFDPKDNVFVRIDRRRKLPATVLMRALGMSAE
FT                   EILDEFFETSTFHIEKSGFSVDLVPSRLRGETATFDIKDGDGNVIVEEGRRITQKHIRQ
FT                   LEKSGLERLEVPMDYLFGKTLAKDQINPNTGELICPCNTAITPELLESLGQAGITTIET
FT                   LYTNDLDCGPFISDTLKLDTTGSQLEALVEIYRMMRPGEPPTKEAAETLFNNLFFTEDR
FT                   YDLSGVGRMKFNRRLRRDADTGSGVLDQRDILDVLGELINIRNGFGDVDDIDHLGNRRI
FT                   RCVGEMAENQFRVGLVRVERAVKERLSMAESEGLMPQDLINAKPVAAAVKEFFGSSQLS
FT                   QFMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVRDVHATHYGRLCPIETPEGPNIGL
FT                   INSLATYSHTNSYGFLETPYRKVTDAQVTDDVVHLSAIEEGDFVIAQASATVDENGRLV
FT                   DDLVQVRHRGETTFMRPEQVTLMDVSPRQVVSVAAALIPFLEHDDANRALMGANMQRQA
FT                   VPTLRAEKPLVGTGMERFVARDSGVCAVARRGGVIDSVDAKRIVVRVNEDEIIGGEAGV
FT                   DIYNLTKYLRSNQNTCQNQRPIVHTGDVVARGDILADGPSVDMGDLALGQNMRIAFMPW
FT                   NGYNFEDSILLSERAVQEDRFTSIHIQELTCVSRDTKLGAEEISSDIPNVGESALSKLD
FT                   EAGVVYIGAEVGPGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRAPTGMK
FT                   GTVIDVQVFTRDGVEKDSRALSIEQQQLDEVRKDLQETYRIAEDATFERLQRTLSGQVV
FT                   NGGPKLKKGDVLSDEYLEELPRQQWFKLRMQDESLNELLAQADEQLENRRKEMDERFED
FT                   KKRKLTQGDDLAPGVLKIVKVYLAVKRRMQPGDKMAGRHGNKGVISAIMPIEDMPFDDN
FT                   GESIDLILNPLGVPSRMNVGQILETHLGMAARGLGVRIEQMLRDAREQQVGEIREFLGQ
FT                   VYNTASSTKVEELDSLSDDEVIALAKNLKAGVPMATPVFDGAREHEIKHLLDLAGLPES
FT                   GQMTLYDGRTGEAFDRPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFG
FT                   GQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVEGRTKMYKSIVDGDHAMQAGMPESFNV
FT                   LVKEIRSLGIDIELES"
FT   CDS_pept        275349..279566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="HELO_1230"
FT                   /product="DNA-directed RNA polymerase beta' subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1230"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41113"
FT                   /db_xref="GOA:E1V5K1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K1"
FT                   /protein_id="CBV41113.1"
FT                   /translation="MKDLVKVLKSQSQSDEFDAIKITLASPDMIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPVKDYECLCGKYKRMKHRGIICEKCGVEVTKAAVRRERMGH
FT                   IELASPVAHIWFLKSLPSRIGMFLDMTLRDIERVLYFESFMVVDPGMTTLERGQLLNDE
FT                   QYFEALEEFGDDFDARMGAEAVQAMLKDIDLEEEIERLREEIPQTNSETKIKKLSKRLK
FT                   LLEAFQGSGNDPAWMIMEVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLNAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVITVGPTLRLHQCGLPKKMALELFKPFIYSKLQLNGQASTIKAAKK
FT                   MVERELPEVWDILAEVIREHPVLLNRAPTLHRLGIQAFEPLLIEGKAIQLHPLVCAAYN
FT                   ADFDGDQMAVHVPLTLEAQLESRALMMATNNVLSPANGEPIIVPSQDVVLGLYYMTRER
FT                   INAKGEGMVFSGLDEVERAFGTQSVSLHARVKVRLDEVIIEEEGGEKTYSRKVYDTTVG
FT                   RALLYRILPEGAPFELVDQPMKKKAISKLINEVYRRAGLKPAVIFADQLMYTGFRMATW
FT                   SGASIGVNDFVIPDAKAEIVEGAEEEVKEIEDQFSSGLVTAGEKYNKVIDIWARANDQV
FT                   AKAMMAGISKEKVVDREGNEVEQDSFNSVFIMADSGARGSAAQIRQLAGMRGLMAKPDG
FT                   SIIETPIVANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDMVITE
FT                   ADCETENGLTLHPVIEGGDIIVSLAQRVLGRVVAQDVIDPNTEEVLIPRGTLLDEKWCA
FT                   ELDTMGVDEIVVRSAISCQTPHGVCSACYGRDLARGHQVNVGESVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRASAVDSVQVKHGGKVRLHNIKHVERADGKLVVVSRSSALAVADEH
FT                   GREREYYKLPYGAELSVKDGEAVEAGQAVAKWDPHTHPIVAEAEGQVQYADMDEGVTIH
FT                   RSVDEMTGLSSIEVIESAARPMAGRDKRPMILLADETGKPVTVTGSDTPVQYLLPGKAV
FT                   VTVDNGSRIGVGEVVARIPVEATGNKDITGGLPRVADLFEARKPKEPAILAEVSGVISF
FT                   GKETKGKRRLTITPEDGDPFEMLIPKWRQIAVFEGETVEKGEVISDGPSNPHDILRLLG
FT                   IAELAKYIVAEVQDVYRLQGVGINDKHIEVIVRQMLRKVEITDAGDSDFIPGDQVELVR
FT                   VLEENARLANEDKFPAKYQRLLLGITKASLATESFISAASFQETTRVLTEAAVTGKRDY
FT                   LRGLKENVVVGRLIPAGTGLTHHAERRRKREDAERMLHPSAQDVEQELGAQLTALDSDD
FT                   DDI"
FT   CDS_pept        279746..280120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="HELO_1231"
FT                   /product="30S ribosomal protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1231"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41114"
FT                   /db_xref="GOA:E1V5K2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K2"
FT                   /protein_id="CBV41114.1"
FT                   /translation="MATINQLVRKPRKRQAAKSDVPALQACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRVRLTNGYEVASYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDT
FT                   SGVQNRKQGRSKYGTKRPKA"
FT   CDS_pept        280246..280716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="HELO_1232"
FT                   /product="30S ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1232"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41115"
FT                   /db_xref="GOA:E1V5K3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K3"
FT                   /protein_id="CBV41115.1"
FT                   /translation="MPRRRVAAKREILPDPKFGSERLAKFMNHLMISGKKSVAERIVYG
FT                   ALDRVAERSKEEPLEIFDKALETIQPMVEVKSRRVGGATYQVPVEVRPSRRQALAMRWM
FT                   VDAARRRGEKTMVQRLAGEMLDAAEGKGSAVKKREDVHRMAEANKAFSHYRF"
FT   CDS_pept        280762..282882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="HELO_1233"
FT                   /product="translation elongation factor G"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1233"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41116"
FT                   /db_xref="GOA:E1V5K4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K4"
FT                   /protein_id="CBV41116.1"
FT                   /translation="MARKTPLKRYRNIGIVAHVDAGKTTTTERILFYTGLSHKVGEVHD
FT                   GAATMDWMQQEQERGITITSAATTCFWQGMDKQFDEHRINIIDTPGHVDFTIEVERSLR
FT                   VLDGAVVVLCGSSGVQPQTETVWRQANKYEVPRMVFVNKMDRAGADYFMVIDQLKSKLG
FT                   ANVVPIQINWGAEDNFKGVIDLIRMKAIQWDEDNFGMNYELVDIPADLEETAQKYREQM
FT                   VESAAEASEELMDKYLEEGDLSEEDIKAGLRRRTLDNEIVLVTCGSAFKNKGVQAVLDG
FT                   VIEYMPSPTEVKAIEGELDDKDGTVATREADDNAPFAALAFKIATDPFVGTLTFIRVYS
FT                   GVLKSGDSVYNSVKEKKERVGRIVQMHSNSREEIKEVLAGDIAACIGLKDVTTGDTLCD
FT                   LNDKIVLERMEFPDPVISVAVEPKSKPDQEKMGTALGKLAQEDPSFQVKTDEETGQTII
FT                   SGMGELHLDIIVDRLRREFKVDANIGKPQVAYRETIRKSVEQEGKFVRQSGGRGQYGHV
FT                   HLRIEPLTAEDKGDDEDMHFKFASEIVGGVVPKEYVPAVEKGAYEQLQNGVIAGYPMID
FT                   VKVTLFDGSYHDVDSNETAFKVASSMAIKEGAPKAKAVLLEPVMKVEVVTPEEFMGDVM
FT                   GDLNRRRGLVQGMDDTPAGKVIRATVPLAEMFGYATDLRSQSQGRASYTMEFADYEEAP
FT                   SSVVEAVINQNG"
FT   CDS_pept        282912..284105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="HELO_1234"
FT                   /product="translation elongation factor Tu"
FT                   /EC_number="3.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1234"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41117"
FT                   /db_xref="GOA:E1V5K5"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K5"
FT                   /protein_id="CBV41117.1"
FT                   /translation="MAKEKFERSKTHVNVGTIGHVDHGKTTLTAALTRVSAEVFGGDAR
FT                   AFDSIDNAPEERERGITIATAHVEYQSEERHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPTIVVFLNKADMVDDEELLELVEMEVRELLNEYDF
FT                   PGDDCPIITGSALMALEGKDDNGMGTTAVANLIKALDSYIPEPERAIDQPFLMPIEDVF
FT                   SISGRGTVVTGRVERGIIKAGEEVEIVGIKDTTKTTVTGVEMFRKLLDEGRAGENIGAL
FT                   LRGTKRDDVERGQVLAKPGTITPHTKFEAEVYVLSKDEGGRHTPFFKGYRPQFYFRTTD
FT                   ITGTCELPEGVEMVMPGDNVKMVVSLIAPVAMDEGLRFAVREGGRTVGAGVVAKIVE"
FT   CDS_pept        284270..284581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="HELO_1235"
FT                   /product="30S ribosomal protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1235"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41118"
FT                   /db_xref="GOA:E1V5K6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K6"
FT                   /protein_id="CBV41118.1"
FT                   /translation="MQNQKIRIRLKAFDHRLIDQSAAEIVDTAKRTGAQVRGPIPLPTN
FT                   RERYTVLISPHVNKDARDQYEIRTHKRVLDIVEPTEKTVDALMKLDLAAGVDVQIKLD"
FT   CDS_pept        284738..285376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="HELO_1236"
FT                   /product="50S ribosomal protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1236"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41119"
FT                   /db_xref="GOA:E1V5K7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K7"
FT                   /protein_id="CBV41119.1"
FT                   /translation="MTIGLVGKKAGMTRVFTEDGASVPVTVIEVEPNRVTRVKSVESDG
FT                   YAAVQVTTGSRKAKHLSKAQAGEFAKAGVEAGRSLMEFRLDEGAEAPEVGGELTVSLFE
FT                   AGQRVDVTGTSKGKGYQGAVKRWNFRTQDNSHGNSLAHRAPGSIGMCQTPGRVFKGKKM
FT                   AGQMGNARCTVQTLEVVRVDAERNLLLIKGAVPGATGSDVIVRSAVKAG"
FT   CDS_pept        285390..285998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="HELO_1237"
FT                   /product="50S ribosomal protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1237"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41120"
FT                   /db_xref="GOA:E1V5K8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K8"
FT                   /protein_id="CBV41120.1"
FT                   /translation="MNLNLAGAGAGTVEVSDATFAKDFNEALVHQVVTAYLAGGRQGTR
FT                   AQKNRSDVRGGGKKPWRQKGTGRARAGTIRSPIWRAGGVTFAARPQDHSQKVNRKMYRA
FT                   AMRSILSELVRQERLVAVDAFGVESPKTKQLAAKLGELGLEKVLIVTEEVDENLYLAAR
FT                   NIPNVDVVDVAAADPVSLVAFDKVLVTVSALRKFEEKLA"
FT   CDS_pept        285995..286291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="HELO_1238"
FT                   /product="50S ribosomal protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1238"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41121"
FT                   /db_xref="GOA:E1V5K9"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5K9"
FT                   /protein_id="CBV41121.1"
FT                   /translation="MNQERVFKVLLGPHVTEKAAMAAERNQYVFKVADDATKPEIKVAV
FT                   QELFGKKVDRVQVLNIKGKTKRSANGLGQRKGYRKAYVTLAAGETLEDFSGAE"
FT   CDS_pept        286309..287139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HELO_1239"
FT                   /product="50S ribosomal protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1239"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41122"
FT                   /db_xref="GOA:E1V5L0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L0"
FT                   /protein_id="CBV41122.1"
FT                   /translation="MAIVKTKPTSAGRRHVVKIVGEELYKGRAYAPLLEKQSKSGGRNN
FT                   NGRITTRHTGGGHRQHYRIIDFKRTKDGVPAIVERLEHDPNRSAHIALLKYLDGERRYI
FT                   IAPRGVSAGDRLESGVNAPIKKGNTLPLRNIPLGSTVHCIELKPGKGAQLARSAGTSAQ
FT                   LVAREGNYATLRLRSGEMRKVLAECRATLGEVSNTEHSLRQLGKAGAKRWRGVRPTVRG
FT                   VAMNPVDHPHGGGEGRTSGGRHPVSPWGIPTKGHKTRKNKRTDKLIVRRRKARK"
FT   CDS_pept        287173..287448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="HELO_1240"
FT                   /product="30S ribosomal protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1240"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41123"
FT                   /db_xref="GOA:E1V5L1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L1"
FT                   /protein_id="CBV41123.1"
FT                   /translation="MPRSLKKGPFIDLHLLKKVEVAVEKNDRKPIKTWSRRSMILPNMV
FT                   GLTIAVHNGRQHVPVHVSEEMVGHKLGEFAATRTYRGHAADKKAKR"
FT   CDS_pept        287467..287799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="HELO_1241"
FT                   /product="50S ribosomal protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1241"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41124"
FT                   /db_xref="GOA:E1V5L2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L2"
FT                   /protein_id="CBV41124.1"
FT                   /translation="MEVTAKLRGARLSAQKARLVADQVRGKPVAEALDLLTFSPKKASK
FT                   LVKKVLQSAIANAEENNGMDIDELRVSTICVDEGMTLKRIRPRAKGRADRILKRTCHIT
FT                   VKVAEK"
FT   CDS_pept        287811..288509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="HELO_1242"
FT                   /product="30S ribosomal protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1242"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41125"
FT                   /db_xref="GOA:E1V5L3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L3"
FT                   /protein_id="CBV41125.1"
FT                   /translation="MGQKVNPTGIRLGIVKDHTSVWYAERGAYADKLNNDLEVRSFLEE
FT                   RLKNASVSNIIIERPANNARITIHTARPGIVIGKKGEDVDKLRRDLSQMMGVPVHVNIE
FT                   EVRKPELDAKLVAQNIAGQLERRVMFRRAMKRSVQNAMRLGAGGIKVQLSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDFATYEAKTTYGIIGVKVWIFKGEILGGIEEVRAKAKQSQ
FT                   GAPSKKKGSK"
FT   CDS_pept        288525..288938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="HELO_1243"
FT                   /product="50S ribosomal protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1243"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41126"
FT                   /db_xref="GOA:E1V5L4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L4"
FT                   /protein_id="CBV41126.1"
FT                   /translation="MLQPKRLKFRKVQKGRNRGLAHRGNKVSFGEYGLKATGRGRVTAR
FT                   QIEAGRRAITRHVKRGGKIWIRVFPDKPISKKPLEVRMGKGKGSVEYWVAQIQPGRVLY
FT                   EIEGVSEELAREAFSLAAQKFPVSTTFVKRTVM"
FT   CDS_pept        288938..289129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="HELO_1244"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1244"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41127"
FT                   /db_xref="GOA:E1V5L5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L5"
FT                   /protein_id="CBV41127.1"
FT                   /translation="MKAQEIREKSAEQLQEQLFELLREQFNLRMQKATGQLSQTHLLKQ
FT                   VRRDIARVKTVLNEKAGV"
FT   CDS_pept        289131..289391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="HELO_1245"
FT                   /product="30S ribosomal protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1245"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41128"
FT                   /db_xref="GOA:E1V5L6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L6"
FT                   /protein_id="CBV41128.1"
FT                   /translation="MAEAKKARTLTGKVVSDKMDKSIVVMIERRERHPIYGKYVKRSTK
FT                   LHAHDATNQAKAGDTVSIEECRPLSKNKSWTLVEVVEQAKG"
FT   CDS_pept        289444..289815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="HELO_1246"
FT                   /product="50S ribosomal protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1246"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41129"
FT                   /db_xref="GOA:E1V5L7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L7"
FT                   /protein_id="CBV41129.1"
FT                   /translation="MIQTQTMLDVADNSGARRVQCIKVLGGSHRRYARVGDIIKVTVKE
FT                   AIPRGRVKKGQVLKAVVVRTRSGVRRNDGSLIRFDGNAAVLLNNINEQPVGTRIFGPVT
FT                   RELRTEKFMKIISLAPEVL"
FT   CDS_pept        289830..290147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="HELO_1247"
FT                   /product="50S ribosomal protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1247"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41130"
FT                   /db_xref="GOA:E1V5L8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L8"
FT                   /protein_id="CBV41130.1"
FT                   /translation="MQKIKRDDQVIVIAGKDKGKRGTVKRVLKDDRYVVSGVNMIKRHT
FT                   KPNPMAGNQGGIVEREAPIHASNVAIFNQETGKADRVGFQVQEDGTKVRIYKSTQAQID
FT                   A"
FT   CDS_pept        290166..290705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="HELO_1248"
FT                   /product="50S ribosomal protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1248"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41131"
FT                   /db_xref="GOA:E1V5L9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5L9"
FT                   /protein_id="CBV41131.1"
FT                   /translation="MANLKERYQNEVAAQLQEQFSYANVMQVPRITKVTLNMGIGDAIS
FT                   DKKLIDNAIGDLEKLSGQKPLVTKARKSIAGFKVREGWPIGIKVTLRRERMWDFLDRLV
FT                   NIAIPRVRDFRGLNPKSFDGRGNYSMGVREQIIFPEIEYDKIDRIRGLDVTITTTANTD
FT                   EEGRALLGALNFPFKK"
FT   CDS_pept        290716..291021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="HELO_1249"
FT                   /product="30S ribosomal protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1249"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41132"
FT                   /db_xref="GOA:E1V5M0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M0"
FT                   /protein_id="CBV41132.1"
FT                   /translation="MAKKSMVEREAKRAKLVEKFSAKRAELKAIIQDVNASDEERFDAQ
FT                   LKLQQLPRDSSPVRQRNRCRVTGRPHGYYNKFGLGRNKLREAAMRGDVPGLKKSSW"
FT   CDS_pept        291054..291446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HELO_1250"
FT                   /product="30S ribosomal protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1250"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41133"
FT                   /db_xref="GOA:E1V5M1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M1"
FT                   /protein_id="CBV41133.1"
FT                   /translation="MSMQDTLADMCTRIRNAQMATKETVSMPSSKLKVEVARVLKEEGY
FT                   VTDYSVSDSVKPELSVTLKYFEGKPVIEHLQRVSKPSLRNYKGKDSLPKVADGLGIAIV
FT                   TTSQGVMTDRAARQAGVGGEVICTVF"
FT   CDS_pept        291456..291986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HELO_1251"
FT                   /product="50S ribosomal protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1251"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41134"
FT                   /db_xref="GOA:E1V5M2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M2"
FT                   /protein_id="CBV41134.1"
FT                   /translation="MSRVAKYPVKLPSGVEIKLDGDQLSVKGGQGSLSMAVHPDVAIGQ
FT                   EDGQLTFQPSESAKSWAMVGTTRALVQNLVTGVSEGFTRTLEINGVGYRAQAKGQTLNL
FT                   TLGFSHPVDYELPEGVTAETPKNTTIVLKSADKQKLGQVAAEIRAFRPPEPYKGKGIRY
FT                   GDEQVRRKEAKKK"
FT   CDS_pept        291996..292346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="HELO_1252"
FT                   /product="50S ribosomal protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1252"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41135"
FT                   /db_xref="GOA:E1V5M3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M3"
FT                   /protein_id="CBV41135.1"
FT                   /translation="MNAKKESRLRRARRARAKIRELGVHRLCVNRTPRHIYAQIISPDG
FT                   GKVLASASTLDKTLREGATGNVDAATKVGAMIAERAKQAGITQVAFDRAGFKYHGRVKA
FT                   LADAAREGGLEF"
FT   CDS_pept        292358..292858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HELO_1253"
FT                   /product="30S ribosomal protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1253"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41136"
FT                   /db_xref="GOA:E1V5M4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M4"
FT                   /protein_id="CBV41136.1"
FT                   /translation="MAKNEQQNGDLQEKLVQVNRVAKVVKGGRIFGFTALTVVGDGNGR
FT                   VGFGRGKAREVPVAIQKAMDQARRNMVKVNLAGNTLQYSVKARHGASKVYMQPASEGTG
FT                   IIAGGAMRSVLELAGVHDVLAKCYGSTNPVNVVRATVNGLTAQRSPEDVAAKRGLSVEA
FT                   ITG"
FT   CDS_pept        292864..293046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="HELO_1254"
FT                   /product="50S ribosomal protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1254"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41137"
FT                   /db_xref="GOA:E1V5M5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M5"
FT                   /protein_id="CBV41137.1"
FT                   /translation="MSATIKVTQTRSTIGVLAKHKATMKGLGLRRIGHTVELEDTPAVR
FT                   GMIHKVNYLVRVEGE"
FT   CDS_pept        293050..293484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HELO_1255"
FT                   /product="50S ribosomal protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1255"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41138"
FT                   /db_xref="GOA:E1V5M6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M6"
FT                   /protein_id="CBV41138.1"
FT                   /translation="MKLNSLSPAPGSKHAEKRVGRGMGSGLGKTGGRGHKGLKSRSGGS
FT                   VKPGFEGGQMPLQRRLPKFGFTSAKALASQEVRLAELARVEGGEVTLETLKQANVLKDA
FT                   TRYAKVILSGELNKAVTVRGLKVTKGARAAIEAAGGKVED"
FT   CDS_pept        293485..294816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="HELO_1256"
FT                   /product="protein translocase subunit SecY"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1256"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41139"
FT                   /db_xref="GOA:E1V5M7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M7"
FT                   /protein_id="CBV41139.1"
FT                   /translation="MAKSGNMPAMGSGLSELWARLRFVLLAIVVYRIGAHIPVPGINPD
FT                   QLAALFREQQGTILGMFNMFSGGALERMSILALGIMPYISASIIMQLLTAVSPQLEQLK
FT                   KEGEAGRRKISQYTRYGTVLLALVQATGMSVGLASQGIAYTADFSFYFTAIVTFVCGAV
FT                   FLMWLGEQITEKGIGNGISLLIFSGIVAGLPGAVGQAFELARNDGAWNVLPLLALSALG
FT                   IATVAFVVFIERGQRRLTVNYPRRQVGNKMYAGQSSYLPLKVNMAGVIPAIFASSILLF
FT                   PASLGQWIGAGDGMEWLQRASQALGPGQPLYILLFAAAVVFFCFFYTALVFNPKDVADN
FT                   LKKSGAFLPGIRPGEQTARYVDKVMTRLTLFGALYITAVSLMPQFLIVAWNVPFFFGGT
FT                   SLLIVVVVIMDFMAQVQSHLMSHQYESVMKKSNLKGYGSGGMMR"
FT   CDS_pept        294869..294982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="HELO_1257"
FT                   /product="50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1257"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41140"
FT                   /db_xref="GOA:E1V5M8"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M8"
FT                   /protein_id="CBV41140.1"
FT                   /translation="MKVRASVKKMCRNCKIIRRNGAVRVICSEPRHKQRQG"
FT   CDS_pept        295188..295544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="HELO_1258"
FT                   /product="30S ribosomal protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1258"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41141"
FT                   /db_xref="GOA:E1V5M9"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5M9"
FT                   /protein_id="CBV41141.1"
FT                   /translation="MARIAGVNIPDNKHAAISLTYIFGIGRTRAQEICVAAGIAPTTKV
FT                   QELSSEEVDTLRTEVGKYTVEGDLRRDVTLNIKRLMDLGCYRGLRHRRGLPLNGQRTKT
FT                   NARTRKGPRKPIRK"
FT   CDS_pept        295584..295970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="HELO_1259"
FT                   /product="30S ribosomal protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1259"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41142"
FT                   /db_xref="GOA:E1V5N0"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N0"
FT                   /protein_id="CBV41142.1"
FT                   /translation="MANPRSNRKKVKKQVVDAVAHIHASFNNTIITITDRQGNALSWAT
FT                   AGGSGFRGSRKSTPFAAQVASERAATAAAEYGVKNVDVLVKGPGPGRESAVRALNAAGF
FT                   RVQSITDATPIPHNGCRPPKKRRV"
FT   CDS_pept        295983..296603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="HELO_1260"
FT                   /product="30S ribosomal protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1260"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41143"
FT                   /db_xref="GOA:E1V5N1"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N1"
FT                   /protein_id="CBV41143.1"
FT                   /translation="MARYIGPKCKLSRREGTDLFLKSGVTPFEKKCKSEQIPGVHGQRR
FT                   QRISEYGLQLREKQKVRRMYGVLEKQFRNYYKEAARLKGATGELLLQLLESRLDNVVYR
FT                   MGFGSTRSEARQLVSHKAIAVNGRTVNVASYQVKPGDVVSVREKAKNQARIQNALGIAA
FT                   NRGDVAWVETDAKKMEGTFKALPERGDLSADINENLIVELYSK"
FT   CDS_pept        296686..297684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="HELO_1261"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1261"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41144"
FT                   /db_xref="GOA:E1V5N2"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N2"
FT                   /protein_id="CBV41144.1"
FT                   /translation="MQRSVTEFLRPRDIKVEEISAHHAKIVLEPFERGFGHTLGNALRR
FT                   ILLSSMPGCAVVEAEIAGVDHEYSAIEGIQEDVIEILLNLKDVAIKMHSRDEAVLSLNK
FT                   QGPAVVTAGDIALDHDVEVVNPEHVIAHVNEGAELKMQLKIARGRGYEPADVRGDADDE
FT                   SRAIGRLQLDATFSPVRRVSYSVEAARVEQRTDLDKLIIDLETDGTLDPEEAIRRSATI
FT                   LQEQLAAFVDLEADKEQEVEEEEDHIDPILLRPVDDLELTVRSANCLKAENIYYIGDLI
FT                   QRTEVELLKTPNLGKKSLNEIKDVLAARGLSLGMRLENWPPASLKDDKASA"
FT   CDS_pept        297724..298107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="HELO_1262"
FT                   /product="50S ribosomal protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1262"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41145"
FT                   /db_xref="GOA:E1V5N3"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N3"
FT                   /protein_id="CBV41145.1"
FT                   /translation="MRHRKSGRHLNRTSSHRQAMFKNMCVSLVEHEVIKTTLPKAKELR
FT                   RHIEPLITLAKQDSVANRRLAFSRTRSKETVGKLFNELGPRYAERPGGYVRVLKCGYRT
FT                   GDNAPMAYVELVDRPVVEEAAED"
FT   CDS_pept        complement(298255..301116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="HELO_1263"
FT                   /product="UvrABC system protein UvrA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1263"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41146"
FT                   /db_xref="GOA:E1V5N4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N4"
FT                   /protein_id="CBV41146.1"
FT                   /translation="MDKILVRGARTHNLQQIDVELPRDKLIVVTGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSTYARQFLSMMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLYARAGTPRCPEHGEDLEAQTISQMVDQVTALPEGSKLMLLAPVVSGRKGEHL
FT                   QLLAELRAQGFVRAMVDGQVLELDDIAPLDKNKKHDISVVVDRIKVREGLSQRLAESFE
FT                   TALGLADGTAVVHFMDGEAEDIAFSSRFACPVCGYSIAELEPRMFSFNNPAGACSTCDG
FT                   LGVQQFFAPDKLISHPELSLAEGVIKGWDRRSVYYFNQLQAVANHYRFTLETPWQDLAR
FT                   HERELILHGSGSDDIAFSYVNDRGRKVTREHPFEGVLPNMQRRYRETESSAVREELARY
FT                   ISTQACPACHGSRLRKEARHVYIDERTLPDVVCLPIGEALDYFQGLSLPGRRGEIAEKI
FT                   LNEIRARLEFLVNVGLDYLNLERSAETLSGGEAQRIRLASQIGAGLVGVMYILDEPSIG
FT                   LHQRDNDRLLQTLERLRDLGNTVIVVEHDEDAIRAADHVLDIGPGAGVHGGRIVAQGTP
FT                   DDIMATPDSLTGQYLARQRRIEIPPWRIPGNPEKQLVLSGASGNNLQDVTLTLPLGLFV
FT                   CVTGVSGSGKSTLINSTLMPIAARELNRATALSPAAYESIEGLEELDKVIDIDQSPIGR
FT                   TPRSNPATYTGIFTPIRELFAGTQEARARGYKPGRFSFNVKGGRCEACQGEGMIKVEMH
FT                   FLPDIYVPCDVCKGKRYNRETLEIAYKGKSIHEVLEMTVEEALEFFSPVPAIARRLQTL
FT                   MDVGLSYIRLGQSATTLSGGEAQRVKLARELAKRDTGKTLYILDEPTTGLHFEDIRQLL
FT                   TVLHRLRDHGNTIVVIEHNLDVIKTADWLIDLGPEGGSGGGRIIAEGTPEQVAQQEASH
FT                   TGRFLKPMLERAKATKSEPEATA"
FT   CDS_pept        301274..302668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1264"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1264"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41147"
FT                   /db_xref="GOA:E1V5N5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N5"
FT                   /protein_id="CBV41147.1"
FT                   /translation="MRKVSGLLLASERRAIAGLAGLYASRMLGLFMVLPVLALHADNLS
FT                   GATPLLVGLALGIYGLTQAILQIPFGLVSDRIGRKPVIAFGLCLFMIGSMVAAQADSIA
FT                   GIIIGRCLQGSGAVAAAIMALLADQTREQVRTAAMATIGLSIGVAFAVAMVLGPLVSTH
FT                   FGLTGVFWFTAGLSAVGLAVLWKLVPPAPRRSRHRDVGLDRGQLASILGRVDLWRMDVS
FT                   IFSLHLILMAIFVAVPFRLVDAGIESAQHGWVYLGVMAVAFVAMVPLVIVAEKQRRMKT
FT                   VCLGAIVAITLSLIGLAGFAEGLRGLLVWLLVFFTAFNLLEATLPSMLSKLAPAGAKGT
FT                   AMGLYSTSQFLGAFLGGVLGGWLSQQWGLSAVFAGCAMLGGVWLVLMVGMAPPRHLSSE
FT                   VVALDERYRDDALDTLMAKFADVAGVEDVLVVPEERLAYLKVDRQHLDEQALAELVARG
FT                   EKQDGV"
FT   CDS_pept        302762..303379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb1"
FT                   /locus_tag="HELO_1265"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1265"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41148"
FT                   /db_xref="GOA:E1V5N6"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N6"
FT                   /protein_id="CBV41148.1"
FT                   /translation="MARGVNKVILIGNLGQDPEVRFTPSGTAVANLNLATTDTWTDRQS
FT                   GQRQERTEWHRVVMFNKLAEISQQYLRKGSKVYIEGRLQTRKWQDQNGQDRYSTEIVAN
FT                   DMQMLDSRGGEMGGAPQGGFGGGQPQQQQQGGFGGQPQQQPQGGFGGQPQQPPQQQGGN
FT                   YGGGQPQRPPQQPAPNQGGQQGGNYGAPDPGSFDDFDDEIPF"
FT   CDS_pept        complement(303464..304630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhoA"
FT                   /locus_tag="HELO_1266"
FT                   /product="N-hydroxyarylamine O-acetyltransferase"
FT                   /EC_number="2.3.1.118"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1266"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41149"
FT                   /db_xref="GOA:E1V5N7"
FT                   /db_xref="InterPro:IPR001447"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N7"
FT                   /protein_id="CBV41149.1"
FT                   /translation="MSQPIDSIDGNRSHHAPAPNPHANPSEANTTKRALLLGYAPQTLE
FT                   ALRDELTELGVATGGTASLVHLESPEFDVAIHAPGTSSAERRQARELLGSHASLIEAPA
FT                   ALAVSRAASALEGEAPPAIDLDAYCARIGYRGPREATFHTLATLQEQHPAAIAFENLDV
FT                   LMDKGIDLAPERIDAKLIDARRGGYCFEHNALFKRALTAMGFQVDGLIARVLWQAPAGS
FT                   APNLPTHMALRVWLDDTPWLVDVGFGGNMPTTPLDMTTSAPQPTPHGLYRVLPFGDGWR
FT                   LQVWIEDRWRSLYELAPTPQLDIDYELPNWYTATHPDSHFRHRLTVALSTPEARYSLAD
FT                   QRLTVRTTDGQQTRTLLDADGLERTLHETFGLDVGPDWRPLLERIAES"
FT   CDS_pept        304874..305767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1267"
FT                   /product="homolog to dTDP-4-dehydrorhamnose reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1267"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41150"
FT                   /db_xref="GOA:E1V5N8"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N8"
FT                   /protein_id="CBV41150.2"
FT                   /translation="MKLLILDAGHCLSLALARESNRRSDVELVIEPGLDLAPERLDEVA
FT                   PDALIIPPLSHPISADPSAVTAHAEAVEACMRACRERDVPLVWCVSDQLYEEGFEGVID
FT                   EHVVPQPRDEGLRRLVSTGERIRAELPRHLIVRVGPLFALEGSHAWLGELLDSLANGEE
FT                   VRAASDVIFCPTSSDAVAMALIGMLQQQHCGADAWGSYHLAGTEPVSAYTFVSMVRTQL
FT                   ATRLEGRGESVELGSVKALSHHHDQPLRRVLNCRRVLEVFGVHQKPWRLEVGRMLDLWC
FT                   LARDEDAGTEEEPGKA"
FT   CDS_pept        305764..306528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1268"
FT                   /product="acyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1268"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41151"
FT                   /db_xref="GOA:E1V5N9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5N9"
FT                   /protein_id="CBV41151.1"
FT                   /translation="MNVIRSTVFYIGYFLAMLICGVLFLPPAPFLPLASRYRLLNLYNH
FT                   FIIAWFRLVCGVRYDVRGRERLPDGPCVLLANHQCEWETVYLQLLKPPVCTVLKKELLN
FT                   IPIFGWGLRLLHPIALDRSKPARAMKQVLTQGKQRLEEGLSVLIFPEGTRVEPGQRRRY
FT                   NKSGAVIACRAGMPVVPVAHNAGERWPGRHWVKRPGRLTLVVGEPIETVGRSAEEVLAE
FT                   TEAWIEAQLAEISEVPRPRDERPAPDGETLPG"
FT   CDS_pept        complement(306611..307825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="HELO_1269"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase FabB"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1269"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41152"
FT                   /db_xref="GOA:E1V5P0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P0"
FT                   /protein_id="CBV41152.1"
FT                   /translation="MRRVVVTGLGIVSCLGNDAQQVLEALRLGRSGIRFKDDYAERGFR
FT                   SQIAGVVDIDLEALVDRKLRRFMGDAAAYAYVSMAQAIEDSGLAPDQVSNERTGLIAGS
FT                   GGASSANQVEAADVMREKGLRRVGPYRVTRTMGSTVSACLATPFEIKGVNYSISSACAT
FT                   SAHCIGNAMEQIQLGKQDVVFAGGGEEEHWTLSCLFDAMGALSTHYNESPEQASRPYDQ
FT                   SRDGFVIAGGGGMLVLEELEHAKARGAKIYAELVGYGATSDGHDMVAPSGEGAVRCMRQ
FT                   ALATVDGDIDYINTHGTSTPVGDVAELKAVREVFGDTTPAMSSTKSLTGHSLGATGVQE
FT                   TIYSLLMMEHDFIAASANVENLDEQAAGFDIVTERRDASLERVLSNSFGFGGTNACLVL
FT                   QRYRD"
FT   CDS_pept        complement(307839..308354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="HELO_1270"
FT                   /product="3-hydroxydecanoyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number="4.2.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1270"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41153"
FT                   /db_xref="GOA:E1V5P1"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P1"
FT                   /protein_id="CBV41153.1"
FT                   /translation="MTKQHSFDREALLACSRGELFGPGNAQLPAPNMLMLDRIAHIHEE
FT                   GGEYGKGEVIAELDIHPDLWFFDCHFPGDPVMPGCLGLDAMWQLVGFYLGWLGHPGRGR
FT                   ALGCGEVKFSGQIHPDAERVTYRINIKRIITRRLILGMADGTLAVDGRDIYQANDLRVG
FT                   LFTSTANF"
FT   CDS_pept        complement(308422..309930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phrB"
FT                   /locus_tag="HELO_1271"
FT                   /product="deoxyribodipyrimidine photo-lyase"
FT                   /EC_number="4.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1271"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41154"
FT                   /db_xref="GOA:E1V5P2"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P2"
FT                   /protein_id="CBV41154.1"
FT                   /translation="MPPSLIWFRSDLRVHDNTALAAAASEGPVVAVFLRSTAQWLEHGH
FT                   GANKLDFWHRGVLALRAALHGLGIPLLHRDIDDFAAAPDALLALARETGARRLHFNHEY
FT                   PLNERRRDASVVDAFEAAGLSAVGHHDGVAFAPGELRTGKGDFYGIFTPFAKAWHRQVT
FT                   PERLALRDLPAIQASLPVASDPEPELPALDTAPAAPENWPAGENAAADRLERFLRWRAR
FT                   HYAERRDFPAESGTSSLSPYLALGMISHRQCLQAALAENDGGLAEGDAGLTAWVNELIW
FT                   REFYQHVVVGFPEVCRHRAFQAHTEALPWRDDTSAWRAWTEGRTGYPLVDAAMRQLRAT
FT                   GWMHNRLRMVTAMFLAKHLLIDWRHGERFFLHHLVDGEFAANNGGWQWAASTGTDAVPY
FT                   FRIFNPITQSRRFDPDGRFIAEWLPELADLPAKERHDPSPEQRAARRYPMPIVEHRAAR
FT                   ARALEAFKGLGPEEARQGHESPPAHPETRQPARAACIRRTRTVD"
FT   CDS_pept        complement(309984..310913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1272"
FT                   /product="MerR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1272"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41155"
FT                   /db_xref="GOA:E1V5P3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P3"
FT                   /protein_id="CBV41155.1"
FT                   /translation="MNDKANLPGDTPRYPIREVSRLTGVNSVTLRAWERRYGLLRPHRT
FT                   PKGHRLYAREDIERVERILQWLHRGVPVSQVRELLEQPDTPARYRPGVDDWASQRQQLI
FT                   AAVEALDTVRLDELFNQSLALYPADVCVEKLWQPIIHSLEERWDDRLGASLQRRTLETF
FT                   LRTRIGTRLYHANSRADKAHVLVAPLPEADSPLTGLLAALLISEQGHRVQWLDAPLPLQ
FT                   ELNLAVERLDVDALLLASGKAEKPDLMRRQLPRLADQLGVPLALCGPVARIRASDLADS
FT                   RVATLGDDLPVAASRLDALLTDTARDED"
FT   CDS_pept        complement(310997..311365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1273"
FT                   /product="CbiX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1273"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41156"
FT                   /db_xref="GOA:E1V5P4"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P4"
FT                   /protein_id="CBV41156.1"
FT                   /translation="MNKALILMAHGSSDPRWREPFERVYQALGERLATPLRLAYMELSE
FT                   PSLETTVAELADAGTERAEILPLFFAAGRHLRKDVPAQVEALGTRHPDIALTLLPPVGE
FT                   HPDFIEALAAVIAERAGE"
FT   CDS_pept        311504..312412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1274"
FT                   /product="YfcH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1274"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41157"
FT                   /db_xref="GOA:E1V5P5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P5"
FT                   /protein_id="CBV41157.1"
FT                   /translation="MRVLITGGSGFVGQALCPLLKESGHRPMVVSRTPERVRDRLPSGT
FT                   DIRRSALDFVDTPPDAIVNLAGEPIAARRWSEAQKERLIDSRVNITHELVTLCEQLSHT
FT                   GTAPRVMVSGSAMGFYGDQGEREVDEETPPHDEFAHRLCRRWEEAAQDVTEYGTRLAIL
FT                   RIGLVLDQGGGTLQRMLPPFRLGLGGRFGHGRQFMPWVHRQDLVRMIVFLLEHEAHEGA
FT                   FNGSAPQPVTNAEFTRQLAQRLNRPALLPVPAWVLESVFGEMSRLLLTGADMRPRRFEQ
FT                   AGFTFRFPTLAEALDDIIGRG"
FT   CDS_pept        complement(312460..312933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1275"
FT                   /product="cytidine deaminase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1275"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41158"
FT                   /db_xref="GOA:E1V5P6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P6"
FT                   /protein_id="CBV41158.1"
FT                   /translation="MLDDTDMAHLRRCVALAAEALEHGDEPFGSVLVGADGKVLAEDRN
FT                   RIAGGDSTRHPEFALARWAAENLPAESRAAATVYTSGEHCPMCAAAHAWVGLGRIVYAS
FT                   STAQLTAWLNEWGIAPPPVRPLPIQDIAPGIEVDGPAPGLDDEIKALQRRCHA"
FT   CDS_pept        313143..313775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1276"
FT                   /product="LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1276"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41159"
FT                   /db_xref="GOA:E1V5P7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P7"
FT                   /protein_id="CBV41159.1"
FT                   /translation="MEISEWLLFVVVASVAIMSPGPAVLVAMRNSLNGGARRVMVSSLG
FT                   NIVGLVCVAGLATLGLGAVLHTAEWLFSLIKVLGAAYLVYLGIRQCRAETPLLSAASVT
FT                   AQRGWSRWRTFLEGYLVAISNPKAILFFSALFPQFIVPESALVPQFALLIATFMMMSFM
FT                   TLVGYGLLARRLVSQLRSPRWTRYIQRLMGSLFIGLGISLFRARLPA"
FT   CDS_pept        complement(313887..316820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rapA"
FT                   /locus_tag="HELO_1277"
FT                   /product="RNA polymerase-associated protein RapA"
FT                   /EC_number="3.6.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1277"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41160"
FT                   /db_xref="GOA:E1V5P8"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR022737"
FT                   /db_xref="InterPro:IPR023949"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="InterPro:IPR040765"
FT                   /db_xref="InterPro:IPR040766"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P8"
FT                   /protein_id="CBV41160.1"
FT                   /translation="MSDFSPGQRWISDGEAELGLGTILNCDNRSVTVLFGASQETRTYS
FT                   SRQAPLTRVVFGSGDRIQSTDGWHLIVDDSKEANGLITYIGENEQGELCELPEAKLADT
FT                   MQFDQARDRLLTGQVDRNDWFDLRFRTLHHHHRVEQNPALGLAGPRVDLIPHQLYIADE
FT                   VARRPSPRVLLADEVGLGKTIEAGLILHRLLLTGRAERALILVPASLTHQWLVELLRRF
FT                   SLEVTLLDEQQSLAHGDANPFEAGQLILASQDWLFADPHRQAQAEACDWDLLIVDEAHH
FT                   LEWSEERVGPGYACVERLAGSVPGILLLTATPEQMGQESHFTRLRLLDPDRYHSLADFQ
FT                   EEERHYIEVAEAIDALERLPGQEEDRQRVAAVIHEADSQALLDTLASSESDAAQRDAAR
FT                   DQLRDQLLDRHGTGRVMFRNSRRHVGGFPERRLHVDHLEPPAAYRRVLRRLSRDEDYLD
FT                   ELLIESGLDHPEVLVYLDTMYRALANDPLNAEPWWQIDPRVTWLLERLTELGDDKVLVI
FT                   AHDRETAIGLSEGLRVLGGMHAPVFHEGLSLVERDRAAAAFADEEEGCQVLVCSEIGSE
FT                   GRNFQFCHHLVMFDLPLHPDQLEQRIGRLDRIGQRHPIEMHVPVFTDSPGERLLRWYRD
FT                   GMDAFSAPHGLGSDIYAAFGDALADALLDEEALEEVIDETRSFFESRLAERDAGRNRLL
FT                   ELNACRHERAEAVISSIHELDTDRALRRYIDQALDIFGVDSQDLGGDIQLLQPSPQMLD
FT                   GLPGLVKGEEGFSATFSRERALARDDVQHLSWEHPLTREMMARILEGSMGNTALALLKH
FT                   PSIPGGRLMAELVFRTHCPAPKRLHLNRFLPPTAVRVLLDESGANLTDKISFSGLSKNL
FT                   NKVKKAVARDLIKSRHDQLRELLDRAETEAERELPSIVEAAQDRMRTALDAELARLEAL
FT                   ARRNPSVREDELTALRDERATLDAAIEGTRLRLDAVRVIVTVDEDSR"
FT   CDS_pept        complement(316943..317743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="resA"
FT                   /locus_tag="HELO_1278"
FT                   /product="thiol:disulfide interchange protein ResA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1278"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41161"
FT                   /db_xref="GOA:E1V5P9"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5P9"
FT                   /protein_id="CBV41161.1"
FT                   /translation="MDAIALGPVLLPLPRLYALAVTLLLLALSAFLLGLPRQRHVRWFN
FT                   GLLIVWLVAARLGHVALHPAAYAEAPLDILKLWQPGFQGVVGLLAALAWTLWSLRDRLG
FT                   ALLGATGLTIGASLLWLALMALAPLGGGMALRQLPDITLENLEGESVELSSLSGEHVLI
FT                   NLWATWCPPCRREMPLLDEVDDREDVTVVVVNQGEDLLPVVRYLDEQGLEFSHALLDPR
FT                   QQLMVESASPGLPTTLLFDAEGRGVTQHVGELTRATLDDWLGAR"
FT   CDS_pept        317865..318080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1279"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1279"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41162"
FT                   /db_xref="GOA:E1V5Q0"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q0"
FT                   /protein_id="CBV41162.2"
FT                   /translation="MAQPAFDTLRALAIASQALGFILIITLETVMGDAARPWQGWTLAA
FT                   MVVAALWIALVRLYRRNKARKRRDMS"
FT   CDS_pept        complement(318096..318698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1280"
FT                   /product="LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1280"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41163"
FT                   /db_xref="GOA:E1V5Q1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q1"
FT                   /protein_id="CBV41163.1"
FT                   /translation="MIEILAYAIGVMYTPGPVNLFALNSGLNGRFASSLGFFAGVGTAM
FT                   LLLLLLFGWVGARWVRGDGLMVISALGCLYIAYLALKVMRAEVNIDGATQGTRLRFRDG
FT                   LAMQLMNPKGLLATLPIATLQFPHAGIEGPALLFASLGLAVLASGAPGSYALAGFLAGR
FT                   RLGDPRVFKALNRVMALLLIGVAGSIGYEHVYLPLHA"
FT   CDS_pept        complement(318712..319542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1281"
FT                   /product="AraC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1281"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41164"
FT                   /db_xref="GOA:E1V5Q2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q2"
FT                   /protein_id="CBV41164.1"
FT                   /translation="MTQRSQFRFTRSRHVPGLTMLRAAMSDFSYDRHAHEEYAFGVTLA
FT                   GRQDFFSSGEYHRSRPGTVIELNPDEVHDGQAGSDATLDYVMLYADPAQLAPLFASAAG
FT                   RESASQFRATETLLHDDTLRGEILDLARRIDTDTGSRIDQEYALYRIAARLIQRTGNLD
FT                   EEVSTGRTDKLLERAKAFIHAHAEHDLSLEEISQAAHLSKYHFLRLFRRQFGITPHQYV
FT                   LNCRVNAARSALDAGHELNDVVGRYGFADLSHFNRRFKRIYGMTPRQYQRNVIV"
FT   CDS_pept        complement(319676..320281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1282"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1282"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41165"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q3"
FT                   /protein_id="CBV41165.1"
FT                   /translation="MTADDVVVLVLAAGRSRRFGRDKRTARLADGRPLLAATRESVSRT
FT                   YPLQRLILREGEGPASLGLSPSVPYWRVPSSIREGLGTSLGHAVRTACLDPELAHCRAL
FT                   AIWLGDMPWIAPATSEALLTQARDDTILRPTHDGQPGHPVLFGRTFWPELSNLTGDQGA
FT                   HELLVRHRERCHHLPVDDPGVLRDVDRPQDLDRSSLRP"
FT   CDS_pept        complement(320278..321231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1283"
FT                   /product="DUF182 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1283"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41166"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q4"
FT                   /protein_id="CBV41166.1"
FT                   /translation="MPPLDLATLESALSWARQGHDVWLCTVLATFGSSPRPPGALLAAT
FT                   RDGQHVGSLSGGCVEDDFLTRLASGEFDAAPRLVSYGANGEQGLQLPCGGVLEVLVERF
FT                   PAGEASTTLLAAMRDILRGAPPRLREVALDDGATRLLDDDGLGPRVERTHDHVRLRLAP
FT                   THRLIIAGISPVARFCAEFARALDFEVIVCDPREEACRTFDIEGVQVVQRLPSSLIPEA
FT                   SHDGTAVVALTHDPRIDDLAMIEAVRTPAFYIGVMGSHRTSEARAERLRRSGGLDEAQI
FT                   DRLHMPIGLDLGSKTPAEIALAVMADILRVQRGRQP"
FT   CDS_pept        complement(321218..322438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1284"
FT                   /product="probable oxidoreductase cytochrome subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1284"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41167"
FT                   /db_xref="GOA:E1V5Q5"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q5"
FT                   /protein_id="CBV41167.1"
FT                   /translation="MRRLLIGILLVPGLTAQAADDESLIERGRYLARTADCAACHTAEG
FT                   GAPFAGGVPIASPFGTIYGTNITPDPDYGIGEYSADDFYHALTEGETPSGRQLYPAMPY
FT                   TSYHLMRREDADAIYAFLMSREPIARAAPETDLSFPYNQRWGVAFWNLIYADALEPDAS
FT                   SSQSSAWQRGQYLVEAMGHCGECHTPRSWTGAMDLDRHLEGGSLAGYRAPSLEAEALAE
FT                   RGWNRDDLAHFLKNGMSPQGSVFNEMFPVMHHSTQYLTDEDLSAMATYLLGDTPPEARR
FT                   IEPRPLEALSDSARRGRQSYLDTCAGCHGGDGQGKPQVAVAMNGNTTLRLENPTNLLRV
FT                   MLDGIEARDFPGFARMQEMPGFAAHLSDAELADLGNYLRETWGGRPGDIAPEDVADLRE
FT                   DSAHAAP"
FT   CDS_pept        complement(322439..322987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1285"
FT                   /product="probable iron-sulfur protein (2Fe-2S)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1285"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41168"
FT                   /db_xref="GOA:E1V5Q6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR019480"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q6"
FT                   /protein_id="CBV41168.1"
FT                   /translation="MAELSTRPLRLTINGQAVGPVEVPDDLMMIDFLHEYQGLTGSRLG
FT                   CGQGICRACVVILDHDDGTSEEMRICITGAHFFHGKRIRTIEGHAEHGDDGDVVALNPI
FT                   QRKFVDHFAFQCSYCAPGFVNAATVLVERLEREPVARADLEATIDQALGHHICRCTGYV
FT                   RYYQAAKAAIEELGLVKEG"
FT   CDS_pept        complement(322980..325769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1286"
FT                   /product="probable oxidoreductase,
FT                   molybdopterin-containing"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1286"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41169"
FT                   /db_xref="GOA:E1V5Q7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q7"
FT                   /protein_id="CBV41169.1"
FT                   /translation="MKYPRLSRRAFLKGSATGIGITVAPLGSRAFAALFEPRVTAARDQ
FT                   WASPSGAHFRIDAISKVSGAKVFARDIRARDMPGWPQQQSHAMLLKATRADRTYQGFDL
FT                   SLLDDGLQPDRIVTSADLEQDGVGFPESHGPDPLLPEGKTPLFLGHPVAILIWHDFARY
FT                   RAAKNALQFRDDLIHYGAKTGEVERPPYGSFRYVRVGGETPYDPDVFSSLKDSDLFPTI
FT                   KNRRPVWPDDPSLNGDIGEQGVYHARRMQDTLDDPPDNWEVFQARYTTPYIEPAALEPD
FT                   NGNGWLDPDTGTLNFVVATQCPFESAHETARMLEGSRFDVRHLNVHPGYTVGYGSKDHN
FT                   IFVYYAVIAALYGDGHPVRLANDRFEQFQSGIKRHPFDMDYRLAVDRDSLKFQIFRAHM
FT                   DVNGGGRANYSASVAAVGATAAQSVYYLPRSDLATTAYPSRAVEAGSMRGYGTLQTMAA
FT                   TEMMVDELAERLDVDPIELRRANVLEAGMKNTQGAIPGGAIRVGEMLDKAKLHPLWKER
FT                   TERRDKRQAEDPDHLYGTGFAISHKDFGTGAEAPMASVEIDAEGRIRLRQIAIDMGTGT
FT                   ATSQAMNVVDFLGRPADDIKTGETDWPELALETSGNPYTMQQAEQDRLSRNPRWTPRLA
FT                   SPSSASNSAYYSSHATREAARLVFRHGLWPAALSIWGQGIYGGQANPYVVRLEDARWVE
FT                   GHLTASGMTPIPLAKLAAKAHEMGLVTAASVHAFNRWSWASAEFPLGDETPRLPLDAVA
FT                   VKYGDDDYHLLDRRDVRYPDVQLNNAHVTYYSPVATLVDLRVNKGSGEVEILEHYSWVE
FT                   CGKPIVPELVKGQLEGGIAMGIGHALLEEMPLYEDGPGNGTWNFNRYQLPLARHCAVWK
FT                   QGSEILPPLSDTDPAKGMGEVVMIPIVGAIVNALAHATGQRFRDLPVTPERIKEALHG"
FT   CDS_pept        complement(326091..326906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dkgB"
FT                   /locus_tag="HELO_1287"
FT                   /product="2,5-diketo-D-gluconate reductase"
FT                   /EC_number="1.1.1.274"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1287"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41170"
FT                   /db_xref="GOA:E1V5Q8"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q8"
FT                   /protein_id="CBV41170.1"
FT                   /translation="MSTQQTLPNPGLGTYRLEGDTVRRVIDTALKLGYRHIDTAQFYDN
FT                   EADVGAAIAASEVPREEIFLTTKVWFDRLQPADLKASVDESLEKLGTEYVDLLLIHWPS
FT                   PGDEVPMADYLTALSEVQQAGKTRHIGVSNFTRAQIDQAVDILGAGALLTNQIEVHPFL
FT                   QNRDLVAHCKRHDIAVTAFMPLAVGKVMEDPTLQRIAEAHDATPAQVAIAWLNQLDIVT
FT                   FPSSTKETNLRRNIEALDITLSDEEMAEIATLDRGERIANPEIAPDWDQ"
FT   CDS_pept        complement(326992..328239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1288"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1288"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41171"
FT                   /db_xref="GOA:E1V5Q9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Q9"
FT                   /protein_id="CBV41171.1"
FT                   /translation="MPIALFALTLSAFAIGTTEFVIVGLVPTIAQDLGVSLPSAGLLVS
FT                   LYAVGVAIGAPVLTALTGRFNRKWVLLGLMALFIAGNLLAWRAPGYESLIVARVLTGLA
FT                   HGVFFSIGSTIATGLVGKDKEARAIAIMFTGLTVALVTGVPLGTWIGQHLGWRATFLAV
FT                   SGLGLLALLGSALLVPGNLERAAPAGITRQFRVLAQPRLLLVYAITILGYGGTFTAFTF
FT                   LAPILENISGFGSGAVSLIMLVYGASVAVGNLYGGMLADRLGAIRALTWIFGGLASLLL
FT                   IFSVTAGHPIAAVLTILVWGAFAFGNVPGLQVYVVQLAERHVPESVDVASGLNIAAFNI
FT                   GIALGSVIGGRVVDAMSLTDTAWIGALIVVLALIATRWSGALDARRSSPLDGPEHPPHM
FT                   GNSAQTHHESSNLLSD"
FT   CDS_pept        328383..329270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1289"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1289"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41172"
FT                   /db_xref="GOA:E1V5R0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R0"
FT                   /protein_id="CBV41172.1"
FT                   /translation="MRTRSEDLELLLAVVDSGGFSAAAGRLGVPVARVSRAIQRLEREL
FT                   AAPLLNRTTRSVALTEEGSEFVARVREGLEALNAAEEGLVTRREQPSGRLRVDAASPFV
FT                   LHQLVPLVAEFRERYPSIQLELSASDDIINLLEQRTDVAIRIGALEDSTLHARPLGRSP
FT                   LYLVASPAYLDTHGRPTAPAELGRHERLGFIGPATLNRWPIEGLASWDITPTLAASSGE
FT                   VVRHLCLAGHGIAYLSNFMIRADIDAGRLETVLDDYTLHGGPRERVQAVYYRNTAMSSR
FT                   IQAFLDVMAPRLTL"
FT   CDS_pept        complement(329245..330192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1290"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1290"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41173"
FT                   /db_xref="GOA:E1V5R1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R1"
FT                   /protein_id="CBV41173.1"
FT                   /translation="MSRRKEALGGQVSDADLRLLRIYRKVVECGGFSAAEVELNISRAA
FT                   ISMAMNDLETRLGLRLCQRGRSGFALTDEGTEVFDASLQLLASVEGFRTRVNGLHARLK
FT                   GELNIGITDNLVTMPEMLITDALSALKERGPDVRINIRMIPPNDIELAVLDGQLHTGVI
FT                   PTLKPLPGLQYRALYAEASQLYCASGHPLFDAEHVTEEQLAQCDAVVPAYAQTPEIKAL
FT                   HEPLKAAASATDREGIAFLILSGRYLGYLPTHYAERWVRDDRMRALNPRECHYLTHYSA
FT                   ITRKGAPPNLVLESYLEELERLSRLESTESNEGP"
FT   CDS_pept        330362..331705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1291"
FT                   /product="beta alanine--pyruvate aminotransferase"
FT                   /EC_number="2.6.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1291"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41174"
FT                   /db_xref="GOA:E1V5R2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R2"
FT                   /protein_id="CBV41174.1"
FT                   /translation="MSDQNRARAAGLSPEQLDAYWMPYTGNRQFKRDPRIIVGAEGSYL
FT                   KDAEGRRIYDGLSGLWTCGAGHCRPEITEAVSRQLGELDYSPAFQFGHPKAFELAHRLS
FT                   ELTPAGLNHVFFTGSGSESADTSLKIARAYWRKKGKPAKTKLIGRSKGYHGVNFGGISL
FT                   GGIGANRVLFGQGVDADHLPHTLLKENAFTRGMPERGADQADELLELIALHDASNIAAV
FT                   IVEPLAGSAGVIPPPKGYLQRLREICDQHDILLIFDEVITGFGRMGSMTGAEEFGVVPD
FT                   IINVAKQLTNGAVPMGGVIVRDEIYQTFMEQGGPDYMLELPHGYTYSGHPVACAAALAA
FT                   LDVLENDRLIERVREMSPVFEEALHGLKGSRYVSDIRNYGLAGALQIEPYPGEPARRPF
FT                   EIAMKCWEKGFYVRYGGDTIQLGLPFIVEREEIDRLINALGDALGELD"
FT   CDS_pept        331895..333385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA2"
FT                   /locus_tag="HELO_1292"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (CoA-acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1292"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41175"
FT                   /db_xref="GOA:E1V5R3"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R3"
FT                   /protein_id="CBV41175.1"
FT                   /translation="MTTLGHLINGSRVAGEGRTQDIFNPSTGEVGGQVSLASKATVEEA
FT                   IAAAEAAYPAWSSTPPAKRARVMFNFKQLLEQNADEIARLIGQEHGKIVHDAKGELQRG
FT                   IENVEYACGAPELLKGEHSKNTGPGIDSWSEFQPLGVVAGITPFNFPAMVPLWMYPMAI
FT                   ACGNTFVLKPSERDPTSALYIAELALEAGLPAGVLNVVNGDKEAVDTLLDDARVQAVSF
FT                   VGSTPIAKTIYQRASANGKRCQALGGAKNHAIVMPDADMDNVVDSLTGAAFGSSGERCM
FT                   ALSVAVAVGDEAADAMIDKMQGRMKTLKVGPFHDAENDFGPVITKAHQEKVCGYIDSAE
FT                   QQGARVVVDGRGVQVPGHENGFYVGGTLIDRVTPDMTCYLEEIFGPVLLVVRANSMEEA
FT                   MQLIDDHEYGNGTCIYTRDGEAARYFSDRIQVGMVGVNVPLPVPVAYHSFGGWKRSLFG
FT                   DLAAYGPDAVRFYTKRKTVTQRWPSAGVREGAQFSFPS"
FT   CDS_pept        333730..336957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1293"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1293"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41176"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R4"
FT                   /protein_id="CBV41176.1"
FT                   /translation="MTSPTSSPLVQAERILSFWHKVEFFESTELKDIDHGKGAIHYRGD
FT                   ELVEFPNCLPWLNPQRVRRAGGGYRPDKPYRFKLYLGLFQRAEIFHVARDAYPEKTEAW
FT                   VERSRDEGLTCSMTMDVDENGLVDRESFAISTAPWMLGALQRGSLDDVTLEAFDEATSR
FT                   FREQLNTILTVADNLKGEHGLPLKLTTFELIEMLKSMESWTAFAPQSDVPVLVAQVLPP
FT                   RKNASVERTDDLALEWSVMADLAPRLESLDQEDLVVQGSHPELDEAPAAINEVAILNSF
FT                   FIRDLEKVMEQVRERGLAPGSPLAHYLQGDCERHPDLLLPEARSLLMRHLAPQRMPDGR
FT                   WPGEDAHAMSLMQQFAINTIDEELSETGLYSVNGPPGTGKTTMLRDLVARNVVKRAEVL
FT                   SSLGGAEAAFGEDIHANIDGDTVIKTLIPELTGFEMVVASSNNAAVENVTQELPQSKAL
FT                   GKTYGELAFLKPVGQKLAANHERQNNKGLYVEPLPAEKDCWGLIATSLGNSRNRRIFLE
FT                   RVFFTPIEQCSTNNDAANYSTLVPALKALAEGRDTRQDFRAAQRAFQKAQQQVQAAQAD
FT                   LQRLLDLQRLESQTEAARRQAEFHRRFAARVALWLSNRQTQPLPLWPLGGHIRNWLTIQ
FT                   QIKRRSERAEQQAKISEQRFDSLARQLETSQRECAPLQEKYGDALLLDEALDLEAAEVQ
FT                   RTSFGHCEALNQVRAQLTARAFELHEAWLVAAYAGKNRLWPTIQSLKGVLNGEIQDRDA
FT                   AKAVWQMLFMIVPVISSTFASVANQFRALNEGEIGWLFVDEAGQATPQQAVGALWRAKR
FT                   AVVVGDPLQIEPVFTVPAGLVEAMAKGEFDRDWYKWSPTVSSVQVVADRANPYGTHEIS
FT                   ESLWVGSPLRVHRRCDEPMFSIANRIAYNDKMFHGDDNLPPGPGDSRWFNVAGETSDKH
FT                   FVPAHAQWIAHMLNRHIEKSGEKPSVYVISPFKAVARGVRNHLSMELKTDAFGGQEALD
FT                   RWLRERVGTVHTFQGKEEDSVILVLGLSTDSPGAAEWASSKPNLLNVALTRAKKRVYVV
FT                   GSTAIWGGKKYFSEAQRALPIDQRGSA"
FT   CDS_pept        complement(337273..338724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1294"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1294"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41177"
FT                   /db_xref="GOA:E1V5R5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R5"
FT                   /protein_id="CBV41177.1"
FT                   /translation="MQHLTRQFIDNQWVESHGLRRLAVTDPYHQCQIAEVTAGDPADVD
FT                   AAVAAARRAQPAWQALGGDGRAPYLEAFATLLEQRRESLMRLSSTNNGKALAETAIDLD
FT                   DAIACYRYYAGQARALEARQGRLVEHGMDGVAARTYEDPAGVVGLITPWNFPLVTSAWK
FT                   IAPALAAGCTVVFKPSEVTPLPEQTLADIAEAIDLPAGVLNLVHGDGEGIGAPLTAHPG
FT                   VDKLSFTGSNRVGESVMRAAAEGVRGVSLELGGKSPILVLDDAEVEQAADWVMAGIYFN
FT                   SGQICSATSRLLVHHSLADALYDALGRRIDAIRLGDPLGDDTDMGPMTSARQRQSVEDY
FT                   LAIAAEEGLVAVRDARHRTLPEQGEFIAPTLFRDVPTDSRLWREEIFGPVLCARSVESE
FT                   AEAIELANDSDFGLAATVISGDSERAQRVGRALRAGSIWFNSEQLVMPEAGWGGFKHSG
FT                   IGRELGPWGLAAYLEVKHLIGPVSQ"
FT   CDS_pept        complement(338857..340176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1295"
FT                   /product="NCS1 family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1295"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41178"
FT                   /db_xref="GOA:E1V5R6"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR026030"
FT                   /db_xref="InterPro:IPR030191"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R6"
FT                   /protein_id="CBV41178.1"
FT                   /translation="MMNDTSSFLGQDTLAAEHVEHSLGLPGTFALWLGANVVVTTILTG
FT                   MLLVPNLTFGHAMLLVLVGSAVGIIPLVLIGLMGQQTGMTTMVLARGTFGRRGAMFPAW
FT                   VNLLALIAWSWIQALLAGMSLDHAVSSLTGYSNVALFTVLCEGLVVLITLRGHLGIEKA
FT                   EKLAAVLMLILSSVVVFALAKNYDLPSITELDATGALGAGVAFDIVIATAFSWIPLAAD
FT                   YNRHCRSPRAAALGTWGGYVTATLIAMGLGATVSALSVSIGFPQTYDPTELLSGFGFGL
FT                   PASLVIFFSVLTTNVMCVYSATLSYMSIRPHTTFWKPALIIGVASVLGSLIPGILDSFQ
FT                   NFLLIIGSIFIPAFSLMIVDYFLIGRERYTTQRLIEHAGQLPAVNLQALGCYLVGALLA
FT                   YYWNWVAPLSFGASLPVFVLTGTLYYVTHQLVRHQRKVRT"
FT   CDS_pept        complement(340264..341871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aruI2"
FT                   /locus_tag="HELO_1296"
FT                   /product="2-ketoarginine decarboxylase"
FT                   /EC_number="4.1.1.75"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1296"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41179"
FT                   /db_xref="GOA:E1V5R7"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R7"
FT                   /protein_id="CBV41179.2"
FT                   /translation="MTCAELLLHLLRDTYQADTVFGIPGVHTVELYRGLHDSGLRHITP
FT                   RHEQGAGFMADGYARATGKPGVCFIITGPGMTNIATAMGQALADSVPMLVISSVNRRDT
FT                   LGRGQGRLHELPSQQQLLAGVSRFSHTLLDPEGLPEALARAFAVFESRRPGPVHIEIPI
FT                   DLFAAPVTSPARWQRLRPTPPAPDAAAIEEAAAWLRTAERPLVLLGGGCVDAPDAARRL
FT                   VEGLDAPAVTTINAKGLLGRDHPLDLGANASLPAVRHLAYEADVILAVGTELGETDYDV
FT                   VFDGGFALSGRLIRIDIDPEQLARNQHAAMAICADAGLALEALARHFPERLARRGAERT
FT                   HAALDALGLTKDPAFADYVPLFATLAEVLPEAILVGDSCATTYAANHLVAQPAPRRFFN
FT                   ASTGYGTLGYGLPAAMGAQLARPDLPVVALVGDGGIMFTLPELACAVEERLPLVILLWH
FT                   NQGYEEIRRFMDDAGVERLGVDIRAPDFQTLAAGFGCAATRVNDCDGLIRALTHRPTDG
FT                   PMLIEIDAAAWADAIGHD"
FT   CDS_pept        complement(341907..343289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1297"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1297"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41180"
FT                   /db_xref="GOA:E1V5R8"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R8"
FT                   /protein_id="CBV41180.1"
FT                   /translation="MSSLDSTSNTALGGAPLGKAGLLKFLVPSLIGIGMFLVPFSTGDT
FT                   INIGMGLLADGLKALLGDALPAIAVVVLCASALLTLIVKFTRPGWARGNALGELFNVAP
FT                   LWLVMRLLGAAFALMTFFQVGPEVITASFTGGVMLNDLAPVLLTFFFFAALLLPFLVDF
FT                   GFMEFIGSLVRTPFRLIFGLPGRSAIDATASWMGSGTVGVLITTQQYEQGYYNRREASA
FT                   IATNFSIVSIAFALLVTSFIGINHLFIPFYLTVVVAGLVAAVIVPRLPPLSHKPNTYYE
FT                   PAGCRIAEERTGSTGLLRYSLGMAVARAEQAPGARQLLRRALFNVADIFFGLLPLVIAI
FT                   GTVALVFAEFTPLFTWLSYPMVPVLEWMNVPEAAAAAPATLVGFADMFLPAVLASDIES
FT                   ELTRFVIACLSLTQLIYMSEIGALLLKSKIPLKLWELVAIFLLRTAITLPIIVVMGHWL
FT                   VG"
FT   CDS_pept        complement(343356..344306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gbuA"
FT                   /locus_tag="HELO_1298"
FT                   /product="guanidinobutyrase"
FT                   /EC_number="3.5.3.7"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1298"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41181"
FT                   /db_xref="GOA:E1V5R9"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5R9"
FT                   /protein_id="CBV41181.1"
FT                   /translation="MSDFNQPLGGNEMPRFGGPSTMMRLPTQSDAVGLDAAFIGIPMDI
FT                   GTSNRPGTRLGPRQIRDESRMLRPYNMATRAAPFDSLQVADIGDVPINTFNLPKNLDII
FT                   TRHYDAVLAQDCVPLTLGGDHTLTWPVLRAIAKKHGPVGLIHIDAHADINDQMFGEEVA
FT                   HGCPFRRAQEEGLLDSQRVVQIGLRGTGYAADDFDWCREQGFRVVTAEECWYKSLAPLM
FT                   AEVREQMGDGPVYISFDIDGLDPSVAPGTGTVEMGGLTAQQGLEIVRGAQGLNVVGGDL
FT                   VEVAPPYDTSGNTALMGATLLYEMLCVLPGVQYRD"
FT   CDS_pept        344478..345899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1299"
FT                   /product="PAS/sigma-54-interact/HTH domain transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1299"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41182"
FT                   /db_xref="GOA:E1V5S0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S0"
FT                   /protein_id="CBV41182.1"
FT                   /translation="MSEFDSPILRTIIETAHDHFFVVEADGRIRDVSPAAAAVYGMSRE
FT                   DLCRTTVQALEAKGVLRPSVSLEVMRTGEPAQVAQVTSTGRRVIAQAHPVFDGGKLVAV
FT                   VSRSMDLTDLQLLQEEYALLQRRFNEHLQRGGGEEAGGELELADLEARSGVMREVALLL
FT                   KRVAPTDATVLMLGESGVGKTAFARQLHHWSPRHKGPFVDVNCGAIPESLFESEMFGYR
FT                   QGAFSGAAPGGKAGLMEQAEGGTLFLDEVGELPLPMQAKLLKVIQDGCITRLGDTRARR
FT                   VDFRLVVATNQDLARSVETGHFRLDLYYRLNVIPVTLPPLRERREDIPGLVERHLQRLN
FT                   TRYGRDKIIARDAWQTLMGWEWPGNVRELENWLERAWLSAGEDVIRPRQETGQPDGTER
FT                   AVTSMMEGEASVRRPGLAEGETLQSALARTERDILAELCREANSTYAIAERLGISQPSV
FT                   VRKLRRHGLRIERSR"
FT   CDS_pept        345978..347366
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1300"
FT                   /product="YcgA family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1300"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41183"
FT                   /db_xref="GOA:E1V5S1"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S1"
FT                   /protein_id="CBV41183.1"
FT                   /translation="MSLQEQTLRERRPWYRTVPDPMVLIFLILVATYVLTFFIPAGEFE
FT                   RVVRDGRTAVVPGSFHYLGDVAAIHPFDVFVAIPKGLISASQYLFIVFIAGGLFHILQK
FT                   SGALENAIGVAVRRVGVARRNLIITVGTFIYGFFGVAVGFENNIALVPIAVLIASAVGC
FT                   SSLVGTAMAVGGIGVGFALSPINPYTVGVAQGIAELPTFSGAWLRTLMVITSLALLSLY
FT                   ICKRVTRMDFEESPHAEALSKHLDEYRMERRDWLTLLVFVGGLVAMLFGVFTAGWYINE
FT                   IAGIFLLLAIVIGAINGLSANGIVKQMMEGASGVTAGALVIGVAASIQVILEQAQIIDT
FT                   IVNALSGLIEGIPIMFSAIMASVVQGVINLFVPSGSGQALVTMPILVPVADLVGMSRQL
FT                   MITAFQVGDGLTNLIVPTSGGTLAMLALGRVSYAQWLKAIMPFMALVYLLCWGGLVVGH
FT                   LAGY"
FT   CDS_pept        347369..348073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1301"
FT                   /product="DUF1028 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1301"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41184"
FT                   /db_xref="InterPro:IPR010430"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S2"
FT                   /protein_id="CBV41184.2"
FT                   /translation="MTLSLLHVHPETGTSASLAATGSVAVGGYVNHCWRGLGACATQGL
FT                   TTNPWYPEGVRRALEQGLSAQDALNDVVAGDAGASRRQCLVMDADGRSALHTGIDNQPV
FT                   VASARCPGVAAAGNMLADAAVPEAMVTAFLAATCEDPDAVLKQGKAPRFRETHDVELLA
FT                   ALIEALEAGLVAGGDHRGCRSVALRIESFTMAPIDLRVDWVEADPVTELRALAHRVASE
FT                   DFQAFLRSLPHR"
FT   CDS_pept        348130..349377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1302"
FT                   /product="probable amidase (homolog to N-carbamoyl-L-amino
FT                   acid hydrolase)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1302"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41185"
FT                   /db_xref="GOA:E1V5S3"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010158"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S3"
FT                   /protein_id="CBV41185.1"
FT                   /translation="MSMHDRNASLGHDLLAWLDEAAHHSLPGPGVTRLFCSMEHRAVLE
FT                   LIAGWMREAGLEPHLDASGNLVGSCPRAAAGERTLILGSHQDTVVEGGKYDGMLGVALP
FT                   LMALKTLREQGVELPYGIQVVAFGDEEGTRFQSTLIGSRALAGTFQAESLDATDADGMT
FT                   LGEALRDFGGDPEAIPALARDPERVLGFCEVHIEQGPVLEQRDHAVGVVTALTGIERHR
FT                   VTLTGKAGHAGTTPMPGRRDALVGAAEMVAAVDRVLNATDNLVGVVGKLDVRPNAVNVI
FT                   PAETTFTLELRSPSVEVRRAGRVRLLDAFAEIAETRGLSLDIEQTYSAEAVDCADWMIE
FT                   ALEAASEECGQPAERLFSGAGHDGLAMHDLTDIGMLFVRCHDGLSHHPDEAITAADADA
FT                   ATRVLMAFLRGLAERD"
FT   CDS_pept        complement(349384..350133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1303"
FT                   /product="GntR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1303"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41186"
FT                   /db_xref="GOA:E1V5S4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S4"
FT                   /protein_id="CBV41186.1"
FT                   /translation="MAGSSTKRRPYQVAETIKRWIVEKQLKPGDRLPGEAELMERLGVS
FT                   KGTVRESTRVLEAQGLVETRTGPGGGAFVHAMSEARAISLLSHYLFFQDISIRDIYQIR
FT                   LALEPELAASLAGRVSPEDMSRLRASLESYADTARDEEEERQQHLDSLNFHLMLAELSG
FT                   GNPLLCFIIRFTTQVLSDLTIYRRLYEPATHDLGRTGCRFHAELLDAIEAGDAEQARRI
FT                   MHEHMLSAQAVMNTQEAQVRRDFLSEA"
FT   CDS_pept        complement(350307..351911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1304"
FT                   /product="PAS/sigma-54-interact/HTH domain transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1304"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41187"
FT                   /db_xref="GOA:E1V5S5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030828"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S5"
FT                   /protein_id="CBV41187.1"
FT                   /translation="MRHIRETQSMAEVRPLFEQQDVGAVEVFDNVGQAIGVLTQTDVET
FT                   AVREARLENQVGECLRYRVTGDSPSLDIADVSSHGFDHEPLRSVLNALHDGVYITDARG
FT                   ITVTVNTAYERLTGIQRDDVVGRHMADLVKAGYISKSVSLEVIRERRPITLVQSIRDHD
FT                   KILVSGMPLLDNEGALRYVITSVRDVTELLRAKHAQEQLAQIHRMREAYDVDVRSDGQP
FT                   PWLIVSPQSRECYALARRIAPTQVKVLIQGETGTGKTLLARYIHQHSERAEGPFLELNC
FT                   TAMPEGLLEAELFGYSPGAFTGAAPRGKQGLLDVAHGGTLLLDEIGDLPLALQAKLLKV
FT                   VEENRFLPVGGTEFRHANIRLICATHRDLQQQVHMGQFREDLYYRLSVVPLTLPPLRER
FT                   REEIIPLLDHYLTHFNQRHEKTRCWHPESLELLAGHDWPGNIRELINLTERLVVSVSEQ
FT                   EITPHWLPHVPASLETPNPSATCDGSLREQIMELERQLIETALATHGTTRAAAAALGID
FT                   QSTLVKKTRRWRLSRSA"
FT   CDS_pept        complement(351961..353409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1305"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1305"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41188"
FT                   /db_xref="GOA:E1V5S6"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S6"
FT                   /protein_id="CBV41188.1"
FT                   /translation="MNQWKHRAEGAETPYIAMGPFKLRLPFLHYRFELPDYLQGLLMCA
FT                   VDLAAIPLMTELLGMPFEAALAIVMLNGVLYLLHHLFGDPVVPGWITPAIPLLMAYVTT
FT                   FPEGEARVHALIAFQMMLGILALFLGRTGLAARVVSLIPSAIKAGVIMGAGLAAIVVVF
FT                   DEGGRFSQYPFTISIAVGLAFYLIFSRHFAKLKASGGAWATLGKLGIFPIIVLAIIIAP
FT                   LFGEAPWPDVEWGISQPDFALMLSEYTVFGVGLPPLSMYVTAIPTVLAAYIVLFGDVLQ
FT                   SKALLDEADDMRRDEKVDYNPDRAHMIFGGRNLGMSVFGPDVVMCGPLWAAMQVVITER
FT                   YKEGKAAMHSIFGGSGSFRWGTNTGLLLLPIVSLVQPILGIALALTLLIQGYVSVRIGI
FT                   MEARSQRDLGIAGVIAAVLVIKGATWAFAVGVLLCLLIYGRRFFSGENDGTFTKDLTRG
FT                   TTPQRPASDSTKSLHESDASLDVH"
FT   CDS_pept        complement(353453..354601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1306"
FT                   /product="probable oxidoreductase (iron-containing alcohol
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1306"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41189"
FT                   /db_xref="GOA:E1V5S7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S7"
FT                   /protein_id="CBV41189.1"
FT                   /translation="MHVSSFKTAHRLITGQQASQDLLAQVSRLGMQKPLLVTDRGVRKS
FT                   GTLDLVTSRVKDLGYAIYDRVPPEPEIEIVEECTQAFRHGEHDGLIAVGGGSAMDIAKC
FT                   VSVYARYSGTLDTLFGEDKVESSGVPLIAIPTTAGTGSEVTNIAILADNRQGTKRGIVS
FT                   DYLLPDVALVAPEMTLSCPRSVTAASGVDALVHAIEAYLSNFASPLTDALALKAMTLIV
FT                   RALPKAFANPNNLAAREDMATGSLMAGLAFGNAGVGAVHALAYPLGGRYHLAHGVSNAL
FT                   LLPHVMAWNKLACVERFQDIAHAFGEPCQGLSATQIADNVIDRLHRLCRDVEIPAQLRT
FT                   FDIPESALPELAEAASKVERLLRNNPRVLSRDDIEQIYRAAY"
FT   CDS_pept        355159..356556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1307"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1307"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41190"
FT                   /db_xref="GOA:E1V5S8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S8"
FT                   /protein_id="CBV41190.1"
FT                   /translation="MTRIVQWSITVALAGFLFGFDTAVISGADKPIQALWGLSDLQHGL
FT                   LIMSMALWGTVLGAIFGNWPTDTFGRRATLLIIGVFYLVSAVGSAVVSDPVLFAIFRLI
FT                   GGIGVGISSVAAPTYISEIAPPKHRGLLVAMYQFNIVFGILMAFISNYIIGSLITEGAW
FT                   RWMLGIEAVPALLYTLMITRVPRSPRWLILKRNDVAEASRVLRLINPEADTDAEIATIR
FT                   AAEDEERNAHAPFFSRRYRLPVLLAFLIAFFNQLSGINFIIYYAPRVLEAAELESQAAL
FT                   LSTAGIGLVNLVFTMIGMSLIDRFGRRTLLFIGSAGYLISLVLISRAFFIDALGGIEVP
FT                   LLLGLFIAAHAISQGAVIWVFIAEVFPNHVRARGQSFGSSVHWIFAALITLVMPWVLGT
FT                   FSGGPVFAFFAVMMLLQLIFVLFLMPETRNVSLEVLQRHLVGDNVKLRRVHLSSARAQS
FT                   VVSGKGA"
FT   CDS_pept        complement(356641..356784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1308"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1308"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41191"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5S9"
FT                   /protein_id="CBV41191.1"
FT                   /translation="MRRISPGHSAYAGTFHGDLPQSLRHEVLARLPDDLRRVVETFEAH
FT                   YP"
FT   CDS_pept        complement(357252..358817)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1308A"
FT                   /product="GAF/sigma-54-interact/HTH domain transcription
FT                   regulator"
FT                   /db_xref="GOA:A0A1R4A451"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A451"
FT                   /protein_id="SJK83733.1"
FT                   /translation="MLHTYASMLEVWREACRHIEIAESVAAIADQLSQWLPIKRLLIRR
FT                   LDPVTYHLETVADTLGSKDESRDRGLTELSSDNIERLMKWCQLGELAHCASRHHEHSFT
FT                   LAAIPTSLTDNVLIGPLISEHDTVGLLIMQLRPDAKISEHDEVLCKRLLEPFAAALEND
FT                   RRLRELKALRESAEADKRSLLSRLGRDALGDTVIGADNGLRQVMQRVQQVADSDAAVLV
FT                   LGETGSGKEVIARSVHQRSTRAGGPFIRVNCGAIPPELVDSELFGHEKGSFTGAVSRRR
FT                   GWFERADEGTLFLDEIGELPMAAQVRLLRVLQDGSFERVGGETSIQVDVRVVAATNNDL
FT                   ARMVQRGEFREDLWYRIAVFPIVLPPLRERSEDIPALAEHFAERAARRFGMKPQVLSAH
FT                   DLSLLAAYPWPGNVREFNSVLERAVILGDGERLDVSQALGVASETTPPLPQSTSSNSER
FT                   KQLKNTEIQPLDVVIRSHIERALVASRGRIEGPEGAADILRINPHTLRARMRKLAIDWS
FT                   RYRQ"
FT   CDS_pept        359342..360496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1308B"
FT                   /product="uncharacterized protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A449"
FT                   /protein_id="SJK83734.1"
FT                   /translation="MYWLIGGSGSMNYGDELIVRGWMSYLSRNENVKNIRIETNSKVSS
FT                   ERFHEEGVESAKEYGTAIVFDDFLYGLCGSVAGLSFWEQFVRGVEFFDKGGVDIYGEEN
FT                   FDFIDSVRAIHLHGGGYFNDIFPWHGFILGFTMSLAKREGIPAMATGIGLMPMGKPSRE
FT                   QREKFVSLMDCFSVFELRDVESFRLVKSLSGGKGNVVNGFDDNFMLKREDLFSCDGHGG
FT                   ANLVLSFIEHDICRMSRSYLKRLSEYAREFDRVVFWECYPWQDENVIEFMRSHISDLEV
FT                   VCSRDWVYARGRLSQNDRVIVSRFHPHFCAARVGVSGVYNIKGRYYDVKHGSIVALGSG
FT                   FGKGSLSRLVRPEKRQGVLCLYDEELASMKRKIVDIGVQDFSLR"
FT   tRNA            complement(360882..360958)
FT                   /locus_tag="HELO_TRNA7"
FT                   /product="tRNA-Pro"
FT                   /note="anticodon=CGG"
FT   CDS_pept        complement(361040..362041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispB"
FT                   /locus_tag="HELO_1309"
FT                   /product="octaprenyl-diphosphate synthase"
FT                   /EC_number="2.5.1.90"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1309"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41192"
FT                   /db_xref="GOA:E1V5T0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T0"
FT                   /protein_id="CBV41192.1"
FT                   /translation="MPATTVPTQLTTPDTPIHAVVAEDFAAVNRTIQTQLASRIPLVEA
FT                   IGQYIVDSGGKRMRPLLVLLAARSLGYEGDQHVALATLIEFMHTSTLLHDDVVDESHMR
FT                   RGRATANDAWGNAPSVLVGDFLYSRSFQMMVGVGSMRIMEILSAATCTIAEGEVQQLTN
FT                   VGNPDVDEAAYFETIQGKTAMLFEAASHCGAIIADATPEQEAALQAYGRYLGLAFQLVD
FT                   DLLDYRGDADTMGKNVGDDLAEGKPTLPLIQAMVTGSPEQAKVIRQAIRQGGLERLDEV
FT                   LAIVHDTGALDYTQRRAEEMSAKALAQLEVLPPSVFRDSMEQLAHRAVDRRT"
FT   CDS_pept        362317..362628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="HELO_1310"
FT                   /product="50S ribosomal protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1310"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41193"
FT                   /db_xref="GOA:E1V5T1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T1"
FT                   /protein_id="CBV41193.1"
FT                   /translation="MYAVIKSGGKQYRVQEGQTLKLEKLEVPTGDTIEFDEVLLVGNDD
FT                   DVTVGAPNVDGAKVSAEVVSHGRGEKVKIIKFRRRKHSMTRKGHRQWFTEVKITGISA"
FT   CDS_pept        362663..362920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="HELO_1311"
FT                   /product="50S ribosomal protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1311"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41194"
FT                   /db_xref="GOA:E1V5T2"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T2"
FT                   /protein_id="CBV41194.1"
FT                   /translation="MAHKKAAGSTRNGRDSESKRLGVKLFGGQAVSPGNIIVRQRGTKF
FT                   HAGTGVGIGKDHTLFALDEGVIKFETKGPKNRKFVSVVSA"
FT   CDS_pept        363007..364194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="obgE"
FT                   /locus_tag="HELO_1312"
FT                   /product="GTPase ObgE"
FT                   /EC_number="3.6.5.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1312"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41195"
FT                   /db_xref="GOA:E1V5T3"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T3"
FT                   /protein_id="CBV41195.1"
FT                   /translation="MQFVDEASIIVEAGKGGNGCLSFRREKYVPKGGPDGGDGGHGGSV
FT                   HLIGDDALNTLIDFKYQRFYKAQNGQPGQGRQMSGRAGEDLHIKVPVGTTVIDEDTLEV
FT                   IADVTEAGQVVLVAQGGRRGLGNIHFKSSTNRAPRRTTPGTEGERRNLRFEMKVMADVG
FT                   LLGMPNAGKSTLIRSVSAAKPKVANYPFTTLVPNLGVVKLGQHEHFVMADVPGLIEGAS
FT                   DGAGLGLRFLKHLTRTRLLLHVVDVAPFDESDPVEAARSIAHELGQFSPALAERPRWLV
FT                   LNKLDLLPAEEREAVADDIVARLAWQGPVFRLSAISGEGTDALVQAVHRWLTEQRRLEN
FT                   EDEEAAEHEREMRRRMEDESVARAEARLGRKRKRDDEDDDDFDDDDYDVEVEYVP"
FT   CDS_pept        364296..365435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="HELO_1313"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1313"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41196"
FT                   /db_xref="GOA:E1V5T4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T4"
FT                   /protein_id="CBV41196.1"
FT                   /translation="MDDLEQVPDREALKRMRRVVVKIGSALLTNDGRGLDEPAIGGWVD
FT                   EIAELHRRGIEVVLVSSGAVAAGMVRLGWQTRPSEVHALQAAAAVGQNGLTECYEGHFA
FT                   RHGLTTAQILLTHDDLSNRKRYLNARSALRTLVGLGVVPVVNENDTVVTDEIRFGDNDT
FT                   LGALVANLLEADALVILTDQEGLFDADPRHDPNARLITEGRADDPRLAEVAGGGGALGR
FT                   GGMSTKVRAARLAARSGAVTVIASGRQRDVLGRLVAGERLGTLLMPERAPMAARKRWLA
FT                   GQLQVRGNLTLDDGAVKVLRDSGSSLLPVGVKSVSGDFVRGDMVLCVDEQGQRVAKGLV
FT                   NYGVDEVRRLLGQPSHRIEAILGYMESPELIHRDNLVVL"
FT   CDS_pept        365648..365914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="HELO_1314"
FT                   /product="30S ribosomal protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1314"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41197"
FT                   /db_xref="GOA:E1V5T5"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T5"
FT                   /protein_id="CBV41197.1"
FT                   /translation="MANTKQARKRARQAEGRRVLKASQRSMVRTYVKNVIKAINGGDHA
FT                   QAMDAFKQAQPVIDRIADKDVISKKKAARLKSRLNKRIKALAA"
FT   CDS_pept        366102..367727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murJ"
FT                   /locus_tag="HELO_1315"
FT                   /product="probable lipid II flippase MurJ"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1315"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41198"
FT                   /db_xref="GOA:E1V5T6"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T6"
FT                   /protein_id="CBV41198.1"
FT                   /translation="MTDRQQPPEQTSSETASAVVDEASRQAAPRRGGLMRSGMVVSSMT
FT                   MLSRVMGLARDMVIAALFGAGQGADAFFVAFKVPNFLRRLFAEGAFNQAFVPVLSEYAT
FT                   QRTRDEVRELLDAVAGSLAAVLMLITALAMLAAPWLAWAFAPGFARDPEKMALTVDMLR
FT                   LTFPYLLLISLTAFSGSVLNTWGRFAVPAFTPVLLNLSLIGAAMLLTPLVSEPALALAW
FT                   GVLIAGAAQLAFQVPFLARLGLLPRPWPRFAHPGVRRVLKLMAPAMFGVSVAQINLLLD
FT                   TVLASLLAAGSVSWLYYSDRLVELPLGVFGVAIGTVILPALSKRHAEQSREHFAQMLDW
FT                   AIRAVLLLGLPAALALVVLAEPLLITLFHYGAMTDHDIDMAAMSLRAYAVGLVAFMLIK
FT                   VLAPGFFAQQDTKTPVTIGMIAMGANMVFNLILIWPLAHAGLALATALSAFLNAGLLGR
FT                   LLHRRGVLIFQAGWGRYAVQLLGGCMAMGLALVWLAPDWHQWLDWSLARRAGWLAALVA
FT                   VGGGVYFAWLAATGVRLRHFRMKS"
FT   CDS_pept        367811..368842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="HELO_1316"
FT                   /product="bifunctional riboflavin kinase / FMN
FT                   adenylyltransferase"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1316"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41199"
FT                   /db_xref="GOA:E1V5T7"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T7"
FT                   /protein_id="CBV41199.1"
FT                   /translation="MQVIRGLHNLRDEHHGCVATIGNFDGVHRGHQAILDQLLERARSL
FT                   SLPATVVVFEPQPREFFAGDQAPPRLTRLRDKVRLLAEYGADRVLCLPFNDALRSLTAR
FT                   AFIEQVLVQGLGVRHLVVGDDFRFGCDRRGDFELLQTVGTGSGFEVEHTRTFLLDGERV
FT                   SSTRVRTMLASGNFDQAARMLGRPYRLGGRVMRDRQLGRTIGVPTANLPQPPHPLALQG
FT                   VYAVKVELPGGRHAEGVANIGWRPTVGSQRPVLEVHLFDFDEDLYGERLTVLPCAKLRG
FT                   EMKFDGLEALKAQIGADQARARRFFAETAATGDSLPLASAPLAREAVFSDSSAGLPADH
FT                   DDG"
FT   CDS_pept        368853..371687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="HELO_1317"
FT                   /product="isoleucine--tRNA ligase"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1317"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41200"
FT                   /db_xref="GOA:E1V5T8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T8"
FT                   /protein_id="CBV41200.2"
FT                   /translation="MSDYKHTLNLPETEFPMRGMLPKREPARVAQWQEMDLYHRLREAR
FT                   QGRESFVLHDGPPYANGSIHIGHALNKILKDIIVKSKNLAGFDAPYVPGWDCHGLPIEH
FT                   KVETTHGKHLEPEQARALCREYAAEQIDGQRESFIRLGVIGDWEHPYRTMDFVNEAGEI
FT                   RALADLVEGGYVFKGLKPVNWCFDCGSALAEAEVEYADKQSDAIDVAFPCAEDDKLAAA
FT                   FGLTELPKPAAVVIWTTTPWTIPANQALNVHPEFTYALVDVGDRLLLLAEELVESCLER
FT                   FGLEGNIIATAAGERLELIEFAHPFYERRAPVFLADYVEVEEGSTGIVHSAPVHGVDDF
FT                   ESCRRYGIEFDDFISVVKGDGVYVDDLPFFGGQLIWKANLQIVAKLDEVDALLAHHTIT
FT                   HSYMHCWRHKTPVIYRATAQWFVGMDTLGHDGRSLRDKALEGVEATAFTPAWGKARLHS
FT                   MIANRPDWCISRQRNWGVPIPFFLHQQTGELHPRTVELMEEVAKRVEREGIDAWFRLDP
FT                   VELLGDEAGEYEKVTDTLDVWFDSGTTHRHVMRGSHPMGHEQGPRADLYLEGSDQHRGW
FT                   FHSSLLTGSAIDGHPPYRQLLTHGFTVDEKGRKQSKSLGNVVAPQDVMDKLGADILRLW
FT                   VASTDYSGEMAVSDQILKRTADVYRRIRNTSRFLLANLNGFDPERDALAFDDMLALDRW
FT                   VVDRAAQLQTRIQRAYEEYRFLDVYQQVHGFCARELGGFYLDVIKDRQYTTQVDSVARR
FT                   SAQTALYHVVQALVRWVAPILSFTAEEIYEHIPGKRGESVLLEEYYDGLGTLEESAELG
FT                   REFWERVLNVKQAVNKCLEDARNAKVIKGNLAAEVTLYVDDELRETLSRLGDELRFVML
FT                   TSEVHLASLADGGDAEATELEGLKVAVAASEYRKCERCWHHREDVGQHAGHEDLCGRCI
FT                   SNLPDGPGETRHYA"
FT   CDS_pept        371680..372231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="HELO_1318"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1318"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41201"
FT                   /db_xref="GOA:E1V5T9"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5T9"
FT                   /protein_id="CBV41201.2"
FT                   /translation="MREVGTMPEHDTKGGAAEVAPMRHPLRWLWLAAAVIVVDLGTKAL
FT                   ASALLEYARPLEVLPFFNLTLLHNTGAAFSFLADHPGWQRWFFAAIAVAASVGLTIWMR
FT                   RLHSDEKILGASLALVIGGALGNLYDRLVHGYVVDFLSFHLAGWYYPAFNVADIGITLG
FT                   AIGLIVESLFGERRRARRRR"
FT   CDS_pept        372256..372717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1319"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1319"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41202"
FT                   /db_xref="GOA:E1V5U0"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U0"
FT                   /protein_id="CBV41202.1"
FT                   /translation="MSDQQANGHRIDEGMQVTLHFTLKLEDGTVVDSTRDKQPATFQVG
FT                   DGNLPPGFEHPIKGLAAGENGSYEISPEHAFGQHNPQNVQMIARDDFGDETPEMGMVMS
FT                   FADVGGGELPGVIKQVGEKQVEVDFNHPLAGRTLTFEVEVLDVQPATTH"
FT   CDS_pept        372741..373694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="HELO_1320"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1320"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41203"
FT                   /db_xref="GOA:E1V5U1"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U1"
FT                   /protein_id="CBV41203.1"
FT                   /translation="MQIKLANPRGFCAGVDRAIEIVNRALDVFGPPIYVRHEVVHNRFV
FT                   VDSLRERGAVFVEELHEVPDDVIVIFSAHGVSRAVQQEAERRGLRVFDATCPLVTKVHM
FT                   EVLRYARRGQECILIGHQGHPEVEGTMGRYDTSQGGQIYLVEDEKDVARLEVQDPSQLA
FT                   FVTQTTLSMDDTARVIDALRAKFPEIQGPRKDDICYATQNRQDAVRELASGSDLLLVVG
FT                   SPNSSNSNRLRELSERVGTPAYLIDNAEQIDAAWLENVGTVGVTAGASAPEVLVQGVIE
FT                   RLRALGAEMPEELDGRAETITFSMPTELRERVIASS"
FT   CDS_pept        373977..374384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1321"
FT                   /product="GspG domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1321"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41204"
FT                   /db_xref="GOA:E1V5U2"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U2"
FT                   /protein_id="CBV41204.1"
FT                   /translation="MCHSQARASRRSEVRRGQAGFTLLELMVVVAIIAILAGAAYPRYM
FT                   DAVGEARLADGRSALMALAGRLERCRTSTHSYVDCIDSPTPSEAGHYRITATLSPTEYR
FT                   LTATHDSEAVKTACRVLTLDSTGQAMPEACW"
FT   CDS_pept        374407..374802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1322"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1322"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41205"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U3"
FT                   /protein_id="CBV41205.1"
FT                   /translation="MARFQQAFTLLEALVALLVLSVGLLGMASVQLESLRGAHVGYQRG
FT                   LTSLAAQDAVELLWSRLEAGRCPGLGAEEADWEARWRARMPGLQGRVEPAGDDCTYVVT
FT                   LEWQASRLADEGETSFVYTTRLPGESP"
FT   CDS_pept        374799..375272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1323"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1323"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41206"
FT                   /db_xref="GOA:E1V5U4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U4"
FT                   /protein_id="CBV41206.1"
FT                   /translation="MMAGRVVESGVSLVELLVALAVSMLVLLGAGRLYLGGVENLARVD
FT                   DLGERQEAMTLGALFLLRDIRRGGVEPGRYKLVDAVNGEGCSLHDGVSGEPLVDGLAAT
FT                   AGSCAASEPLQADVGGRAGLYRIVLRPLDVSEPLVLHAMDREAAVRHAGESAP"
FT   CDS_pept        375269..376312
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1324"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1324"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41207"
FT                   /db_xref="GOA:E1V5U5"
FT                   /db_xref="InterPro:IPR033693"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U5"
FT                   /protein_id="CBV41207.1"
FT                   /translation="MRDGAERQAGLALPIVLVLLAMAVMLGVAGLRSALTAERLAGNFK
FT                   ASVQAGMAAEAAASSGWSALKKPGDITVESSREVLDALTWHEFIDPARFQGEPVRRGDC
FT                   EAPIRCAYRYVADASRRHLIVAMGAVMDGDGRVRAVSEPVRVTVVFSRLAELFSRYALL
FT                   ADGTVVTGEGEASKGRAHGNASRVRENRVRIPDVDASPPEDAVSLALEADENGQPRCRF
FT                   EAVGDLAGRVYHCAGRLDIPVAARFHNATLVARGDIHLAGEVGREASVDVAMLSGGDIH
FT                   FRAPGVARGWFMAAGDARLEAGALLEGAVIAHGDIHRSSGAVVRHLVGDPLLPHAPREK
FT                   RLLRWES"
FT   CDS_pept        complement(376344..376898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1325"
FT                   /product="GspH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1325"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41208"
FT                   /db_xref="GOA:E1V5U6"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U6"
FT                   /protein_id="CBV41208.1"
FT                   /translation="MPPDRITQTYHIDTPHGPARKRQAGLTLLELCVALGILAFTVAWA
FT                   APGLGGFMARNEVAADVMRLKDVLATARNTAITRGTIITVCPSRDGRRCIEDWTAPLSI
FT                   LQGEIDLPPGQRLLLGRRGASQVAAITYRLDHRPVRYQPTGRATGHNGTFRLCGRRGEG
FT                   ASVIVSNFGRVRVVDDTPSAC"
FT   CDS_pept        376970..378058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="HELO_1326"
FT                   /product="glycine oxidase ThiO"
FT                   /EC_number="1.4.3.19"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1326"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41209"
FT                   /db_xref="GOA:E1V5U7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U7"
FT                   /protein_id="CBV41209.2"
FT                   /translation="MSDFLVVGGGVIGMMTTLQLADAGHSVTLVERGQCGREASWAGGG
FT                   IVSPLYPWRYSAPISRLSAWSEGRYPELALRLLEETGVDPEYRQKGLLYLRVDDERDAM
FT                   AWAREVGKPLERVSGDFLYDKEPEAVPGCADALWMPTLGSIRNPRLARALHARLADMPR
FT                   VTLHEHCEVQGLREQGGRIVAVETNEGELHGDQVVVCGGAWAAEVLTTVGVELPVRPVK
FT                   GQMILFKAPPGLVRRVVLMDGRYVIPRADGRVLAGSTLEETGFDKSLSESARESLWTSA
FT                   TGIVPALADCEVEHHWAGLRPGSPDGVPFIGAVPGIDNLHVNAGHFRNGLVLAPASTRL
FT                   LVDELLGREPIVDPAPYRLKGR"
FT   CDS_pept        complement(378096..378356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1327"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1327"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41210"
FT                   /db_xref="GOA:E1V5U8"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U8"
FT                   /protein_id="CBV41210.1"
FT                   /translation="MNLLLIRLIIFAVLFFAGLKLYRMYREWKQDRDADDRQDASPGNP
FT                   MVRCAWCKVHLPENDALREKGEWFCSPDHRDKYLAESSSEE"
FT   CDS_pept        378467..380101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="HELO_1328"
FT                   /product="NAD synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1328"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41211"
FT                   /db_xref="GOA:E1V5U9"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5U9"
FT                   /protein_id="CBV41211.2"
FT                   /translation="MQDLTLVMAQLDPLVGDIPGNTERAIETVREARIEHGADVVVLPE
FT                   LFLTGYPPEDLLLRPSMETRLRQARARMAEKMARDVMVIVGYPGRREGANWNLAGVLYN
FT                   GEWLGEYAKQALPNYEVFDEQRYFAVGESPLVIEHKGAKLGVLICEDVWEEGPVQQARE
FT                   AGADILVTLNASPFHQDKPAERLALLEQRAREVGLPIVYVNQIGGQDELVFDGGSACVD
FT                   ADGELRVQAPHWAVGLMPVQFVRDEQGAWVPSAGEVDEEASAEENLYCALVTGLRDYVN
FT                   KSGFKGVVLGLSGGIDSALSLAIAVDALGPQRVHAVMMPYHYTADISKEDAAEQARMLG
FT                   VDYEVLPIESMVEAFMDTLADSFAGTERDTTEENLQSRCRGVLLMAISNKKGLMVLSTG
FT                   NKSEMAVGYATLYGDMVGGYNAIKDVYKTWVYRLARWRNTQDPAIPERVIERPPSAELA
FT                   PDQQDTDSLPDYDTLDAILVRYIEGDMSAEAIIEAGFDHDDVYKVVRLVDRCEYKRRQA
FT                   PVGVRVTRRGFGRDRRYPIVNGWQPGE"
FT   CDS_pept        complement(380244..381053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamD"
FT                   /locus_tag="HELO_1329"
FT                   /product="outer membrane protein assembly factor BamD"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1329"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41212"
FT                   /db_xref="GOA:E1V5V0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V0"
FT                   /protein_id="CBV41212.1"
FT                   /translation="MRVITTGTRLAAMLLATALLAGCASTKEEQAPDVAEGQLYQEGRA
FT                   ALEDGRYTTAVNRLEAIDTRYPFGEHAEQAQLELIYAYYETSDWEAARAAASRFIRLHP
FT                   DHPQVDYAYYMRGLAAWEAGRFSLESLRLIDISKRDLGATRDAYSDFRDLVRRYPNSQY
FT                   APDARQRIVYLRNLLAQHELEVADFYLRKGAYLAAVKRGRWVIEHYPEAESTRDALAVM
FT                   VEGYLGLDMPERAKESLRVLIENAPNHERLNGRTFDPRYVKADPISA"
FT   CDS_pept        381214..382173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="HELO_1330"
FT                   /product="23S rRNA pseudouridine(1911/1915/1917) synthase
FT                   RluD"
FT                   /EC_number="5.4.99.23"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1330"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41213"
FT                   /db_xref="GOA:E1V5V1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V1"
FT                   /protein_id="CBV41213.2"
FT                   /translation="MPQTLDAHQRIPDSMAGFRLDQAAAELFSDFSRERLKAWIKSGAL
FT                   TVDGGPAKPKDKVYGGEMLALVAELEDDARFEPEDIPLEVVFEDDEVLVIDKPPGLVVH
FT                   PAAGNPDGTLLNGLLHHCPSLAMVPRAGIVHRLDKDTSGLMVVAKTLVAQTALVEQLQA
FT                   RTVSREYDAVAVGAMTAGGTLDAPIGRHPRDRKRQAVNASGKPAVTHYRVIERFRAHTH
FT                   VRCRLETGRTHQIRVHMAHLRYPLVGDPVYGGRLKLPAGAGDTLKEVLREFPRQALHAR
FT                   KLAFVHPTSGATMTFRAPLPDDLLMLLDFLRDDRETMR"
FT   CDS_pept        382170..382925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1331"
FT                   /product="laccase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1331"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41214"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V2"
FT                   /protein_id="CBV41214.1"
FT                   /translation="MSDALDLDPTLVRPDWPAPDSVAACVTTRETGPSQDAFAAFNPAL
FT                   HVGDKPEHVALCRRQLGKVIGDDRPLLWLTQVHGGRVQQHFAEDAPQADASVARDRGHA
FT                   CVVLTADCLPVFFCDRDGQRVAVAHAGWRGLAGGVLEATVAALGVPAESQMAWLGPAIS
FT                   NAQFEVGPEVRQAFVAVQPEALEAFDPSPYRLGHYMADLYKLARLRLERLGVSHISGGH
FT                   FCTACEPRFYSHRRDDGVTGRMASMIWLR"
FT   CDS_pept        383110..385689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="HELO_1332"
FT                   /product="molecular chaperone ClpB"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1332"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41215"
FT                   /db_xref="GOA:E1V5V3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V3"
FT                   /protein_id="CBV41215.1"
FT                   /translation="MRFDKFTAKLQNAVADAQSLAVGQGHNQLEPGHLLLALLDASDTG
FT                   VKALVQKAGGDAARLRDALVGHLEDLPRVAEFDGEVQPSRDLVKLFNLTDREAQKRGDQ
FT                   YIASELVLLAALEMRHAVSKALTQAGLSRQSLETAIDGVRGGAKVDDPNAEEQREALDK
FT                   YTLDLTERASSGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVDGEVPEGLKDKRVLSLDMGALLAGAKYRGEFEERLKAVLKELAEEEGRVILFIDELH
FT                   TMVGAGKAEGAMDAGNMLKPALARGELHCVGATTLDEYRQHIEKDAALERRFQKVLVDE
FT                   PTEEDTVAILRGLKERYEVHHGVDITDGAIIAAAKLSTRYITDRQLPDKAIDLIDEASS
FT                   RIRMELDSKPEEMDRLDRRLIQLKMEREHLKKETDEASRKRLESLEEQISELEREYADL
FT                   DEIWKAEKASIQGAAQFKDELDRARIDLEQARRQGDLGRMSELQYGVIPELERKIAESS
FT                   EEEADTSEHRLLRSNVTEEEIAEVVSRWTGIPVSKMLEGERDKLLRMEEALHERVIGQD
FT                   EAVNAVSNAVRRSRAGLADPNRPNGSFLFLGPTGVGKTELCKSLAWFLFDTEEAMVRID
FT                   MSEFMEKHSVARLIGAPPGYVGYEEGGYLTEAVRRKPYSVLLLDEVEKAHADVFNILLQ
FT                   VLEDGRLTDGQGRTVDFRNTVIVMTSNLGSDIIQRMGSDEDYTQMKSMVMEVVGNHFRP
FT                   ELINRIDEVVVFHALEQEQIRAIADIQLERLRDRLAEHDLSFEVSDEAMAQLAAAGFDP
FT                   VFGARPLKRAIQSRIENPLAQDLLAGQFSPGETVRVEAEGDRLVFRH"
FT   CDS_pept        386224..387948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvI"
FT                   /locus_tag="HELO_1333"
FT                   /product="acetolactate synthase catalytic subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1333"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41216"
FT                   /db_xref="GOA:E1V5V4"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V4"
FT                   /protein_id="CBV41216.2"
FT                   /translation="MELLSGADMIARFLQDEGVEYIYGYPGGAALHIYDALFRQDKVKH
FT                   ILVRHEQAATHAADGYARASGKPGTVLVTSGPGATNAVTGIATAYMDSIPMVVLCGQVM
FT                   SHLIGDDAFQETDIIGVTRPIVKHSFSIRHPSEIPEVLKKAYYLASTGRPGPVVVDIPK
FT                   DMTTPTERHEYVYPKKVKLRSYNPVARGHTGQIKKAVELMLKARRPVFYTGGGVVTGRA
FT                   CEGLTDLVKRLGHPITTTLMGIGAFPQSDDQCLGWLGMHGSYESNMAMHHADLIIAIGA
FT                   RFDDRVTNNTSKFCPTAKIIHVDIDPSSVSKTVRADVPIVGPAQSVINEMISLLQGREI
FT                   ADPEALDEWWRTIDGWREERRGKLYEPSKEGEPIKPQEVIEAICRQTRGEAYVTTDVGQ
FT                   HQMFAAQYYKFDKPNRFITSGGLGTMGFGFPAAMGIKQNFPDEQVVCVTGEGSFQMMMQ
FT                   ELSTCKQFGGGVKIVNLNNASLGMVRQWQDLNYKSRHAHSYMESLPDFQQLIESYGFTA
FT                   LRVETMAELEPALERTFADKQELVFLDVMVDPHEHVYPMQVPLGSMRDMLLSKTERS"
FT   CDS_pept        387948..388439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="HELO_1334"
FT                   /product="acetolactate synthase regulatory subunit"
FT                   /EC_number="2.2.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1334"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41217"
FT                   /db_xref="GOA:E1V5V5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V5"
FT                   /protein_id="CBV41217.1"
FT                   /translation="MRHIISILMENEPGALSRVVGLFSQRNFNIETLNVAPTEDETLSR
FT                   LTVTTVGDDRVIEQITKHLNKLIDVVKLVDLTEGSHIERELMLVKVKALGAARDEVKRT
FT                   VDIFRAQIVDVTPSLYTVQITGDAEKLDAFLQAMAPVGIHEVARTGVSGIARGDKVLSL
FT                   "
FT   CDS_pept        complement(388562..389569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1335"
FT                   /product="probable oxidoreductase (zinc-containing alcohol
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1335"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41218"
FT                   /db_xref="GOA:E1V5V6"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V6"
FT                   /protein_id="CBV41218.1"
FT                   /translation="MKLVTLASPGGLDRLRLQEHDAPGEPGPGEIRVRIHASSLNFHDY
FT                   GVVSGGMPTAEGRIPMSDGAGVVEAVGEDVDTFSVGDSVVSTFFPTWLTGPAEVGDFRT
FT                   VPGDGVDGYAREAVIRPQTWFTHAPRGYSHAQAATLTTAGLTAWRALVVEGGLKAGDSV
FT                   LVLGTGGVSIFALQFAKAMGATVIATSSSDDKLTRLESLGADHTINYRTHPEWGSKVKE
FT                   LTAGRGVDHIVEVGGPSTLAQSIEAVRIGGHISLIGVLTGRGGDIPTAKLMAKQARLQG
FT                   IIVGSRAHQQEMIRGIESLGIEPVIDRHFALDEIAEAFRHQESQKHFGKICLDI"
FT   CDS_pept        complement(389660..390550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvY"
FT                   /locus_tag="HELO_1336"
FT                   /product="LysR family transcription regulator IlvY"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1336"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41219"
FT                   /db_xref="GOA:E1V5V7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V7"
FT                   /protein_id="CBV41219.1"
FT                   /translation="MDMRPLKHFLTLADTLHFGRASEACHVSPSTLSRSIQQLEESLGV
FT                   RLFERDNRHVALTRQGHSFHAYARDTLEQWEQLRQSLMSEAHILTGEISIYCSVTASYS
FT                   FLYDLLSEFRTRYPGIELKLHTGDPAQAMPRVLAGNEDMAITSRPRQLPEGLAFKSLTR
FT                   SPLVFIAPCDEHEWVPADPRTPSADQWRNVPMVLSESGLSREVSNTWFKALGISPRIYA
FT                   QVAGHEAIVSMVGLGFGVGVVPRIVLEASPLSERVRILPVKPELPHYDVGLCVLNRRLR
FT                   SPLIHALWDEVEERG"
FT   CDS_pept        390743..391759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="HELO_1337"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1337"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41220"
FT                   /db_xref="GOA:E1V5V8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V8"
FT                   /protein_id="CBV41220.1"
FT                   /translation="MRVYYDKDCDLSLIQAKQVAIVGYGSQGHAHANNLKESGVDVTVA
FT                   LRPGSSSAAKAEAAGLKVATVEDACQAADVVMVLAPDEYQKAIYEQQIAPNLKEGATLA
FT                   FAHGFNIHYNQVEPRADLDVVMIAPKAPGHTVRSEFTRGGGIPDLIAIHQDASGSAKEL
FT                   ALSYAAAIGGGRSGIIETTFKDETETDLFGEQTVLCGGAVELVKAGFETLTEAGYAPEM
FT                   AYFECLHELKLIVDLMYEGGIANMNYSISNNAEYGEYVTGGEVINEQSRQAMRNALKRI
FT                   QTGEYAKMFINEGNSNYPSMTARRRLNAEHPIEQVGEKLRGMMPWIAANQLVDKSKN"
FT   CDS_pept        391897..392733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="HELO_1338"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1338"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41221"
FT                   /db_xref="GOA:E1V5V9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5V9"
FT                   /protein_id="CBV41221.1"
FT                   /translation="MSQDPSNGERDRRESNDEDLAATFVRESEVVEEALEDGKKVKRRG
FT                   IYLLPNLFTTSALFSGFFAVVAAINGDFTAASIAIFIAMALDGLDGRVARLTNTQSDFG
FT                   AEYDSLSDMLSFGVAPGLVSFIWILQDVGKTGWVVAFLYVACAALRLARFNVQIGSVDK
FT                   KWFIGLPSPSAAAVVAASVWTFHSFDAEAFGFKLWMLFLVGAAGVLMVSNIRYYSFKDI
FT                   DLKGPVPFVMLLAIVLGFVVISIEPSLMLLLLFGTYVASGPVLAVWRKLRTPSQKP"
FT   rRNA            393362..394894
FT                   /locus_tag="HELO_RNA16S2"
FT                   /product="16S rRNA"
FT   tRNA            395089..395165
FT                   /locus_tag="HELO_TRNA8"
FT                   /product="tRNA-Ile"
FT                   /note="anticodon=GAT"
FT   tRNA            395275..395350
FT                   /locus_tag="HELO_TRNA9"
FT                   /product="tRNA-Ala"
FT                   /note="anticodon=TGC"
FT   rRNA            395558..398444
FT                   /locus_tag="HELO_RNA23S2"
FT                   /product="23S rRNA"
FT   rRNA            398530..398643
FT                   /locus_tag="HELO_RNA5S2"
FT                   /product="5S rRNA"
FT   CDS_pept        399189..399695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1339"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1339"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41222"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W0"
FT                   /protein_id="CBV41222.1"
FT                   /translation="MKQQILRKLALMLLVGTATAGLAACSDDDAGSESAGENTEQAADE
FT                   AAQSAEETAGDAESAMDEAAAETEQAADEAAESADQTMDEAGEAAEGAANDAESAMDSA
FT                   AESTEEAVNDAGEAMDSAAENANQAVEDAGESVGDAVDDTMNSAGEAMEDAGEQTQEAA
FT                   DETQQ"
FT   CDS_pept        complement(399791..400609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1340"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1340"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41223"
FT                   /db_xref="GOA:E1V5W1"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W1"
FT                   /protein_id="CBV41223.1"
FT                   /translation="MRHFLVMLIVGMFGFGLAVDHADARRLGGGKSVGSYSRTINSQNT
FT                   STPRSTAAPQRKPSSGLSRFAGPFAGLLAGGLLASLFFGGAFDELRLMDILLIAGAAFL
FT                   LFRLLARRRTAMAGANGTTSQASREADAQAFQSSASLGGTTHIGDEPAWFDRERFLGGA
FT                   KEHFMTLQRAWDNNDFTLIQDYVTPELYNLLRQEREQHPANNRTEIVRLIAELGSVRET
FT                   DQQAEATVLFHGILDENGAQNEFNETWHLVRDLRDGAPWYVQGIEQNPAI"
FT   CDS_pept        400716..401291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1341"
FT                   /product="isochorismatase family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1341"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41224"
FT                   /db_xref="GOA:E1V5W2"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W2"
FT                   /protein_id="CBV41224.1"
FT                   /translation="MRMHRDTSLLLIVDLQVGLLPVLATGEQAVEEASWMGGVAEALGV
FT                   LVWLTEQYPEGLGESVPSLLASLENPRVWRKTHFNAHAEPDFADALADTGRRQIVLCGA
FT                   EAHICVLQTGLALLEAGYRVAWLTEAASSRRPAEASLARQRVERAGAQAVSADMVAYEW
FT                   LERCDDARFKDIHRRFLKERASRPLCFD"
FT   CDS_pept        complement(401338..402120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1342"
FT                   /product="UPF0246 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1342"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41225"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W3"
FT                   /protein_id="CBV41225.1"
FT                   /translation="MLSVISPAKKLDFETPATTSRHTQPDYLERSQTLIDILRDLSPQQ
FT                   ISDLMGVSDKIAGLNAARFAEWHTPFTPDNAKPAAQAFQGDVYVGLEAERFDAADNAFA
FT                   QDHLRILSGLYGLLRPLDLIQPYRLEMGTKLANPAGKDLYAFWRDELTAALDRAIADSG
FT                   SAVLVNLASNEYFKSIDAKRLNARVITPVFKDEKNGQYKMISFYAKKARGLMAAWMIRQ
FT                   RVDDSEALKDFDVAGYRFNAAISEGDTLVFCRDERDRT"
FT   CDS_pept        complement(402210..403241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tas"
FT                   /locus_tag="HELO_1343"
FT                   /product="aldo/keto reductase Tas"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1343"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41226"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W4"
FT                   /protein_id="CBV41226.1"
FT                   /translation="MHTRPLGNTGIEVSRLCLGTMTFGEQNSEAEAHEQLDRAVSFGID
FT                   FIDTAEMYPVPPDAATQGRTESYIGSWLASRGSRDDIILATKVAGPGLAHLRGGSRLTR
FT                   EQIHQAIDASLTRLQTDYVDLYQLHWPDRRSNFFGRLGYEPDEEEDAIALEESLSALQE
FT                   LVKAGKVRAVGLSNETPWGVMHALRLADRLGLPRVASVQNPYSLLNRTFEVGLAEIAHR
FT                   ENVGLLAYSPLGFGVLSGKYLDGARPEGARLTRYERFQRYTSPQAEQAVRAYVEIAREH
FT                   DLDPAQMALAFVNSRPFLTSNIIGATTMAQLESNLASESLRLSDEVLDAIEDVHRRLPN
FT                   PCP"
FT   CDS_pept        403472..403987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1344"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1344"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41227"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W5"
FT                   /protein_id="CBV41227.1"
FT                   /translation="MPQASSLFTRLEYRLAQQLVHTRWLPRSPRTQKLTMHLFQRCADA
FT                   GHPAALAQYGHMLFHRGVSPQDKARGARYVIEAAHGGDTRAQFRAGQIHEHGCAQYPRR
FT                   EDHAVTWYARAGEAGHPQAAERLARAYRCGELGLPVDAERTAYWQRLADQLTGAFESLD
FT                   MHEAGARH"
FT   CDS_pept        404069..404557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1345"
FT                   /product="RNase H domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1345"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41228"
FT                   /db_xref="GOA:E1V5W6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W6"
FT                   /protein_id="CBV41228.1"
FT                   /translation="MTLPTLLDIEASGFGRGSYPIEIGLARADGSVCAFLIQPLDEWTH
FT                   WDPKAELLHGISRNRLQREGYPVRQVACWLNDELSDIGIAYSDSWGYDNTWLSLLFHHA
FT                   GMLPAFRLEALRRLLSEAQLERWSDTKETIIREQGILRHRAGEDALLLQQTYQRTLTL"
FT   CDS_pept        complement(404554..405522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1346"
FT                   /product="probable oxidoreductase (zinc-containing alcohol
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1346"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41229"
FT                   /db_xref="GOA:E1V5W7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W7"
FT                   /protein_id="CBV41229.1"
FT                   /translation="MRAIRHDDERLVWDETPAIPGPGAHEVRLKVAWADVNRADLMQRA
FT                   GHYPPPPGASTVLGLEVSGTITELGDDVRGLSVGQPVCALLAGGGYAEEVVVDAHQVLP
FT                   LPEDFSLREAAALPEVFATAWLNLFMEGALGAGDRVLLHAGASGVGTAAIQLCRAFGYP
FT                   CFVTVGSEAKLAACRELGADAGWNRHEGSFVDAVQRWGGADMILDPVGASYLADNQRVL
FT                   NEDGRLVVIGMMGGRQAELDMGRMLMKRQRLIGSTLRARPPEAKGRILAALAEHVWPRL
FT                   AAGELRPLVDRTWPIEEAEAAHDHVRADANTGKVLLEVGSA"
FT   CDS_pept        complement(405533..406093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1347"
FT                   /product="probable cytokinin riboside 5'-monophosphate
FT                   phosphoribohydrolase"
FT                   /EC_number="3.2.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1347"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41230"
FT                   /db_xref="GOA:E1V5W8"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W8"
FT                   /protein_id="CBV41230.1"
FT                   /translation="MSTFCVYLGSRTGNDTAFLDAARQLGDELAARGHSLVYGGARVGM
FT                   MGALADQVMAAGGEVTGVMPDHLVEREQAHRGLTRLLRVRNMHERKASMAAHSDAFIAL
FT                   PGGIGTLEELFEAWTWQYLGLHDKPIGLLDTQGFYTPLLTFLDGTVERGFLDRATRANL
FT                   IDAATPTELLDALEQRLTPSPVN"
FT   CDS_pept        complement(406133..406654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1348"
FT                   /product="DUF501 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1348"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41231"
FT                   /db_xref="InterPro:IPR007511"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5W9"
FT                   /protein_id="CBV41231.2"
FT                   /translation="MVIRPDTMPDDRQLAIITEQLGRPPRGIEALAATDGEGTPLVLRM
FT                   APIVDGAPFPTLYWLCSERLKAELSRIEAAGVIKHLEARLREEPAFLHAYHRSHADYVE
FT                   ARWRYMSAAQRDEVQRLGYESVLRERGIGGIANWDQVRCLHTQYAHHLCGDNVIGRWLD
FT                   DEYAVADCLP"
FT   CDS_pept        complement(406626..406955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1348A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A453"
FT                   /protein_id="SJK83735.1"
FT                   /translation="MMAIRYDLWLDPENVARHHAVEADLERYFMERFADYPHIRLFGED
FT                   PYDYDAPFNRLYDVLMARAVDYCDRYWRYAPTPEQLNRTFFRAVGRSNKFIRDDNDGDP
FT                   TRHDA"
FT   CDS_pept        complement(407044..407526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaK"
FT                   /locus_tag="HELO_1349"
FT                   /product="Cys-tRNA(Pro)/Cys-tRNA(Cys) deacylase YbaK"
FT                   /EC_number="4.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1349"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41232"
FT                   /db_xref="GOA:E1V5X0"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X0"
FT                   /protein_id="CBV41232.1"
FT                   /translation="MTPAVKALEKADVDFSLATYEHDPRSPAYGEEAARALGLPAEEVF
FT                   KTLLACLDDGRLVMAIVPVPTQLDLKALARAAGARKARMAEADAAERATGYVVGGISPL
FT                   GQKKRLPAFVDASAEPLEAIHVSGGRRGLEIRLAPNDLAALLNARFALLSRSRATP"
FT   CDS_pept        complement(407523..407933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1350"
FT                   /product="thioesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1350"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41233"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X1"
FT                   /protein_id="CBV41233.1"
FT                   /translation="MFVRTIEPAFYDTDALGHVNNTRLPAWFELARNDLFKLFTPDLDP
FT                   RRWRLIMARMEIDYRAELHYGTDIEIRTYLSRLGNSSFTVTQEAHQSGTLTNVGHTVLV
FT                   HFDHETKRAVPLEGSLREALAEHLQQTESEDA"
FT   CDS_pept        complement(407989..408801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1351"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1351"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41234"
FT                   /db_xref="GOA:E1V5X2"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X2"
FT                   /protein_id="CBV41234.1"
FT                   /translation="MDVPLGWQLAKLLVSIGVVLGLSVVAERLSTRAAGLLSGYPLGTA
FT                   IALFFIGLEISPSFAAESAVHTLAGFSATLALGGGYLLCARRDGLPGVLTGTAGGLVAW
FT                   AVAGLLLTRFDVNRLGGTLITLAAILIFMRLYRHVPEAAAPPRGGFSWPALALRAGLAA
FT                   GIIFLITGLAHVVPSAWAGVMAAFPVTMYPFLVILHLTHGAAPVATVIKHYPAGLGSLL
FT                   CYALCVSLTYVPLGLAWGTLAGFAAATLWLLAWTRGQAWWRHRRGGMT"
FT   CDS_pept        complement(408830..409264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1352"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1352"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41235"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X3"
FT                   /protein_id="CBV41235.2"
FT                   /translation="MPQSSFYAKVRRGLPAVIAQWLALGQGDTDRLALILAETARVAKL
FT                   GEPEETPSGATLEAWCDAERHDEIPLWAGRTAVFLLVQMPARPQPADDDEACAWAYCWL
FT                   RNRQVDDYDAAVAGLPEHLREPLDAALKAAWVDQQGLRLV"
FT   CDS_pept        409326..410507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="patB"
FT                   /locus_tag="HELO_1353"
FT                   /product="cystathionine beta-lyase PatB"
FT                   /EC_number="4.4.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1353"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41236"
FT                   /db_xref="GOA:E1V5X4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR027619"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X4"
FT                   /protein_id="CBV41236.1"
FT                   /translation="MTSTFDFATPIDRRHPSDGDWPSQKWHRFDADVLPLWVADMDFRS
FT                   PPAVIEALRARVDHGVYGYGLVPSSLRETLCEWSAEHYGWSIEPDWQLWLPGVVPALHM
FT                   ASLALTEPGDGVLTVTPIYPPFLQVARRTGRESQQAAMRPPETPDGDWRLDLEALEAAI
FT                   TPRTRLLLWCHPHNPTGRVWSAAELEGLAALVERHDLLVVSDELHCDLLLDDGARHRPL
FT                   AAMFPALAERTLTLWAPSKTFNLAGLTTACAVIPDAGLRRRFAEQAKGLQPDGNVLGLV
FT                   AAEAAYRHGEPWRQALLETLRGHRRRLAERVASWPGVRMAAPQSTYLAWLDLREAPALQ
FT                   DADSPQQALLERAGVALSDGADFGWPGFARLNFGTTAEQLEAALERMDTLLKS"
FT   CDS_pept        complement(410571..413417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="valS"
FT                   /locus_tag="HELO_1354"
FT                   /product="valine--tRNA ligase"
FT                   /EC_number="6.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1354"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41237"
FT                   /db_xref="GOA:E1V5X5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X5"
FT                   /protein_id="CBV41237.1"
FT                   /translation="MDKTYQPEQIENRWYQRWEEDGHFAPSGEGEPYSIMIPPPNVTGS
FT                   LHMGHAFQDTIMDTLTRWRRMQGRNTLWQVGTDHAGIATQMLVERKVAAEEGKSRHDLG
FT                   REAFTDKIWEWKHESGGHITRQLRRMGASVDWSRERFTMDDGFYKAVQEVFVQLFDKGL
FT                   IYRGKRLVNWDPTLHTAISDLEVENRDQQGQFWHFRYPLADGVTTEAGLDHLVVATTRP
FT                   ETLLGDSAVAVNPEDPRYASLIGKFVDLPLVGRRIPIVADEHADMEKGSGCVKITPAHD
FT                   FNDYEVGKRCELPLINVFSRDAVILERAEAFDLQGRPLSDIDTSLPSAYAGLSRFEARE
FT                   RIVADMEAAGLLERTETVNNTLPFGDRSGDVIEPYLTDQWFVAVENLAKPAIAAVENGD
FT                   IEFVPKNYENMYFSWMRDLQDWCISRQLWWGHRIPAWYDAEGNVYVARTEAEARDKHGL
FT                   PADVPLTQDEDVLDTWFSSGLWTFGTLGWPEKTEALETFHPSSVLVTGFDIIFFWVARM
FT                   IMLTLEFTGEVPFKQVYVHGLVRDGQGNKMSKSKGNVLDPIDLIDGIDLESLVEKRTGN
FT                   MMQPQKAKAIAKATRQEFPEGIEPHGTDALRFTFLSQATTGRDIKFDMGRLDGYRNFCN
FT                   KLWNASRYVLMNAEGQDCGADGSEVELSLADRWIISRLQQTEAQVTRAMEEYRFDHASQ
FT                   ALYEFIWNEYCDWYLELSKPVLWDDDATPESQRGTRRTLVRVLEAILRLAHPMMPYISE
FT                   EIWQRVAPLAGTYRGEGDSLMVHAWPEADEARVDEAATRNIEWLKGVIVAIRNIRAELN
FT                   IAPGKPLEALLTKGDATDRERLEANRPFLAKLAKLERLDWLDDPAAAPLAATQLVGDME
FT                   VLVPMAGLIDKEAELARLAKEIDKQDKLIGGIEKKLGNESFVAKAPEAVVQKERDKLDD
FT                   LSANRRLLVEQRDKIAAL"
FT   CDS_pept        complement(413589..414044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="holC"
FT                   /locus_tag="HELO_1355"
FT                   /product="DNA polymerase 3 chi subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1355"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41238"
FT                   /db_xref="GOA:E1V5X6"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X6"
FT                   /protein_id="CBV41238.1"
FT                   /translation="MTQVDFYILPDTTLDARLEFACRLAETIVNKGYRLHLHAEDEAMA
FT                   RALDDRLWDFRPDAYLPHALLGSEQADSVPATIGWEEPPSPGEPGTQAMLNLHPDIPEW
FT                   FSRFERVAEIINQHQEVLTAKRDCWQTYKKRGYPVKAHQLGGQGGNG"
FT   CDS_pept        complement(414232..414972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygfF"
FT                   /locus_tag="HELO_1356"
FT                   /product="probable oxidoreductase YgfF (short-chain
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1356"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41239"
FT                   /db_xref="GOA:E1V5X7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X7"
FT                   /protein_id="CBV41239.1"
FT                   /translation="MSKVMLITGAGRGIGAATARLAAQRSYAVAVNYRSDEAAAASVVA
FT                   DIEAAGGRAIAIRADVAVEADILAMFETVDRELGRLDVLVNNAGVVDQVCRVEDMDAER
FT                   IDRMMRINVTGPFICAREAIKRMAKRHGGQGGAIVNVGSAASHLGGADEYVDYAASKGA
FT                   IDTMTEGLSKEVAGDGIRVNTVRPGVVRTTIHASGGNPEKTDVAGSVIPMGRIGEPEEI
FT                   AEGVLWLAEAGFTTGALVDIDGGV"
FT   CDS_pept        complement(415058..416158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvE2"
FT                   /locus_tag="HELO_1357"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1357"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41240"
FT                   /db_xref="GOA:E1V5X8"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X8"
FT                   /protein_id="CBV41240.1"
FT                   /translation="MPTERFSVLPSTDAKAAHIRDDILANPGFGRYFTDHMAHVRWTVD
FT                   AGWHGHEVRPYGPLTLDPAAAVLHYAQEIFEGIKAYRHADGSVWAFRPEKNAERFRRSA
FT                   RRLALPELSDEDFIDSLKALLAQDHAWVPTPASDADESSLYLRPFMIASETFLGVRPAH
FT                   EIDYYVIASPAAAYFKGGVAPVSIWLSSQYKRAAAGGTGFAKCGGNYAASLAAQKEAEA
FT                   HDCSQVAFLDAAENKWIEELGGMNLFFVYRDGRLVTPRLTDTILEGVTRDSVLTLARDE
FT                   GLTPEERPISIDEWREGAANGEITEVFACGTAAVITPVGELVTEEGSIRLSAGGDNEVA
FT                   KRLRSHLLDLQYGRREDSRGWLTRLA"
FT   CDS_pept        complement(416308..417828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="HELO_1358"
FT                   /product="aminopeptidase PepA"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1358"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41241"
FT                   /db_xref="GOA:E1V5X9"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5X9"
FT                   /protein_id="CBV41241.1"
FT                   /translation="MEFPVQTANPAKIETACLVVPVFKDGDLLPVAAKLDDASERLIGQ
FT                   LIERGDFDARLGNVQLIPFAPGLNADRLMLVGLGSREKCQEGAFRKAVDAAFGALATLP
FT                   ADDATVAFNDVPVPDRACDWKARMVAEAAHRAIYRFNDFKSEPAPVPPLERVTLLVSEG
FT                   GDSDAAREGGRIGDGIGQGINATRTLGNLPGNVCTPSYLAERAEQMAADSEGALTTDIL
FT                   DEQALEELGAHSLLSVGRGSVEPSRLIVMKYQGADDPDEAPHVLVGKGITFDSGGISLK
FT                   PGEGMDEMKFDMCGAASVFGAVTSVLAIRPKVNLVAIVASAENMPDGRATKPGDIIKTL
FT                   KGLSVEVLNTDAEGRLVLCDALTYAERFEPASVVDIATLTGAAIIALGHHATGLMSNDD
FT                   DLALDLLDAGETAWDRAWHMPLWDEYQEQLDSNFADLANIGGRPAGTITAGCFLSRFTD
FT                   KYPWAHLDIAGTAWHSGKQKGATGRPVSLLTQYLLDRSSDSQVEVGED"
FT   CDS_pept        417964..419049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptF"
FT                   /locus_tag="HELO_1359"
FT                   /product="lipopolysaccharide export system permease protein
FT                   LptF"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1359"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41242"
FT                   /db_xref="GOA:E1V5Y0"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:E1V5Y0"
FT                   /protein_id="CBV41242.1"
FT                   /translation="MIIFRYLTREILQTMAAVAGVLLLVIMGSRFIRYFSNAAEGEIPV
FT                   DILGTLMLFHLPGFLELILPLAFFLGILLALGQLYLNSEITVLVACGTSPNRLLWVSLL
FT                   PATVVAILVGLCSLWLTPAGALQNEIILDEQSSQLDFGVLAPGRFQNFGGGRVAYTEAL
FT                   SEQERRLEGVFISERQRRDDGTPQTVVTRAAEGYQTIDEETGSRFLVLSDGERYSVEPG
FT                   RAVAEHLSFGTYAVRLSRAAAERDDLDDPEYATTPALFADGSAPAMAQLQWRLGLPPMV
FT                   FILTLLAMPLSRVNPRQGRFAKLLPAIFLYVAYLSLLLAALDAIARGAWPTTLGMWPIH
FT                   AAFLVIGLLMTLRAQRKGMSG"
FT   CDS_pept        419046..420110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lptG"
FT                   /locus_tag="HELO_1360"
FT                   /product="lipopolysaccharide export system permease protein
FT                   LptG"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1360"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41243"
FT                   /db_xref="GOA:E1V6B4"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6B4"
FT                   /protein_id="CBV41243.1"
FT                   /translation="MIADRLDRYIARNVLGAILVVQVVLLGLDLVITYINDLGDVEGDY
FT                   GALQVFFYLVMRLPWRFYQYAPVGVLIGALIGLGGMASSNELTVMRAAGRSLARILWGV
FT                   MKPVILVIAVVLFIAEFVSPSTEQYASAWRLEKMQGEGAVLTERGGWQREGDSFYRFGA
FT                   IRVDNVVLDLTRYRFEGRELREAVSARRAVWRDGGWVLENVDITRFVDGRTEVTHQATR
FT                   PWQTELTPAELNRLLRRVETQAPSELWAHARYLEAQGQDATQPLLYFWQKMLMPLTMAS
FT                   LMLVAASFVFGPLRSVAAGTRVFYGVITGLVFKYLQDLLGPASTVFGFSPAWAVLAPTL
FT                   ICAALGFYMLRRSG"
FT   CDS_pept        420126..420602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1361"
FT                   /product="RDD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1361"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41244"
FT                   /db_xref="GOA:E1V6B5"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6B5"
FT                   /protein_id="CBV41244.1"
FT                   /translation="MVQRFDRLDDVWPAGLGRRLGAMVYDGLLVLAIWIALAAGHVLVS
FT                   RLLLDMPAAQLGVGVVQVASLRVLLLCGAFVFFAFFWMRGGMTLGMQAWRLRVQTTDGR
FT                   AINLRQSLVRYLVGALSWAACGLGHLWVLFDAERRSWADIVSGTQVVVVPKAGT"
FT   CDS_pept        420715..420921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfd"
FT                   /locus_tag="HELO_1362"
FT                   /product="bacterioferritin-associated ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1362"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41245"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6B6"
FT                   /protein_id="CBV41245.1"
FT                   /translation="MYICLCKGVSDKAIRQSVEEGARSWREVQLETGCGTQCGKCACMG
FT                   KGITREAIRETLTAPAEALAYAV"
FT   CDS_pept        421071..421547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="HELO_1363"
FT                   /product="bacterioferritin"
FT                   /EC_number="1.16.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1363"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41246"
FT                   /db_xref="GOA:E1V6B7"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6B7"
FT                   /protein_id="CBV41246.1"
FT                   /translation="MKGDSKVIQYLNTVLGNELVAINQYYLHAKMYQDWGLAALGKWEY
FT                   KESIEEMQHADTLIERILFLEGIPNLQDYGKLLIGENTKEMLECDLKLEQKARADLIDA
FT                   ITHCEQVKDYVSRDLFKCILDDEEEHIDHLETELGLIDKVGIQNYLQKQMQEAE"
FT   CDS_pept        complement(421815..422039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1364"
FT                   /product="DUF1653 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1364"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41247"
FT                   /db_xref="InterPro:IPR023387"
FT                   /db_xref="InterPro:IPR037135"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6B8"
FT                   /protein_id="CBV41247.1"
FT                   /translation="MEAQHPVPGIYRHYKGALYEVIGVAHHSETEEPLVAYRALYGDYG
FT                   LWVRPLSMFMEEVEMQGEPLPRFALEKAF"
FT   CDS_pept        complement(422055..422882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tcdA"
FT                   /locus_tag="HELO_1365"
FT                   /product="tRNA threonylcarbamoyladenosine dehydratase"
FT                   /EC_number="6.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1365"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41248"
FT                   /db_xref="GOA:E1V6B9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6B9"
FT                   /protein_id="CBV41248.1"
FT                   /translation="MNDPLMPPTPTQDDDYELRFGGIRRLYGARAAERFRQAHVVVAGV
FT                   GGVGSWTVEALARSGIGRLTLIDLDDVCVSNVNRQLHALDGTIGRPKVEVLAERCRAIQ
FT                   PGIEVIADTAFVTPGNLADRLPEDTDHVVDAIDSVVAKAALIAWCKRRKLPITVTGAAG
FT                   GQTDPTRIRTADLTRTEHDPLLAKVRARLRRDHGFSRNPRRRFSVECVYSDEQLVYPGA
FT                   DGEVCHTKPGAGESTRLDCASGFGAATFVTGSFGFAAASRVLARLARDATSAH"
FT   CDS_pept        complement(422879..423649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truC"
FT                   /locus_tag="HELO_1366"
FT                   /product="tRNA pseudouridine synthase TruC"
FT                   /EC_number="5.4.99.26"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1366"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41249"
FT                   /db_xref="GOA:E1V6C0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C0"
FT                   /protein_id="CBV41249.1"
FT                   /translation="MIEALPILHHDDHLIAVHKPAGMLVHRSALARGERHFLLQTLRDQ
FT                   IGQRVYPVHRLDRPTSGLMVFALDPEVAGRLADAFATQRVAKRYLAVVRGQGPEAERLD
FT                   YALRDEDGRRPKAEMPAREARTEVRRLDSVELPVRVDRYPSARYSLMEARPLTGRRHQI
FT                   RRHLSRRGYPIIGDAKHGKGVHNRFFAEQLDCPRLLLAAVGLDFEHPVDGRRLTLGCAL
FT                   DAPMTALFQRFGWSAHLPDNRRGISPSAPATTSP"
FT   CDS_pept        423839..424573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npdA1"
FT                   /locus_tag="HELO_1367"
FT                   /product="NAD-dependent protein deacylase"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1367"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41250"
FT                   /db_xref="GOA:E1V6C1"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR027546"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C1"
FT                   /protein_id="CBV41250.1"
FT                   /translation="MEETSRPHLVVLTGAGISAESGIQTFRAADGLWADHPIEEVATPE
FT                   AWARDPERVLRFYDARRDQVRRARPNAAHKALAQLEREGFRVSIITQNIDDLHERAGSR
FT                   QVVHLHGEILKARSSVDERMRYPLPRGGIALGDVCDKGSQLRPDVVWFGEAVPRFDDAL
FT                   ELVAEADLLLVVGTSLAVMPAASLLDEAPLATPRVLVDPEASELTTAGVNGLALPAGEG
FT                   VPLLTRHWRREGRLWLPETVFG"
FT   CDS_pept        424633..425424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1368"
FT                   /product="DTW domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1368"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41251"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C2"
FT                   /protein_id="CBV41251.1"
FT                   /translation="MQDDSSTLRHSDTDPASPPRREFKARGSFVVRCEACNLPSLNCLC
FT                   PYRVRAESRTRVWLLTHPIEQYKPTNTGRLIRDVLPDTEVFTWYRTAPDERLLALLEDS
FT                   RYAPFVVFPDDQEGYAERVVGMDRVIERQKTGRIPVFILLDGTWRQARRIFRRSPYLAT
FT                   LPVLPLVTDRQSRYRLRKAASSDHLCTAEVAAELLRQAGDTRAADVLDDYFEVFNDNYA
FT                   ASRRHTKPTEPTPAMRRLLAARGDEAEEIYGRSTFSERDEQ"
FT   CDS_pept        426304..427212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1369"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1369"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41252"
FT                   /db_xref="GOA:E1V6C3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C3"
FT                   /protein_id="CBV41252.1"
FT                   /translation="MSKNEATALLSEMAVFVKVVEAGSFSEAGRQLASTPSAVSRSVAR
FT                   LEKALGTRLLQRTTRKLRLSDSGKEVYERSRDIVNAAQAVMEVSGRFSHEPQGLVRLSV
FT                   PKAVGRFVIHPHIPEFLALYPEVNLEMRLDDRYIDLIDDQIDVAIRITDQPPPGLMGRR
FT                   LLSIDHLLCTTPHYLAEHGTPAHPRDLKHHSCIYLGEEPGDSRWKFRQGSKVFTVNVQG
FT                   RYAVNHTGARLDAVLHHIGIGSLPYFTAKEALQQGLVIQVLPDWTFKTNYCGDAWALYP
FT                   PTRHLPPKLRVLIEFLAERLR"
FT   CDS_pept        complement(427226..428458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1370"
FT                   /product="TraB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1370"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41253"
FT                   /db_xref="GOA:E1V6C4"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C4"
FT                   /protein_id="CBV41253.1"
FT                   /translation="MTDTQDCAIAEPAAATLGPRRTLQVGETRYTLLGTAHVSAQSATE
FT                   VRDLIASGEFDAVAIELCDSRHQNLANPDALGEQDLFQIFRQGKAGMVAASLALGAFQQ
FT                   RVAEQSGIEPGAEMRAALEGARAHSLPLELIDRDIGITLKRIYHNVPWWQRFSLFSGLL
FT                   GGVLSRQDVSAEDIERLKEGDVLESTFREFATQSESLYTPLISERDRYMALRLAERCPP
FT                   GRYRHVLVVIGAGHLQGMAEHLEAPLPEAPSEERERLETTPPRSRVWKAIPWLITALVL
FT                   TGFAIGFSRNTGLGWQLVGEWFLINGALSGAATLVALAHPLTVLATVVAAPLTSLNPTI
FT                   GAGFVAAGVELALRKPKVRDFSTLRHDVTELKGWWRNRVSRTLLVFLTATLGSAAGTWI
FT                   AGLRIAGTLFG"
FT   CDS_pept        complement(428548..429996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkH"
FT                   /locus_tag="HELO_1371"
FT                   /product="trk system potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1371"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41254"
FT                   /db_xref="GOA:E1V6C5"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1V6C5"
FT                   /protein_id="CBV41254.1"
FT                   /translation="MSLRMILRILGLLLMMFSLTMVPPILISLLFADGMWQAFVVALGI
FT                   TVGTGALMYLPNRHARKELRTRDGFLIAALFWSVLGLFGSLPLMLTGAAALSPTDAVFE
FT                   SFSGLTTTGATVITGIDLLPEAILYYRQQLQWLGGMGIVVLAVAILPTLGVGGMALYRT
FT                   EIPGPLKDSKLTPRITETAKALWYIYATLTVTCALAYMAAGMNWFDALGHSFSTVAIGG
FT                   FSTHDASIGYFDSAAIELICSAFLLISAFSFSLHFVAWRERRLTHYFQDPEARFLMLFL
FT                   AGLIIITSVSLWLTSDYETLQGLRHAVFEVVSIATTAGFSVADFSTWPGALPFLLFVAA
FT                   FVGGCSGSTGGGMKVIRIILILKQGMREVMRLIHPSAVIAVKIGKVSVPDGIAQAVWGF
FT                   FSAYVLLFFLMLVGVMATGVDQVTAWSTVGATLNNLGPALGEASAHYGDLPSLAKWILV
FT                   VAMLLGRLEIFTVVVLFTPAFWRK"
FT   CDS_pept        complement(430040..431413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="HELO_1372"
FT                   /product="trk system peripheral membrane protein TrkA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1372"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41255"
FT                   /db_xref="GOA:E1V6C6"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1V6C6"
FT                   /protein_id="CBV41255.1"
FT                   /translation="MKIIILGAGQVGGTLAEHLAREENDITVVDTDADRLRELHTRLDI
FT                   RTVAGAGSYPMVLRQAGCEDADMLIAVTNTDEVNMIACQVAHTLFRTPTKIARVRATAY
FT                   LTRKGLFAHEAVPIDVLISPEQVVTDHIRRLIEHPGALQVLEFTGGLVQLVAVKAYYGG
FT                   PLVGQELGFLRRHMPSVDTRVAAIYRRNRPIIPRGDTVIEADDEVFFIAARRDIRAVMS
FT                   ELRRLERDFRRVVIVGGGNIGERLAEHLEHSHQVKIVEHNLERCTQLSERLDRTVVLHG
FT                   SATSKRLLEEENIEDCDIFCALTNDDEVNIMSSMLAKRMGAKKVLTLINNAAYVDLVQG
FT                   GEIDIAISPQQATIGSLLTHVRRGDIVNVHSLRRGAAEAIEAIAHGDTQSSKVVGRAIG
FT                   DIDLPSGTTIGAVVRGKEVLIAHDDVVVESGDHVILFVIDKRRIRDVERLFQVGLTFF"
FT   CDS_pept        complement(431512..431715)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1373"
FT                   /product="dodecin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1373"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41256"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C7"
FT                   /protein_id="CBV41256.2"
FT                   /translation="MNHTYKHIELTGSSDKGVEDAIQGALSKASESLHGMRWFEVIDTR
FT                   GHIEHGRVAHWQVTIKVGFTLD"
FT   CDS_pept        complement(431760..433103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="HELO_1374"
FT                   /product="16S rRNA (cytosine(967)-C(5))-methyltransferase
FT                   RsmB"
FT                   /EC_number="2.1.1.176"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1374"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41257"
FT                   /db_xref="GOA:E1V6C8"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C8"
FT                   /protein_id="CBV41257.1"
FT                   /translation="MNQQRRDAGRGKPLDNGQAVRAAAARAIAPVITGKKSLNDLDEHQ
FT                   VVARDRGLFKELCFGTCRALPRLEALAGKLLEKPFKTRDADIQALLLVGIYQLLYLRVP
FT                   AHAAVGETAGAARLLSKAWATRVLNGCLRRLQRESTTLLAEVDRDPAVALLHPRWWVKA
FT                   FRQAWPDDWRAICDANNQPGPMTLRVNRRHGDREMYLERLDSPGARLCPHAPDGLTLET
FT                   PCDIAELPGFKEGHVSIQDEAAQLAAVLLGPVIAPRPGARVLDACCAPGGKAAHLLELF
FT                   DIDLQAIDSDDARLARVEDTLARLGLSASLAHGDATERDWWDGTAFDAILLDAPCSGSG
FT                   VIRRHPDIKRLRRPSDIAKLAELQARLLDNLWPLLAPGGTLLYATCSVLPEENADQVQA
FT                   FLERTPGVEVTTPNGLAWGRPAGAGRQLLPSPDSHDGFFYARLRKGTA"
FT   CDS_pept        complement(433100..434080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="HELO_1375"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1375"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41258"
FT                   /db_xref="GOA:E1V6C9"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6C9"
FT                   /protein_id="CBV41258.1"
FT                   /translation="MSQSLRVIFAGTPDFAAASLRALLASQHSVVGVYTQPDRAAGRGR
FT                   KLTASPVKVLAQSHDLPVHQPESLRTPEAQVQLASLDADLMVVVAYGLILPREILDTPR
FT                   RGCINVHASLLPRWRGAAPIQRAIEAGDSESGVTLMQMDEGLDTGDMLLTRRTPIEADT
FT                   TGGSLHDTLAELGGEALIETLDALAGPGLTAQPQPDDGVTYAAKLSKAEAELDFREPTA
FT                   TLAARIRAFNPWPVAWCALGDERLRLWLAEPGAPARHETNATPGTLLEPDADALRIACG
FT                   DGVLRVTRAQLPGGKPLDVAELLRARADRFTVGTRLGTPDRERSA"
FT   CDS_pept        complement(434197..434709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="def"
FT                   /locus_tag="HELO_1376"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1376"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41259"
FT                   /db_xref="GOA:E1V6D0"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D0"
FT                   /protein_id="CBV41259.1"
FT                   /translation="MAKLPILEFPDERLRTEAAAVETVDDEVRQLVDDMLETMYDARGI
FT                   GLAATQVDVHRRVIVMDVSDDQSAPLVLINPEYTPIGDEREPMQEGCLSIPEYYAEVPR
FT                   ALKVHLKALNRQGEPYELEAEGLLAHCIQHECDHLRGVLFVDYLSPLKRDRVMKKMQKR
FT                   HKLAQGA"
FT   CDS_pept        434873..435973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dprA"
FT                   /locus_tag="HELO_1377"
FT                   /product="recombination mediator protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1377"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41260"
FT                   /db_xref="GOA:E1V6D1"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D1"
FT                   /protein_id="CBV41260.1"
FT                   /translation="MQRSATDWLALSLLPGVGAARLAELAASDPPWPDGWLAALPRPAA
FT                   QALRLCLEHPAQSPLAARLATEREWLDAAPDRHLLHPDHPAWPEALSQIADPPPVLWAL
FT                   GDLDALEAPRLAMVGTRRPTREGTGNAAGFARSLAERGWCVVSGMALGIDGIAQQAALD
FT                   AEGRSIAVLGCGVDVIYPARHRRLHERLREPGGLLLSEHPPGTRARAGFFPRRNRLITG
FT                   LSRGVLVVEAAERSGSLVSARLAVEQGRDVFALPGSIHNPQARGCLHLIREGAALVRDL
FT                   DDILAELAQWSVAPVVNRRAPEAAPDADPVLAWLSDTPTPVDALVDLTGLAVPDCQRRL
FT                   LALELEGRASQAAGGWVRLPTSPGPC"
FT   CDS_pept        436056..436613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tsaC"
FT                   /locus_tag="HELO_1378"
FT                   /product="threonylcarbamoyl-AMP synthase"
FT                   /EC_number="2.7.7.87"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1378"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41261"
FT                   /db_xref="GOA:E1V6D2"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D2"
FT                   /protein_id="CBV41261.2"
FT                   /translation="MLQASSLDTAVAALREGGVIAYPTEAVWGLGCDPDDTSALTRLLR
FT                   IKRRDPAKGVILVAADLDQFSPWLEGLPDERRAVLAEPQAQPTTWLVPDNGRAAELVRG
FT                   EHDKVALRVSDHPLVGELCRAFGGPLVSTSANRAGEPSAMSAEEVRRVFGDELDALLDG
FT                   PLGGHTRPSTIRDLATGRVLRA"
FT   CDS_pept        436687..437622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="HELO_1379"
FT                   /product="coproporphyrinogen-III oxidase, oxygen-dependent"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1379"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41262"
FT                   /db_xref="GOA:E1V6D3"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D3"
FT                   /protein_id="CBV41262.2"
FT                   /translation="MAQAHLDDVKTYLLDLQDRLCDGLAAEDGKAGFREDSWRREEGGG
FT                   GRSRVIENGAVFEKGGVNFSHVHGATLPASASAARPELAGRSFHAVGVSWVLHPENPHV
FT                   PTSHGNVRFLIAEKEGEAPVWWFGGGYDLTPFYPVLDDVRHWHRVARDACAPFGEDVYP
FT                   RYKAWCDDYFMLKHRDETRGVGGLFFDDLNEGGFERCFDFQRAVGDSFLDAYLPIVQRR
FT                   RDTPWGQRERDFQLYRRGRYVEFNLVWDRGTLFGLQSGGRTESILMSMPPLARWEYGWE
FT                   PESGSPEAELNDYLRPRDWLGEAEREEQAQ"
FT   CDS_pept        437619..438431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="HELO_1380"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1380"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41263"
FT                   /db_xref="GOA:E1V6D4"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D4"
FT                   /protein_id="CBV41263.1"
FT                   /translation="MNDRYCVFGHPVGHSKSPAIHTAFAAQTGEALEYIAIEAPLDDFA
FT                   GAWRAFTAEGGRGANVTVPFKEQAYRLCDTLSHRARRAGAVNTLALDADGQTRGDTTDG
FT                   LGLVGDLHRHHVELAGARVLVLGAGGAVRGVLEPLLEAAPASLFIANRTAAKAEALAAD
FT                   FADLGEVAGGGFDAVRGPFDLVINGTSASLAGDLPPLPDDLFAEGGVAYDMMYGSEPTV
FT                   FLRWAGERGARTIDGLGMLVGQAAESFRLWRGKHPDVAPVLDMLRRSL"
FT   CDS_pept        complement(439499..440296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1381"
FT                   /product="peptidase M48 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1381"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41264"
FT                   /db_xref="GOA:E1V6D5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D5"
FT                   /protein_id="CBV41264.1"
FT                   /translation="MRWMHYLALGALGVSLAACTTSPTGRSQMLLMSESDLSQMGAQAF
FT                   AQYQQELPTVGGAQLNYVQCVTNDIVAVLPPEQRDQNWQVKVFESEDANAFALPGGYVG
FT                   VNTGLLDIATNQDQLASVIGHEIGHVLAHHANERASTQSATQLGMSVVGTALGANGVAG
FT                   SDQIMAAMGMGAQYGVMLPFSRSHESEADKIGLQLMAEAGFDPRASIELWHNMNATGGG
FT                   QPPEWMSTHPSHGHRIDGLQANMDAALAQYQRARQAGRRPNCQ"
FT   CDS_pept        440488..441351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1382"
FT                   /product="DUF815 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1382"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41265"
FT                   /db_xref="InterPro:IPR008533"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D6"
FT                   /protein_id="CBV41265.2"
FT                   /translation="MDDELARRLLGVLERVEPWLPPTPVEVDWNRDVAALWQRHMLGGH
FT                   LTPVPPRDALRLDDLLGIERQKQALVDNTRAFLRGYPANHALLWGARGGGKSSLVRALL
FT                   NDLAGEGLRLVQVDRHDLAGLPVLVERLRREPHRFVVYCDDLSFEGHDDAYKALKSVLD
FT                   GTLTGPPENVLLYATSNRRHLLPESMSDNDDSRLVGEELHHGDAVEEKISLSDRFGLWL
FT                   GFRPFDQATYLEACAHWVNWLGDDGDWNDEARGEAIRYATLRGGRSGRVAWQFACQWVG
FT                   RLRLEA"
FT   CDS_pept        complement(441460..442863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="der"
FT                   /locus_tag="HELO_1383"
FT                   /product="ribosome maturation GTPase Der"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1383"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41266"
FT                   /db_xref="GOA:E1V6D7"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D7"
FT                   /protein_id="CBV41266.1"
FT                   /translation="MNPVIALVGRPNVGKSTLFNRLTRSRDALVADFPGLTRDRKYGNG
FT                   MLGGKAYTVIDTGGISGDEEGIDAAMAEQSLQAIDEADIVLFMVDGRSGLNVADEAIAN
FT                   HLRVNQKKTWLVVNKTDGLEEHSAMADFWQLGIGEPRSIAAAHGRNVTSLIEEVLDPFP
FT                   ERDPDIPADTGASGIHIGVIGRPNVGKSTLVNRLLGEDRVVVFDEAGTTRDAIEIPFER
FT                   RGKPYVLVDTAGVRRRKNVREVAEKFSIIKTLEAIKECHVAVMVLDARSGLVEQDLHLL
FT                   DYVLTSGRALVLAVNKWDGLEHEAKEKMRAEIKRRLGFADYAELHFISALHGTAVGDLY
FT                   PSIERAFESANSHWSTNRLTNILRDAVEQHQPPMIHGRRIKLRMAHQGGTNPPIIVVHG
FT                   NQTDSLPEAYKRYLTNTFRKVLKVRGTPMRFEFRSGKNPYDNMAGANDREKAKKRELDR
FT                   TRSARRDRR"
FT   CDS_pept        complement(442860..444008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bamB"
FT                   /locus_tag="HELO_1384"
FT                   /product="outer membrane protein assembly factor BamB"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1384"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41267"
FT                   /db_xref="GOA:E1V6D8"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017687"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D8"
FT                   /protein_id="CBV41267.1"
FT                   /translation="MKSTLAITAIAALGLLAGCAGQVDSQNPPRELQDISRSTSVNTLW
FT                   DEQVGDGLGLGGYLLSPAQDGDTLFAADQHGLVMALNANSGEIRWEQKIDNGVSSGLTA
FT                   MAGHVYLGTRNGEVISLDQSSGKEVWRSRVSSEVLSAPQINSQLVVVQTIDGNVTALDR
FT                   TSGAERWVHTASRPSLTLRTTGTPRVIDAVTFAGLANGRLVTLENGSGRPLWEQRIATP
FT                   EGRSDIERLVDLAGQPVLTRDGRLYVTSYSGRLVALQATSGQELWSRDIASYQTPILIG
FT                   ETLYVVDADSHLLALSASSGDELWRLDDLEGRKLTAPAFADGRLVVGDFAGYLHVIDAR
FT                   NGTLVGRTKVDGSGLSVPPLTDGKRVYALADDGSLEALELKP"
FT   CDS_pept        complement(444005..444664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1385"
FT                   /product="DUF9976 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1385"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41268"
FT                   /db_xref="GOA:E1V6D9"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6D9"
FT                   /protein_id="CBV41268.1"
FT                   /translation="MAELRTEEEQLEAIKRWWKENGVSLLIGAAIAAAGVFGWKTWQDY
FT                   QAGQAEAASQRYQQLLTLSSQEQLDDAARERAEEVATTLVEEHGGTLYADMAQLLSARL
FT                   SVEGGDQAAARETLEALIANSEHDYLSGLARLRLARLQVAADEAEAALKTLDGAIPAPL
FT                   AAQQADIRGDAHFALEQTDQARDAWREALRLAENGERPLYGVQLKLDNLGVQETTS"
FT   CDS_pept        complement(444695..445996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisS"
FT                   /locus_tag="HELO_1386"
FT                   /product="histidine--tRNA ligase"
FT                   /EC_number="6.1.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1386"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41269"
FT                   /db_xref="GOA:E1V6E0"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E0"
FT                   /protein_id="CBV41269.2"
FT                   /translation="MKESSLSKKIQAIRGMNDLLPAQAPLWQYFEQQVRTLMGRYGYDE
FT                   IRTPILEQTALFKRSIGEVTDIVEKEMYTFEDRNGDSLTLRPEGTASCVRAAMENGLLH
FT                   NQTQRLWYQGPMFRHERPQKGRYRQFHQVGVETFGLEGPDIDAEVILLSARLWKQLGLF
FT                   EHVTLELNSLGSPEARAAYRDKLVSYFEAHLDVLDEDSRRRLSTNPLRILDSKNPAMAD
FT                   MLADAPRLMDHLDAESREHFERLTAILDAAGIEYVINPRLVRGLDYYSRTVFEWTTEAL
FT                   GSQGTVCAGGRYDGLVEQLGGKPVPAVGFAMGIERLILLLETLELVPDAVHDTLDVYLL
FT                   PMGEAAEAAALELAERLRDDLPALRLQLHCGGGGFKSRIRKADKSGARLALLLGEEELA
FT                   ENAVTLKFLREEREQRRLSRSELAPALADLLSEA"
FT   CDS_pept        complement(446006..447121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ispG"
FT                   /locus_tag="HELO_1387"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase (flavodoxin)"
FT                   /EC_number="1.17.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1387"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41270"
FT                   /db_xref="GOA:E1V6E1"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E1"
FT                   /protein_id="CBV41270.1"
FT                   /translation="MHAPSPIQRRQSRRIHVGDVPVGGGAPISVQSMTNTDTLDVDATV
FT                   AQIQQLENAGADIVRVSVPTMDAAEAFGRIKRAANVPLVADIHFDYRIALRVAELGVDC
FT                   LRINPGNIGREDRVAAVVSAARDNGIPIRIGVNAGSLEKDLQKKYGEPTPAALVESAMR
FT                   HIDHLDRLDFPDFKVSVKASDVFMAVAAYRELASRIEQPLHLGITEAGGLRSGTVKSSI
FT                   GLGMLLMDGIGDTIRVSLAADPVEEIKVGFDMLKSLSLRSKGINFIACPSCSRQNFDVI
FT                   GTMNALEERLEDVLTPLDVSVIGCVVNGPGEAKESDIGLTGGSPANLVYIDGKPASKLR
FT                   NDHLVDDLERLIRDKVREKQQAEQDVIARDA"
FT   CDS_pept        complement(447127..448137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1388"
FT                   /product="RodZ family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1388"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41271"
FT                   /db_xref="GOA:E1V6E2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E2"
FT                   /protein_id="CBV41271.1"
FT                   /translation="MSDTPLQEPDAVTPQASPGELLRRERDALELSREEVAAALNLRPA
FT                   VIDGLERDSYEEIPIATYRRGYLRSYANLLGLDENRVLAAYKAHFGQDDEHKVTPVHVV
FT                   SKPPSRLGAWLFRLATLVVIAGLIGLTLMWWQSRGGSQPPAPGDNAPVAVDGLDGSAAV
FT                   AEDATPAPDGTSAPEESGETAGAVNATGDAEAPTDGEPELLPTTDEASVAETPEATEDA
FT                   STAEDATASVDGDDASANTDEADVAEANQATQADPRVLNLTFNEQSWTEIFDANNQRVF
FT                   VGLQEPGTTARVEGDPPFRLTVGNATGVELRWGGETVDLREHAGANNVARFTLGE"
FT   CDS_pept        complement(448168..448890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1389"
FT                   /product="PilF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1389"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41272"
FT                   /db_xref="GOA:E1V6E3"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR013360"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E3"
FT                   /protein_id="CBV41272.1"
FT                   /translation="MTGRPSLDGYRQYRIAALLAGAVWLGGCAMRADQPPPDADPAEAY
FT                   TRLGVAYLARDDLSRASEALDHALKLAPDDAEARQAMAMVHHRRGDDALAEENFRAALR
FT                   DAPDLTRARNNYAAFLYDQGRIREACQQLQRASEDTHYTNRAQLLVNLGRCQRATGNEA
FT                   AARASFERALRIDPGRPGSHLHLAELDVAQGRLASAERHLERYRRQAGQDALSARLAEV
FT                   IARARDDHDRPATSRGTP"
FT   CDS_pept        complement(448996..450123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmN"
FT                   /locus_tag="HELO_1390"
FT                   /product="dual-specificity RNA methyltransferase RlmN"
FT                   /EC_number="2.1.1.192"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1390"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41273"
FT                   /db_xref="GOA:E1V6E4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E4"
FT                   /protein_id="CBV41273.2"
FT                   /translation="MTADTAPQRPNLLGMTREEMEAFFLSIGEKKFRAAQVMKWIHQEG
FT                   CSDFASMTNLSKALRAQLSEVAEIRGPSVVYEGTSSDGTRKWVLEVEDGSYVETVLIPA
FT                   DNGKRRTLCVSSQVGCSLDCSFCSTGKQGFQRNLTAAEIIGQVWVASNSFGPRHDTANR
FT                   PVTNVVMMGMGEPLLNYDNVVPAMKLMLDDNGYSLSKRRVTLSTSGVVPMLDRLGDELD
FT                   VSLAISLHAANDELRSELVPLNRKYNIRTLLDACQRYLAKCDDTRMVTIEYTLIKDVND
FT                   QQEHARQLAELLQELPSKINLIPFNPFPHSGYETPSRNQVKRFQQWLADLGYTAPIRST
FT                   RGDDIDAACGQLVGRVKDRTRRHERYIQSIQLDAD"
FT   CDS_pept        complement(450243..450668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndk"
FT                   /locus_tag="HELO_1391"
FT                   /product="nucleoside diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1391"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41274"
FT                   /db_xref="GOA:E1V6E5"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E5"
FT                   /protein_id="CBV41274.1"
FT                   /translation="MATERTLSIIKPDAVAKNVIGEIESRFEKAGLKIVAAKMLQLSQE
FT                   QAEGFYAEHKERPFFGDLVGFMTSGPVVVQVLEGENAIAANRDLMGATNPKEAEAGTIR
FT                   ADYAQSIDANAVHGSDSPESAAREIAYFFEESEICSR"
FT   CDS_pept        complement(450837..451163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscA"
FT                   /locus_tag="HELO_1392"
FT                   /product="iron-sulfur cluster assembly protein IscA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1392"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41275"
FT                   /db_xref="GOA:E1V6E6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E6"
FT                   /protein_id="CBV41275.1"
FT                   /translation="MANLSITTAAAEQINRVLDERGHGLGLRVTVKPSGCSGYSYVLDF
FT                   ADEASNDDVAFEEHGVKVFVAPDALEMLDGSEVDYVSEGLNRFFRFNNPNVKDECGCGE
FT                   SFSV"
FT   CDS_pept        complement(451347..452495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscS"
FT                   /locus_tag="HELO_1393"
FT                   /product="cysteine desulfurase IscS"
FT                   /EC_number="2.8.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1393"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41276"
FT                   /db_xref="GOA:E1V6E7"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E7"
FT                   /protein_id="CBV41276.1"
FT                   /translation="MSAPIYLDYAATTPVDPRVAEVMSRHLTLDGVFANPASRSHMPGW
FT                   QAEQAVESARRQVADLIGADPREIVWTSGATEADNLALTGIMRANREKGRHLVTSTIEH
FT                   KAVIDTALALEREGFEVSWLTPGEDGRIAPSALRAALRDDTVLVSLMAVNNELGTINDL
FT                   ADLAEVAHAGGALFHVDAAQAVGRLPLDVKQSGIDLMSLSGHKAYGPKGIGALYVKRDP
FT                   DIRVEPLIHGGGHERGMRSGTLPTHQIAGMGEAFAIAGREGEADQARIQALRDRLLAGL
FT                   DDLDGIQLNGTGEVSVPNILNLAFTGVDGESLLMALRNIAVSTGSACNSASVEPSYVLK
FT                   EIGVPRPLALASLRFSLGRFTTEDDIDRTIDTLRHALTGLRR"
FT   CDS_pept        complement(452542..453009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iscR"
FT                   /locus_tag="HELO_1394"
FT                   /product="IscR family transcription regulator IscR"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1394"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41277"
FT                   /db_xref="GOA:E1V6E8"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E8"
FT                   /protein_id="CBV41277.2"
FT                   /translation="MRLTTKGRYAVTAMLDLAMHADEGPICLADIAKRQEISLSYLEQL
FT                   FARLRRRGLVDSVRGPGGGYLLTLSPEAISVAQVIDAVDESVDATRCGGMSDCQQGDTC
FT                   LTHHLWNELSEQIHGFLDGVTLGQLARRDEFRAIATRQHRAADNQIPASSP"
FT   CDS_pept        complement(453118..454005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysE"
FT                   /locus_tag="HELO_1395"
FT                   /product="serine O-acetyltransferase"
FT                   /EC_number="2.3.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1395"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41278"
FT                   /db_xref="GOA:E1V6E9"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005881"
FT                   /db_xref="InterPro:IPR010493"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR042122"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6E9"
FT                   /protein_id="CBV41278.1"
FT                   /translation="MFQRLREDINSVFARDPAARNFLEVLTNYPGLHALLLHRLSHWLW
FT                   QRNLKWLARTLSTLGRWLTGIEIHPGASIGRRFFIDHGMGVVIGETACVGDDVTLYQGV
FT                   TLGGTSWNHGKRHPTLGDGVIVGAGAKILGPFTVGAGAKVGSNAVITKEVPAGATVVGI
FT                   PGKVVQRSDPDKEETLQVDPERREAMCRKFGFDAYGVSQDMPDPVARSMQAMLDHMHAV
FT                   DERIERMCSTLHQIDASFRDGQLPELRDEDFANILEDVDSCCPPPEEDTTTQNAENDEP
FT                   RREKDAVSDRHGKG"
FT   CDS_pept        complement(454082..454825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmJ1"
FT                   /locus_tag="HELO_1396"
FT                   /product="tRNA (cytidine/uridine-2'-O-)-methyltransferase
FT                   TrmJ"
FT                   /EC_number="2.1.1.200"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1396"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41279"
FT                   /db_xref="GOA:E1V6F0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F0"
FT                   /protein_id="CBV41279.1"
FT                   /translation="MLERIRIVLIGTSHPGNIGGTARAMHNMGLEDLALVAPRCEPITA
FT                   DTVSRASGADALVHNARTVDNLEDAVGDCTLVVGASARSRNLPWPMVTPRELGERLPTE
FT                   LASPQGRVALVFGREDSGLTNTEMQRCHAHVHIPTNPDFSSLNLAAAVQVLAYECRLAC
FT                   QAESPEMQEPDAAPLASHEELEHYFAHLERTLIDIGFHDPDMPRQLMARLRRFTLRAHP
FT                   ERMELNILRGILSATQRQVEHRQDE"
FT   CDS_pept        454996..455790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1397"
FT                   /product="homolog to inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1397"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41280"
FT                   /db_xref="GOA:E1V6F1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F1"
FT                   /protein_id="CBV41280.1"
FT                   /translation="MHPMVQFALRAARSAGEQFLRIRERIENAHEEHSLDKLLEDTARN
FT                   AETLIQRQLARGYPQHGVVGRYTSHREGEGEGRDMLWRIEPVHGYSNLTVAAPDFALSV
FT                   VCMVKGRPEHAVVICPFSDDEYLASRGRGAQLNGKRIRVPKHYTIDGARIAMGLPESAL
FT                   RSRLLPDHLTLTQQLAPRVELMRASGSGLLDMAELASGRVDAAFVLGLEDQDLHVGSLL
FT                   LKESGALMGTPDGQPSVSASQPLMAAGPRMYKALVKQLKPHF"
FT   CDS_pept        455960..456301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1398"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1398"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41281"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F2"
FT                   /protein_id="CBV41281.1"
FT                   /translation="MQPLSYYYYNVLESLEKPCDVPALHLQEGYDLLYRYGGRVEMDLM
FT                   RRAEAASANGEPYHWHEALDDEQRDKLRRALDDENPAKILKVMQRNGYAGVLYHHAREV
FT                   FRPDAQGVA"
FT   CDS_pept        complement(456419..457345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secF"
FT                   /locus_tag="HELO_1399"
FT                   /product="protein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1399"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41282"
FT                   /db_xref="GOA:E1V6F3"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F3"
FT                   /protein_id="CBV41282.1"
FT                   /translation="MQSLINRQFDFMGKRRYAFIFSVATLLISLVAILVQGLNLGLDFT
FT                   GGTLVEVRYATAPALSMVRETLEAAGFKDVAVQTFGASTEVLIRLQQAFDADVGNQVVD
FT                   LLRQGGNNVDLVRAEFVGAQVGDQLRDQSGMGMLVALGVVVLYVAFRFQYKFALGALLA
FT                   LGHDVLIVLGIFALFGFEFDLTVLAAVLAVIGYSLNDTIVVYDRIRENIRKSRIDDMPA
FT                   IFNEAINQTLSRTLATSGTTLLVVLALMILGGDMIHYFAVALFIGIAVGTFSSIYVSAA
FT                   LLLPLKLQRADLMPAKKEDAEAEEELP"
FT   CDS_pept        complement(457355..459205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secD"
FT                   /locus_tag="HELO_1400"
FT                   /product="protein translocase subunit SecD"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1400"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41283"
FT                   /db_xref="GOA:E1V6F4"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F4"
FT                   /protein_id="CBV41283.1"
FT                   /translation="MLNRYPLWKYLLILLVLVVGLIYALPNLFPEDPAVQISSDRGEFT
FT                   LDERRLDRLEDSLDEAGIATQAIERQPQSVLIRLRHADDQIRARDLLGDSLGEDYVVAL
FT                   NQAESTPAWLESLAASPMTLGLDLRGGVHFLLEVDMEAAITQRLESDASAMRNLLRDER
FT                   LRYRNTELGERSISMDFMNAEDRDQARQLIAPEYPDFDYSNVEKTRGAGLEMTLTDTAV
FT                   NEIQDYAVNQNLTTLRNRVNELGVSEPLVQRQGPNRIVVELPGVQDTAAAKRIIGATAN
FT                   LEFRLEARPDTPESETETFPFRDNEARTATLMRDVIITGDRVSNANRSFDENGRPQVNI
FT                   SLDGTGGTLMNRATRTNIGRNMAVLFIEHNSRERTVMKDGEPTTVRTQDTERGIISLAT
FT                   IQSALGNSFRITGLESPTEAADLALLLRSGSLAAPMYFAQERTIGPSLGAKNVERGILS
FT                   VQVGLLLVVLFMLVRYRVFGVFANLALGFNLTLLVAVMSMLGATLTLPGIAGIVLTLGM
FT                   AVDANVLIFERIREELRNGLSVQQAIHAGYERAFSSIVDANITTLLVALILFSIGTGPV
FT                   KGFAVTLSLGILTSLFTALMVTRAMVNLCYGGKPVKKLWI"
FT   CDS_pept        complement(459343..459681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="HELO_1401"
FT                   /product="protein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1401"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41284"
FT                   /db_xref="GOA:E1V6F5"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F5"
FT                   /protein_id="CBV41284.1"
FT                   /translation="MLDFFISPALAQDAGGAPGGGIAQIVMLVGFVLIFYFLLWRPQAK
FT                   RAKQHKKLISGLSKGDEIVIGGGMLGRITKVSEDSEFLTMEIAEGTEVNVQKNAVATVL
FT                   PKGTLKSI"
FT   CDS_pept        complement(459762..460898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tgt"
FT                   /locus_tag="HELO_1402"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /EC_number="2.4.2.29"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1402"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41285"
FT                   /db_xref="GOA:E1V6F6"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F6"
FT                   /protein_id="CBV41285.1"
FT                   /translation="MRNECFMTFERLATDGRARRGRLTFPRGTVETPAFMPVGTYGTVK
FT                   GMTPQSVKEIGAEIILGNTFHLWLRPGTEVIEGHGDLHDFAQWDKPILTDSGGFQVFSL
FT                   GEMRKITEQGVHFRSPVDGAKVFMGPEESMAVQRSLGSDIVMIFDECTPYPASFDEAKR
FT                   SMEMSLRWAQRSRDAHGDSPSALFGIIQGGMYPALREASLKGLDEIGFDGYAIGGLSVG
FT                   EPKEKMIGVLDYLPEWMPADKPRYLMGVGKPEDLVEGVRRGVDMFDCVMPTRNARNGHL
FT                   FTAEGTVKIRNARHRHDTGPLEEGCDCYTCQHFSRAYLHHLDRCGEMLGSMLNTIHNLR
FT                   HYQRLMAGLRGAIEAGTLANFVEGFYAQRGLPVPPAPN"
FT   CDS_pept        complement(460891..461970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="queA"
FT                   /locus_tag="HELO_1403"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /EC_number="2.4.99.17"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1403"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41286"
FT                   /db_xref="GOA:E1V6F7"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F7"
FT                   /protein_id="CBV41286.1"
FT                   /translation="MQRADFHYELPEALIARYPSEQRSDCRLLCVDGASGALDHRRFPE
FT                   LIDKLEPGDLLVFNDTRVIPARLHGHKASGGRVEMLLERPLDAHRGLAHLRSSKSPKIG
FT                   TELTFEGGIQAVVEGRREALFELRFLGETPLIALLERHGHMPLPPYITRDDELSDRERY
FT                   QTVYARRDGAVAAPTAGLHFDEPLLERLAAKGVESAFVTLHVGAGTFQPVRVDDIREHE
FT                   MHSEWIEVSASVCEQVRAARARGNRVVAVGTTSVRCLESASLKSPDGDIAPYSGETDIF
FT                   IYPGYEWRVVDALVTNFHLPESTLLMLVSSFAGYDTVMAAYREAVQEGYAFFSYGDAMF
FT                   LTRHNSSSTRHADVETPDA"
FT   tRNA            462109..462195
FT                   /locus_tag="HELO_TRNA10"
FT                   /product="tRNA-Leu"
FT                   /note="anticodon=CAA"
FT   CDS_pept        462582..462992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rnk"
FT                   /locus_tag="HELO_1404"
FT                   /product="Rnk family transcription regulator Rnk"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1404"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41287"
FT                   /db_xref="GOA:E1V6F8"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR029462"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F8"
FT                   /protein_id="CBV41287.1"
FT                   /translation="MVARPPLIINRLDAERLQRLIDAAGEDAVALSLEEELERGEVLEP
FT                   EQIPADVISMNSRVRFTDLTREREIVKTLVYPHALDATEDGVSVMAPVGAALLGLHVGD
FT                   VIEEWPLPGGKQTSLRVDAILWQPEREGQFHR"
FT   CDS_pept        463219..463839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1405"
FT                   /product="LysE family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1405"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41288"
FT                   /db_xref="GOA:E1V6F9"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6F9"
FT                   /protein_id="CBV41288.1"
FT                   /translation="MPLSLWLSLAAICAMGAMSPGPSLALVLRHTLGGGRTPGVAAALS
FT                   HALGVGFYALLTVWGLGALIVRFPALFQVITWAGAAYLAWLGIKALRAGRAGALNADAM
FT                   ATSGMQAAREGMLVALANPKLILFFVALLSQFVTPDMSLAARAIIVFTAMIIDGGWYVL
FT                   VAVGLSHSRVLPWLQARAHWINRATGVLLLALALRVALGPIGG"
FT   CDS_pept        complement(463853..464377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1406"
FT                   /product="YgjV family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1406"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41289"
FT                   /db_xref="GOA:E1V6G0"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="InterPro:IPR026267"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G0"
FT                   /protein_id="CBV41289.1"
FT                   /translation="MEDWTLRWMLGQAVSLVALALCVVAFANKRDDRLFVILVFANVAF
FT                   AAQFALFQSWVASGISALIVLRIALARRYPRHTGIMLAMLVATLAIAALTWSGPRDIPA
FT                   LAAGLLGTYGMFMLRGIAMRVLLASAAFCWIISNLLAGSIGGSIAETLIFITNVITMLR
FT                   LRRDALLHGAP"
FT   CDS_pept        complement(464438..466087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidB"
FT                   /locus_tag="HELO_1407"
FT                   /product="homolog to adaptive response protein AidB"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1407"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41290"
FT                   /db_xref="GOA:E1V6G1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR041504"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G1"
FT                   /protein_id="CBV41290.1"
FT                   /translation="MQEYAPRARLATHEVTNQPPPPEDRDLLEDDLPMREALAREAPDW
FT                   VAERLAPLGRDVGSEHVRALGEAANRHPPELRLFDRYGRRLDAVDYHPAYHELMHLAMD
FT                   HGWHAVAWQEEGRGGHQAHVAALYLLTQAEPGFCCPVTMTHAAMPALRHSPSLHERWSP
FT                   GLLHWDYDPRALPAERKTALTFGMAMTEKQGGSDVRANTTQATPVADGWRLNGHKWFCS
FT                   APMSDAFLTLAQTDDGLGCFLVPRFTPDGERNAIELQRLKDKCGNRANASAEIEYRDTW
FT                   AEPLGEPGRGVATILSMVQQTRLDAATAPVAMMRQALSEAWRHVRARHAFGRCLAEQPL
FT                   MRTLLADMALEVEAGVALTLRTARAFDGAARGDAHETALARLLPALAKYWHNKRAPAFL
FT                   AEAMECLGGIGYVEESPLARLYREAPVNSIWEGSGNVICLDVLRVFGRHPEALTALRQE
FT                   LDAARGASSALDTAMQELVTRLEAPPDTLERQARWLTQRLAQCLQGALLLRHAPAEIGE
FT                   TFCRSRFIDASPVFGTLPADAPEAAILNRIQP"
FT   CDS_pept        466276..466830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcD"
FT                   /locus_tag="HELO_1408"
FT                   /product="NUDIX family hydrolase YfcD"
FT                   /EC_number="3.6.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1408"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41291"
FT                   /db_xref="GOA:E1V6G2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR024195"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G2"
FT                   /protein_id="CBV41291.1"
FT                   /translation="MATEPGVSSESTTVQRISDESIQLVDARNRPCGSAPRATMRRYCF
FT                   WHRATYIVVRNARGELCVQRRTLYKEVFPGGIDLAAGGVVGAGEAVHVAARRELAEELG
FT                   IVGVPLRHVLEFVHARNGNHIFGSAYLVDYDGPLVLQAEEVAEAFWLPPEQALALEDVT
FT                   PDTRQVVETLIHDGSLVAVSR"
FT   CDS_pept        466902..467393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1409"
FT                   /product="peroxiredoxin"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1409"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41292"
FT                   /db_xref="GOA:E1V6G3"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR029760"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G3"
FT                   /protein_id="CBV41292.1"
FT                   /translation="MSIHDHDCRTHGGEPFNLRALRGQVLLIVNVASRCGFTSQLGELE
FT                   RLYRRHRDRGFTILAFPCNQFGRQSPESAAGFCSFGEQTYSVTFPLMEKVRVNGRHAHP
FT                   LFVELKREAPGVLGTKAIKWNFTKFLVARDGRVVRRFPPRAGIRELNEALESILDEPWG
FT                   "
FT   CDS_pept        complement(467406..467795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1410"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1410"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41293"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G4"
FT                   /protein_id="CBV41293.1"
FT                   /translation="MDAQTLVDERGELWLALAPLWLEREPKETDYARMVEVIQRHDLSV
FT                   QELEWVFRLELAPVLSRQQMSVASEWRHFDDHKLMRLLVAHNLRLKGWRRKTWALFSGL
FT                   TTIMARHRWNELMERVLIARGETLS"
FT   CDS_pept        468004..469200
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabV"
FT                   /locus_tag="HELO_1411"
FT                   /product="enoyl-(acyl-carrier-protein) reductase (NADH)
FT                   FabV"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1411"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41294"
FT                   /db_xref="GOA:E1V6G5"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G5"
FT                   /protein_id="CBV41294.1"
FT                   /translation="MIIKPKVRGFICTTTHPVGCEKNVLEQIEATRTRGLDKNAGPKKV
FT                   LVVGASSGYGLAARVTAAFGYGADTLGVFFEKPGTEKKPGTAGWYNSAAFDKFAKAEGL
FT                   YSKSINGDAFSHEAREKAIELIKQDLGQVDLVVYSLASPVRKLPDSGEVKRSSLKPIGE
FT                   TYRATAIDTNKDAIIEAEVEPATEQEIADTIDVMGGEDWELWIDALDRAGVLAPGARSV
FT                   AFSYIGTEITWPIYWHGALGRAKEDLDRAAGEIDKRLGQQGGGANVAVLKSVVTQASAA
FT                   IPVMPLYIAMVYKVMKEQGLHEGTIDQLNRLFGERLYGGEAETDDAGRLRLDDWELRDD
FT                   IQQACKALWAEVTTDNLFEITDYAGYKHDFLKLFGFERDDVDYEADVDPVANFDVVEL"
FT   CDS_pept        469297..470280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1412"
FT                   /product="PfpI/HTH domain protein (homolog to transcription
FT                   regulator CdhR)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1412"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41295"
FT                   /db_xref="GOA:E1V6G6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G6"
FT                   /protein_id="CBV41295.1"
FT                   /translation="MMGADGRGGSPSYGLTRDVGMVVLPGFSMLAQACATEPLHVANRL
FT                   AGRTLYRLSTFAVDERPVASASGQALLPQAAAGESGTSLDLLLVCAPGPLAGSVPRTLL
FT                   DWLQRLAAARVVLGGIGGGTELLARTGVLDGYRATLPWPRFEAFARDYPRVRLSQQLFE
FT                   IDRDRLTCGGGTAAMDMMMTLVGSHHGDELAERISEHFVLERIRMGDEPQQVPLRTRLG
FT                   HAPQSLVDAVALMESNIEEPLTTHELAEHLGISRRQLERLFKKYLQAVPSRYYLNLRLQ
FT                   QARRLLRESDRPAGEIALQTGFSSAAHFSTAYRNHFGMTPREERLG"
FT   CDS_pept        470419..470976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1413"
FT                   /product="isochorismatase family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1413"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41296"
FT                   /db_xref="GOA:E1V6G7"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G7"
FT                   /protein_id="CBV41296.1"
FT                   /translation="MNTALLMIDVQASFPARDYWDEALAAPWRERQHALLALARQAGIP
FT                   LVRIYHEEPGSATPFDPEHGLIRPLEGFDEPSAATFHKRAHNAFTDTELERWLHDRGIE
FT                   RLIISGIRTEQCCETTTRIAADLGFEVDFVSEATLTFPMARLGRTWSAEDIRARTELVL
FT                   EGRFARIVDVAELASEWGTHAA"
FT   CDS_pept        470966..471943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1414"
FT                   /product="PfpI/HTH domain protein (homolog to transcription
FT                   regulator CdhR)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1414"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41297"
FT                   /db_xref="GOA:E1V6G8"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G8"
FT                   /protein_id="CBV41297.1"
FT                   /translation="MPLEVAPSPTVGVLMLPGQVPLDLVGPLQVLHSAQRMHEDLTIRY
FT                   FGPSETLDWLGPLALSGIEPLPRASQDWDLLLVPGQYRQGIDPSRQPLAVEWLREHAPA
FT                   ARTVMGICSGSLLLAEAGLLDGRRCTTHHTLLAQLETLAPGARVQGDCIFIEDGPVLTS
FT                   AGISTGIDTMLHWLTRRFGHRLTLAVAREMVLYLRRSGHEPQLAGWLEGRNHVDERIHR
FT                   LQDALSARLGERWSMADMARAAIMSERHLRRRFPAVAGMSPHDYLLRLRLQLARQLMDE
FT                   TPWSLARIAEEVGLGDDRQLRRAWRRFETGSPRAWRERRESGSS"
FT   CDS_pept        472082..473296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aruC"
FT                   /locus_tag="HELO_1415"
FT                   /product="multifunctional
FT                   acetylornithine/succinylornithine/succinyldiaminopimelate
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /EC_number="2.6.1.17"
FT                   /EC_number="2.6.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1415"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41298"
FT                   /db_xref="GOA:E1V6G9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR017652"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6G9"
FT                   /protein_id="CBV41298.1"
FT                   /translation="MTQTPTRSDFDQYMVPNYAPQKTIPVRGEGSRLWDQQGKEYIDFA
FT                   GGIAVNALGHCHPVLVDALKDQADKLWHLANVYTNEPALKLARSLVERTFADKVYLCNS
FT                   GGEANEAALKLARRWAYDNHGERKNRIVSFGKSFHGRTFFTVSVGGQPKYSQGFGPVPG
FT                   GIVHGEYNDLESVRELIDADTCAVMVEPMQGEGGIVPADPEFLKGLRELCDANDALLIF
FT                   DEVQTGVGRTGSLYAYMQYGVTPDILTTAKALGGGFPVGAMLTTDRVAPSLGLGTHGST
FT                   YGGNALASAVALAAVEHIDTPEVLEGVAKRHDLFREHLEAINRKHGVFKEVRGMGLLIG
FT                   AEMHPEYEGRAKDILPLAIEEGLMALVAGPNVLRMAPSLVIPEADIAEGMARLERAVAR
FT                   LVADQ"
FT   CDS_pept        473344..474414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aruF"
FT                   /locus_tag="HELO_1416"
FT                   /product="arginine N-succinyltransferase subunit AruF"
FT                   /EC_number="2.3.1.109"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1416"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41299"
FT                   /db_xref="GOA:E1V6H0"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H0"
FT                   /protein_id="CBV41299.1"
FT                   /translation="MLVVRPARPADLPALERLAGSATPRLTNLPAHRDRLEERLARSQR
FT                   AFEAEVEFPGDEHYTFVLEDLERGEAVGTATIRAQAGAREAYYTYRQETLIHASQQLDV
FT                   RREVQTLSLSHEVSEASLLCAYSLDAHYRGTSAESLLRRARLMFIAQYPERFAEILAMA
FT                   FPGYLDDEQQSPFWNSVGRHFFVRDFQDINYIAGVRSKSFIAEVMPQFPLYQALLTPQA
FT                   RAAVGREHPEHESAMSEMLAEGFLRSRHVDIFDAGPVIKGERERLESFRHAAWHPVRIR
FT                   PAHSLPDAEPAMVANQRLGDFRCVVARYALSPTGQLMLSPEHAELLGVEEGRAVLAAPL
FT                   ALAGAEHDPGYDEGEL"
FT   CDS_pept        474414..475460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aruG"
FT                   /locus_tag="HELO_1417"
FT                   /product="arginine N-succinyltransferase subunit AruG"
FT                   /EC_number="2.3.1.109"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1417"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41300"
FT                   /db_xref="GOA:E1V6H1"
FT                   /db_xref="InterPro:IPR007041"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017650"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H1"
FT                   /protein_id="CBV41300.1"
FT                   /translation="MRIRPIAESDLDELRVLARETGVGFTSLPDNEPFLAAKIASAVSA
FT                   FNGETPEDKRLYFFVLEDEVEGRLAGCCAIESQVGREIPFYHYRVGTLAHSSVQLDLHR
FT                   TIDTLFLSSDHTGDAEVASLFLRSEYRGSDRRHERNGALLSMMRWLFMAEFRDGFPDKV
FT                   LAEMRGLFDESGRSPFWECLGSHFFPMDFNEADRLTGLGQKSFIGELMPKFPIYTPFLS
FT                   EEARACIGQVHEHTRPALAMLKKEGLRWEGFIDIFDGGPTVEAYIDDVRGVRLSRTCRV
FT                   EVKAGELEQTPRPRWLASNTVMADFRAAWVGRGPDDEGVLTLSEAEAERLEVGAGDTLR
FT                   ILDTDEET"
FT   CDS_pept        475460..476929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aruD"
FT                   /locus_tag="HELO_1418"
FT                   /product="N-succinylglutamate 5-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.71"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1418"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41301"
FT                   /db_xref="GOA:E1V6H2"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017649"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H2"
FT                   /protein_id="CBV41301.1"
FT                   /translation="MKATQQLLIGGHWQSGEAEEFAKHDPVGGEALWSGGAASEAQVGA
FT                   AVEAARAAMPAWARTPLEQRKALVERFREVLETHREALATAIAHETGKPLWEARTEVGA
FT                   MIGKVAISIRAQQERAGERERDLGDARAVLRHRPHGVMAVFGPYNFPGHLPNGHIVPAL
FT                   LAGNSVVFKPSEQTPLTADLTLQCWREAGLPDGVINLVQGAAPVGQALSRHPGIDGLLF
FT                   TGSAKVGGLLQRQFSEQLGKILALELGGNNPLVVKDVPNQEAAVLTILQSAFLSGGQRC
FT                   TCARRLIVPRGPVGDRLLEALSEAIAKLRVAGQFAEPAGFYGGLATLEAADGLLAAQAD
FT                   LEERGGTVLSRMARLEEGTSLLSPALVDVTGLEVPDEEHFGPLLKVYRYDDWDEALRLA
FT                   NDTRYGLSAGLIGGERADWDDFLLRIRAGIVNWNRQTTGASGDAPFGGVGDSGNHRPSA
FT                   YYAADYCAYPVASMETEDLQLPDQLPPGVSL"
FT   CDS_pept        476926..478290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aruB"
FT                   /locus_tag="HELO_1419"
FT                   /product="N-succinylarginine dihydrolase"
FT                   /EC_number="3.5.3.23"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1419"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41302"
FT                   /db_xref="GOA:E1V6H3"
FT                   /db_xref="InterPro:IPR007079"
FT                   /db_xref="InterPro:IPR037031"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H3"
FT                   /protein_id="CBV41302.1"
FT                   /translation="MTDERQAGLDVREVNFDGLVGPTHNYSGLAHGNVASMTHEGLVAN
FT                   PREAALQGLEKMKSLMEAGYAQGVLPPQQRPDLGALRALGFDGDNARVLSRAAREAPQL
FT                   LRAVCSASSMWTANAATVTPSVDAADGRVHFTPANLQSSFHRYLEPDTTGRVLASIFAD
FT                   EARFAHHPALPATPAFADEGAANHTRLCASHGEAGVHLYVYGRQAFGGDGVEPRRYPAR
FT                   QTLEASQAVARQHGLNEAQTVFAQQHPEAIDAGVFHNDVIAVGNGPVLLYHEMAFRDEE
FT                   GTLEALRASMPEPLIPVRVPREAVSLDDAVASYLFNSQLLSNPDGSMTLVVPGECQERE
FT                   AVWRCIQDHLLAGNNPIGEVVVKDVKQSMRNGGGPACLRLRVALSAEERATLSGRVLLD
FT                   EALHGELTAWVERHYRDRLAPADLADPQLAEETLAALDELTRILRIGSVYPFQMA"
FT   CDS_pept        478422..479348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1420"
FT                   /product="DUF808 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1420"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41303"
FT                   /db_xref="GOA:E1V6H4"
FT                   /db_xref="InterPro:IPR008526"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H4"
FT                   /protein_id="CBV41303.2"
FT                   /translation="MAGASLLTLIDDIATILDDVSVMTKVAAKKTAGLLGDDLALNAEQ
FT                   VTGVRASRELPVVWSVARGSLLNKAILIPAALLISAFMPWLVTVLLMLGGAFLCFEGAE
FT                   KLAHKFLHGEDDKAEHAERAQALASGEVDMRTFERKRIKGAVRTDFILSAEIIVIALGT
FT                   VTGAALGQQIVVLIGIGLLMTVGVYGLVAGIVKLDDLGFYLDERGGSLAVIGRGLVNGA
FT                   PYLMKLLSVVGTLAMFLVGGGILNHGVPALHHLARDMSEVELAMPGLDAIVHGLGPMLL
FT                   NLLVGLVAGALVLGAVTLIQKWRGADA"
FT   CDS_pept        479345..480454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1421"
FT                   /product="AFG1 family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1421"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41304"
FT                   /db_xref="GOA:E1V6H5"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H5"
FT                   /protein_id="CBV41304.1"
FT                   /translation="MTSPLVAYRCALADGFVADDAQWQAVEVLEWTHQALQRGDARVPG
FT                   VYLWGTVGRGKTWLMDAFQRGLEVSSIRQHFHHFMRWVHRRQFQLTGTADPLQQLAVEL
FT                   SSEARVLCLDELFVTDIADAMLLGRLLGELFEQGVTLVTTSNQAPSGLYADGFNRERFL
FT                   PAIEAIERSTRVVHLAGYQDHRRHPGTLEQRYWVRGEGEASVLPDVFARLNGERAASTE
FT                   PVILGHQPIEVEACGESVVWCRYAALCERPLAALDFIALCDRFRHVLLGEVPCLGGMPV
FT                   AARIARGTEDAGARVEAGDRELPALSRHDDGARRFIALVDECYDRGVPLHVEARVPMEE
FT                   LYPAGHLAFPFRRTLSRLREMQLARFAVR"
FT   CDS_pept        complement(480476..481525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1422"
FT                   /product="stomatin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1422"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41305"
FT                   /db_xref="GOA:E1V6H6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H6"
FT                   /protein_id="CBV41305.1"
FT                   /translation="MDLPVSPGLILSLIIVVIGILIIVKGLVVVRQSEVMVIERLGSFN
FT                   RLLESGINIIIPFIEQPRAITMIRYRKMGDDYHAITSDETRIDRRETVMDFPGQPVVTT
FT                   DNVTVTINGALYYQVIDPKRAVYEVENMSQAVEVLAKTTLRSVVGKMELDKLFESRSEV
FT                   NNEIQAAMEEPASKWGVKISRVEVQDIAMPEEVESAMRLQMAAERKRRATVTEAEGEKS
FT                   AAIAMAQGQRESAILNAEGDKESAILRAQGEQESIKLVLNALGDSEDNKQTVVGYLLGQ
FT                   SYIKGLPNMAKEGERVFVPYESSALLGSMGMFRELAGSPEDAVSTHLQSRGNREGLRSG
FT                   MVGGASSGS"
FT   CDS_pept        complement(481528..481992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1423"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1423"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41306"
FT                   /db_xref="GOA:E1V6H7"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H7"
FT                   /protein_id="CBV41306.1"
FT                   /translation="MDWNPAYTWLVIALLLGVAELASGALLLLALGVAAALTAALAALG
FT                   FSLPWQLLGMGISSGLLVPVAVWVLRPRFSPAGVAYGTTGTGVEQGQTYRVIERDFDGA
FT                   SGIKINGDFYRIRLAATDEADLPADTLVTFKEFDGTTAIVSLASTTSKEQ"
FT   CDS_pept        482198..482932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1424"
FT                   /product="UPF0126 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1424"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41307"
FT                   /db_xref="GOA:E1V6H8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H8"
FT                   /protein_id="CBV41307.2"
FT                   /translation="MTGMIYWLDMMGVIVFALSGVILACRSRMDPFGMLVLAAMTGIGG
FT                   GTLRDLVLGVRPVFWVEDPAYLWVILATVGLSILGFHYIHRLSRVFLPVADAFGLALFT
FT                   VIGAHKAMTLEAPGVVAVLMGLLTGVAGGMMRDVLAHRVPMVLRQEIYATASIAGGVVF
FT                   VTLEALNLPLFAAICGALVTTLGLRLAAIRWRLALPVFAWVEVERPASPSQAGQPPAPP
FT                   KRSKFRVKLIPPERSRRHKERP"
FT   CDS_pept        482929..484005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1425"
FT                   /product="DUF3541 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1425"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41308"
FT                   /db_xref="InterPro:IPR021928"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6H9"
FT                   /protein_id="CBV41308.1"
FT                   /translation="MIATLKATARLRVAWLWGLVLCLGLAGCALDARQDEARYTAVAAE
FT                   IRQHYERILPDLPVDDRRHYAQRLYRLTGEPRYLPPNRAYADRLIAELREEIEGLARPE
FT                   VVAARAEAAVTDYPERTAKQQRRKRMLADWREVAYAKGLAFRLTQASYHGLLNETDLPG
FT                   HRRALRYLESVDFQAFVTDPQVMEVYAAQVANLVYYLHELGVADLREAAIEAFRAHYPP
FT                   ERDAALSRASYRNKIYGMTHFVIAASGYYQRPVSAEEFDWILDYFATHLDRILVETKAD
FT                   IYTEVGISFLLAGREADPAVRRLRDALLAAYDPEARMVPAENGSLDPAYGEHRNVLAIM
FT                   LLDWPERLYPGPELGTHQ"
FT   CDS_pept        484002..485849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1426"
FT                   /product="DUF4153 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1426"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41309"
FT                   /db_xref="GOA:E1V6I0"
FT                   /db_xref="InterPro:IPR025291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I0"
FT                   /protein_id="CBV41309.1"
FT                   /translation="MRSHPSDQATSVTMDTHDPLDTASRYALVIIALLQGGVLCYLHFS
FT                   LGFGAEGRQLWPATDLRWLAAIYTLVIALPGFFYMGLERFRDSRNLLAAAVLAPLLFWL
FT                   GWHLGWLAQAADLALRGGNFIMPFVASIGTSLFILAVYFRAWSHGGRLKVSYPQLVAYS
FT                   WQNALILALLGLFIGVFWLLLMLWSELFRIIGVDVFATVFNEPIFVYPVTWLVGGIGLV
FT                   MIRSRIRLIAMVQFMCEVLIKALLPLACLIGVLFLAALPFTGLQKIWDTGHAALLMMLL
FT                   AIVLLFFFNAVFSEQAESPPYPRVLRCFVYLGILLLPINSLLAAWALWLRIDQYGFTVD
FT                   RLWAGVIQLLIAAFTLTYAVMLPWKRGDALRGIHTINSWLGIGMAVVLIAINTPLADLR
FT                   DWSAESQSARLSSGKVDPDEYEYAYLRFELGAYGVRVLERLRADKAFAEEHPLAAKGID
FT                   AALARESRYDRTPQVDTSDPDAVAAMFRIDASASPPDSLMRVVAEQQNYCLSSSGLCAV
FT                   VQATSPDADYWIVFYTHYSPYSSGEVYRQTPAGGRKIGSASLLGCQHEEASHSGNLGKL
FT                   ERLPGPFMVFTDGECYYQIEPELDYLIDRPISEDGNAGG"
FT   CDS_pept        complement(485923..487413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaD1"
FT                   /locus_tag="HELO_1427"
FT                   /product="sodium/proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1427"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41310"
FT                   /db_xref="GOA:E1V6I1"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I1"
FT                   /protein_id="CBV41310.1"
FT                   /translation="MMLQSFRRLARGRQRLPDRLALASCPFLLFFLVTPALAATPALDL
FT                   TTSFVGFLALAIFTLAYALVMAEERLHMRKSKPVLVAAGIIWGLIGWVYVQAGMSSESE
FT                   HAFRETLLEFSELMLFLLVAMTYINAMEERNVFDALRSWMVRKGFSYRMLFWLTGILAF
FT                   IISPIADNLTTALLMCAVVTKVAEGDKRFINLACVNIVVAANAGGAFSPFGDITTLMVW
FT                   QAGIVHFHEFFALLVPSLVNFLIPAVVMSAFIKNRKPASLEDDIWLKRGARRIIVLFFL
FT                   TVATAVVCHTLLHLPPVLGMMTGLGYLQFFGYYLRQSLPRSLERKRTRYTQRGDWKKLE
FT                   QLGSVVPFDVFNRVARAEWDTLLFFYGVVMCVGGLGFIGYLGLLSDVLYTQWHATGANI
FT                   ALGVVSAVVDNIPVMFAVLTMEPDMSHGHWLLITLTAGVGGSLLSVGSAAGVALMGQAR
FT                   GSYTFMGHLRWTPVIALGYIASVVTHLWLNGASFALHG"
FT   CDS_pept        487659..488375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1428"
FT                   /product="DUF3581 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1428"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41311"
FT                   /db_xref="InterPro:IPR021974"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I2"
FT                   /protein_id="CBV41311.2"
FT                   /translation="MFLDDYHSRTGSRIHITAEQASRFAKRVAGDFNPIHNSDARRFCV
FT                   PGDLLFALVLARFGLSQNMNFRFLSMVGDSVPLSFAEGDDGLIRVQDDAGKCYLEVCRD
FT                   GDVTHDESVVEAFTRCYVAFSGKNFPHYLKPLMEDRGVMFNPRRPLVIYDSMGFSLDRL
FT                   DGVEPGLELLDSSLDVAGKRGDALLDFRIVAGGEEVGNGAKKLVVSGLCDYDASAMDEI
FT                   VDEFYRLKAAHEAGAS"
FT   CDS_pept        488409..489377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1429"
FT                   /product="MIT family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1429"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41312"
FT                   /db_xref="GOA:E1V6I3"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I3"
FT                   /protein_id="CBV41312.1"
FT                   /translation="MIRTLLLDADGHATLGGEELIARWRESPDSRIWIDLQGEGMVRER
FT                   EMLEAFGCHPMAIDDAHRDRHPPKIEEFDDHTLILYRGISSFDDELDYVPQQMAFLLGE
FT                   RFLISLHPGQAMSVDRLFEREGEYLLGWSPEYVALRIMYISAGFYLDSLLAFETQLSDL
FT                   EDALTNDGSDTLMRRVIAYRSRLVKMRRIFNYHVGITQQLIGHDYDHLPRANEETLHAI
FT                   NDVHERFERLLSLTQMYYDICGDLLDGYLSLSSYELNSTMRILTVITAIFVPLSFLAGV
FT                   YGMNFSYMPELSFRYGYFIVVGVMLTLMVSMLYLFRRKRWF"
FT   CDS_pept        489516..489953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1430"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1430"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41313"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I4"
FT                   /protein_id="CBV41313.1"
FT                   /translation="MSIISLGRCALFALPLVAASALAADGNDLTFQGDASFGGPHGGQS
FT                   IQVALIDTASGEVLGMESGEVSADADPAFAFDFPGALQEGGSYEVHYWIDSNFGGGSVG
FT                   SCDEMQNDHQWSVPIEADGGDVSHVETHDPSTLASVCDTFE"
FT   CDS_pept        complement(490008..490502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1431"
FT                   /product="MarR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1431"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41314"
FT                   /db_xref="GOA:E1V6I5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I5"
FT                   /protein_id="CBV41314.1"
FT                   /translation="MDRVSVAIDQWRRECPDLELLPMELTARLGAISRHISHDYLEPFF
FT                   SERGLQPREFDVLATLRRAGKPYALTPTQLFKVLMFSSGGMTNQLDRLEKAGLIARRPN
FT                   PDDRRSMLVTLTEEGLDLVNDTIAPHVDNEARALSPLNQEEQRTLNALLTKLMGGLDTD
FT                   V"
FT   CDS_pept        490580..491533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1432"
FT                   /product="DMT superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1432"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41315"
FT                   /db_xref="GOA:E1V6I6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I6"
FT                   /protein_id="CBV41315.1"
FT                   /translation="MANVPTGHKADVVKALGCLLLVGTLLALSLSVAKFADAADLPRLS
FT                   FLMVAMAGASLAQLLLSLPKRAHWRLDRRVLEYALVSGILLALPNALGFLAVRHVGAGF
FT                   VSLNFAFPILVTWLLAVLLRMESLRWDRLGGVLLGLAGGVVLALSKASAGGGHLGWSLL
FT                   ILLLPLTLALGNIYRTWRWPDGVPLAFLTALVLAGAALGLLPVAFGTETGRVGELFASP
FT                   AAVGLLLVEIGIFTVLYLFFFILQRLAGPVYLSQIGTVAAVMGTAIAVLFLGESAPPNL
FT                   AIAGGLVIAGTLVFQRAAWRAAQASSPSTVSRAKES"
FT   CDS_pept        491536..492168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1433"
FT                   /product="nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1433"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41316"
FT                   /db_xref="GOA:E1V6I7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I7"
FT                   /protein_id="CBV41316.1"
FT                   /translation="MLHTALNWRYATKRMNGRRVPEATVERILDAAHLAPSSYGLQPYS
FT                   VVVVETPELRERCQPAMFHQPQVVEGSHLLVFATWECIGEAEVDQLMALIAEERGLELS
FT                   SLEGYRQTVAGTVERLATAEARHQWAARQAYLAMGMVLAAAAMERVDATPMEGFDPAAL
FT                   DEVLGLPARGLRSAVVVTLGYRDTDADWLANLKKVRWPRERVITRAE"
FT   CDS_pept        complement(492190..492936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="HELO_1434"
FT                   /product="aquaporin Z"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1434"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41317"
FT                   /db_xref="GOA:E1V6I8"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR023743"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I8"
FT                   /protein_id="CBV41317.1"
FT                   /translation="MHKYIAEFIGTFWLVLGGCGSAVLSASFPELGIGLLGVSLAFGLT
FT                   VLTMAFAIGHISGCHLNPAVSIGLWAGGRFPARELPWYIVAQVIGALIGAGVLYLIATG
FT                   KPGFEISSGFAANGYGEHSPGGYDMISALLVEIVMTMMFLFVILGATDARTPRGFAPLA
FT                   IGLSLTLIHLVSIPVTNTSVNPARSTGVALFVGDWAVAQLWLFWVAPILGSLLGAIFYR
FT                   MISGTWRDREEAEQRRQQESEPSHAA"
FT   CDS_pept        493423..493965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1435"
FT                   /product="GNAT family acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1435"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41318"
FT                   /db_xref="GOA:E1V6I9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6I9"
FT                   /protein_id="CBV41318.1"
FT                   /translation="MSGRAFETERLIIRRLAKEDLADLTALLSDPEVMRFSVRGVCDRR
FT                   ATRRFLDWSQDCHALRGFGPMALIDRGSGAFVGFCGLVPEEVAGVEEIGIGYRLARQFW
FT                   HRGLATEAARAVMAHAFDVQRLEEVVSVIEPAHRASIRVAEKIGFQAFVTCHFHGRDVR
FT                   VYRLSRAQWREMASSVG"
FT   CDS_pept        493990..494541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1436"
FT                   /product="DUF925 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1436"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41319"
FT                   /db_xref="InterPro:IPR009267"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J0"
FT                   /protein_id="CBV41319.1"
FT                   /translation="MFHDPENRILAWLHADPVRCEALELAECLGLADWCLAAGFVRNLV
FT                   WDRLHGYAHSTPLNDIDLVYFDPDDDSESRDRDLEGYLNSVSRLPWSVKNQARMHERNG
FT                   DAPYRSTSDAMTYWVERETAVGVRLDGEGSMSLVSPLGLTSLLEGQVTYNPRCRNMVAF
FT                   RERSRNKDWLSIWPRLVVAG"
FT   CDS_pept        complement(494608..495249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1437"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1437"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41320"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J1"
FT                   /protein_id="CBV41320.1"
FT                   /translation="MQRQSAEVLREYGPFPGIECVHGVTFDGRYIWLATGETLTALDPT
FT                   SGKTERSVDAAASAGTAFDGQHLFQIAGQRIQRIDPETGDVLATIPSPSGDDDSGLAWA
FT                   EGTLWVGQYEGRRILQVDPQTGAVLRTLESNRMVTGVTWVDGELWHGTWESGESDVRRI
FT                   DPHSGEVQQRLDLPTDTGVSGLESDGADRFFCGGGPSGRLRAIRRPQREA"
FT   CDS_pept        complement(495295..496515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1438"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1438"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41321"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J2"
FT                   /protein_id="CBV41321.1"
FT                   /translation="MDALIEAAGRALAAGDPLGALNRIALREDAPALALRGIALARLGD
FT                   LSLGRERLRDAARAFGSKEAAARARCIVAEAEIALVSRDLGWSARALGGARDTLETHGD
FT                   LVNASHARHLEARHLLLRGRLDEADAILADIDTAPLPPALRAAHELVVAGIATRRLKTG
FT                   RVHAALARAENAARAAGIPALMAEVETASRILRTTAARRITRDDACPLLLEDVEALLAS
FT                   RALVVDACRHVVRHADSVVSLTRRPVLFALVRALGESWPDDVPRETLIKRAFRTRYVDE
FT                   THRARLRVEIGRLRTALRSLASVSATHRGFSLAACEAREVVVLAPPDDTPHADVMALLA
FT                   DGEAWSSSALALALGVSQRTAQRSLDALAAANKVQAYGRGRARRWMTGAIPGFTTTLLL
FT                   PGPLPSG"
FT   CDS_pept        496635..497414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1439"
FT                   /product="DUF899 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1439"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41322"
FT                   /db_xref="InterPro:IPR010296"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J3"
FT                   /protein_id="CBV41322.1"
FT                   /translation="MVEHRTATREEWLAERLELLQAEKELTRRSDELAQRRQALPWVRI
FT                   DKSYRFETEAGDASLKDLFQGRSQLIVYHFMFGPDYEAGCPSCSMIADGFNGFVTHLAH
FT                   HDVTLMAVSRAPLATLQAYKQRMGWSFPWASSPDGDFNFDFSVWFTEQQQRDGDIEYNY
FT                   QREPVFAWRAGKAGGGEAPESQFAAMCGTDTATYQRDRPGMSTFVLEDGAVYHCYSTYS
FT                   RGLDGLWGSYQWLDRAPLGRNESGGIWWRRHDEYGES"
FT   CDS_pept        497551..497961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1440"
FT                   /product="glyoxalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1440"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41323"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J4"
FT                   /protein_id="CBV41323.2"
FT                   /translation="MTRMIFVNLPVTDLGASMAFYQALGFENNPTFTDETAACMVWSET
FT                   ISVMLLTHDKWRTFTSRPIPPATSSEVMLAISCESREAVDDMNEAAAANGGTADINPLQ
FT                   DLGFMYNRNLADPDGHVWEAMWMDMAAMPTDT"
FT   CDS_pept        complement(497998..498411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arfB"
FT                   /locus_tag="HELO_1441"
FT                   /product="peptidyl-tRNA hydrolase ArfB"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1441"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41324"
FT                   /db_xref="GOA:E1V6J5"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J5"
FT                   /protein_id="CBV41324.1"
FT                   /translation="MLRISNTVELTDQEIEITQIRAQGAGGQNVNKVASAVHLRFDIPG
FT                   SSLPPFYKERLMALSDRRISKEGVIIIKAQNHRTLELNKEDALGRLRELIQGAVQQRKT
FT                   RKATRPTRGSQRRRVDKKVQKGKTKALRGKIKP"
FT   CDS_pept        complement(498431..498652)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1442"
FT                   /product="DUF3820 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1442"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41325"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J6"
FT                   /protein_id="CBV41325.1"
FT                   /translation="MNPEDLERLVSLRMPFGKYEGTLIADLPGPYLNWFAREGFPSGEI
FT                   GRLLHLMHEIDHNGLGGLLDPLRSTSQA"
FT   CDS_pept        complement(498685..499608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ampR"
FT                   /locus_tag="HELO_1443"
FT                   /product="LysR family transcription regulator AmpR"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1443"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41326"
FT                   /db_xref="GOA:E1V6J7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J7"
FT                   /protein_id="CBV41326.1"
FT                   /translation="MARPHLPLNALRAFEAAARHASFTQAANELNVTQAAVSHQVKLLE
FT                   SRLDVALFKRLPRGLLITPEGEALLPVMQDSFDRMAEMLERLETGRVRDILMVGAVGTF
FT                   AVGWLLPHLPDFQARHPLIEIRLSTHNNRADIAAEGLDYAVRFGDGGWHGTEAMPLFEA
FT                   PLSPLCIPRIAESLHEPSDLMHHTLLRSYREHEWTSWFEAAGVHATPPLAQGIVFDSSL
FT                   AMMDAALQGAGVALCPPRMFTRQLASGAIRQPFDLHTSMGGYWLTRLKSRPVTPAMHAF
FT                   ETWLGEASTPHRAMDTGHFPEHRPLP"
FT   CDS_pept        499798..500700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="blaA"
FT                   /locus_tag="HELO_1444"
FT                   /product="beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1444"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41327"
FT                   /db_xref="GOA:E1V6J8"
FT                   /db_xref="InterPro:IPR000871"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023650"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J8"
FT                   /protein_id="CBV41327.2"
FT                   /translation="MSISLTRRGFTALLGSLAVAGAMFTPMITLADTEGAGLEAELASL
FT                   EQRLDARLGVAVTDTGSGRHWGHREDERFPMASTFKVLACAALLDRVDAGQEELQRRVI
FT                   YEQDDLVTYSPVTKEHVGEPGMTLGSLCEAAMGYSDNSAANMVLKAIGGPSAVTDFTRS
FT                   LGDDMTRLDRWETKLNEAIPGDPRDTTTPAAMAADLQALFLGDRLSEESRERLTDWFLG
FT                   NRTGDARLRAGLPDDWRIGDRTGSGAHGSTNNVAVAWPSDGEPVIISAYLTEFEGDMDQ
FT                   RNAAIAEVGKLVARALQQR"
FT   CDS_pept        500794..501426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1445"
FT                   /product="YhfK family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1445"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41328"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6J9"
FT                   /protein_id="CBV41328.1"
FT                   /translation="MTTLVIGANGQIGRQFCELAKAAGEPIKAMVRSEEQRAWFEERGI
FT                   DTVVADLEGELRHAFEGCDQVLFTAGSGPHTGPDKTLMIDLYGAIRAADLASELGLSRY
FT                   LMVSAMRAEDPLSAPEKLRPYTAAKFAADAHLRHSRVPHVILKPGRLTDEAATRKVATS
FT                   LEETGGENTVSRANVAHALLHLVQARTLVDCEFDLLDGEREIAEALS"
FT   CDS_pept        501423..501791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1446"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1446"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41329"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K0"
FT                   /protein_id="CBV41329.1"
FT                   /translation="MSGNITPGASDPALAERVRRVLETLPESALPMTYRQLAATLGLTP
FT                   PRTIQRVTTALEALMREDVRQARPMIAALVVSQRGGESLPATGFFELAVELGRLTADPA
FT                   RQVDAYHEEFRRALAARG"
FT   CDS_pept        complement(501802..502581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1447"
FT                   /product="DUF81 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1447"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41330"
FT                   /db_xref="GOA:E1V6K1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K1"
FT                   /protein_id="CBV41330.1"
FT                   /translation="MAELEWYQYALIGLIFAWSGFVRTSLGFGGAVLALPFLLLVLDEP
FT                   LVFLPIVAIHLLIFSSWIAWRGHRQARADDAGARDGGNIDWAYLFRALKIMIVPKLIGV
FT                   VGLLTLPGNIMSIIIFVIVLVYGTSYLLNRPFRSQNKAVDCVLLGLGGYVSGTSLIGAP
FT                   LIVSVFASHVAKHQLRDTLFVLWFILVAIKMVSFVIAGVDLQLIHQLWLLPCALAGHLL
FT                   GERAHRYMLSAGSGVFFRVLGGVLILVSVIGLISGAG"
FT   CDS_pept        complement(502585..503058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1448"
FT                   /product="YwhH family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1448"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41331"
FT                   /db_xref="GOA:E1V6K2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K2"
FT                   /protein_id="CBV41331.1"
FT                   /translation="MSLASVRTFLAEKAPDIEILELETSTATVALAAEAHGVAPGQIAK
FT                   TLAFRIGERQVLVVASGDARFDNRKMRDTFAGKAKMLDAETVLALTGHPVGGVCPFGLA
FT                   SPLPVYCDASLKAYDEVLPAAGEVNSAVRLTPTRLAELVDAEWVDVCKTPEVA"
FT   CDS_pept        complement(503129..503896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1449"
FT                   /product="DUF1499 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1449"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41332"
FT                   /db_xref="GOA:E1V6K3"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K3"
FT                   /protein_id="CBV41332.2"
FT                   /translation="MSSLTFKPRPRGGNWPVVLGWLGVILLVVAVALMGAAGPAYRLEW
FT                   LSLGTSFTLLRQGAHLALGAGVLGLLTFMVAGLCRRWRPALVGMLVILAVAATIALPAQ
FT                   MMHMARTVPPIHDITTDVTTPPAFEALADERQAAPNAVAYPGEPTARQQRIAYPHLAPI
FT                   TLDQPLDRVMAAVEAAADAQDWHIAEVTSHRLEATATTRWFGFEDDIVIRLTETPDGVR
FT                   VDMRSASRIGRSDLGTNAARIQTFLEDVQRRAQ"
FT   CDS_pept        complement(504079..505557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trkI"
FT                   /locus_tag="HELO_1450"
FT                   /product="trk system potassium uptake protein TrkI"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1450"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41333"
FT                   /db_xref="GOA:E1V6K4"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/Swiss-Prot:E1V6K4"
FT                   /protein_id="CBV41333.1"
FT                   /translation="MADTRRVTDTLRRWAPILKVLAVLWLVLAIFMAIPLLVLIVESEP
FT                   DALAFGLSIAIVLAAATLSWIVTWRIPVSLKPWQMFVLTTLSWVTISSFASLPLVLGAP
FT                   QLSLTNAVFESVSAITTTGSTILVHIEDLSDGLKLWRGIMQWLGGIGIIVMGIAILPFL
FT                   KVGGMRLFHTESSDWSDKVMPRTGGIAKATLSIYCGFTLLAAMAYYLGGMSPLDAVVHA
FT                   MTSLATGGFANSDASFGAYAEQPQLLWMGSLFMLCGALPFVLYIRFLRGSRMALLRDQQ
FT                   VQGLLLLLLLVILALTIWRVSQGTPAFTSLTQVTFNVVSVVTTTGYASDDYSAWGATAY
FT                   VAFFYLTFVGGCSGSTSGGMKIFRFQVAMLLLRDQLRYLIHASGVFVSRYNNQPLTDDI
FT                   TRGVVAFSFFFFLTVAGLALGLSLLGLDFTTALSGAATAVANVGPGLGETIGPAGNFAP
FT                   LPDAAKWLLCVGMLMGRLEILTVLVLLTPMFWRQ"
FT   CDS_pept        complement(505718..506860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1451"
FT                   /product="mandelate racemase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1451"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41334"
FT                   /db_xref="GOA:E1V6K5"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K5"
FT                   /protein_id="CBV41334.1"
FT                   /translation="MSVIERIEITHHQQPLEPPFPAAWDSQPRRLFPATLVRVIDNEGR
FT                   EGVGSGDAMYGFEDFRSLFIGRDPLDLERHSGVIDNIGFHAGRCWPMEVALWDLAGKIR
FT                   GEPVWRMLGGTSNRLRAYASSGTHRPLEQLVALAEQVRDAGFPAMKLRFGRPRLEDDIA
FT                   ALAAVRQTLGEAFTLMVDCNQGWRMPWDVQAPWDLAKASEVAEELIRHNVLWMEEPLYR
FT                   GDYPGMAALNAHTGDRLKIAGGEMTREPYEFHEMLRRDCLDVYQPDAVCSIGMLGLSRL
FT                   ARDVTAHGKWFTPHTWGNGIGLIANLHLTAGTVGPEGCPYLEFPFDPPEWTPEARDYPL
FT                   ATPLTIDDAGWLSLSEAPGLGVMLDERRLRDTRTDRATYR"
FT   CDS_pept        complement(506857..508047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1452"
FT                   /product="probable oxidoreductase (iron-containing alcohol
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1452"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41335"
FT                   /db_xref="GOA:E1V6K6"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K6"
FT                   /protein_id="CBV41335.1"
FT                   /translation="MPMNFTTGRQVPLVVGAGALAQLPELCRTHGASSALIIADAGIAA
FT                   TGLVDRLASLLDGELPVTRFIAPAGEPTLATVDAGAEAARELESPLVIGLGGGTALDIA
FT                   KLVAALVTSPGAMADYLLARTPWAGRAPAMMIPTTSGTGSEVTRTSIVADDRGRKQWAW
FT                   GDELLPEAVLLDPELTRTLPAPLTAATGLDAFVHALEATSGQGRHVVIEASALQAMRLI
FT                   GQALPRAVAAPDDLEARQHMQVAACLAGQAIDNGGTGLGHNIGHALGSLYHLPHGIAVT
FT                   LGVEATLAWTIEGREAVFAPAAKALASGDTASELPARFSALVDAARFNAALAPFADLEL
FT                   NAGALAATMQAEENAPMADNAARRPAADDWHALAEATVSLFERRLAHLKAAQEHPA"
FT   CDS_pept        complement(508049..509575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuC3"
FT                   /locus_tag="HELO_1453"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1453"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41336"
FT                   /db_xref="GOA:E1V6K7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K7"
FT                   /protein_id="CBV41336.2"
FT                   /translation="MADDTAILTPRTRDLDGWRELATQLSLPCRAYLGGDWHSAESGRT
FT                   FTARNPATGEPLTEVAACDTADVDRAVAIARRTFEAGEWRNQPPAERKARMLAWADAIT
FT                   AHADEIALLETLETGKPIGQTTSVDVPGLVGGLRWYAEALDKLYGETAPNGASSVCFIE
FT                   REPVGVVAAVVPWNYPLIIAGWKLGPALGAGNSVILKPAEQSTLATLRVAALARNAGIP
FT                   SGALQVITGLGHEAGQALGLHDDVDAIGFTGSTEIGKKFLEYSARSNMKRIGLECGGKS
FT                   PHIVTRDVDDLDRIAMYVAYGVWYNQGETCHAGTRLIVDRAIKDELLARVRQWADRLQP
FT                   GDPLDPDTQMGAMIEPEHADKVMGYLQQGRDEGARLLFGGERVRQDSGGVFITPAIFDD
FT                   VTNDMRIAREEIFGPVLVVIAVDGLDEALEVANDTDYGLGAAIWTQRMSDGHRAARALR
FT                   AGTVWVNCYDHTSINAPFGGYKQSGQGRDKSLHAFDKYTELKTTWIELDT"
FT   CDS_pept        509755..510651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1454"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1454"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41337"
FT                   /db_xref="GOA:E1V6K8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K8"
FT                   /protein_id="CBV41337.1"
FT                   /translation="MSRYLPPLNALKAFEAAAQCQNFTQAAQRLHVTQSAISRQVRHLE
FT                   EQLGVILFERRPGQLRLTEAGRRLLPALSTSFDRIALTVRDLASPTDLTRLRLNVPPTL
FT                   ASRWLVPRLDDLRRRYPSLSLTLTTREVDDLAADSTLDAAIRFGDGDWTDVEPHFLMQE
FT                   SHIAVCSPRLLRDGRPLDLREQTLLHVMRTTEDRFPTWRHWLDAAGIEGIDTEGGLEFD
FT                   LLDLAIRAALEGLGITIADRAMVARELAKGELVQPLAAAMPGHQSYWFTTRPGQGDEPS
FT                   LTLLRDWLQGAVGNDHA"
FT   CDS_pept        complement(510681..511625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1455"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1455"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41338"
FT                   /db_xref="GOA:E1V6K9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6K9"
FT                   /protein_id="CBV41338.1"
FT                   /translation="MLDAPQPFEKRVIPMDSIGDSDRSRLPALDSDLLLAFITVADSGG
FT                   FTTAARYLHKTQSTISLRVSTLEDRLGTRLLNRTSRHLSLTPDGQTFLVYARRLLQLQR
FT                   EALGALSVSSEPITLRFGLPEDHADTWLPALLERFSAAHPEVRVHIHCRMSTELLDRLD
FT                   DGSLDLVLAVRHAADSGGEVVGKEAVVWAAHRDFQLDPQRPLPLALFPEQCIYRRRALQ
FT                   ALTERGLAWQVDSTSQSPSGLRVIVDQARALTLCDLRSLPEHWRVLGEAEGLPPLPAAE
FT                   LEIHRSPSLTHPAFEAFVQRLQEVIADAVPASS"
FT   CDS_pept        511666..512559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1456"
FT                   /product="hydroxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1456"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41339"
FT                   /db_xref="GOA:E1V6L0"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L0"
FT                   /protein_id="CBV41339.1"
FT                   /translation="MSATDHGLANAEALDLSDIVDTHRYPLHRPDDPGLLETIETARVH
FT                   LDREGCAVLRGFLRQDRLELVREESAWMAEKSFYNTREVNAYFTADDPDLPERDPRRLF
FT                   MTRTSGFVTRDMITADTLIHRLYVSRAMKSLVQRCLGEPRIYEYADPYAGLVLNVLPDG
FT                   TEQPWHYDTNEFIVTMMTQQSENGGVFEYCPNIRTPRDENYDGVGAVIRGERTERVQRL
FT                   DLRPGDLQLFKGRFSLHRVTRVEGDTPRLTAIFAYSRAPDIVGRLERTRQLYGRVAEQH
FT                   MLAEERREERADGLID"
FT   CDS_pept        512612..513859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1457"
FT                   /product="peptidase M24 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1457"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41340"
FT                   /db_xref="GOA:E1V6L1"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L1"
FT                   /protein_id="CBV41340.1"
FT                   /translation="MRMDLAAMDILPPTHDPAECEPSADEIPRILLDRLGRVRAELAKR
FT                   DITAAVLFDPAHVRYATGSRNMQVYSSRNPARYAFVPAEGPVVLFEFSGCEHLASHLPT
FT                   VDEIRPAKAISYYFNEKNTEAVTRAWADEIVELARQCGGGERLAIESATPEAAFELQRR
FT                   GYRVLDAQEPLEMARAYKVPNEIKMVRSSLRAVEDGVRKLEAAIVPGVSENAVWAKLHE
FT                   HIIATDADFVETRLMNSGPRTNPWFQECSDRLIRDGELVALDTDVVGRYGYYADFSRTF
FT                   LCGDGEASPAQRDLYKLAYEQIRTNMENLKPGVSFKEYAERAWRIPPAYRARRYFALAH
FT                   GVGMNGEYPYIVHREDIDDKGYDGIIAPGMTLCVESFIGHENGGEGVKLEEQLYVRDDG
FT                   RVELLSDYPFDPRLIG"
FT   CDS_pept        513995..514864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1458"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1458"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41341"
FT                   /db_xref="GOA:E1V6L2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L2"
FT                   /protein_id="CBV41341.1"
FT                   /translation="MKKISSALLALALIPASQGLMAQDKNLVIGTNNWAENIAVANMWK
FT                   ILLEEEYGYDVELSNVSKNALYAAMSQGDIDISMEIWLPITDKPFLEPYKDELQVHDAW
FT                   YEGTGLGLVVPGYVDIDSIPELKEHADEYEYQGSPSILGIDSGSAIAGLTDEAIEQYEL
FT                   PMSQVNSSGPAMMAALDGAYASQEPIVVTLWSPHWAFAEYDLKYLEDPKGVYGENETIY
FT                   WFSRGDFASDDPWLTEVLNAWKMDDDTLGGLMATIEEVGDPVEGAQQWIDNHRDTIDQW
FT                   LAASEAAN"
FT   CDS_pept        515244..515675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1458A"
FT                   /product="probable deaminase (homolog to ribD deaminase
FT                   domain)"
FT                   /db_xref="GOA:A0A1R4A446"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A446"
FT                   /protein_id="SJK83736.1"
FT                   /translation="MESHEIYMRLALRESRKALPECLPNPPVGCVLARRGVVVSRGYTK
FT                   APGGYHAEADALAGYEGPSSDLTAYVTLEPCSFHGRTPSCADALIDQGVSLVVVALVDP
FT                   DPRNDGRGLTKLRRAGVDVIEGVCAREVSEFLTAYLSDH"
FT   CDS_pept        515789..516126
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1458B"
FT                   /note="product:uncharacterized protein (nonfunctional)"
FT   CDS_pept        516247..516561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1458C"
FT                   /product="uncharacterized protein"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A447"
FT                   /protein_id="SJK83737.1"
FT                   /translation="MIIAITKFQLPSPITPDEAKQIFLSTAPTYQGVQGLFRKHYVLWE
FT                   DRKTVGGIYLWNSRAEAEATYTECWKAFVRDKYGSEPSVTYFDSPVLVDNIAGEIISDE
FT                   "
FT   CDS_pept        complement(516700..517335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1459"
FT                   /product="OmpW family outer membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1459"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41342"
FT                   /db_xref="GOA:E1V6L3"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L3"
FT                   /protein_id="CBV41342.1"
FT                   /translation="MKNVTALSAAFLALASGIYASSAVAYYGKGDIYTRVGIVKVDPKS
FT                   DNGNFNAIGVSDVDVDQDRGFGFTLGYRFMDKLGVELLAAEPFEHDIALDGVNSASTKH
FT                   LPPTLTLQYYPLGGTDSSVQPYAGVGVNYTRFSDEKVDGGSLELDDSWGVAAQLGVDLL
FT                   LDDHWALNAAAWYLDIDTDATATIGGSSYDTTVNIDPLVVMGGISYRF"
FT   CDS_pept        517753..518490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1460"
FT                   /product="probable flavin-dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1460"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41343"
FT                   /db_xref="GOA:E1V6L4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L4"
FT                   /protein_id="CBV41343.1"
FT                   /translation="MNPTIELMKSHRSVRQFTDQRIPRETLLELIRAGQGAATSSHVQA
FT                   YSVIHVTNPTNRERIAELAGGQDYIATCSDFLVFCADMKRPTEASERTGASVTRGMTEQ
FT                   LLVASVDTALMAQNVALAAESEGLGICYIGGIRNNPAAISDLLRLPAHVYPVFGMCLGY
FT                   PDKENLPEVKPRLPVEAILKEDAYTDDTEEVAAFDESMRRYYSQRSGGRKNSDWSHNLT
FT                   PLFDTKLRPHMRDFLVERGFEMK"
FT   CDS_pept        complement(518607..519503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1461"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1461"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41344"
FT                   /db_xref="GOA:E1V6L5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L5"
FT                   /protein_id="CBV41344.1"
FT                   /translation="MERLEDLEAFVGVVEQGGLTAAARWLDRSVQSVSRALATLEDNLG
FT                   IELVERTTRRSTPSEAGLAFYRRVKPALEEIKEARLEATDSRIAPSGLLRIGAPVLFAP
FT                   VYLMPVIADFMRRYPEIDVELKLSDRFVNFEEEELDLAVRIGELPDSDLKARRLGSLRR
FT                   VVFGAPGYFARHGRPRHPDDLQRHACILRTVDRHPNQWTFQINGRTRSVPVSGSFRADT
FT                   MTAIYSAVTHELGLGFSPLWQIRHLVDAGQVELVLTSYELPPVPVHIVWPSGRSPLAKT
FT                   RLFKEYLLEQWPQMGLE"
FT   CDS_pept        519616..520509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1462"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1462"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41345"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L6"
FT                   /protein_id="CBV41345.1"
FT                   /translation="MSQATPTRPSPTVLVVGATGRFAGLVVPALVERGARVRALIRNPE
FT                   RASSARHRGASEIAIGDLRDRPSLVRAMEGIDGVFHIGPAFVPDEAELGVTLVEVAKQA
FT                   GVRKFVFSSVIQPTNTQLPNHTAKIPVETALFRSGMEYTILQPANFFQNIEGAWRTVMT
FT                   DGTFGEPFPVTSRVTRVDYRDVAEVAALALTDDRLAYGTFELCATEKLNRKEIATLMSQ
FT                   ALGRRIEATAPDFETWAERAALPYDREQQRLLANVHAHYADHGSGGNDLVLRSILGRPP
FT                   RSLKAYIQELAQRADT"
FT   CDS_pept        520991..521761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1463"
FT                   /product="probable oxidoreductase (short-chain
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1463"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41346"
FT                   /db_xref="GOA:E1V6L7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L7"
FT                   /protein_id="CBV41346.1"
FT                   /translation="MQTLQQKVAIVTGASSGIGRATALLFASEGAKVVLGARRQSELDG
FT                   VVEEIEALGGEAIAVVGDVREEAHAKALVNTAIGRFGGLDIAFNNAGTIGRMAPTSELT
FT                   RDDWTQVIETNLTGAFLGARHQVPALLERGGGTLIFTSSFVGYTASIPGLSAYAASKAG
FT                   LIGLAKTLAVEHGAQGLRANAILPGGADTPANMVNAPDATQEVRDFVEGLHALKRIASP
FT                   EEIARAVLFLASEASSFVSGSAMLVDGGLSINRT"
FT   CDS_pept        521857..522882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1464"
FT                   /product="MerR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1464"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41347"
FT                   /db_xref="GOA:E1V6L8"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012925"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L8"
FT                   /protein_id="CBV41347.1"
FT                   /translation="MLLRVGELAKRTGLTVRTLHHYDDIGLLKPSTRSDAGYRLYRRQD
FT                   VARLHRIQALRSLGMSLAEIGTLLDQPSPPLSTVIERQMRLLERQIAQKNQLRDRLANL
FT                   HRQVVNGEEPAMDDWLKTLELMTMYDRYFSPEELDRLPLYQADNARWAEWQDLVKEAEE
FT                   LQQQGTSPVSPAARDLSMRWMEKLERDTAGDPALLEKLNTMHANEPDAQEQLGISKKVS
FT                   DFVMQAFAEYKLTFYRRYLSDAEFDVMRENYPQCMHEWPPLMARLRQLLEQGTRPEEPA
FT                   AQQLAREWLALLQRFAGDDPATHQKIRQANEQEPALKDSTWMDDRMKDYLGQAVASLTA
FT                   G"
FT   CDS_pept        complement(522994..523548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1465"
FT                   /product="TetR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1465"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41348"
FT                   /db_xref="GOA:E1V6L9"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6L9"
FT                   /protein_id="CBV41348.1"
FT                   /translation="MGEKSAVRPGGRSARVQRAVHEAVQALDEEVPRDKLTVPQVAERA
FT                   GVTPSTIYRRWGNLKELLADVAAERLQPDAPVADTGSLESDLMAWAGVYMEEMRSTPGQ
FT                   QMLADTLGSASTEQRQRCLQAQQDQLRLILSRAEARGETPLPTVEALLDGIMAPLTYRL
FT                   SYAPQTLSKACLERWVAATLR"
FT   CDS_pept        523636..524832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1466"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1466"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41349"
FT                   /db_xref="GOA:E1V6M0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M0"
FT                   /protein_id="CBV41349.1"
FT                   /translation="MAMPLEATVENAGPSRQLLFYTLVLVAFLAASGVPTPLYPLYQSS
FT                   WHFSTPMLTLAFALYMFTLLLALLTTGKLSEYMGRRPVILIGLVIEIASMLCFLVAHDL
FT                   TILLVARALQGLATGIATSALGAAIIDTDHRRGPVLASVAPLVGMGLGALCSGVLVDLA
FT                   PYPMRLGFILMTAIFIWQLIGLRGTRESVSPRSGALASLRPTARIPAPVRPTFLRVIPA
FT                   CIASWSLGGFSLSLGPVLARQVSGIETSMIGGAMVSLLSMMGAVGVWNLRRQKTRRILL
FT                   LSSILLPLGVSIVLLGVATHSILTLLIGFAIAGPGFGGGFMGAMRAIMPLAPDGGRASL
FT                   MAVLYVVSYLSASLPAMVAGNATQHFGLEPTVYGYGAYVIALSLMALVGMLSQRQATA"
FT   CDS_pept        525044..525688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1467"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1467"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41350"
FT                   /db_xref="GOA:E1V6M1"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M1"
FT                   /protein_id="CBV41350.1"
FT                   /translation="MMIYVAFFLIFVGVTFALYQVYSVHYAINFEDEEERPEQVNQALK
FT                   TLADEAEGCVDGEPSSGFVQSVQRIFGDGVDARLVLAAVASGSQKAFAEPLLRRRGRVE
FT                   TNGELTIAHLPFWKTRPPVRYRRGPVLVFIMVCSLLALFWGGMSIITLAYPVAVPALAW
FT                   ANSLLVLTVLVYASALLAYGASKLDFYLHDIQQIGRLNRSLNGSESVDQLT"
FT   CDS_pept        complement(525662..527071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1468"
FT                   /product="YjiR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1468"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41351"
FT                   /db_xref="GOA:E1V6M2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M2"
FT                   /protein_id="CBV41351.1"
FT                   /translation="MKRYERFADEIAELIRNGVLAPGGRIPSVRQASRQYGISPSTVFQ
FT                   AYYLLEDRGLIVARSRSGYYVREQAQRVLHEPRMTPSRQEASDVSVSELAFSVLDSLQD
FT                   TATVPFGSAFPSPDLFPLARLARSMAKGLRGMSGDDVLKDMTAGDADLRRQIVLRYTLK
FT                   GMPLPPDELVITSGAMEALNLGLQCVTSPGDLVAIESPAFYASLQILERLKLRAVEIPV
FT                   HPREGIDLAVLADSLARLPIKACWFMSHLQNPLGASLDQEKKRELYTLIKRHQVPLIED
FT                   DAYAELHFSTSPPKPVKQFDDEGLVIHCGSFSKSLAPGYRVGWVAGGRFAERISRLKLM
FT                   TTISPSVPAQAAIADYLQHGGYDRHLRQLRHALETQQGQMLAAASRCFPDETRATRPAG
FT                   GYFLWFEFPERVDSLRLFRMALEQGISVAPGPIFSATRGFRHCLRLSYGHPWTPRSEAA
FT                   MKTLGELVDAF"
FT   CDS_pept        527438..527788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1469"
FT                   /product="glyoxalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1469"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41352"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M3"
FT                   /protein_id="CBV41352.1"
FT                   /translation="MKVKRIMANTATEDLDKAEAFYGGILGLERLMDHGWFRTYGSDER
FT                   MRVQVSFGAEGGSGTEVPDLSIEVDDIETALMRFEEASVPIEYGPVSEPWGVRRFYVRD
FT                   PFGKLVNILQHE"
FT   CDS_pept        528150..529904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1470"
FT                   /product="ABC-type transport system ATP-binding/permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1470"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41353"
FT                   /db_xref="GOA:E1V6M4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010128"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M4"
FT                   /protein_id="CBV41353.1"
FT                   /translation="MTTRPAPTILQRALKACRPFFLSAALFSLFINLLMLVPPLYMLQV
FT                   YDRVITSRSLDTLFMLTLIVVFLFIVMGGLEIVRSRLLVRLGNRLDSMVNHRLFEAMFQ
FT                   NGIRQPGRASAQPLNDLATLRQFLSGNGLFAFFDAPWTPIYIGVLFLFDVWFGVFALAA
FT                   GILLFLLALTNEWATRGLLAGAGEEQIQAQSLANANLRNAEVLHAMGMMPGIRKRWAER
FT                   HQGFLLQQSRASDRAGTLANLSKVLRLLAQSLILGLGALLVLEGDLTPGMMIAASILMG
FT                   RALAPIDQVIGAWKQFVGARGAYGRLQTLLRSVPQEEERMSLPAPKGEVSFEQVVAVPP
FT                   GGKIATLRGLDFRVAKGQHVGVIGPSGSGKSTLARVLLGIWPAQGGTVRLDGADIAQWA
FT                   REELGPYVGYLPQDIELFDGTISENIARFGEIDAERVVEAARRAGVHEMILRQPDGYDT
FT                   RLSSTEGVLSGGQRQRLGLARALYGDPVLVVLDEPNANLDDAGERALGEALNRLKAQGT
FT                   TLFVISHRERVLKSVDTLLVLQEGQPRFYGPKADVIAQLNSSKRHLQAARSAGGRPRAS
FT                   TDGHVVSQ"
FT   CDS_pept        529985..531334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1471"
FT                   /product="RND family transport protein MFP component"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1471"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41354"
FT                   /db_xref="GOA:E1V6M5"
FT                   /db_xref="InterPro:IPR010129"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M5"
FT                   /protein_id="CBV41354.1"
FT                   /translation="MSVVASASSSTSALPASTSLPTSGRAAHWIGIAIVLIAFGGFGSW
FT                   AVLASLSVTVVASGTVSVESFKKTVQHFEGGIVSRIDVDDGDRVEQGQTLIVLDNTQSQ
FT                   SQLEIAQAKAFTAGAQKARLIAEQQGKETLTFPPSLVEQASGNAEREQTLAVQRSLFVS
FT                   RRSSQEGELGALAAQSRQFREQIEGLEQNMAINRERITSLNAEADDYRSLFRAGLGNNQ
FT                   RIRELERQVMQYRADSAESKAQIAQLRSRISENTLRAQVQRQNYHKDVNEQLREAQSQL
FT                   ESSREKAQALSDRVRRTTITAPVAGTVVGLTTHTIGAVIEPGKPVMHIVPSSDGFMIEA
FT                   RIPAQEVDNVYPGAHANIRFSAFNQRRVPVMDGVVRHVSADSFEDESTGVNYYKARVDV
FT                   SPDDREELGDDLQLLSGMPAEVMIETGKKTLAEYLLQPVTDMLRRALRQD"
FT   CDS_pept        531338..533023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1472"
FT                   /product="homolog to outer membrane protein TolC"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1472"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41355"
FT                   /db_xref="GOA:E1V6M6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010130"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M6"
FT                   /protein_id="CBV41355.1"
FT                   /translation="MRRFPLSPLAAAMVLLFAADVTLAGTQASPSSFLGRVETREAAIA
FT                   DMPSQSTGGDAAIWQEANTALSGPADAQMTGGAGSAAADTISIPSLPGLFERALNADAD
FT                   LQAQRLRAEARGQDVPKARAGLLPRLDASYVYRYTDSDNIYTDGGVTTCETNPDTGEPV
FT                   GGDTYERRCAGESTDSIRQLELTQPLFSMSRIRQMQHAEAQRDQAMLRLAVAERDLALK
FT                   TSQTYLDAFFASRRARLLEGKRASLELQLAQARKAYELGIGDRIDLLAARSALDSTRAD
FT                   IVLARNETDDALATLERLTGVRSTFDGFSLATLTGVEFAEPAPLETLEGSIDSNAGVEA
FT                   AREGVRVAEADVALRKAGYYPEVSLNLSWRDRNSNDPYLASEEASAAIQARLNLFRGGY
FT                   TRADMRQGELMARASRSDVDGARRQALEQLRQSRRGIIGEQGRLAALAQSIRSGELYLE
FT                   AADKGAALGLRDLVDVLDARAKLFDQRIQYVDAFRRLLLNRLQMQAAVGDLSGEDLADV
FT                   MSSIQQIIGPPRPIDKMPDAWRHAQAESPENGIHASHDSLASLH"
FT   CDS_pept        complement(533065..535503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1473"
FT                   /product="hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1473"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41356"
FT                   /db_xref="GOA:E1V6M7"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M7"
FT                   /protein_id="CBV41356.1"
FT                   /translation="MLDNDSLTDTSLRIATYNASLNRSQQGELLSDLSTPDDPQAQQIA
FT                   SVIQQNRPDILLLNEFDYSPEAAQAFLDNYLNVSQAGDTPIDYPYVYSAPVNTGIASGM
FT                   DLNGDGQVVTEPGTDGYADDALGFGQFPGQYGMLVLSRYPIIENDIRTFQQFPWADMPG
FT                   ARLPDDPSTPQPHDYYDAEALDTLPLSSKSHWDLPIDVNGEIVHLLASHPTPPTFDGAE
FT                   DRNGLRNADEIRFWADYISPEKGDYIVDDDGQRGGLDGGQRFVIAGDQNVDPVDGDSLP
FT                   GAAQQLLGNAHIAAGLAPDSDGGTVAAATQGGDNAGQQGDPRFDTADFSEPSPGNLRVD
FT                   YVLPSQFGLTRLDGGIVWPTEGTPGSDATAASDHRLTYADLVITEDTTRVQDVEFIGET
FT                   SFESGSMFQGTTLGGLSGLTYDAASDSYLAISDDRSDIDAARFYSLRIDIADGQLDDGS
FT                   VRFTDVTTLRQEDGTPFAEGTIDAEAIDYAEDGTLFISSEGNANEGLAPSIGQFARDGQ
FT                   QLDSFEIPDTLVPTHSGESGIRNNLALESLTVTPDHQHLFTATENALVQDGPAADYDTG
FT                   SPSRLIEYDLDDGDVSHEYLYPTEPVAERAATDDGFATNGLVDLLALDDDHLLAMERAF
FT                   SEGAGNTIRLYEIDTSEATDISGIDALSETHETVRPVDKTLVADLGDFGIEPDNVEGMT
FT                   LGPMLGDDRQSLLLVSDDNFSDSQATQFIGLTFDLSTADDEKDDHPGKGAHGDVPPFGH
FT                   AFGHELKDLFDGGPNPWGPMPFSSATDESQAGPQPPFAKMPPALAGLADVQPELDSLIG
FT                   "
FT   CDS_pept        complement(535588..540414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1474"
FT                   /product="DUF3616 domain / hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1474"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41357"
FT                   /db_xref="GOA:E1V6M8"
FT                   /db_xref="InterPro:IPR001322"
FT                   /db_xref="InterPro:IPR022060"
FT                   /db_xref="InterPro:IPR036415"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6M8"
FT                   /protein_id="CBV41357.1"
FT                   /translation="MSLFSRFATPYRFHDDVSTAALGGGASWHAQSMLGSLFDRIDDFL
FT                   DDLFDWIGHDPDDGGTTEPAAPTIGLSNDATMRLPLDGDGDMIRGVIGDPTDPALTDGI
FT                   ALDIADADTPRDDLTVTVESSDESIARAVLDNGDVLRIAPVNAGNATITVTVSDGESES
FT                   RYTLDYAAADGTETNNAARFHTGTSDTSAAIAIGNGLVLVGDDEGQTLRLYDHDRSGAP
FT                   LKSFDLNESLGLEAGDEIDIESVVDAGNGTYFWLGSLASSERSTVFATRITGENSRSLQ
FT                   VDVTGQFDGLDLAIMEWAEQHRPDVDFGSFEVEGATYADDTLFLGLRAPIDSDGRALVL
FT                   PVTNVDELMAAGNADEAQFGTAIGLDLDGRTIRDIKAIGDGTYLISAGPANAGDDDGDD
FT                   SNDDFQLYRWDGAHKAMPVEGADLNTNAEATDGTAETLSNIQVDANGSVSVDVAYDNGT
FT                   ADWSESATESKDLDDDIQTFTSSTVTFDALPDLAPQAGDVALTMIDQAADTFSFVALAA
FT                   ITPGAPLTLQSGDSRVTWTAPEDGLSAGSVIDAEANAAQFDGDLNLSLADGVTIANADG
FT                   DTLYRLGNGSDADLSLPADAEAWQYAGITHGSTEALRGSLNDTDAWQPGNGNTADFVVD
FT                   TGHAPLGDPEPQDLGIAVSEIWPGQSDSDITEDWFEITNTGDETLDFGQTPLYYDDDSA
FT                   NPEEAAQVQGLTTLAPGATAIVMVDGDAQAVEAFRQAWGANSDLDGVEVGYTGDAAGLS
FT                   GGGDQVTLWLGEPGRDTLAAMAAYPDTDANDAASWDVTQQRFTTLEDGGVESEALGGDD
FT                   DATPAVATPGRVTGNAGGEVGQGGLLISEYVEGSGYNKAIELTNTGADALSLDGYQLSL
FT                   YSNGNQSATSSADLGNLTANGELAAGETLVVTSSQTEDPELIARSDATSDVINFNGNDA
FT                   LTLTDAEGSLIDVIGTVGNDDSFAQDVTLRRDASITTGSDTFDASQWQQLPQDTFDGLG
FT                   LPGAETGAAEGGDDGSGDGGDTPTPPSETTLISQVQGAGMVSPLEGEQVTLDAIVTLAS
FT                   QDGLSGFFIQEEDADQDGDAQTSEGLFVYAPDATDVAVGDQIRISGTVTQYEGKTELTD
FT                   ISALQVEARGQALPSVTEVELPIADKSTLSAYEGMRVAVSGENDSALTVTDTYELGRYG
FT                   TVTLSSGGRLEQYTENHAPDQAGYQQWLNESESRSIVLDDASNAQNPQDVIFGRNGEPL
FT                   SAANPLRGGDTLDQATGVLDFNYQQWRIQSQEGQDFQATNERSDAPDVQALGDASLKVA
FT                   SFNVLNYFTTLDENGNSVVTPAGTEHDPRGANSSLELTRQQDKIVSAINGSDADIVGLM
FT                   EIENNGYGDDSAIAHLVEALNADDADAGWAYVTPTDAEGNTVAPGSDAIAVGMIYKSTS
FT                   VTPEGHAAVDASGVFETGNRPPMLQTFREDASGETFSVAVNHFKSKGSVINGQEAIGDG
FT                   QGNNNPIRVEAAKQLADWVASDPTDSGDSDTLLIGDFNSYANEDPITALEDDGYTLLDD
FT                   DYSYSYDGQWGSLDHALASESMNAQVTGTTTWHINADEPTSFDYNTEYKSDDQVDAYYD
FT                   DGPYRASDHDPIVVGVDLGNSADGTTLAG"
FT   CDS_pept        complement(540591..540728)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HELO_1475"
FT                   /note="product:uncharacterized protein (nonfunctional)"
FT                   /db_xref="PSEUDO:CBV41358.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1475"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41358"
FT   CDS_pept        complement(540765..541787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1476"
FT                   /product="LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1476"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41359"
FT                   /db_xref="GOA:E1V6N0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N0"
FT                   /protein_id="CBV41359.1"
FT                   /translation="MSSEKRRPLPTITDVARKAGTSTATVDRVLNRRAAVRENTMRRVL
FT                   DAALALGYLHTGQVEALREPEPIKLALLLPRGTNPYLALVNEKARAFIEHHHRDARVKS
FT                   FFIDGFDPDELSHSIRRHGKTADGVIFMAIDHPSVRMATNELVAAGKKVITFISDISTS
FT                   RRHAYVGIDNFAAGRTAALLLGRFTGHVPGRVALIAASRIYRAHLEREVGFLGLIEERF
FT                   PHIAVSATREGHDDRKQNYEHTRRLLEKHPDITGIYNVGGSSDGIGRALQESGRAQEVT
FT                   FIGHGLTHDTRAMLADGTMDAVITQNPDRLFEAAVAAAMGKEGTQVPMELYVAENLPQE
FT                   "
FT   CDS_pept        541915..542925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1477"
FT                   /product="TRAP transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1477"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41360"
FT                   /db_xref="GOA:E1V6N1"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N1"
FT                   /protein_id="CBV41360.1"
FT                   /translation="MKTLGKRLTLRHTLAGVVMAAGLVSGAQAQDITLRYGHMNAPNSI
FT                   AGKQAEWLADAIKEKTDGDIAVQVFPSSQLGKLQELAEGVSTGTIALSHNTAGAIGSLH
FT                   PPFAAFDTPYLYRDVDHLMSVVDTSSPLMTRLNEELVDAAGVRVLYGFYFGSRNLTADR
FT                   PVTHPDDLDGVKIRSIPFPIYMAAVEGLGAVPVPVDWSEVPTALATGVVSGQENPVNVA
FT                   VSHKLHEVQSHMMETGHIIAAEMVLINEGVWQGLSDEHQSALQTAADDVRERATQYVLE
FT                   SEREDTETLREQGMTIIGPDEGLDIEAFRTSVEARVMEEFADQYGEFYSQVEAIE"
FT   CDS_pept        542946..543446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1478"
FT                   /product="TRAP transporter small transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1478"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41361"
FT                   /db_xref="GOA:E1V6N2"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N2"
FT                   /protein_id="CBV41361.1"
FT                   /translation="MSEIGWLVSARAALSRMARAGLWLSVMLLIAIAVLVAGQVVMRNA
FT                   FSIGLHWADELARWFGIALVYLTIPYLLDRSAHIAVEILPNRLKGRWRMAVLAFSELAV
FT                   ATFAGLSLVAFSAFLERAARFRTPALELPNLIFYMPAVIGIALLGAIAVTRALILLGGK
FT                   EPS"
FT   CDS_pept        543443..544720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1479"
FT                   /product="TRAP transporter large transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1479"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41362"
FT                   /db_xref="GOA:E1V6N3"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N3"
FT                   /protein_id="CBV41362.1"
FT                   /translation="MTLTLLVLFAAGLILGIPIAVCLGVSSVITILLHDLPFAVVAQRS
FT                   VNALDSTPLLAVPLFIFAASLLSATGVTSHLFELTRLFVGRLRGGVAQVNVLVSLIFSG
FT                   MSGAALADIGALGGIQIKMMEAQGYMRRFAAGTTIAAATIGPIFPPSIPLIIFASAAEV
FT                   SAVRALLAGVVPALIVTAALMVQIAIMARRGNLPRDTHRPSASEIGRKFTISLPALLAP
FT                   VLMIAGLLSGVFGPTEVAGVIVAYSVVIGILFYRSLTVQRFFTAARESVEASANILFIV
FT                   ATAALFAWVLTIGGVPAMAGQWLLSISTDPLVLLLILNVLLLVAGMFLESIAAILIIAP
FT                   IVAPTLMMAGVPAEQLGVIFVLNLMIGLLTPPIGMSLYMVSIITRMEFGEVVRGVLPFY
FT                   LPLFVALVVVTLFPGFSTWLPNLIMQ"
FT   CDS_pept        544728..545273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1480"
FT                   /product="glyoxalase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1480"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41363"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N4"
FT                   /protein_id="CBV41363.1"
FT                   /translation="MSRFLGEIRQLGYVVPDIEAAMDHWSRVMGVGPFFYNPRVPIEGY
FT                   HYGGEPFEVENSVALANSGFIQVELIQTRNDAPSMYRDFMRAGNMGLQHVAYWTEDFDT
FT                   DLARMLELGFKVQMEGQVGANGRFAYFDREAHPGTVIELSEVKGPKGRMFEMIRQASID
FT                   WDGRDPVRPFPSLTETTP"
FT   CDS_pept        545270..546526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1481"
FT                   /product="ribulose-bisphosphate carboxylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1481"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41364"
FT                   /db_xref="GOA:E1V6N5"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N5"
FT                   /protein_id="CBV41364.1"
FT                   /translation="MIHARYLLETPLDPESVAAMMAGEQSAGTFVRVPGETDELRERHG
FT                   ARVQRLTVLGESDCPTLASAYLERKGVTGPWRRAEVEIAYPEDNVGVNLPTLAAVVAGN
FT                   LFDLGEVTALKLLDVTLRPEYRARYPLPAMGIEGTRRCLDVHERPLFGTIIKPNIGMSP
FT                   ADIARLVQSLCEAGVDFIKDDEIVGNPACAPVKERVDSVMKVVRDHRERTGKEVMVAFN
FT                   ITDELDAMRRHADHVLAQGGNCVMASLNWCGLSAIQALRQHTPLCLHGHRNGSGAFGRH
FT                   PAHGIAFPAWQTLYRLAGADHLHVHGMGGKFADATDEVALAARRCLTPLGSEDDRVLPV
FT                   FSSGQWAGTLPSTHARIGGSQDFLFLAGGGILAHPEGPRAGVESLRAAWEAVTAGEDLR
FT                   QHAKRSPALARALDSFGSR"
FT   CDS_pept        546529..547758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1482"
FT                   /product="DUF1537 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1482"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41365"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N6"
FT                   /protein_id="CBV41365.1"
FT                   /translation="MTPSTRYVFVADDFTGATDTLATLARAGLAVRLFLDVPGPSDTEG
FT                   LDAFGIATEARALSKAEMTSLMQSIGHRLLPHRPEVVHLKICSTFDSAPQTGNFALAMQ
FT                   LLGDALEIRTRAILGGQPSLGRYCVFGHLFARAADGRVYRIDRHPVMKSHPVTPMTESD
FT                   LLQHIASLDGTPPVLVDRVTLQRHDDLRLPDPEGSTLFDAVDGQDIDRVGAYLRASTPV
FT                   LCAGASSVAEAVVGAGPRRAPGRVESSGPVLAFVGSRSSVSAEQVHRATAYRGVALAPA
FT                   RLTDSCDLEDLIAAIDTALQSGENVMIHLDDSTSPGTPRDLAQRSAALVRTIAQHSRLG
FT                   ALVVAGGDTSSAIIRALGPLSMAFSGDIDPGVSLCMADFGEGRRLPVVLKGGQVGRPDL
FT                   FDYLVSDVFG"
FT   CDS_pept        complement(547868..548863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1483"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1483"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41366"
FT                   /db_xref="GOA:E1V6N7"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N7"
FT                   /protein_id="CBV41366.1"
FT                   /translation="MPATRTTSPALERAHLVWDLFIIVLVIANLALLLFDSLFLLPPLN
FT                   AAFETVAPGLHGAYDEHIHANFLTIDLAFVAIFLLDVLLGWAVAIAERHYHRWFFYPFV
FT                   HWYDVLGCIPLGGFRLLRILRVISLLHRLQRMGLIDVRRWYLYSVVAKYYDILLEELTD
FT                   RIAIRMLDNVQQELRAGDGLSAPVIERVVEPRKQALIREISQRLEGMAGDTYTHNRDDI
FT                   LRYVRGLVGRTLSESPEFKRITRLPLGGQLARGLEASLSDLACHLVDEALAGLKSTEFS
FT                   TLVEQLAESGFDAWLHTDPQTEQITEQVLVDMLELLKEQIAVKGWQHKYE"
FT   CDS_pept        complement(548909..549565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1484"
FT                   /product="nucleoside phosphorylase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1484"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41367"
FT                   /db_xref="GOA:E1V6N8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010050"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N8"
FT                   /protein_id="CBV41367.1"
FT                   /translation="MSNTPRTPAPLTNLGGRSVLFVMAADAEYGPHLRERFVPFMTGVG
FT                   PVEAAVELTAALADLQARGRLPDLVVSLGSAGSRELEQTEVYQATSVAYRDMDASPLGF
FT                   EPGVTPFLDLPATLPLPLRIPGIREATLSTGADIVSGAAYDAIDADMVDMESYACLRAC
FT                   TRFGVPLVVLRGISDGKAELHHVDDWTEYLHVIDEKLADAVDRLGEAIGQELLTR"
FT   CDS_pept        549735..550106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1485"
FT                   /product="DUF427 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1485"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41368"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6N9"
FT                   /protein_id="CBV41368.1"
FT                   /translation="MKKPTSKRLPMANYTTPRINLHPHTRRVQIYHRDTLLADTSDVIE
FT                   LREKDYPQRQYLPRSDVDMSKPTTSTAVTHCPDKGDSTYYSLPDLLDIAWSYDHPIDEM
FT                   SAIAGRLAFDSNKMTELVE"
FT   CDS_pept        550356..552083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1485A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="InterPro:IPR018891"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A454"
FT                   /protein_id="SJK83738.1"
FT                   /translation="MNPIIKAQLQNFKEMNPNEHLNDSDFFEVMSIFSLENGILGENID
FT                   PFKAHLRGDEFGVDGVAISVQGTLCSDIDEAIEILSHGKNHNSEFHFYQSKISSSLDYG
FT                   DVSKFLDAVYDFFSDQKLIEGEQLVSLAEVKDAIYESAAKTSPSLRCYYCTTGTGQASD
FT                   VIRRLIETNKARLLELNIFDDVHIECVGAKTIQTGFRSATNSSSAKLNFQKSITMPAHD
FT                   KVDEAHIGYVSASEILEIALGEEDQEGTRHVNRALFYDNVRDFNPNSEINKSIIYELEH
FT                   GDNASFVFKNNGVTIVAKSIDRKGDTFSLEDYQIVNGCQTANILAHIRDKAENISVPLR
FT                   LIGCRDPDFVSNIIVGTNRQNEVREDQFWAMLPFMKDLEEYCASQNMSSRIYIERRDNQ
FT                   YRDTSIERTRIFRPSDLMKAAAAMFFYQPHRAARDHRGIRKEFSRKIFSESHNVELYHL
FT                   AAFALYKFDYLIRSGKVDRSRVIFKFYALYALIKSYWRTPDILDAPSRSQKKVRNSVIS
FT                   ILDNNERFVGHIEEAVGHLENLTAEAGATSREKIRDYIRSESVVDEFNKRLFPSKQEG"
FT   CDS_pept        complement(552244..554430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="HELO_1486"
FT                   /product="RecBCD enzyme subunit RecD"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1486"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41369"
FT                   /db_xref="GOA:E1V6P0"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P0"
FT                   /protein_id="CBV41369.1"
FT                   /translation="MTPDITTVSPERALDDHEALFALLERWVARGWLRSLDRAFADFLR
FT                   REVSEASPALLLAAALASHQLGRGHVCLDLALTLETPDLALSLPPEGDSLEEPPPLPSQ
FT                   VMAGLDVATWRAALHQPELVGDGPGATPLVLDGDAERPRLYMRRYWQHEQDIHSRISTR
FT                   LTIDETTVEAASLRPLLDTLFVPRDAQPAPPLDWQKTACALATRSRFAVITGGPGTGKT
FT                   TTVVRLLALLQALTLGAGEPALRIRLAAPTGKAAARLNESISGQVGQLPFDSLASQAGI
FT                   ETTPSDGETSPAARLHKAVPQDVSTLHRLLGSRPDTRRFRHDRHNPLPLDVLVVDEASM
FT                   VDVGMMAALLEALPPHARLVLLGDKDQLASVEAGSILGDLCARADGGHYTPATADWLND
FT                   ATGQTLPGDYLDADGQPLDQSIAMLRVSHRFTADSGIGQLAAAINAPLDRENEPAEQRR
FT                   AIQQALSAGFADLSHLKLPKDDERRLARLAVTGYPEGFPKAETSDAAASRTPPVGYQHF
FT                   LSIMAEQRPADDADHTAFDDWARKVLEAHGHFQLLCALRRGPWGVEGLNERVRQALEKE
FT                   GLIDSQDGRQLWYPGRPVLVTKNDYGLGLMNGDIGITLAMPRPDANSSDNNPRLLRVAF
FT                   PAGDGSDRIKWVLPSRLQAVETVFAMTVHKSQGSEFTHAALVLPDAPNPILTRELVYTG
FT                   ITRARHWLTLVETGRGQLLDAAQRRVMRVSGLGS"
FT   CDS_pept        complement(554427..558482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="HELO_1487"
FT                   /product="RecBCD enzyme subunit RecB"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1487"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41370"
FT                   /db_xref="GOA:E1V6P1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P1"
FT                   /protein_id="CBV41370.1"
FT                   /translation="MSEHAPNLDPIHLPLPGSRLIEASAGTGKTFTIALLYLRLVLGPR
FT                   DADDTAAFPRPLTPPEILVVTFTNAATQELRERIRARLVEAADAFQADTSAAGKGSGDA
FT                   EEASGTGADKAPPETGDLFAEPQGSAEPVPDSASTAERPADPLLALRDSYPRESWPACA
FT                   RRLRLAAEWMDEAAVSTIHAWCHRMLREHAFDSGSLFALTMELDQSAMDQEIARDYWRT
FT                   FYYALDPEALGVITKHWASPDALNEAVGRLRVHAAALPEAPPPAETLANARAERERILG
FT                   ELKAPWPTWVDELEALLEDAADRKAFHGQKLNAKNRANWLNKLRDWANDPEAVTPDLTD
FT                   AAWKRLTPEGLAEIWKEGPPPTHPALDALAELRDRLAELPEPFADLLSHAVHWMARRRE
FT                   TVQRRRAELGPDDLLHRLDAAFQGEAGDTLASRIRAQFPVALVDEFQDTDPVQYRLFDH
FT                   VYRLAENRGVVDDSEKSAVLLIGDPKQAIYAFRGADIHTYLEARRDTAGRHVTLGTNFR
FT                   SAANMVAAVNRVFEHAEANNEAGAFLFRKKQSESLDQSASGMEHEAHGAQEARHNERLG
FT                   ELSSTAQRSDPSAQPFSQGFSNPVPFQPVSAKGRKDSLTRDGAPQAALTLWHLDSETPL
FT                   SKSAYLRELASRCASQMAALLREGQAGRTGFTEGEDFRPLAPSDLAVLVNNAGEARAIR
FT                   RALLERGVRSVYLSDKEGVYETEAAAELELWLAACAAPDDDRALRAALASPSLGLTLAE
FT                   LDAMSGGNQQDELAWEARVMQFRDYHRQWRQRGVLPMLHRLLADFSVPGRLLTVPEGER
FT                   RLTDLLHLGELLQQASSELDGEHALLRHLREAIARPQEQGEAHRLRLESDADLVQVVTI
FT                   HKSKGLEYPLVFLPFIAAARPTKKTDLPLRWHDDEGRLHLSLEADEAIRERADHERLSE
FT                   DMRKLYVALTRARHATWLGLAPLEGLEHSAIGRLVASGQPLPPEALRPALEALGDAAHD
FT                   STPSGTTGGTVVVSDAPEADTTPVPPDNDEAPLAPARRPQRTIREHWWIASYSALGYSS
FT                   HSDSAMGSDDSAPASRSEPTTPSEESAREVHDEPRDSGAMPVNKEPASEGSLHAFPRGP
FT                   SAGTFLHGLLEWAGQHGFSRVAEDAPLRDETLARRANRRGWENQIPALAEWLPSLLSAE
FT                   LPVPNSPAETTTDDTPLRLDRLESYKIEMEFWLAAHRVDTRRLDALVSTHTLGGRPRPA
FT                   LDPDRLNGMLKGFIDLVAEHQGRYYVLDWKSNHLGADDAAYSPEAMIDAVLEKRYDVQY
FT                   CLYLLALHRLLSSRLPDYDIDRHLGGALYVFLRGTRSPSRGVHAERPSRELIEGLDALF
FT                   RDAEETAA"
FT   CDS_pept        complement(558479..562195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="HELO_1488"
FT                   /product="RecBCD enzyme subunit RecC"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1488"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41371"
FT                   /db_xref="GOA:E1V6P2"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P2"
FT                   /protein_id="CBV41371.1"
FT                   /translation="MLATSDTTLQPGFMVVHGNRLEDLRDLAVTWMRSHPLTPLEDETI
FT                   LVQSNGISQWLKLALAADAPQGSGVAAALDVTLPARFLWQAYRSVLVHRDGEGAVPPES
FT                   PLDKPRLIWRLMRLLPALLDDPLFAPLSRFLADDDDLRKRHQLAERLADLFDQYQVYRA
FT                   DWLAAWAEGRDELIDARGQARPLDEDQRWQPALWRYLRDDIGAAGLATSRALVHSRFLE
FT                   ACKELTPETRPPGLPRRVMVFGISSLPRQTLEALAAIARVSQVILCVHNPCRHYWADII
FT                   EHKDLLRAARKRQQRRPGMPIELDDTQLHLHAQPLLAAWGKQGRDYLRLLDEFDDQESY
FT                   RARFEAESLRIDLFESPLERCDAPGLLQQLQDDILELRPPSESRDTWPAVDPERDTSLR
FT                   FHVAHSALREVEILHDQLLAAFDADPSLKPRDILVMVPDIDTYTAAVQAVFGRLAPDDP
FT                   RHIPFTLSDQTSRHRQPLLIALEALLHLPESRLSVGELLDLLEVPALRQRFGLDAEALP
FT                   VLRRWIEGAGIRWGLSADQRARLDLPDGLTANTWAFGLRRLLLGYAVGDNADGPWHGIE
FT                   PFGDIGGLEAALAGPLVDLLDTLDTLWRRLSEPADVATWCQRLRELLADCFSAADEADL
FT                   STLTRLEELLDEWRDTTEDAGLEEPLPLSVVREHWLGQIDGNNLSQRFLAGAVNIATLM
FT                   PMRAIPFRHVCLLGMNDGDYPRTQRPLDIDLMGHDYRPGDRSRREDDRYLFLEALLSAR
FT                   ERLMISWVGRSIHDNALQPPSVLLGQLRDHLAGGWRLAGHAADEQDDGGQALLDALTTE
FT                   HPLQPFSRDYFRQPNRADATATQAADKGLFTYAHEWRAIHTDQPDANEHLEPGFNAVSP
FT                   STASLQSVPPLPAMTQETPLTLKQLGAFLKDPVKAFFNTRLGVYLEREAAESPDHEPFD
FT                   LDGLAHWQLQNELISAGRRAVEASEPPMPVVDETLARLEREGRLAMGGFAQRMREDLVA
FT                   PLDDLFAKYAELLDAWPHARPMPAPVSLSLDADGGELAVEDWLGELRENDQGETCRLLL
FT                   LTSSLIINQSKYNWKHWLTPWVEHLAAQIAVGPVITELRSRAGKGTLYPLPADEARARL
FT                   TAIASAWQAGMTAPLPLARDTAFAWIEKGGDASGIERYLGDVEKAEETDLKAGKAAAQT
FT                   LEGNDHQGGELSRDAYLARQWRDFDELARHQAAGRRFGELAERLYGPLHYAVKVTQKQK
FT                   SGTTKRQPRGDKS"
FT   CDS_pept        complement(562276..563145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1489"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1489"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41372"
FT                   /db_xref="GOA:E1V6P3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P3"
FT                   /protein_id="CBV41372.1"
FT                   /translation="MNWDDVRFFLAVYRAGTLRGAAQRLALDQTTVGRRLTGLERTLGS
FT                   RLFLRTKGGLTLTDSGRQVLPTAENMERLAVSFERLSEGADERVAGEVRVTTTDALAVD
FT                   FVVPAIERLRTTHPDIRVILSTTTRLLDLARREADVAVRTLRPEQPDLIVRQLGRWEVG
FT                   LYATQGYLERHGEPHPDEGFAGHDIALYQEGVTGRQDDTLAGVPRGQGRVVAELDSSLM
FT                   LATFVRAGLALGELPDYLAQRDRRLVRVWPDRHRATPYEAWLVLHQDLAHTARVRVVVE
FT                   AISDAFAR"
FT   CDS_pept        563285..564457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1490"
FT                   /product="major facilitator superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1490"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41373"
FT                   /db_xref="GOA:E1V6P4"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P4"
FT                   /protein_id="CBV41373.1"
FT                   /translation="MPRLSFVLTVAMLSAFGLIASDVYLPAMPSMTIEFGVADWQMPQT
FT                   VSIYLLALAIAQLSYGPLSDRYGRKPLLLAGIALYMVGSLGCAASSGYTGFLIWRILEA
FT                   VGAAAGLVIGRALIADICDKRTSAKVYAVVYPLVSLSPALAPAIGGHLAAVFGWRADFL
FT                   FVAAFGAAALLMVLTLLPETLPVAARTRTSPFAGFGHVVRDRNFRRYTLVVCAIYCAWF
FT                   VYLTQSPFLFARQGLSEEQSGWLYLPLTAGIIGANLLAKRLLDRWPYDRIVAAGIACFV
FT                   LGGIAFLGMAALERQGAVTVVLPMCLVSLANGSSLSLAVSGAIASEHGYAATASGLVGF
FT                   CQIGSAALLAMGISATFGTGLNVLGGAVLTLGLLALSTCLPWSGRPAEQA"
FT   CDS_pept        complement(564472..565335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1490A"
FT                   /product="gluconolactonase family protein"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A450"
FT                   /protein_id="SJK83739.1"
FT                   /translation="MNNISIAFSSQATLGESPVWSQSRGRLLWVDTLAASLNAFDPATG
FT                   QNIVHTMPSPLGFVTEAHEGQLLVGIGCHIERVDETTGKRQRIATAPHAQKGYRLNDAY
FT                   LDPTGHLWVGLMDEGLSEGSGYLYRLAPNGVWETIDSGFTLINGIARSLDGGTLYVTDS
FT                   RHGTIYAYEHDELSGEVGHRHRLIDIAPDEGKPDGLLIDQEGYLLSVLFDGAGIARIST
FT                   DGDIVRRITLPVLRPTSCAFDSSHKYLFVTSARLGLSPTTLANMPASGSVLRIDYERIM
FT                   RQGSAA"
FT   CDS_pept        complement(565332..566198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1491"
FT                   /product="probable oxidoreductase (short-chain
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1491"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41374"
FT                   /db_xref="GOA:E1V6P5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P5"
FT                   /protein_id="CBV41374.1"
FT                   /translation="MISFEGQIVLITGAGRGLGFSYARYIGQLGATVLIQDIGADTEGS
FT                   GDSPEVAEIAAQQLQEEGLDALAIAGDISSREGCHRLVRQALAIAGKLDALIHNAGWVA
FT                   YEHIEAIEETSFDRMMAIAAKAPLWLTQAAWPTMKSARYGRIVMTTSCRALYPQYVHRG
FT                   LASYSAAKSAVIGIMNVLAVEGREDNIIVNAISPVAKTRMWGIEGEPDELHPAEVAPGM
FT                   AFLASSACSEGGWILRAANGQFHATKAMEAKGVDYPRNLQAIQASTAHEVAKNWALIAT
FT                   HDVEPRS"
FT   CDS_pept        566337..567251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1491A"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="GOA:A0A1R4A4B0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A4B0"
FT                   /protein_id="SJK83740.1"
FT                   /translation="MAVDARGRITLRTMEQFVAVAEELHFHRAAERLNMSQPPLTSAIR
FT                   KLEEDINVTLIERGNRVLGLTPAGEKFLEEARETLRRAEQAITSTQDVAAGQTGLVRLG
FT                   YVGSSLYGRLPDAIRAFRVQYPKVRLELREATTAAQISAIRAGVMDVGVVIPPLHNAED
FT                   VGLEGFDNDRLCMAIPKDHPLGKNDKVQLSDLSDEPFVLWPMLEGRGFHLQVIRLCANA
FT                   GFVPRVEQEAYGMHAVLSLVAVGLGVSVVPDSMSGFRDDRITYRPINDAGSEFELSFIY
FT                   RDLSPSAASFVCHASGKEKYKVL"
FT   CDS_pept        complement(567265..567768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1492"
FT                   /product="HPP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1492"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41375"
FT                   /db_xref="GOA:E1V6P6"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P6"
FT                   /protein_id="CBV41375.2"
FT                   /translation="MLHKMKGGGTLPARPDTLQILTGLMGGISGIGLVAWLTRFTEVPL
FT                   LMAPFGATCVLLFAAPGAPLAQPRNVIGGHLVSALVGLVAMQLLGTGPLAMAIGVGVAI
FT                   AAMQGLRVVHPPAGANPLVVMMSGAVGYDFLLMPVLAGSVSLVLVALLINNLGEGRRWP
FT                   NYWL"
FT   CDS_pept        567864..568454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1493"
FT                   /product="TetR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1493"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41376"
FT                   /db_xref="GOA:E1V6P7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P7"
FT                   /protein_id="CBV41376.1"
FT                   /translation="MAKRDDILATATRLFGEHGYHAVGVDRIRDEAEVSKMTLYHHFPG
FT                   KEALVEAVLEQRHERFMASLNAAVESSSTWETRLRAVFDWHARWFASENFHGCMFLKAT
FT                   EEYAREPASLLALSRRHKAEVKALVEEIIATQEGVSAPRLARLVQVTLDGMIVNAYLFG
FT                   PDAVDDAWAALAPLLALDARPLDREGAADWTQP"
FT   CDS_pept        complement(568503..569078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1494"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1494"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41377"
FT                   /db_xref="InterPro:IPR024453"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P8"
FT                   /protein_id="CBV41377.1"
FT                   /translation="MEDKLLITVKSLLLLALCLLAGTCQASQLLPGDLVFRQGTEPVSE
FT                   AVMVMDDNRFSHVGMLAGQPDDWQVVHAVPEGGVISEPLADYIAAEHARQFAYFRVKAT
FT                   DAQRQSATDFAEANLGVPFTLLDAGVPGNGTYCTLLIRDAWQAAGIDLQAKFKHLNLPL
FT                   YPGDFLLPSGLLASPLVSPVLQDTDSPS"
FT   CDS_pept        complement(569060..569458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1495"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1495"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41378"
FT                   /db_xref="InterPro:IPR024267"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6P9"
FT                   /protein_id="CBV41378.1"
FT                   /translation="MTRFMHFLASALILLMVSACGASTDTPESSLTAFYEAVAENDAKT
FT                   ALEHVSLADIKESEMGVAREKIKMMVGNFHAKAEEKGGIEKVEVLNVATNEEKTEAEVE
FT                   VQVTFGNGKSEKNTDDMVKEDGEWKISF"
FT   CDS_pept        569847..570335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1496"
FT                   /product="phosphoesterase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1496"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41379"
FT                   /db_xref="InterPro:IPR000979"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6Q0"
FT                   /protein_id="CBV41379.1"
FT                   /translation="MNTERLECDAPVGVIADTHGTLRDEALTMLEGCGVILHLGDVGSR
FT                   DQDAAILERLAELAPVHTVRGNVDTAPWAERLPWYLDLVVNGWRLHLVHDIADFAPDTP
FT                   CDAMLHGHSHKARNEWRDGRLLFNPGGAGRRRFSLPLTLGKLWADETALRGAILRLPL"
FT   CDS_pept        complement(570366..571676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="HELO_1497"
FT                   /product="arsenical pump membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1497"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41380"
FT                   /db_xref="GOA:E1V6Q1"
FT                   /db_xref="InterPro:IPR000802"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6Q1"
FT                   /protein_id="CBV41380.1"
FT                   /translation="MLAFAIFVATLMLVIWQPRGLGIGWSALGGAAVALATGVVDWGDV
FT                   DTVWHIVWDATFTFVALIIISLILDEAGFFAWAALHIARWGNGRGRLLFPLIVMLGAMI
FT                   AALFANDGAALLLTPIVIAILARLDFRPGAALAFIIATGFVADSTSLPLIISNLVNIVS
FT                   ANYFDIGFTRYTQVMVPVDLVSLIATLVVLGWYFRREIPGQYDVERLEAPASAIRDHHV
FT                   FRAAFPLLLVLLAALFLTTRWEVPFAIIMGSAALILMAIAGRWFTAGHVHVISLKRVIR
FT                   NAPWQIVLFSLGMYLVVYGLGNAWLTARAADVLVWLSQQGTIVATVGTGFASAILASLM
FT                   NNMPSTLIGALAIDQADVAQQTQQLMVYANVIGNDLGPKFTPIGSLATLLWLHVLAGKG
FT                   YRIGWGQYMKVGLVITPPVLLATLLALALWLPVLPAP"
FT   CDS_pept        complement(571705..572421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1498"
FT                   /product="ArsH family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1498"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41381"
FT                   /db_xref="GOA:E1V6Q2"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR014063"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6Q2"
FT                   /protein_id="CBV41381.2"
FT                   /translation="MSFEPLPNIDPDHLHAIDVDALVGPDQPRHPPRILVLYGSLRERS
FT                   YSRLLSEEAARLLRWFGCEVRTFNPSGLPLPDDADAEHPKVQELRDLAKWSEGMVWVSP
FT                   ERHGAMTGIMKTQIDWIPLALGGVRPTQGKTLAVMEVSGGSQSFNAVNQLRILGRWMRM
FT                   LTIPNQSSVPKAFNEFDEAGRMHLSPLYYRVVDVCEELVKFTWMTRGRSAYLTDRYSER
FT                   VESAEELSRRVNQATH"
FT   CDS_pept        complement(572561..572917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1499"
FT                   /product="ArsR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1499"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41382"
FT                   /db_xref="GOA:E1V6Q3"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6Q3"
FT                   /protein_id="CBV41382.1"
FT                   /translation="MDNEKILEAFTALSQATRLETFRVLVRFEPEGLPAGEIARLLGVP
FT                   HNTMSTHLGVLSRAGLVSSRRQSRSIIYRANLDHMRETLSFLVRDCCAGRAELCEPLLA
FT                   ELQPACPSQESDPS"
FT   CDS_pept        complement(573057..574574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="matB"
FT                   /locus_tag="HELO_1500"
FT                   /product="malonate--CoA ligase / methylmalonate--CoA
FT                   ligase"
FT                   /EC_number="6.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1500"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41383"
FT                   /db_xref="GOA:E1V6Q4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1V6Q4"
FT                   /protein_id="CBV41383.1"
FT                   /translation="MSHNLFEIFANRMQQRGDADFITTREGRRYSYADTLAESARLAGA
FT                   LTELGVASGDRVAVQVDKSPEVILLYLACLRIGGIYLPLNTGYTGDEIRYFLGDAEPAL
FT                   FVCRPQVHEDARAIAAETGCPAVETLGADADGSLLDKAARATPRNEVVPREADDLAAIL
FT                   YTSGTTGRSKGAMLTHRNLASNAETLVDAWRFEAEDRLIHALPIFHTHGLFVACNVSLM
FT                   AGSSMLFLPRFDAEVILEEMPRGSVMMGVPTFYTRLVADERLTAERTANMRLFVSGSAP
FT                   LTAETHEAFETRTGHAILERYGMTETNMNISNPYDGPRRAGTVGKPLPGVEIRITDRET
FT                   GEEVPEGEIGLLQVRGPNVFIGYWRMPEKTREELLEDGFFITGDLAMIDDHGYVQIVGR
FT                   DKDLVISGGYNVYPKEVEQVIDELEGVQESAVIGLPHPDFGEGVTAAVVCEPGASLDEA
FT                   QVLDHLQGRLAKYKQPKRVFFIDALPRNTMGKVQKNELRQRFDATYR"
FT   CDS_pept        complement(574571..575926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1501"
FT                   /product="malonyl-CoA decarboxylase"
FT                   /EC_number="4.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1501"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41384"
FT                   /db_xref="GOA:E1V734"
FT                   /db_xref="InterPro:IPR007956"
FT                   /db_xref="InterPro:IPR035372"
FT                   /db_xref="InterPro:IPR038351"
FT                   /db_xref="InterPro:IPR038917"
FT                   /db_xref="InterPro:IPR042303"
FT                   /db_xref="UniProtKB/TrEMBL:E1V734"
FT                   /protein_id="CBV41384.1"
FT                   /translation="MNMTFLQEMFNNITQRDALLRRRHGYNTNPDHADLVGACRALLES
FT                   DGEASSIALASRALAMYERLDGSERRRFFARLAEEFAADPTRIDQAYAAYSESRDNATL
FT                   NGLFEACEPRRQELFRRLNLASDGTYQLVRMREDLLALRREHPELAGIDADFAHLFASW
FT                   FNRGFLMLKRIDWNTPASLLERIIHYEAVHEIHDWNDLRRRLDTRDRRCFAFFHPAIGD
FT                   EPLIFVEVALCKGLPDHIQPILAGEDSDVEAPEDADTAAFFGISNCQTGLRGISFGNFL
FT                   IKQVVQELKQELPQLKHFVTLSPVPGFAQWLKAQRDDDSTSEAQREALAALDEPGWHRD
FT                   PERAEALKAVVRPMAARYLTQEKNDRGLPLNPVARFHLGNGAELHRINWLGDISDKGLE
FT                   QAAGLMVNYLYVLNDIERNHENYTANATVACSSEVRDLARKARKQQAKGELK"
FT   CDS_pept        complement(575940..577274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1502"
FT                   /product="TRAP transporter large transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1502"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41385"
FT                   /db_xref="GOA:E1V735"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V735"
FT                   /protein_id="CBV41385.1"
FT                   /translation="MDPITLGIIVAVGLVALMAIGTPIAFALGGVSLLALLYDRGLPEL
FT                   TYFGETFFERIADFGFVAIPMFILMGAAVASSPTGRDLYRSLDLWMGRLPAGLAVSNIG
FT                   ACSIFAALSGSSPATCAAIGKMGIPEMRTRGYPDGVAAGCIAAGGTLGILIPPSVTMII
FT                   YGIASETSIGRLFIAGIVPGFMLAGLFMVWTIIACKLAGGYQTPMAQTAERLKETVKAN
FT                   ADSNIKALMRVLPFLAVVAGILFALYGGVATPSEAAGVGAFLCLALAILIYRMWQVGPI
FT                   KLIMRDSLRESVMIMLVIACAEVFAYALSSLFITQTVAGAIAELEVNRWVLMGVINVFL
FT                   LVAGFFLPPVAVIVMTAPILLPIILAANFDPYWFAVVLTINLEIGLITPPVGLNLFIIK
FT                   GIAPDISLRDILFGSLPYALCMVLGIVLLCFFPGLALWLPDLLMG"
FT   CDS_pept        complement(577276..577797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1503"
FT                   /product="TRAP transporter small transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1503"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41386"
FT                   /db_xref="GOA:E1V736"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V736"
FT                   /protein_id="CBV41386.1"
FT                   /translation="MAMANTSPLARRLPLIDLYIRMMDSLSRYAAYLAAAMFIAGVFAV
FT                   CHMVFVRYVLGMSTSWQTEFTVFSVTGAMLMGSAYVLMTGGHVAITLLPDMAGGVIRKI
FT                   MQGVASLFGLGFCAALSYGAWIYLAEAWHGQWTTGTVWNPPLWPALVPMAVGTSLLTLQ
FT                   YIAELLRGEA"
FT   CDS_pept        complement(577864..578868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1504"
FT                   /product="TRAP transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1504"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41387"
FT                   /db_xref="GOA:E1V737"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V737"
FT                   /protein_id="CBV41387.1"
FT                   /translation="MKRSYMPPLVAGLALAALAASSSASAQTVLRASHQFPGGQGDVRD
FT                   EMVQLMAEKVADADVGLEVEVYPGQSLFKAREQWSALTRGRLDITALPLDYASGRHPEF
FT                   SATLMPGLVRNHEHAQRLNDSKFMGMIKDVIQEGGARVLADAWLAGGFASSERCITSPD
FT                   TVDGQNFRAAGPAFEEMLEAAGASITSMPSSDIYTAMQTGVLDAANTSSMSFVSYRIYE
FT                   QVECLTQPGEHALWFMYEPILISEQSWQKLDEAQQKALMEAGQAAEEFFAEKAAGLDQQ
FT                   MVDVFEENGVEVVSMSEEDYNAWLEIAKQSAYKNFAENVPDGQALIDAALAVD"
FT   CDS_pept        579014..579688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1505"
FT                   /product="GntR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1505"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41388"
FT                   /db_xref="GOA:E1V738"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V738"
FT                   /protein_id="CBV41388.1"
FT                   /translation="MKRSNTQRLRDALEDDIINGRRAPGERLDPEALGREFEVSRTPVR
FT                   EAIQQLVASGLVTVSPKKGTFVAKVGIDQLIEMFEVMAELEGMCGRLAARRISDAELAE
FT                   LREALARCETAARAGDPDEYYYENAAFHDCIYRASHNGFLDSEARQLKQRLKPYRRLQL
FT                   QVRQRMGSSLEEHREIVTAIEAGEAERAERALRDHVLIQGERFSDFVASVRRLGTLQED
FT                   AV"
FT   CDS_pept        complement(579699..580187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ogt"
FT                   /locus_tag="HELO_1506"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.63"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1506"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41389"
FT                   /db_xref="GOA:E1V739"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR008332"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR023546"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:E1V739"
FT                   /protein_id="CBV41389.1"
FT                   /translation="MTDALDYYQPPQSDALGLLRLSATASGITEIAFVMEKDAAPRPNE
FT                   ITERARQQLDEYFAGERRDFELPLAPRGTDFQRRVWEALATIPFGETRNYAEIAEQLGC
FT                   KGGQRAVGAANGRNPISIVVPCHRVIGSDGQLTGYAGGIGRKQWLLAHEAGEIPFQLA"
FT   CDS_pept        complement(580184..581587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1507"
FT                   /product="AlkA/HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1507"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41390"
FT                   /db_xref="GOA:E1V740"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010316"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR037046"
FT                   /db_xref="UniProtKB/TrEMBL:E1V740"
FT                   /protein_id="CBV41390.1"
FT                   /translation="MLEPSQCRQARLARDARFDGRFFVAVTSTGVYCRPICPATPPHER
FT                   NVRYYESALAASRDGFRPCLRCRPDSAPDSPAWRGTHTTFERALRLIDEGALREAPLGA
FT                   LCERLGIGERYLRQLFQQRLGVSPKTYALHRQCLFAKQLLHQTRLPVTEVAYASGFRSL
FT                   RRFNDAFRRHIGLAPRELRRRGGTGDDGLTLTLSYRPPYAWHPLHDFHRQRAIDGLEWV
FT                   GEHHYGRHVHWGSARGWFTAEHDPEHHAFRVHLMLDDLAVLAPVVRQIRRVLDLDADTA
FT                   TIESHLGRIAPGLSLTEGLRLPGVWSPFEAGVRAILGQQVSIVAARRLVGSLVEQLGEP
FT                   AGDGYHFPTPESVAASELEFLRMPGARKATLQRFASWYAGAGSGDDPLQWTALKGIGPW
FT                   TANYAAMRGIGHPDIWLDGDAGVRRTLDRLGDSDPADAAPWRSYLTLQLWSQEPTPDNP
FT                   EQNVMEASR"
FT   CDS_pept        581781..583010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynU"
FT                   /locus_tag="HELO_1508"
FT                   /product="kynureninase"
FT                   /EC_number="3.7.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1508"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41391"
FT                   /db_xref="GOA:E1V741"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010111"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1V741"
FT                   /protein_id="CBV41391.1"
FT                   /translation="MAVTLDSARELDRQDPLATFKERFALPEGVLYLDGNSLGAQPLAA
FT                   RKAVTETMDQWRDELIKGWNQGWFDAPERLGNLLAPVIGAGEGEVVVTDNITLNIFKLL
FT                   GYIIGQRGDGGGVVLSEGGNFPTDGYIAQGFSRFGGHQHRFLPEGESLEAHLDGVDVVV
FT                   LSQVNYRTGALRDMAAATRLVHAHGAEVIWDLAHSAGALPVDLNGSGARYAVGCTYKYL
FT                   NGGPGAPAFIYVQRGHQDSGWQPLSGWHGHAAPFAFEADYAPAGDITRFRTGTHSALAY
FT                   SALEASLAMWAEVDMHALRDKSLAVSELFRDCLADLLEPYGIADITPAAGERGSQVSLV
FT                   AAEDGFAIVQALIARGVIGDYREPGLMRFGFTPLYLSFEDVWQAARHFREVLESGEYRE
FT                   SRFKVRSAVT"
FT   CDS_pept        583081..583941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kynA"
FT                   /locus_tag="HELO_1509"
FT                   /product="tryptophan 2,3-dioxygenase"
FT                   /EC_number="1.13.11.11"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1509"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41392"
FT                   /db_xref="GOA:E1V742"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR017485"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:E1V742"
FT                   /protein_id="CBV41392.1"
FT                   /translation="MSHLDENKTRQNAVNLQDEKNVHWDQDMSYGQYLGLEALLSCQRP
FT                   VSNEHDEMLFVIIHQVSELWLKQCLHEAHAAARHIAADQLRPAFKMLSRVARIQEQMIQ
FT                   AWEVLVTMTPSDYVSFRDSLGQSSGFQSHQYRELEFLLGNKHPGMVKVHRSHSANYQRL
FT                   MSVLQAPSLYDISLQLLARRGFKLPASVLDRDWSEPYEACAEVEAVWADIYASTDHHWD
FT                   LYELAEKLVDTEYNFHKWRFSHMKTVERIIGHKSGTGGTSGVSYLKKALDLKFFPELWS
FT                   VRTSL"
FT   CDS_pept        584183..585520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1510"
FT                   /product="DUF2252 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1510"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41393"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:E1V743"
FT                   /protein_id="CBV41393.1"
FT                   /translation="MPQPLTRHNRPRQVLDAIASANAGLSEQEREAKYAKLAESPYRFF
FT                   RGTNHLYWDDIWHDWRFALYGGLPETQTWLQGDAHAYNFGAYGHRDDTVRYGMDDFDDA
FT                   MIGDYQYDLWRLAISLVLDARENVGLSRKSTGKALATLTESYHDELAGHLNGEAPDGVT
FT                   LETAKGPVAPFLEKVAAKRSRARMLDKWTRLTDEGRCFAERPDKLARLPAHLASQLRKA
FT                   VEGEYRETLYSERAEADEDHFRVKDMARRLDAGTGSLGLERYYVLIEGGRDHEHDDVIL
FT                   DVKQQTPPEGWRLMNATEKRAWRRAFPHEGVRHAAAFHAIAEHPDPYLGWLHIGDSVFS
FT                   VRERSPFKDDFPTHKLDSGKDYRKLVKRWGRILAREHLRGARDLYPEDPGSFARNVCAR
FT                   LEGRLDHFTDMVATLAVSYAECVTQDYRTFVASRAEQAEETSAEKT"
FT   CDS_pept        585743..587221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1511"
FT                   /product="UPF0061 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1511"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41394"
FT                   /db_xref="GOA:E1V744"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:E1V744"
FT                   /protein_id="CBV41394.1"
FT                   /translation="MFPSFSLRYARLPERMRAASQPIPVEDARLVAFNRELADELGFEL
FT                   AAFEADEAAEIFAGNRLPEGAEPVAMAYAGHQFGNFVPQLGDGRALLLGEVVDRHGRIR
FT                   DIQLKGSGRTPFSRGGDGRSPLGPVLREYLVSEAMHALGIPTTRALAAVTTGERVFRRI
FT                   PEPGAVLTRVASSHLRVGTFQYFAARGDTEAVRLLADEAIDRHYPHLADRTDDGERYLA
FT                   LLDAVAERQAELVARWMGVGFIHGVMNTDNTAISGETIDYGPCAFMDTFDPRTVFSSID
FT                   ERGRYAYVNQSVIIQWNLARFAETLVPLIDSDGERAVERATPIIRDFSERFDARWREVM
FT                   CVKLGLVTEEEGDGELAQALLDAMRDGRADFHLTFRHLADAVDASAEAPRLRENFASQE
FT                   ELEAWLPRWRERLAREGVSTDDIVARLNAANPAVIPRNHRVAEAIAAAEEDDFGPFEAL
FT                   LAVITDPYTTPDGDVDYMRPPRDEEKVLRTFCGT"
FT   CDS_pept        587441..588310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1512"
FT                   /product="beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1512"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41395"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1V745"
FT                   /protein_id="CBV41395.1"
FT                   /translation="MSQQPIVQTFFDEPTKTFSYVVQDPDGKACAILDSVLDFDYAAGR
FT                   TDVRSADEIIAFIRDNALEVMWILETHVHADHLSAAPYLHEQLGGRTGIGANITVVQEV
FT                   FGKAFNAGSEFARDGSQFDHLFEEGDTFAIGNLEGRVLYTPGHTPACLTYVIGDAAFVG
FT                   DTLFMPDYGTARCDFPGGDARTLYRSIQKVLALPGETRLFMCHDYKAPEREEYQHETTV
FT                   AEQRAHNIHVHEGVSEEAFVKLRTERDATLGMPRLIIPSVQVNMRAGEMPAAEDNGQVY
FT                   LKVPINAF"
FT   CDS_pept        complement(588385..590604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katG"
FT                   /locus_tag="HELO_1513"
FT                   /product="catalase / peroxidase KatG"
FT                   /EC_number="1.11.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1513"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41396"
FT                   /db_xref="GOA:E1V746"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019793"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:E1V746"
FT                   /protein_id="CBV41396.1"
FT                   /translation="MGEQQNSKAAGQCPVMHGSNTNMRGKGTENRDWWPNQLNLGILHQ
FT                   HTAKANPMGEGFNYAEEFKKLDLAAVKRDLNDLMTDSQDWWPADFGHYGGLMIRMAWHS
FT                   AGTYRMGDGRGGAGGGQQRFAPLSSWPDNVNLDKARRLLWPIKQKYGNKLSWADLYILA
FT                   GNVALESMGFKTFGFAGGREDTWEPEEDVYWGAEKEWLGSDERIVDKENRELENPLGAT
FT                   HMGLIYVNPEGPEGEPDPVKAAHDIRETFKRMAMDDEETVALIAGGHTFGKTHGAGTEE
FT                   QVGPEPEAAPVEQMGLGWKSSYGKGMGEDTMGGGPEVIWTQTPTQWSNHFFGNLFGYEW
FT                   ELTKSPAGAYQFIAKDAKGDEVPGPEADSQRRAPTMLVTDLSLRYDPAYEKISRRFYEN
FT                   PEEFADAFARAWFKLTHRDMGPKARYLGPEVPDEDLIWQDPVPPVDHELIDAQDIAELK
FT                   RKLLGSGLSVTELVRTAWASASTFRGSDMRGGANGARIRLAPQKHWEVNQPEQLAKTLQ
FT                   VLEGIQSDFNAAQSGDKKVSLADLIVLGGAAAIEKAAQDAGHAIEVPFSPGRTDATEAQ
FT                   TDAESFEVLRPEADGFRNYRRTKFAIPDEELLVDRAQLLGLSAPEMTVLIGGMRALGAN
FT                   YGDVSHGILTDRPGTLTNDFFVNLTDMGTDWQPVSSEEDVYEGRDRKTGETKWTATRVD
FT                   LVFGANAQLRALTEVYAQDDSREKFVQDFVAAWNKVMNADRFDLA"
FT   CDS_pept        complement(590864..591811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1514"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1514"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41397"
FT                   /db_xref="GOA:E1V747"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V747"
FT                   /protein_id="CBV41397.1"
FT                   /translation="MLDWQDIQIFLEVARSQRLADAARRLGLDHSTLSRRTRRFEQRLN
FT                   TQLFERSTHGYHLTEAGHRLLAHAEEMARHAFEASESLTDQDHRISGQIRLGVTEGFGT
FT                   WVIAPLLAAFCDRHPGVTLDLLALPRVVNLSRHEADLAITIERPSSPGLVISRLCDYRL
FT                   RLYGSQDYLHRHGTPRRLADLGQHRLIGYIDDLIFSEQLNYLDPLLDPAVIGHPGPHFA
FT                   MRGTSVTTQHSACLRGAGLAVLPCFMGTTTPTLSSLLVDEVDIVRQFWITARQEQRRLA
FT                   RVRLLWDFLRDALELNRDFLMGESRELTIPPSPS"
FT   CDS_pept        591971..593470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA1"
FT                   /locus_tag="HELO_1515"
FT                   /product="methylmalonate-semialdehyde dehydrogenase
FT                   (CoA-acylating)"
FT                   /EC_number="1.2.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1515"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41398"
FT                   /db_xref="GOA:E1V748"
FT                   /db_xref="InterPro:IPR010061"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1V748"
FT                   /protein_id="CBV41398.1"
FT                   /translation="MSVREIPLYIDGQAVPSRSQEVRDVVNPATQEVVARVPFCTVEEV
FT                   DRAVASAREAFKSWRKVPLAKRQRIMLKLQALIREHTEELAALITEEHGKTLPDAAGEV
FT                   GRGLEVVEHACSITSLQLGELAENAASEVDVYTLNQPLGVGAGITAFNFPIMLPCFMFP
FT                   LAIATGNTFVLKPSEQDPSSTMRLVELAHEAGVPAGVLNVVHGGPEVANRIADHPDIKA
FT                   LSFIGSTHVGSLLYNRAAAAGKRMQAMMGAKNHCVVMPDANRSQAINNLLGSAFGAAGQ
FT                   RCMANSVVVLVGEARSWLDDIAEGARNMKVGPGTQRDADLGPLVSPAAKARVEELIATG
FT                   EREGARLVVDGRGHQVEGYPDGNFVGPTLFSDVTAEMTIYREEIFGPVLCVVGVETLDD
FT                   AIDFINANPNGNGTSIFTNSGWVARRFETDIDVGQVGINVPIPVPVAYFSFTGSRGSKL
FT                   GDLGPNGKQAIAFWTQTKTVTARWFEPENVSSGINSTISLS"
FT   CDS_pept        complement(593543..595033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1516"
FT                   /product="SSS family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1516"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41399"
FT                   /db_xref="GOA:E1V749"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E1V749"
FT                   /protein_id="CBV41399.1"
FT                   /translation="MNSHIFLGTFFVYIVLMIGFGWWVSRHSRGSGDDFLLGGRSVPLF
FT                   LTVGTTVATMVGTGSSMGAVGFGYTNGWAGALYGIGGAVGVLLLALLFAPVRKLRFMTM
FT                   SEELSYYVGANRLVRNLVALLIYIACIGWLGAHILGGGLYLAWMADIDPALAKVIVALG
FT                   FGIYCVIGGYMAVVWTDTIQAIVLFIGFFLMAGLALIEVGGFSGLTASMDAGATSLLGI
FT                   DKIGALPALSLAAVIAVGVLATPSFRQRIYSGKSVGSVRRSFLVTGVLYLAFSIVPAII
FT                   GMATHALNPSLDNSNFAFPFLATEVLPLGLGLLLLVAGLSATMSSASSDAIAGVSTLMR
FT                   DLYVLFTGRAPSARHVVLYSRLALVVTIGLALTFALASDNVIDYITTMISTVLAGLFVC
FT                   GLLGRFWPRYNWQGAVASLITASATSLAVTAHAGWSDFWGNPSIPSVLLAIGGGVLVSL
FT                   LTRAPRTTPEQALAILDQERRRMEEAPDVSLTAGASQG"
FT   CDS_pept        complement(595235..595627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1517"
FT                   /product="RutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1517"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41400"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E1V750"
FT                   /protein_id="CBV41400.1"
FT                   /translation="MTIKRYGAEGGTGTGGQKLPFSRAVEAGGWLRVSGQTPMTDGEVV
FT                   EGGIVEQTRLAFDNCLAIMHEAGYGVEDVVHVTAVLTDARYFSSFNKVFAEIFGDHPPA
FT                   RICSVQDLVVDCKVEVDVSCYRADRA"
FT   CDS_pept        complement(595624..597105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1518"
FT                   /product="N-acyl-D-amino-acid deacylase"
FT                   /EC_number="3.5.1.81"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1518"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41401"
FT                   /db_xref="GOA:E1V751"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR023100"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E1V751"
FT                   /protein_id="CBV41401.1"
FT                   /translation="MHHDLLIRGAMVLDGTGAAPFPADIAVSGERIVAVGRLAADDATT
FT                   VIEAHGRYLAPGFIDVHTHDDTNVIRTPEMQPKLSQGVTTVVVGNCGISASPVTLRDSV
FT                   PDPMNLLGGVEDFRYPSFADYARAVDDAVPSVNVAALIGHTSLRSQVMDDFARPAEAAE
FT                   IEAMRRSLRDALDDGALGMSSGLAYRNAFHAPDTEMRALVDEVGAAGGLYTTHLRDEFA
FT                   GLLDAMDEAYATARHGQAPLVISHLKCAGAGNWGNAPLALSSLERAAREHRVHCDCYPY
FT                   TAGSSTLDLGQVTDEIAIFITWSDPHPEQARRPLADIAADWNVSLMDAARRLQPAGAVY
FT                   HNMSEDDMRRVLAHPLSMIGSDGLPNDPHPHPRLWGAFPRVLARYSRDLGLMPLAEAVR
FT                   KMTGLSAAQFGLTDRGVIREGAYADLTLFDLTTLEDTADYARPIAAARGIDLVTVNGAI
FT                   AYRDGHFADHRRGRLLRRRQRLSPTPIHAMTEDSP"
FT   CDS_pept        complement(597107..597970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1519"
FT                   /product="RpiR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1519"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41402"
FT                   /db_xref="GOA:E1V752"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1V752"
FT                   /protein_id="CBV41402.1"
FT                   /translation="MTQDIDILSRITSDFAGLRDAEKKVAELIFADIDFVSEASIGDIA
FT                   ARADVSDASVTRFARAVGCQNVRDLKLRLARALAAGRRFIQDAGDTDGLGAVYDIATQT
FT                   LEVNRELMEQADVAGAIELLDGARQILVFGAGGGSTMLAQELQFRLVRLGYAISAYPQS
FT                   LLPRMVASTLEPDDVVVTLSVSGYTPEIVESAQIARQYGARVVAITANGSPLAETADVV
FT                   LPVAARETDFIYHPSASRYAVLAAIDVLALELALRHQDRSRDKLRRLKITLDAHRGGDN
FT                   RQPLGD"
FT   CDS_pept        598214..599425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1520"
FT                   /product="PLP barrel domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1520"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41403"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR026956"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR042208"
FT                   /db_xref="UniProtKB/TrEMBL:E1V753"
FT                   /protein_id="CBV41403.1"
FT                   /translation="MRQMASKMGDKGVPESGTSLLEGVSLPAAAIQEAPLAHNLAWMQR
FT                   FAESHGAELAPHGKTTMTPELFRRQLEAGAWGITLATAPQCRAAFVSGVERLLMANQLV
FT                   GRANMAIIADLIEAGADFHCVIDGEDNARALGRFFSERGLTLKVLIELGVEGGRTGCRS
FT                   VEAVSELARIVDTEPGLALAGMEGYEGVVHAEDPVPAIRDYAARLVEAARRLDDEGRFG
FT                   VDAPIITASGSAWYDLIAETFDAAELRSRFTPVIRPGCYVVHDHGIYRQAQRGVLSRRP
FT                   DLHEGLRPALEVFAQVQSLPEPGLAIVALGKRDIGFDHLPEPLRRYREGGSADEVLSVS
FT                   GWELTKLMDQHAFIRLPEHADNVRVGDVVAFGASHPCLTFDKWRRICLVDEHLTVTETL
FT                   ETAF"
FT   CDS_pept        599627..601033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1521"
FT                   /product="SSS family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1521"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41404"
FT                   /db_xref="GOA:E1V754"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E1V754"
FT                   /protein_id="CBV41404.1"
FT                   /translation="MPYLTSAVLGAALLCFAYLGLRARRADGPLDDYVTARNSQSARSL
FT                   GVSFLASGMGAWILFAPPEIGAMVGPLALVGYALGSALPFIVLSLYGPVIRRYLPEGRS
FT                   IGEFAEACYGQGVRRWVTLVSILYMACFLAAELTAIGAIASLLSEVPAGLVVMGVAVVT
FT                   LVYTAVGGLRASLATDRWQGWLLLALLVLVAGVVVWVLPPLPENASMPTTPSVNALSVA
FT                   LTLIIAVTAAELFHQGYWQRVWAAETNGALGRGALLGGVGVLLVVMVIGGLGILAAMHG
FT                   LPLGEPPIPFFALLAEAPGWLAVPALVLAVTLVASSVDTLQNAIASLVVAGSGRRGLSI
FT                   GSARLATVVLMVPVVVVALQELSVLRLFLIADLLCAATVVPVLLGVWRRMGSLAAMAGG
FT                   VAGLVGAVVPGWVAQGSLMAGVQAASFPGGIPTLSPFLCALIASTLVSLLIAWCRPARR
FT                   SRSVASEGVS"
FT   CDS_pept        601136..602824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD2"
FT                   /locus_tag="HELO_1522"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1522"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41405"
FT                   /db_xref="GOA:E1V755"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E1V755"
FT                   /protein_id="CBV41405.1"
FT                   /translation="MSDTPSDSRRRYSAPVVDGVGKSASRAMLRAVGFSDDDFSKPQVG
FT                   IASTWSQVTPCNSHLGELADRASAGADAAGGKGVIFNTITISDGIANGTEGMKYSLVSR
FT                   EVIADSIETVAGCEGFDGLVALGGCDKNMPGCLMGLARLNRPSVFVYGGTIMPGADHTD
FT                   LVSVFEAMGAHSRGDLDLIDVKRIEETAIPGPGACGGMYTANTMASAIEALGMSLPGSS
FT                   AQNAVSDEKRADSHAAGEAVLNLLEHDIKPSDIMTREAFENAITVVIALGGSTNAVLHL
FT                   IAMADTIGVSLSLEDFTAIGRRVPVLADLRPSGHYMMSELVAIGGILPLMKTLLDAGLL
FT                   HGDCLTVTGRTLAENLADVAPYPEGQSIIAPLDAPLKDESHLRILYGNLAPEGAVAKIT
FT                   GKEGTRFTGTARVFGSEEQAQASINDGGVVAGDVVVIRYEGPRGGPGMREMLTPTSAIM
FT                   GRGLGDQVALITDGRFSGGSHGFVVGHVTPEAFDGGPLALVEDGDSITIDAEANTIDVA
FT                   LDDDELARRRAAWQRPEPRYTRGALAKYARVVSSASMGAVTDRLE"
FT   CDS_pept        complement(602831..603514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1523"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1523"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41406"
FT                   /db_xref="UniProtKB/TrEMBL:E1V756"
FT                   /protein_id="CBV41406.1"
FT                   /translation="MRHLATGLLATGLVMTASAPALADGQATLEAQSDQGGVTMNVRWA
FT                   GENLRMDFPGQSQAGFMLLRDGKGYLVTQVQGQTMVMDMAKLKGMAENMGGGEVETIAG
FT                   QQASRVDALEATGDSESIAGLEGDVYRLQWTDKNGSAHDDELVLSDDPQVLELMSAFHD
FT                   YQRSMTGESDPIATTLEERGLGMLRFGDRFRLAEMTDASPAPDIFELPENAKSFEDMMR
FT                   SAISE"
FT   CDS_pept        complement(603592..603873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1524"
FT                   /product="HTH domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1524"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41407"
FT                   /db_xref="GOA:E1V757"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR039554"
FT                   /db_xref="UniProtKB/TrEMBL:E1V757"
FT                   /protein_id="CBV41407.1"
FT                   /translation="MSTASHTCDTDPSDPPPRRCPDLDVRDLEQRTRLMRIITRLIAIS
FT                   DLGSRDIARRAGLPMQKISDLLAGRLEQLTLDELRTLRRTIDPEFTAS"
FT   CDS_pept        604170..605594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1525"
FT                   /product="APC family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1525"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41408"
FT                   /db_xref="GOA:E1V758"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:E1V758"
FT                   /protein_id="CBV41408.1"
FT                   /translation="MHDDTTRLTRVLARKDVLALAFGAMIGWGWIVMTGNWIQSAGSLG
FT                   AIVAFLLGGSVIVLVGLTYAELASAMPQVGGEHVYSYRALGHFASFLCTWAITLGYVSV
FT                   VSFEAVALPTVVEHLFPGYAVGRMWTIAGWDVNATWVAVGVAGSVAMTWINYLGVRTAA
FT                   LVQKVVTLLILVVGIMFITGALFEGNTATLEPLFNVQEGVIGGIMAVIIMVPFMFVGFD
FT                   VIPQAAEEIDLPFREIGRVLMISVILAVFWYALIILGTALMLDPSALAESSLAVPDAMQ
FT                   AVFQAPWAGNLMILAGIAGIITSWNAFYIGGSRAIYALAHAGMLPAFLARLHPKHRTPT
FT                   NAILVMGLLSAIAPFFGRPALVWLVVAGGLGIVIAYLFVALSFVVLRRREPELHRPFRV
FT                   RHGKTVGALSVLLSIALIGLYLPGSPSSLSMAEWGIFAVWMLLGLAFYAWSRRRYGVAY
FT                   SDTMMRRELEGESSSG"
FT   CDS_pept        605635..606831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhgO"
FT                   /locus_tag="HELO_1526"
FT                   /product="L-2-hydroxyglutarate oxidase LhgO"
FT                   /EC_number="1.1.3.15"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1526"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41409"
FT                   /db_xref="GOA:E1V759"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1V759"
FT                   /protein_id="CBV41409.1"
FT                   /translation="MHDFIIIGGGILGMSTAMQLKQAYPDRRMLLVEKEQAPACHQSGH
FT                   NSGVIHAGVYYTPGSLKARFCLAGNRATREFCEAHGVAYEICGKLLVATSELEKQRMEA
FT                   LWERTAANGLEREWLSGEALREREPNITGIGGIFVPSSGIVDYAAVTRAMAAEFERLGG
FT                   EIRYGAEVSGLEERRREVVVTTSQGECTGRYLVTCSGLMADRVIRMLGQKPGFTICPFR
FT                   GEYYVLPERHNDIVNHLIYPIPDPSMPFLGVHLTRMIDGSVTVGPNAVLAFKREGYRRR
FT                   DVSLRDLAGMAANPGLLKVLGSNLRPGLAEMKNSLHKRGYLELVRKYCPSLSLDDLEPY
FT                   PAGVRAQAVSRDGKLVDDFLFVNTPRTLNVGNAPSPAATSALPIGAHIVEKLKKQVAD"
FT   CDS_pept        606983..607945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1527"
FT                   /product="TRAP transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1527"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41410"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:E1V760"
FT                   /protein_id="CBV41410.1"
FT                   /translation="MRALKYALAASLLVAAPAAVAQQQLSIATGGTGGTYYPYGGGLAE
FT                   LIKEHIDGYDAVAEVTGASVENMGLVWRGDSDMALALADTVYQAYNGTGDFEGRQLENI
FT                   RALASVYPNAVQIVTMADSGIESLQDLEGKIVSVGAPGSGTELNARAVLETNGISYDDF
FT                   EARRLNFNETADALRDGDIDAGFWSVGPPTSSIMNLATTRDIRLIGLSDEEVANAREEV
FT                   PVFAPYELRAGLYEGMEEPVQTIGIPNILATNAEMDEELAYQITKTLFEHTDQLIAIHP
FT                   AANDTTMKFSVDSTPIAFHPGALRYYEEQGAEIEDRQRP"
FT   CDS_pept        607942..608535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1528"
FT                   /product="DUF1850 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1528"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41411"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:E1V761"
FT                   /protein_id="CBV41411.1"
FT                   /translation="MRGRRIQLIAGRARGSALLLWLAWALVSLPAQAACPEYELRVSDA
FT                   EGQPLVSLPMPEGAGWCLAWNHSVEGFAVHDCYRNVGGHMVLERSHLPDFAAGLDHIPG
FT                   RGRQVSDGQGGYWIEDIDEPVPGDRYRLRVGAMRVDHRLVRHGEPSLRSLLERSRDQGC
FT                   GIDEDMLAGDGPVVISLSELAANEGVTIGLYSKH"
FT   CDS_pept        608594..610600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1529"
FT                   /product="TRAP transporter 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1529"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41412"
FT                   /db_xref="GOA:E1V762"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:E1V762"
FT                   /protein_id="CBV41412.1"
FT                   /translation="MSDSGNSPVIPGSQAKHSWLVLRLISLVAIGLSLFQLYSAGIEPL
FT                   GLFYQRSIHLALIMMLAFLMFPVFGPSRPRGVVGGLIDLVFFAGAVITGGYLVLYLDEI
FT                   INRAGFWTQTDIVIGCIATVTVLEASRRAVGLGMTVIGVLAILYAFAGARGELPWLGEW
FT                   LPGILEHRGYSLDRLVGQLYLGQEGIFGLPMGVAATYIFIFVLFGAFLEITGAGKFFID
FT                   LAYAATGRQRGGPAKAAVIASAGMGSISGSAIANVVTTGAFTIPLMKRLGYRPHQAGGI
FT                   EAAASTGGQIMPPLMGAGAFLIAEYTRMPYLEVVKVSILPAVMYFSTVYLFVHIIALKQ
FT                   GMKGMSKDELPQMRDVLGAGWHFLLPLAVLVWLLVQNLSPMRVGYYAILTMLAVAILRF
FT                   VIWMVFVAPKQGQPVTASALKLAVRNGVLKLLEGLELGARNAVAVSMACAVAGIIVGVV
FT                   GLTGLGLKFSAMMMAFSNGHLLLALVMVLLASLVLGMGLPVTASYIVLIVLVGPALTSE
FT                   FGVPLLIAHLVVFWYSQDSNVTPPIALAGFAGAAIAGSKPMDTGFQAWKFAKGLYLIPL
FT                   FMVYNPEIIMGGPWPLLVWTALAGFLALGAFAAALEGYLFTRMSVPVRLVLLPAIVAAF
FT                   YPSLVAEVIGVAVMVVALGGNWLASRRQALATG"
FT   CDS_pept        complement(610739..611401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1530"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1530"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41413"
FT                   /db_xref="InterPro:IPR039366"
FT                   /db_xref="UniProtKB/TrEMBL:E1V763"
FT                   /protein_id="CBV41413.1"
FT                   /translation="MKRPLLLIAALTGTLILAGCDDAKEAEQDNAESTQAEQQANASAQ
FT                   DDQSEASITRSLEGVLEFSATDVPLPDGAEVTISLRDISRADAPATTIAETSVTPGNED
FT                   PVEFHLDYDAADVDPKHTHGLRAALHGDKGELLWTTTSRHTVEVGPDAKQGPITLVLEP
FT                   VNTTPDGESLQEAQEDMLQEEAENADAQGDTADSLDEVNEQAADMQEPAPAGETATQ"
FT   CDS_pept        611685..612194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="HELO_1531"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide mutase"
FT                   /EC_number="5.4.99.18"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1531"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41414"
FT                   /db_xref="GOA:E1V764"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E1V764"
FT                   /protein_id="CBV41414.1"
FT                   /translation="MPANESPRVGVIMGSKSDWPVMEHAVDMLERLGVACETRVVSAHR
FT                   TPDLLFDYAKSAAERGLQVIIAGAGGAAHLPGMVASQTALPVLGVPVESKSLKGLDSLL
FT                   SIVQMPGGVSVGTLAIGKAGATNAGLLAAQIVGLQDAKVREAVEAFRAEQARNVLDNPD
FT                   PRPDSQ"
FT   CDS_pept        612217..613329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="HELO_1532"
FT                   /product="N5-carboxyaminoimidazole ribonucleotide synthase"
FT                   /EC_number="6.3.4.18"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1532"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41415"
FT                   /db_xref="GOA:E1V765"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:E1V765"
FT                   /protein_id="CBV41415.1"
FT                   /translation="MNIGVLGAGQLGRMLALAGYPLANRFTFLDTTGHPSAGIGDVMVD
FT                   TDQKHLADFLAKVDLVTYEFEHLPVPLVQAIEEHKPVHPSSEAIRICQNRAEEKALFDR
FT                   LGIPTPAYRLVDSAEALEDAVRELGTPVVAKSVTEGYDGKGQAVIKTPSEAAEAWRSIN
FT                   HPRLIVEAFVDFVREVSIIAVRGRDGQVVFYPMAENLHVDGILRYSLAPMPDLDAAIQD
FT                   TADGYIRALLDELDYVGVLTLELFQTPDGGLLANEMAPRVHNSGHWTMDGAVTSQFENH
FT                   LRAIQGLPLGDTAARMPSCMVNVIGQEGEAARLLEIEDAHLHRYDKGERPGRKLAHVNL
FT                   LAPTHAELIEKVRRCAELLPGAPTPRFSFE"
FT   CDS_pept        complement(613430..614422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1533"
FT                   /product="UPF0324 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1533"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41416"
FT                   /db_xref="GOA:E1V766"
FT                   /db_xref="InterPro:IPR004630"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:E1V766"
FT                   /protein_id="CBV41416.1"
FT                   /translation="MWQGLLICAALTTAGFGLVRLPGLAESGVSPLVVALLLGILAGNL
FT                   PLARRLEHAGPGLAFATRWLLRGGIVLFGLSLTLQQIVALGPKVLLLDALVITGVLTVG
FT                   YVIGTRVLGMDRETTLLTSAGSAICGAAAVLATESTIRSRPAATAMAVATVVLFGSLAM
FT                   LLYPLLYPLLGMDEGLYGIYIGATIHEVAQVVAAGEAVGPEALANAVIVKLVRVMLLVP
FT                   FLLIVGQWWLRRHTPAEGRAPGGLVIPWFAFGFMAMVVFNSLVDLPAPLHDALVLAGQV
FT                   ALTMAMAALGFETRLEKLRALGIRPFLLALTLFVLLIGGGWIASYLLMG"
FT   CDS_pept        614523..615416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1534"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1534"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41417"
FT                   /db_xref="GOA:E1V767"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V767"
FT                   /protein_id="CBV41417.2"
FT                   /translation="MTPAVSFRQLQVFVTVARLGTVSAAAESLSLSQSATSQALSDLER
FT                   QLGVALFERPGRRLLLNELGRRMMPRAEELLEGLADFVATAREPEGALHGALSVSASAT
FT                   VGTYLLPGLAGRFSERHPAVDLRLKLRNTFEVITDVLRLEADLGLIEGECREPRLASEA
FT                   WCEDRLVIVAAPNHPLAERKWLDDETLGEADWILRESGSGTRSVFERAMRDRNLLPKGR
FT                   MELGQHEAIKQAVRAGLGLGCLSRLSVAGELERGELVALDSELSLRRTFSLVWHPERYR
FT                   SPLWQAFKVFLVESMP"
FT   CDS_pept        615480..616439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1535"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1535"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41418"
FT                   /db_xref="GOA:E1V768"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V768"
FT                   /protein_id="CBV41418.1"
FT                   /translation="MRSGFGFDLRSMEIFVETLERGSQTAAAEYLGLKQSSVSQSLANL
FT                   EEGLGMILLDRHSRPLEPTGAGRFFYDRAKRLLHEARHTRRELQSGSFGRLHQVRMALV
FT                   DSLATAVGQPLIEVIRRHTSDYSLTTGLSHMHGHSLLTRHVDIIISDDRLENYDGLERH
FT                   AILGEPFVLVLPADWTGPVDNLRWLARQMDFVRYTAQSLIGQSIERHLRLNRLELPARL
FT                   YIDNTFALLSLVGAGSGWTITTPLCLFQAGLDRLALRVEPLPTPPLRRDLTLVSRRDEL
FT                   GDLPAQLARDGRQLLDQRFTGELRRHLPWLVSEVRTGH"
FT   CDS_pept        616668..618137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1536"
FT                   /product="APC family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1536"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41419"
FT                   /db_xref="GOA:E1V769"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:E1V769"
FT                   /protein_id="CBV41419.1"
FT                   /translation="MSHSRTSTASVDYESVDEAYLDKRKLKKGAAGWILLASLGVSYVI
FT                   SGDYAGWNFGLAAGGFGGMLVATILMAIMYTAMVLSIAELSSSLPTAGGGYSFARRAFG
FT                   PWGGYVTGTAILLEYAIAPAAIAIFIGGYVNELIGLNGPLVYAVFYAVFVGIHLWGAGE
FT                   ALKIMMGITALAVIAILVFVVGMLPHFDPANLFDISVNTGALGASTFLPEGFIGIWGAL
FT                   PFAIWLFLAVEGVPLAAEEAGDPGRDMPRGIITAMLVLLVFGACVLLLAPGGAGAAAMS
FT                   EHAAPLVGALQAVYGTDSWAAGFVNLVGLAGLIASFFSIIYGYSRQTFALSRAGYLPRW
FT                   LSVTGGRKVPFLALIVPGVIGFLLSLTGKGDLMITMAVFGATISYAMMTLSHILLRRRE
FT                   PELERPYRTPGGVLTSGTAFVLAIVAFLSTFVVSVEAALWSAVFYAIMLAYFGFYSRHH
FT                   LVAQAPEEEFEAIALAERELDAQAETTPDRA"
FT   CDS_pept        618204..619586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1537"
FT                   /product="GlnA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1537"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41420"
FT                   /db_xref="GOA:E1V770"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:E1V770"
FT                   /protein_id="CBV41420.1"
FT                   /translation="MSRMQARDIKTAEDARRIVEERGLSHVKVGMFDIDGVMLGKYMQR
FT                   DKFFSALEDGFAFCDVVLGWDSKDELYDNVRFTGWHTGYPDAPLRIVIDSCREMPSEGN
FT                   GMLLFLAEFAGPAGDICPRGLLGRVLEQGRNMGYEASGSLEYEFFMFQETPESVREKGF
FT                   RNLRPLTPDMMGYSMLRSSVHSELYHELLALSQEMDFPIEGLHTETGPGVLEAAIAVDD
FT                   ALAAGDKGALFKTFTKVWAQRRGLMATFMAKWSPDYPGQSGHIHLSLHDSESGESAFFD
FT                   ADKPHRMSDVQRHFVAGQQKLMPEFLAMFAPTINSYTRLIPGFWAPTEATWGVENRTTA
FT                   LRVIPGSAKSQRVEYRLGSADANPYLALAAAIGAGLYGIQHRLEPDEQVKGNAYELEHP
FT                   AHQALPSTLWEAAQRLKASEAARGLFGDAFVEHFAATREWEEREFRKHITDWELDRYFE
FT                   II"
FT   CDS_pept        619769..621151
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1538"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1538"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41421"
FT                   /db_xref="GOA:E1V771"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1V771"
FT                   /protein_id="CBV41421.1"
FT                   /translation="MALQQTISPVDGSVYVERELADSAQVDAALERAVAAQRSWRATSI
FT                   AERAAFCSAMVDAFVARRDELAEELTWQMGRPIAAGGAEIGGFEERARGMIALAEESLA
FT                   PVTLPDKPGFTRYITREPLGVSFIVAPWNFPFMTAVNAIVPSLMAGNAVILKHSAQTPL
FT                   CAERIHQAFEAAGLPEGVFQYLHLSHPSTEAVIRDPRIDHVSFTGSVGGGEMVERNAAG
FT                   RFIATGLELGGKDPAYVRADADLDAAVPGVMDGAFFNAGQSCCGIERIYVHRDIHDAFV
FT                   ERAVAWVRQLKLGNPSDPSTTLGPLVKPAAADFVRGQIEDAVAAGATAWIDPGEYPLSE
FT                   PGSAYLAPQVLTGVDHSMRVMHEESFGPVVGIMPVDSDEMAIGLMNESDFGLTAAIFTR
FT                   DIAVGERLAQRLEAGTVFTNRCDYLDPELAWTGVKQSGRGCSLSRLGYETLTRPKSFHL
FT                   KH"
FT   CDS_pept        621270..622457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1539"
FT                   /product="probable oxidoreductase (iron-containing alcohol
FT                   dehydrogenase family)"
FT                   /EC_number="1.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1539"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41422"
FT                   /db_xref="GOA:E1V772"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1V772"
FT                   /protein_id="CBV41422.1"
FT                   /translation="MKSKDDMGQLTATWNYPARILAGAGRVRELPEACRALGMRAPLLV
FT                   TDPGLAALPMVHDLVQNCADEGLKVAVFSEIKGNPTGANVEAGVTAFREGGHDGVIAFG
FT                   GGSGLDAAKAVALMAGQRDELSIWELEDIGDYWKRADGDAVAPVVAVPTTAGTGSEVGR
FT                   ASVITNEQEHVKRIIFHPQMVPATVILDPELTVGLPASITAATGMDALSHCLEAWCSPN
FT                   YHPMAEGIAVEGMRRIRDHLPRVHADGRDLESRQHMLVASMMGATAFQRGLGAMHALAH
FT                   PLGALYDAHHGTLNAILMPYVLRANEQAIGEPMVRLGRYLDLRQPGTGAVIDWVLDLRE
FT                   RLGIPHTLAELGIGTEQAEKVGRMAVADPSSGSNPIDFEPARYRDIFVDAVEGRL"
FT   CDS_pept        622500..623216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1540"
FT                   /product="GATase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1540"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41423"
FT                   /db_xref="GOA:E1V773"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1V773"
FT                   /protein_id="CBV41423.1"
FT                   /translation="MRIGLLQCDDVAPELRERHGNYPAMFERLFASVDPTLTFQVWRCL
FT                   DGELPDDVDAADAWLTTGSKFGVNDGMAWIEELCGFVRQLWDADKPLVGICFGHQLIAK
FT                   ALGGEVVKSPKGWGVGMSFNDVAQRADWMDPWQEGLDLVVSHQDQVSTLPPNARILAGS
FT                   DFCPLYLMQIGECFLGVQGHPEFAKDYSADLMRLRRDQVGASRVREGLASLNAPVDDQL
FT                   MARWILNFMRLRTNHR"
FT   CDS_pept        complement(623197..623994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1541"
FT                   /product="TraX domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1541"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41424"
FT                   /db_xref="GOA:E1V774"
FT                   /db_xref="InterPro:IPR008875"
FT                   /db_xref="UniProtKB/TrEMBL:E1V774"
FT                   /protein_id="CBV41424.1"
FT                   /translation="MMPQASTAAATRPSSAWTGWGQWLALVTMTLDHLARYVFPDAWGL
FT                   GWVDSSLGRIAFPLFAAMVAWHGLFNTRNPLRYARRVLVIGLIAQLPYMLMPRAADGLI
FT                   LNICFTLSLGLTGAAWARALPERLERNVLGRRRLAIEAGAALAIWAIAGYIVEYGHLGL
FT                   LMIPFYMLALARLHQGGDGLSERLASTAMALPILVVAGLMNSSDMAKSFTVATTLAILL
FT                   LAAGAHRLPAEVPLRMPRRLWLGWYPGHFAAIALWLWVSGGLS"
FT   CDS_pept        complement(624106..626304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1542"
FT                   /product="P-type transport ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1542"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41425"
FT                   /db_xref="GOA:E1V775"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1V775"
FT                   /protein_id="CBV41425.1"
FT                   /translation="MSDAHEHGCCGGHHTEPREAVAAPADSETLRLRIQEMDCPTEEAL
FT                   LRKALTSAPGVAALEFDLMARILSIHHHDADTEALQARVRDLGMTPRPLDTDDDPSDEP
FT                   PASDDTPWGRLILAALLALAAEIVGWTPWPWTDWLAPVLALPAITLVGLPTWRKGWVAI
FT                   RHRTLNINALMSVAVTGALLIGHWSEAAMVMVLFTLAEHIESRSLERARRAIRDLLDSA
FT                   PRQARRRAPSGEWENVAAADVAIGDIVRVLPGERLPLDGEVMRGHPSLDESPITGESLP
FT                   VDKAPGDSVFAGAINHDGDFDIRTTRVASDTTLARIIHAVEQAQASQAPTQRFIDRFAA
FT                   VYTPVVFALAVLTALAWPWIAGGAWLDGIYRALVLLVIACPCALVISTPVTIVSGLSAA
FT                   ARAGILIKGGRFLEQGRRLSWLALDKTGTLTRGEPTLEHWEPLDEPSDASSREALARQA
FT                   TLLAGRSTHPVSAAIHRALAPNADDGSVDDFRELPGQGVEGRVDGQPLWLGNRRLAEAR
FT                   GLIDATLAERIETLERRGASVVALGSSERVLALFAVRDPLKPTSLAAIEALHGLGVKTL
FT                   MLSGDNRHAVSAIATEAGIDSARGELLPEDKLAIIEEHGHRGVIGMVGDGINDAPALAR
FT                   ADIGFSMGAAGSDVAIETADVALMDDDLGKLPTFLRLSRATYAVLVQNIVLALGIKAVF
FT                   MVLAFTGQATLWMAVFADLGASLLVIGNGLRLLRSRLA"
FT   CDS_pept        626396..626848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1543"
FT                   /product="MerR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1543"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41426"
FT                   /db_xref="GOA:E1V776"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011791"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E1V776"
FT                   /protein_id="CBV41426.1"
FT                   /translation="MKIGELATRTGCRVVTIRYYEREGLLPEPARSEANYRLYGETHVE
FT                   RLAFIRHCRALDMTLDEIRALLDCHDHPAQSCQRANVLIDEHLSHVEARIAQLQALEET
FT                   LVALRARCQGQRPAAECGILNALAQPPRDEPLNEDAEHVPGTHPRL"
FT   CDS_pept        627062..628081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1544"
FT                   /product="TRAP transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1544"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41427"
FT                   /db_xref="GOA:E1V777"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V777"
FT                   /protein_id="CBV41427.1"
FT                   /translation="MKKTILATSVSLALMATASQAWSDVRTLKFHSGLAESRPEAASLE
FT                   RFSELVDEYSDGQLQVDVYHAGSLGLKEADMLRIMQRGMVDMALMYGEYYNRDAPEMAS
FT                   IYAQGAITEAEQHLDILPTLRELYREGYADWGIHTIGGVVAPVFDVGLHCKEPVNSLEG
FT                   LRDKKVRVWSGHLVETFDRLGISAQVIPQNDMYLALQTGVVDCAYYLSTVAKTVSLQEV
FT                   TDYEAYLHPWAASPWMFGVSDRTWNSLDEQQQEILTRAGEEIWKETRDQAVDPEREAEA
FT                   RKEREAMGITMLPAFSDEDVQTFVDAAWEAWYEMASKAGDEGIRYYDTVTGELQSDSQ"
FT   CDS_pept        628105..628614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1545"
FT                   /product="TRAP transporter small transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1545"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41428"
FT                   /db_xref="GOA:E1V778"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V778"
FT                   /protein_id="CBV41428.1"
FT                   /translation="MRVLSTWLDRLVYGVFLIGVCGGVFMTGLVLVSTLMRYLAGSPIG
FT                   FSDELSGLLFLSLSFLSLPHVLNTSQHIRIDLLVRTFSHRLAVVADIFANAIFIAFAGI
FT                   FAYEAWDFMVFSLQIGARSEISGVLLWPWMALMPLSMLLCILIIVRNGLRGLFGRNASS
FT                   SEGGLS"
FT   CDS_pept        628611..629897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1546"
FT                   /product="TRAP transporter large transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1546"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41429"
FT                   /db_xref="GOA:E1V779"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V779"
FT                   /protein_id="CBV41429.1"
FT                   /translation="MSWAILSAGLLVFLGSGAVLGAALGLTGFILLHFQAGGASALAIN
FT                   SAWNLLTEFTLSAVPLFIFLGDILLASGVSTRVYNGLTPLFRRVPGQLLHTNIAVCTLF
FT                   GAVSGSSTSTAAAIGSVGYPELSQRGYSPRMIVGTLAAGGTLGLLIPPSLALLIYGATQ
FT                   NVSIGKLFLAGMLPGLMIAMAFFGWIMVRSSLGSSVAPPREEKMDWGAVGRGLLEVWPL
FT                   PILIFFVLGTIYMGIATPTEAAALGVTASIVLGLTWGDLDMPKLWGAFKHASMMFGAIA
FT                   MILIGTVILSQAVSLLGLPRAAVDAIAGLGLDRYGILLMIVLVYLLLGCFFDGISLLLM
FT                   TLPITFPMVTSLGFDPVWFGVIVTLLMEIGMITPPVGLNLFVLCSITRNEVTLPDAAWA
FT                   SLPYWLILLGAVGTFTAFPELILWLPNLM"
FT   CDS_pept        630072..631115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1547"
FT                   /product="PfpI/HTH domain protein (homolog to transcription
FT                   regulator CdhR)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1547"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41430"
FT                   /db_xref="GOA:E1V780"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1V780"
FT                   /protein_id="CBV41430.1"
FT                   /translation="MAKSARFDSPLISKNRAFIEVETGEAPIVDSRRIAFVLFEHFSLM
FT                   AFTGAMDALVTANLVKAPVEYEVTVVSIDGRRAMSDLGIEVAVDDSLEDLQEETLDYLI
FT                   LCGGYRLEMHATPELRVKLRAADYAGCMLGGLWNGAYFIAEAGLLDGYECAFHPDGRAM
FT                   MLEEFPAVTISSQNHVLDRDRVSCAGANSSLDMMLSIISRDCDIACISAIEEVLSCDKA
FT                   AEAIDTSVISIDRDLSLPQSLRNALELMHHNIDEPLSIGELATCVDVSRRQLERLFGRC
FT                   LETTPARYYLELRLTRARQLLQQTNKDLADIAVAAGFVSISHFRRCFSQLFGVSPGRFR
FT                   KASRQAR"
FT   CDS_pept        complement(631210..631977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1548"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1548"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41431"
FT                   /db_xref="GOA:E1V781"
FT                   /db_xref="InterPro:IPR001320"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR018313"
FT                   /db_xref="UniProtKB/TrEMBL:E1V781"
FT                   /protein_id="CBV41431.1"
FT                   /translation="MKLNKLLSIGVLGAGMIAGVANAEVRDIRIGVDVPYEPMEYRTAD
FT                   GELTGFDIELGNAMCEEIGIECEWVVQGWDGIIPGLMARKYDAIMSSMTINDKRREQVL
FT                   FSDPYFTPPSAWFAPADSEIETPDAETLEDMSIGVQRGTLQDNYVTDMYGDVADVNRYA
FT                   TADDMVLDMDSGRLDIVFLDFPVGKSTLLDSEAGDYKTVGEQITEPKQYFGDGFGIAFR
FT                   KRDEELAAAFNEALATLKENGTYAEIESKYFSE"
FT   CDS_pept        complement(632119..632850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1549"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1549"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41432"
FT                   /db_xref="GOA:E1V782"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1V782"
FT                   /protein_id="CBV41432.1"
FT                   /translation="MESLMNWLQAQLADNSIFTLQTLSYYGEGLVTTVQLVFLSLIIGL
FT                   VLAVPLAIGRGSKHAWIRLPIFFYCYVFRGTPLLVQLYLIYYGVVFVEGIQDTWLWVIL
FT                   EKPFVPALIAFTLNTGAYTTEIFRGAIKSTPKGEIEAARAYGMSRALMLRRIVLPSAFR
FT                   RALPAYGNEVIFMLHASAIASVVTIMDLTGAARFVYARFYAPFDAFLFVAAIYLCLTFT
FT                   IIYFFRHLEKRLLAHLKPASG"
FT   CDS_pept        complement(632850..633554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1550"
FT                   /product="ABC-type transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1550"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41433"
FT                   /db_xref="GOA:E1V783"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E1V783"
FT                   /protein_id="CBV41433.1"
FT                   /translation="MIDLHGYGPRLAEGALVTVELAVLSLILAVVLGLITASAKMSRNW
FT                   LLHRLGTLYTTLIRGVPDLVLMMLLFFGGQIGVNMFTDWLYARFDIDIFININEFVAGV
FT                   VTIGLIFGAYMGETFRGAFLAVDNGQIEAGRAYGMSHWLVFRRIRFPQMMRHALPGLSN
FT                   NWMVLLKTTALVSVIGLSDMVRVAAEASKATREPFTFMIIVAIVYLLIASVSEWGFARL
FT                   QKRYDIGYGEAD"
FT   CDS_pept        complement(633579..634349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1551"
FT                   /product="ABC-type transport system ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1551"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41434"
FT                   /db_xref="GOA:E1V784"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:E1V784"
FT                   /protein_id="CBV41434.1"
FT                   /translation="MADTPIPLEVRNITKRFGDTEVLKGLSLQAHKGDVITLIGASGSG
FT                   KSTFLRCMNLLEQPNEGELIVHGESIRFKETRHGREPADWKQVVDMRAKLSMVFQSFNL
FT                   WAHMTLLENVIEAPVHVLGKSKREAIEHARQLLERVGLADRADYYPAQLSGGQQQRGAI
FT                   ARALAMDPEVMLFDEPTSALDPELVGDVLKVMRDLAEEGRTMIVVTHEMAFARDVSTQV
FT                   IYLHQGQVEEAGPPDQVLGNPTSERLKQFLAPKH"
FT   CDS_pept        complement(634582..635571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aruE"
FT                   /locus_tag="HELO_1552"
FT                   /product="succinylglutamate desuccinylase"
FT                   /EC_number="3.5.1.96"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1552"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41435"
FT                   /db_xref="GOA:E1V785"
FT                   /db_xref="InterPro:IPR007036"
FT                   /db_xref="InterPro:IPR016681"
FT                   /db_xref="UniProtKB/TrEMBL:E1V785"
FT                   /protein_id="CBV41435.1"
FT                   /translation="MLADWLERSLDGSVSAPVQGDIPGGRFRVLGPGLLELTPTADETR
FT                   TPAVVLSAGIHGNETAPIELLGASLARLEAGLLRLGSPVLVILGNLEAIRAGTRFVNTN
FT                   LNRLFRRDLAEDGMEPDRARQLMEAVDTFYVRHPGRTRLHYDLHTAIRDSQYPRFAVEP
FT                   FADAVTTPEQWQWLAGADIQAVLHQHDHSWTFSHYGKHYHGAQAFTLELGRALPFGAND
FT                   LAPLAPMGQLLDALLEGREPASASPSRMAFFRVEHELFRHAEAFRLCFPDDTPNFTEFA
FT                   PGTRLAEDAEAGPFTVGDTPLRVVFPNARVELGARAALLVTPVPDEET"
FT   CDS_pept        complement(635788..636807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnl"
FT                   /locus_tag="HELO_1553"
FT                   /product="gluconolactonase"
FT                   /EC_number="3.1.1.17"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1553"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41436"
FT                   /db_xref="GOA:E1V786"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:E1V786"
FT                   /protein_id="CBV41436.1"
FT                   /translation="MTLERRQFLTASVALGAAAAAPNLLAGNTAPSRYPDSTWQVIDER
FT                   FERYMLFNTPLERQWTGGLWLEGPAWNAVGRYAVFSDIPRARQMRWDETTGEVSVLRHK
FT                   VGHSNGHTFDNRGRLIACEHSPARVVRYEWDGSMSVLAERYDDKPLNAPNDVVALESGG
FT                   LIFTDPGYGAHIDYEGQRRELQLDTAVYYWEDGMAEPKVLTTELYKPNGIALGPDGRSL
FT                   YVTDTAPSHHPDQPATITRFTLTEDGKALNNTKRLVESREEGYDGLTCDADGNLWVGTS
FT                   GGEGIDGVSVFAPDGTLIGRVLLPEICANVCFTGEDRNRLLMTASQSIYTLYTAARGA"
FT   CDS_pept        636980..637900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1554"
FT                   /product="probable S-adenosylmethionine-dependent
FT                   methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1554"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41437"
FT                   /db_xref="GOA:E1V787"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1V787"
FT                   /protein_id="CBV41437.1"
FT                   /translation="MAHGDYGGDGGIERPRARVSTDAGRLARHYTGAGDAEGASGEALV
FT                   ERLRRAFIDSGRNPDRLALDDIAGIDQLHLGGRRASRSLARLGEFSPGVRVLDVGCGTG
FT                   GASRLLAEEYDAKVIGIDITASFVEIAGWLSRATGLATRTRFCCADAARAPLPEACVDV
FT                   VWCQHALMNMPDTTAVLAEWRRLLAPGGSVLLHEVVAGDNPAALTLPVPWARERATSHL
FT                   QTRSALEQKLQTAGFRPCKIADVTAEALAWRRKHARREPQHQATPALPGPASLFGDGFS
FT                   EMGRNLLDNLADDRVRIIEGAWSRP"
FT   CDS_pept        complement(637906..638844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhpA"
FT                   /locus_tag="HELO_1555"
FT                   /product="4-hydroxyproline epimerase"
FT                   /EC_number="5.1.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1555"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41438"
FT                   /db_xref="GOA:E1V788"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniProtKB/TrEMBL:E1V788"
FT                   /protein_id="CBV41438.1"
FT                   /translation="MKRIQVIDSHTGGEPTRLVLEGFPDLGAGSLREKLERLRGEHDRW
FT                   RTACMLEPRGHDVLVGALLCEPETPEATCGVIFFNNSGYLGMCGHGTIGLVASLAHHGR
FT                   LAPGLHHIDTPVGAIEAQLHEDGSVTVRNVPAYRYRRAVPLEVPGHGRVHGDIAWGGNW
FT                   FFLVSDHGQRLELDNTDALTDFTWAIRQALETRGITGEDGGEIDHIELFADDPDADSRN
FT                   FVLCPGKAYDRSPCGTGTSAKLACLAADGKLAPGQSWRQASITGSEFVAHYEPEGERIR
FT                   PYLRGRAHISAEASLIIDETDPFAWGIAADA"
FT   CDS_pept        638968..640296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1556"
FT                   /product="D-hydroxyproline dehydrogenase"
FT                   /EC_number="1.5.99.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1556"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41439"
FT                   /db_xref="GOA:E1V789"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1V789"
FT                   /protein_id="CBV41439.1"
FT                   /translation="MTQASPDPKASSPTRAAADTGLDDADIAVVGAGVVGTACALELAR
FT                   QGLRVRVLDSDAPGMGASFGNAGHLATEQVFPIADASLLKRIPGMLMDPQGPLRLDWRY
FT                   LPKATPWLMRLLWNLRSSPYRHSVAGIRALNEASLAAWQELLSSIGRLDLLCGHGSLLV
FT                   HEKAETADALEASAARFAAQGVALERLSGEEVHRRVPELSERIRGGLFFPETGHVIDPH
FT                   RVVQALVEAAEAAGVRFSRAVVQGGQADAGGVRLETSQGRLTVPRVLVAAGAHSAPLVT
FT                   ALTGVRVPLDTERGYHLMLPREVERLPMAVTSLERRFIMTPMAEGLRLAGTVEFAGLER
FT                   PPRMERAWRLRELAQGMFSRHLDETDATPWMGFRPSLPDSLPVIDRTGPEGRVWLAFGH
FT                   HHLGLTQAAITARLVGRFSSPERESTEMALPSLAPYRLARFAR"
FT   CDS_pept        640360..641793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mleN"
FT                   /locus_tag="HELO_1557"
FT                   /product="NhaC family malate/lactate antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1557"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41440"
FT                   /db_xref="GOA:E1V790"
FT                   /db_xref="InterPro:IPR004770"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="UniProtKB/TrEMBL:E1V790"
FT                   /protein_id="CBV41440.1"
FT                   /translation="MNEQQAGGRLPSMGEVGAVMVGFIAIMFLFINVFELPIQLALFTS
FT                   WFLVMALGVKLKLSYETMQKGLIDGIHNGMEAVLVLITVGALIGTWIAGGIVPSIIYYG
FT                   LSVMSPQIFLCAAFIICAITSLSTGTSFGTAGTAGVAMIGIGHSFGIPLPLVAGAVISG
FT                   AYVGDKMSPLSDTTVMTASLCRVKLVDHIRSMSLVSGPAALIAALLFLVVGFFYVGDDV
FT                   DTQRADMAMQALQSHFTINGWLLLPAVVVIGLLIRRYPAIPVITFGAVMGIVCAWLAQD
FT                   VALLDAMRTAYVGNAMQSDVDFLNTLLNRGGIESMLGVIALILFALGLGGLMERVGVLQ
FT                   AISNSFLRWADNAGRLTLSTMLGGFFGNFFGGAAYVSLITASTITEKNYDKQGIDRRVL
FT                   SRNAEAGGTITTPMVPWTDGGVFMAMTLGVSTLSYLPFLWYHMLVLLITLFYGYANIAI
FT                   WRTGEPQEDTAVPGVAMKS"
FT   CDS_pept        641979..643031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1558"
FT                   /product="TRAP transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1558"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41441"
FT                   /db_xref="GOA:E1V791"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR026289"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1V791"
FT                   /protein_id="CBV41441.1"
FT                   /translation="MKTMTWFSTALVTAAFASQTLAADIEWRVPTSVPDGSPFFENFLE
FT                   RFADNTALLTEGRVEIQPFGAGVIVPALQVYDAVKEGTVDAGHSTPSYLVNQNPVNAIF
FT                   AGFPGGMGPQAYINWIYEGGGQEKLQELRASEGLHSLIVGIGSTEIFAHSNVPINGPED
FT                   LKGLKYRTSGPWAEVMREYYDAVPTVVPPGDTYTLLQRKGVDAVEWATPSSNQLEGFHE
FT                   AARYIVVPGVHQPTFLWEVVVRQETWDQLPDDLKPLLEAAAKLTTYEGLGNFYHQDLLA
FT                   MEEYRAGKNEVISLDEEFIKELSDNGRAWVAERAEEASQSGDSRMAEILEEYQAYQQRW
FT                   NAQKDYLITD"
FT   CDS_pept        643096..643599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1558A"
FT                   /product="TRAP transporter small transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1558_A"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41442"
FT                   /db_xref="GOA:E1V792"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:E1V792"
FT                   /protein_id="CBV41442.1"
FT                   /translation="MIFKLIDRLSSLSAWLSKAALIVLSVAMLYEVVARYVFNASTIWA
FT                   FDVSYMATGIAFMFGVAWTAKVDGHVRVDVFSSMMPPRLFRLINGVVYTLLMFPVLSLM
FT                   AWHGWKKTVNAFLSGEVEMVSIWAPKMWPFYSCIAFGLSLLALQVLVIGLRSLMNENTC
FT                   RETI"
FT   CDS_pept        643599..644918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1559"
FT                   /product="TRAP transporter large transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1559"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41443"
FT                   /db_xref="GOA:E1V793"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1V793"
FT                   /protein_id="CBV41443.1"
FT                   /translation="MDATVAALMFPGLFLLIFLGIPIAFALTIVSVFAGWFAFGPMVFQ
FT                   QLYGSVFSAASHYVLSSIPLFVLMGAILEKSGIARNLFDAIQIWIGRLPGGLALTTIAM
FT                   AAIFAAASGVVGAVEIMIGLMAIPAMRAYKYNNTLITGTICAGGSLGTIIPPTVIVVVY
FT                   AALAQLSIGALFAAIIVPGLLMLSLFALYIVGRCLLRPQDGPAAVASGDDLPLSEKIGI
FT                   TLKALIPPLLLMFAVLGSLLGGIASPTEAAAVGVAGAVVLAAINGGISFGAMVESFSLT
FT                   VRITAMILLIVAGGTMFTGIFAVNGGGDMVADIAAGLGGGTTGVILFFLGVTFLLGFVL
FT                   DWTSIVLICVPIFTPIVKQMGIDPIWFATLVLVTIQTSYLTPPMASSIFYLKSIAPKDI
FT                   TYGQMCRGVLPFIAVQLLTLLLVALFPATATWLPDRIVGF"
FT   CDS_pept        645049..646632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1560"
FT                   /product="alkaline phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1560"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41444"
FT                   /db_xref="GOA:E1V794"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="InterPro:IPR042085"
FT                   /db_xref="UniProtKB/TrEMBL:E1V794"
FT                   /protein_id="CBV41444.1"
FT                   /translation="MTFCMKQKTAVGPLVGGMLLASVAAPASAAEVKNVILMIGDGMGP
FT                   QQVGLLETYANQAPDSIYDGEPTAFHQLAKEGVVGFSLTHPEDAVVVDSACSATQLASG
FT                   IYSGSEVIGIDAEGNPVETVLELAQARGKATGLVSDTRLTHATPAAFAAHQPHRSLENE
FT                   IAVDMLEVGPDVMLSGGLRHWVPQLASEDAEVTSLMDGAYEPASKRQDDRNLLAEAVEK
FT                   GYGLAFSREQLEADQSDKLLGLFANSGMADGIEYRNTRDDADRLEPTLHEMTQAALNRL
FT                   EQDEDGFFLMVEGGQIDWAGHSNDAGTMLNEMVKFEEAVQGVYDWAKGREDTVILVTAD
FT                   HETGAFGLSYSSADLPEPQSKSGPAFAERDYAPNFNFGDFALLDSLYQQKASFSTLLSE
FT                   FGALEEEQRTPARLMEMVNANSDFQIDEEQAEAVLADKPNPYHVEGHSYLEAEEVPAIQ
FT                   DFDAFYPYNDRGNVLGRVLGTAQNVVWGTGTHTHTPVNVFAWGPAETILPVSSIQHHSE
FT                   VGQYLKSLVE"
FT   CDS_pept        complement(646701..647384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1561"
FT                   /product="GntR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1561"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41445"
FT                   /db_xref="GOA:E1V795"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V795"
FT                   /protein_id="CBV41445.1"
FT                   /translation="MAYKTRAQFVADDIRHRILNGEFPGGTQLRQDALAADYDVSRIPV
FT                   REALLTLEAEGLVEFYPHRGAFTTELSVAKIRELFDLRVLLESHLLRHAIPLMTESALH
FT                   KAERILLEYDAALDSGSQIDNWSDYNFAFHEALYSPADLPEAMNLVSQLNTKSDRYIRM
FT                   QLLYTREIEKAEREHHDLLEFSRQGNADAACQLLERHILEACEGIVAVLEGRVQASQTP
FT                   DTAQL"
FT   CDS_pept        647637..648590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lhpC"
FT                   /locus_tag="HELO_1562"
FT                   /product="1-pyrroline-4-hydroxy-2-carboxylate deaminase"
FT                   /EC_number="3.5.4.22"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1562"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41446"
FT                   /db_xref="GOA:E1V796"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1V796"
FT                   /protein_id="CBV41446.1"
FT                   /translation="MTNDNIFTGCIPALMTPCTPERKPDYDALVAKGRELIDIGMSAVV
FT                   YCGSMGDWPLLSEAERQEGVARLVAAGIPTIVGTGAVNSREAVSHATHAAEVGAQGLMV
FT                   IPRVLSRGTSAVAQKAHFSAILKAAPNLPAVIYNSPYYGFATRADLFFALREEHPNLIG
FT                   FKEFGGADDLRYAAENITSQDDDVTLMVGVDTTVVHGFVNCGATGAITGIGNALPREVL
FT                   HLVSLSKQAARGDVKARRQAQELDAALGVLSSFDEGPDLVLYYKHLMVLNGEREYALHF
FT                   NESDALSDAQRNYVEAQYALFREWYAQWSADIRDGH"
FT   CDS_pept        648622..650199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1563"
FT                   /product="2-ketoglutarate semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.26"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1563"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41447"
FT                   /db_xref="GOA:E1V797"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:E1V797"
FT                   /protein_id="CBV41447.1"
FT                   /translation="MTLEGKLLIGQQAIEGSRAAIQAINPATGERLEPGYPGGTQDDVE
FT                   RACELAWTAFDTYRETSLEARAGFLEAVADEIEAIGDALIERAVAETGLPRARIQGERG
FT                   RTCGQLRLFARTVRAGEWLDVRVDPALPDRQPLPRADLRQRHVALGPVVVFGASNFPLA
FT                   FSVAGGDTASALAAGCPVIVKAHSAHPGTSELVGRAIQAAVKKCDLPEGVFSLLFGSGR
FT                   EVGQALVTDPRIKAAGFTGSRSGGLALWQAAQSRPEPIPFYAEMSSINPVFLLPAALEA
FT                   RGKALGEAFAGSLNMGAGQFCTNPGLVLAIKGPALDDFVAAAGEAVAASAAQTMLTPGI
FT                   FEAYESGVAALADSDRVREIARGQKGEGPNQCRTGLFATSAEDFLASETLQAEVFGPTS
FT                   LVVECSDAAELARVAEHLEGQLTATLQMDDADLDAARALLPTLERKAGRILVNGWPTGV
FT                   EVCDAMVHGGPFPATSDSRTTSVGTAAIFRFLRPVCYQDMPDALLPDALKAHNPQGLDR
FT                   LVDGRREG"
FT   CDS_pept        complement(650229..651302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmlA"
FT                   /locus_tag="HELO_1564"
FT                   /product="D-malate dehydrogenase (decarboxylating)"
FT                   /EC_number="1.1.1.83"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1564"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41448"
FT                   /db_xref="GOA:E1V798"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:E1V798"
FT                   /protein_id="CBV41448.1"
FT                   /translation="MTHRIAIIPGDGIGTEVTPEGQRALEAAARRFDIALDFETFDFAS
FT                   CDYYLEHGRMLPEDWRHTLGEFDALFFGAVGWPEKVPDHVSLWGSLLQFRREFDQYVNL
FT                   RPCRLLPGIKSPLAGRKPGDIDFYVVRENTEGEYSSVGGTMFEGTDREVVIQETVMTRT
FT                   GVDRVLKYAFDLAASRPRKKLTSATKSNGIAITMPWWDKRVAAAAEGYPEVSVDQFHID
FT                   ILTANFVLHPDWFDVVVASNLFGDILSDLGPACTGTIGVAPSANINPEGRFPSLFEPVH
FT                   GSAPDIAGRGIANPIGQIWSGAMMLEHLGHPEAGRTMLAAIEAVLEEGDERLLTPDLGG
FT                   QGSTEALGRAIAERIAG"
FT   CDS_pept        651453..652403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1565"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1565"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41449"
FT                   /db_xref="GOA:E1V799"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V799"
FT                   /protein_id="CBV41449.1"
FT                   /translation="MAQLDDLAFFQHLARAGSLTATARELGLSLSAVSKRLKQLEARLG
FT                   VSLASRTTRRLTLTAEGELYLSRGATILDELGELEETLGDHRAELSGPLRINATFGFGR
FT                   QHVAPLFSAFCRRNPRIEGSLELTNFPASLFDQGFDIGIRVGEPPDSRLVARRILANRR
FT                   VLCAAPSYVATMPPLRDPRDLPSHPCLVIRENGSDYAVWRFQRRDAPDEERAVKVAGPM
FT                   ASNDGEVIRRLARDGHGVALRSWWDVHDDLAAGRLVELLPMWRGVRADFHAVYHQRRHV
FT                   PLRIRAFIAYLEREMAGRVPSRVPPRSVMTGESPQ"
FT   CDS_pept        652400..653725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1566"
FT                   /product="probable glycosyltransferase, type 1"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1566"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41450"
FT                   /db_xref="GOA:E1V7A0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A0"
FT                   /protein_id="CBV41450.1"
FT                   /translation="MNVLMFTNTYQPIVGGVSESVQRLKRQLCMAGHRVLVVAPRLEGQ
FT                   PENETDVVRVAAVQHFNGSDFSLPVPMPGQLYEAIEDFEPDIVHSHHPFLLGDTAARAA
FT                   ETYGLPLVFTHHTLYEHYTHYVPGDSPRMQRFAIALATQYSWLCDSVIAPSESIRDLLL
FT                   EREANSAIRVVPSGVDTARFALGNGEDCRRRMGIPADAYVIGHLGRLAREKNLPFLAEA
FT                   VSLALLERPDAHFLIVGDGDAAEAMREIAEEQGVAERFHFTGRLQGRALIDAYHAMDVF
FT                   AFASHSETQGMVVAEAMAAGLPVVAVAAPGVVEVVVDGDNGRLLPEDDAEALARALCEL
FT                   ADERCREPLRRHALETAANYDERRCAERCLAVYREVIARGGPFTHADDGGWDRVRGRLG
FT                   AEWQMLRYRGRLLRHLVQEEWEQERPSWWPKGRHDEPGVPSK"
FT   CDS_pept        complement(653732..654409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1567"
FT                   /product="YdjX family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1567"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41451"
FT                   /db_xref="GOA:E1V7A1"
FT                   /db_xref="InterPro:IPR015414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A1"
FT                   /protein_id="CBV41451.2"
FT                   /translation="MSRPLSILFIILLALVSLGLLWQWLAMQDLLTVDSLMALVQGSVA
FT                   WRDTSWAVLVVIAVYAGASLVMFPLSLLVALTGLLFGPWWGFAYALAGTLAASVLTWWI
FT                   GRRLGRDALLRHGGKHLKGLSRYLSGRGIRTMTVVNLLPLAPFTLTNMMAGAFHLRFRD
FT                   YMIGSTLGIVPGLVGVTLLGSQLGELVTAESSQEVIFSLLGLVAGVGVLYGLKRWAEKR
FT                   RRC"
FT   CDS_pept        complement(654494..655432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1568"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1568"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41452"
FT                   /db_xref="GOA:E1V7A2"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A2"
FT                   /protein_id="CBV41452.1"
FT                   /translation="MRVRSTSALLSLPLALGLAAPALADDATLDFGVPAWPGITVKTEI
FT                   AAQLLEPLGYETRAEELGMQVVYQGLDSGDLDVFLGGWLPAQNSIYTPLEESGAITPLA
FT                   NNVDGARMTLAVPEYLYEQGIQSFADLDANRDSFEGKIFGFGAGSAASEILNEAIDNDT
FT                   WGLGDWQLVDTSVVGMLTAARDAISREEPIVWVGWTPHWMNLEMDMRYLDDPQDLFGEN
FT                   NGASQVLSVARSDYAEAHPNLVDFFANFTFSAEEQSWMIREFGQKERGVEAVAQQWLRE
FT                   HPERVQAMLEGVTTRDGDPAWPAVEKALASR"
FT   CDS_pept        complement(655498..656679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1569"
FT                   /product="gamma-butyrobetaine dioxygenase"
FT                   /EC_number="1.14.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1569"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41453"
FT                   /db_xref="GOA:E1V7A3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A3"
FT                   /protein_id="CBV41453.1"
FT                   /translation="MTTATPSEARHTRVIWPMSELTDHSGEHALVDALTSGARVTLTWE
FT                   DRQQAHFPLSWLRDHCPCTECRHTTTRERLYIPLELPDSAPEARLEDGNLELTWADGHI
FT                   SRFDAGWLRQRRPGQESGDHVPARRPWAEDFQPVRVDHADFVAGAAGERAWLTALLRDG
FT                   LVLLENGPLADEEVSRLAERIGPLRATNFGARFDVRSKPNPNNAAYTAIGLPLHTDLPN
FT                   WRQPPDIQLLYCLENDAEGGESTFTDGFAAAEALRERSPESFRLLSETPIDFRFQDEEH
FT                   DIAWRAPILTLDHDGQLLEVRFNNWIRDSLCLPLEKADAWYRAYREFWNLVHDPRQRLE
FT                   FSLLPGQMIAFDNRRVLHGRNAFDPNSGRRHLQGTYLDLDLLESRLRVLARSA"
FT   CDS_pept        656805..657677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1570"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1570"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41454"
FT                   /db_xref="GOA:E1V7A4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A4"
FT                   /protein_id="CBV41454.1"
FT                   /translation="MAGLPPLGWLQAFEAAARTLSFTAAGHELGVTQAAISQRIRLLED
FT                   RLGQKLFVRHPRSLSLTPAGQAWLPSIQDAFMRLGEGTSEVFGGAVGDAQVTLRTTPVI
FT                   QQNWLAPRLPAFQRAHPEIAVRLVSAIWPDDFGPEGADIEIRYGRGDWQGVDAVSLGEE
FT                   SMLPACSPALAREIAEPSDLAGHTLLHAVGFAVGWPTWLEQAGQPGLEAQCPSLTCDSQ
FT                   VMTLALAGQGGGVALTHRRLLEGRDDLVAPLALAVPSDEGFWLVRPARRRPREEAARLW
FT                   EWLVARLSS"
FT   CDS_pept        658274..658714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1571"
FT                   /product="DUF411 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1571"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41455"
FT                   /db_xref="InterPro:IPR007332"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A5"
FT                   /protein_id="CBV41455.1"
FT                   /translation="MNRRIASLMLSSALLAGPSLAHAALPDAATLYKNPQCGCCDDYAR
FT                   HLEEMGVDVTIVDDADLNEIKSAAGVPYGLGACHTIEMGNYWIEGHVPMEALEALYEQR
FT                   PDADGIGLAGMPIGTPGMPGQKQDDWDVYRFTDGESAPFMTL"
FT   CDS_pept        658872..660011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1572"
FT                   /product="probable glycosyltransferase, type 9"
FT                   /EC_number="2.4.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1572"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41456"
FT                   /db_xref="GOA:E1V7A6"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A6"
FT                   /protein_id="CBV41456.1"
FT                   /translation="MYLLTAIRRNERMRRLGKTLERSAKAWCFRLLSRRGGNARAAGPE
FT                   TLKGVQRVLLVRPNFRIGNAVIGARFIQALTESRADIEIDYLGADTTRALFEGMPLARY
FT                   HALSRSMPLRPWRLLQLLMRLRRRDYDLAIQVGEGSLTSWLCMRLCGARRTLGQRGRLE
FT                   ASYDWVGDVSRGHAYEWGSALAASLGLAWEPRPWMVISARERAAAASLAGAGDSTSPVG
FT                   IFVGGHLDKRFPFSFWQALLGELERRRQPYLVLLGPEEEAGRARLEQACGFHGRVVPAV
FT                   SLRCCAALLANLSRLITPDTGPMHMAVALGVPVVALLNVDGSRKFTPRGPEDRVLFRPA
FT                   PARVAELVSPGARRERSHDAVKALPCRPSAPMDAEVGLT"
FT   CDS_pept        660008..661720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1573"
FT                   /product="EptA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1573"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41457"
FT                   /db_xref="GOA:E1V7A7"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012549"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR040423"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A7"
FT                   /protein_id="CBV41457.1"
FT                   /translation="MKRPLGVFGHAGGGPLAKWWAVRERLPALSPQALTLAACLAFTLF
FT                   YNGRFWSSTFGAQPVASLADWARLLSDGVLMTALQFVVVVPWINRFSVRPLLSILLLMA
FT                   AAISYFTGHYGTYFDTHMIDNVLQTDTREADELLTSGLALHLLLYAGLPIWVVWFWPLR
FT                   RRTWRRGLAMSLLWLAGGVGVSIVALLISFQSLSSLMRNHHELRYLVTPGNAIVSTERV
FT                   MTAEEPLPEERLPVGEDAHRLASGTDKPRLLVLVVGESVRAADWGLSGYSRQTTPRLAK
FT                   RDVLNVGEVTSCGTSTAVSLPCMFSPIGKADYDERYIRSHESLLDVLQRAGYRVMWIDN
FT                   QSGCKGVCRGVEQYAPAPDAYPSLCDGDTCLDGVLVEELKKRIASLNSDTVIVLHQLGN
FT                   HGPSYYRRYPDAFRAFTPACDKADLAECSREAIVNSYDNAVLYTDSVLDQLIGVLERHA
FT                   SMASALLYVSDHGESLGENGIYLHGLPYAIAPEEQTRVPMIWWSSPAFERSVGLQRDCL
FT                   ARHAAQGLSHDHLFHSLLGLLGVESRSRDPRLDISQGCRGAVSAEPAGRLSKP"
FT   CDS_pept        661779..662057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1574"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1574"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41458"
FT                   /db_xref="GOA:E1V7A8"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A8"
FT                   /protein_id="CBV41458.1"
FT                   /translation="MRTLAMGTRDSWLTKESWQVGVLVLVGTLLLAAGQWGPGWSLVDL
FT                   PLGLASLGAVAVVLVAPGMTHPEELLESTNSLLLSSLATLTGFHLFA"
FT   CDS_pept        662145..662807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1575"
FT                   /product="response regulator/HTH domain transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1575"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41459"
FT                   /db_xref="GOA:E1V7A9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7A9"
FT                   /protein_id="CBV41459.1"
FT                   /translation="MRVLLVEDDPLLGDGIRTALQREGYAVDWLETGRDGIAAIRHDDF
FT                   SAVILDLGLPDIDGMEVLDKIRHAGSLPVLILTARDAVESRISGLDGGADDYVLKPFDL
FT                   QELLARLRVIMRRAEGRSSRLLEVGELCIDEARHRVSWQGNDISLTRREYALLLELARH
FT                   PGRVMTRPHLEDLLYGWEDEVASNAVEVHVHHLRKKLDRHLIATVRGVGYRLDTASE"
FT   CDS_pept        662804..664204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1576"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1576"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41460"
FT                   /db_xref="GOA:E1V7B0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B0"
FT                   /protein_id="CBV41460.1"
FT                   /translation="MTSIRRYLTRTMALVIAGATLLVVTAAYLITAHETEEILDAQLSL
FT                   QSRVVAGLMEGDTSTETYRRIAERLTQPGHFARFYQDGQPLSDVDSANAELYHHEERKL
FT                   SVGFWHQDGSPLLMGAVWSDAGPFPAPEEEGYAWVDYGGEKWRVFSMFDESSRTWIRSG
FT                   VKASFMQELERKVTLGNFVPMLLALPILLLAMGWIVRRGLRPIGSLSRQVASRGERELA
FT                   FLDVEVPRELTGLRKAINEFIARLRETLERERRFTADAAHELRTPLAGLKIHLDNARSG
FT                   ERDSLEKAYQGVERLQRVVEQLLTLARLDRRENRQAQTLDLYPLVLEMVAELWPWAESR
FT                   DQQVTVKGVQALPIRADAAEAGILVRNLLDNALRYTPASGRVEIELSEVDDSAVLRVRD
FT                   TGPGISDDLLDTVTERFRRGTDQRTTGSGLGLSIVAELVERQGARLTLDNRQPHGLEVC
FT                   LAWPRADD"
FT   CDS_pept        complement(664216..665037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1577"
FT                   /product="MtfA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1577"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41461"
FT                   /db_xref="GOA:E1V7B1"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B1"
FT                   /protein_id="CBV41461.1"
FT                   /translation="MLQRLRRWRAARFEARHPFPEHDWREARARLPLLAALPADLADRL
FT                   GHRAWRFVHDKRLSLHPDLVAEHVEFDAPARLALAAQACLLTLGWNERDHRDALAGVHE
FT                   ILILPEAFHRRVEEMDEFGVMHEYDDERAGETSHQGPVVVAYPDLMASGGLNGFNVLIH
FT                   ELSHKLDMGNSLDADGYPPLSGDMAPQEWHRTFSAVWDDLQARLARGEATPIDDYAASH
FT                   PGECFAVSCEYFFTAPRILHEAYPALYDLLSRYFRQDPLSCHTGTAPADRT"
FT   CDS_pept        complement(665042..666619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1578"
FT                   /product="GNAT family acetyltransferase / carbon-nitrogen
FT                   hydrolase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1578"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41462"
FT                   /db_xref="GOA:E1V7B2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B2"
FT                   /protein_id="CBV41462.1"
FT                   /translation="MSLDDLHLNLRNLTPDDYPQLKTLMDAVYDDLGGAWPEHTMERLI
FT                   EEFPDGQIGIEDDGRLVGVALTVRVDYDDFSNPHQYDDLIGQREIILNDAEGDAMYGLD
FT                   VLIHPAYRGYRLGRRLYEARKELCRSMNLRAILAGGRIPQYHQYADELSPTEYIDKVAR
FT                   KEIHDPILSFQLANDFQVKRLLRKYLPEDEKSQGYATLLEWNNILFEPAERVLETRRTQ
FT                   VRVGAVQWQMREFASVEAVLQQVEYFVDALADYQSDFAVFPELFNAPLMGLQDRAAQQD
FT                   QLAAIRFLAGFTERFKTELSRMAVSYNINIVAGSMIEVAEDDHLYNVAYLCHRDGTVER
FT                   QAKLHITPQERRDWVIEGGEELQVFETDAGRVGIQICYDVEFPELSRLLADQDMDILFV
FT                   PFWTDTKNGYLRVRHCAQARAIENECYVVLCGSVGNVPSIENLDVQYAQSSVFSPSDFS
FT                   FPHDAVLAETTPNTEMIMFSDLDLNRLKVVRNEGSVTNLKDRRQDLFDLRWRDWSWKSG
FT                   GRTGVEEG"
FT   CDS_pept        complement(666690..667610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1579"
FT                   /product="DMT superfamily transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1579"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41463"
FT                   /db_xref="GOA:E1V7B3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B3"
FT                   /protein_id="CBV41463.1"
FT                   /translation="MPLLLFLPPLGAVLIWSGNMTINQLTVGAIAPSSIAFLRWLLALA
FT                   VLTPFVAPAAWRYRDTLRREWPKLAVLGLLGMGLWQGLAYVAAETTSATNMGILAAMVP
FT                   LLTVLLSALILREPPSVGGILGGLFALCGVALLLGHGNPLSLLELEIASGDALMLVAAT
FT                   CYALYGVMLKRWPLELPPWVLLYGQVICAVLILLPPYLLGPMTPVTSSNAGLIAYAGIP
FT                   ASIVTTYLWMLAIRRIGASRASIFINLMPLFSALIAMAVLGERLALFHVFGGALVLAGV
FT                   IMAQTLTSPLGRTAPAPNDAPGRRP"
FT   CDS_pept        complement(667718..669367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betG"
FT                   /locus_tag="HELO_1580"
FT                   /product="BCC family transport protein BetG (substrate
FT                   glycine-betaine)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1580"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41464"
FT                   /db_xref="GOA:E1V7B4"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="InterPro:IPR018093"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B4"
FT                   /protein_id="CBV41464.1"
FT                   /translation="MSIPSDPTPPAVTSDMQTDYVVGQDNIQGRLGPFGFDIHNRVFVV
FT                   SALASIIFIVLTLLFPQQAGSIFQSIVSFSTGTLDSYFMIVVDGFILFCLALVVLPYGK
FT                   VRLGGPDARPDHGYLSWFAMLFAAGIGIGLLFFGVLEPVYHANVSLPLGIASPFGADGA
FT                   LNPNAIADATAMGLAGTYLHWGIHGWAVYVVMALALSIFTYNKGLPFSIRSAFFPILGE
FT                   RVWGWWGHAIDILAVFSTLFGLATSLGLGAQQANAGMNFVFGLDVNATTQVIVIVLVTA
FT                   VALVSVWRGLEGGVKKLSEINMVMAVLFFFFVLFAGPTLAALSGFWTGLETYVTEFMPL
FT                   SAPFGREDDAYRQAWTIFYWAWWVSWAPFVGMFIARVSRGRTVREFVICVLLIPSLFIF
FT                   IWMGVFGATALDQLYANPAGSLVKEYVIDNYSPELSLFGMLNELPLSGLMSTLGIILAL
FT                   IFFVTSSDSGSLVIDTITAGGKIDAPRPQRMFWAAVEGLIAIVLLLGGGLSALQAGVTA
FT                   TAIPFSIVMILMCYSIIRALNGELRQLRRQAA"
FT   CDS_pept        complement(669563..671095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="betC"
FT                   /locus_tag="HELO_1581"
FT                   /product="choline-sulfatase"
FT                   /EC_number="3.1.6.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1581"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41465"
FT                   /db_xref="GOA:E1V7B5"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017785"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR025863"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B5"
FT                   /protein_id="CBV41465.1"
FT                   /translation="MTARQPNILFLMADQIAAPSLPFYGHPVVKTPNLSRLASEGVVFD
FT                   SAYCNSPLCAPSRFVLMAGQLPSRIGAYDNAADLPADTPTFAHYLRDAGYLTALSGKMH
FT                   FCGPDQLHGFEERLTTDIYPADYGWYVDWENFDKRPSYYHNMSSVIQAGPCVRSNQLDF
FT                   DDEVTFRAQRFLYDYARNGEQRPFCLTVSLTHPHDPYTIPREYWDRYEHDEIDMPSVPY
FT                   SRDLMDPHSQRLRYIYQLDENTLDEAQIRNARHAYYGEISYVDDQLGKVLKALEETGLD
FT                   EDTIIVFSGDHGDMLGERGLWFKMSWFERSARVPMLVHAPKRFSPGRVSQSVSTVDLLP
FT                   TFAELGNGGEAPDYAVPLDGRSLLPHLTGRGGHDEVIGEYCGEGAIAPLLMIRRGRYKF
FT                   VHSAPDPDQLFDLETDPLELTNLAELDDYRELRQEFREEVARRWNLDEFYDQVVDSQRR
FT                   RKLIARSLMKGKVTTWDHQPQFDASTQYMRNTIDLDDLEARSRFPTPDTAPA"
FT   CDS_pept        671201..672097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1582"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1582"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41466"
FT                   /db_xref="GOA:E1V7B6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B6"
FT                   /protein_id="CBV41466.1"
FT                   /translation="MSLLDRKVSPNSLRVFESAARHLSFTAAARELRSTQSAISQQIRA
FT                   LEEQLGLRLFDRVYRGVRLTEPGQSLFASVREGFSLMEKTIEQLQQRHRNPRLNILTDF
FT                   SLASYWLMPRLPAFRRDHPHIDVRIMTNQGGVDWRGQEADVAIAFCDARTLEDRPRLFH
FT                   EDVFPVCSPGFLEMHGAIEDPTRLAELPLLTLTADQGQGWLDWPSYFERLAGMAYGESS
FT                   ELIFNNYTLLIQAAIAGQGVGLGWKGLVDDLIERDMLVGLSHLRVATSCGYGLIDVDPS
FT                   DEAPAKRAFLDWVMANR"
FT   CDS_pept        complement(672121..672387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1583"
FT                   /product="zinc finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1583"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41467"
FT                   /db_xref="GOA:E1V7B7"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012783"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR020460"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B7"
FT                   /protein_id="CBV41467.1"
FT                   /translation="MAGGWAKDGGVQEQIESTVDDAVRRSRSRLPSGASLSHCEECDAP
FT                   IPEARREAVPGVRLCIDCQAERDKRDSATSAFNRRGSKDSQLR"
FT   CDS_pept        complement(672459..672860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcG"
FT                   /locus_tag="HELO_1584"
FT                   /product="HbpS family protein GlcG"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1584"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41468"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B8"
FT                   /protein_id="CBV41468.1"
FT                   /translation="MKTKAILGLAEVNTILDAAQREAEANQWTITVAVADDSGELLGLR
FT                   RLDGASPMTAMISARKARTAALSHKETQFFENMINEGRTAFLSAPLEGLLEGGVPVVID
FT                   GQVIGAVGVSGVKADQDAQVAKSGIAAVL"
FT   CDS_pept        complement(672925..674157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcF"
FT                   /locus_tag="HELO_1585"
FT                   /product="glycolate oxidase subunit GlcF"
FT                   /EC_number="1.1.99.14"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1585"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41469"
FT                   /db_xref="GOA:E1V7B9"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7B9"
FT                   /protein_id="CBV41469.1"
FT                   /translation="MQTHFTEQDLEQPHLREAERVLRTCVHCGFCNATCPTYQLLGDER
FT                   DGPRGRIYLMKTLLESRDDDHQATEETRLHLDRCLSCRNCETTCPSGVEYHKLLDIGRA
FT                   EIERRVPRKAGERALRFGLRKALVDPRRFRALLKLGLTFKPVVPGTLKQKLPATPVDAG
FT                   IRPEGRDHERQMLILEGCVQPSLSPNTNAATARVLDRLGIGLTPAPEAGCCGAVDFHLD
FT                   AQDAGRDRARANIDAWWPHIEAGCEAIVQTASGCGAFVKEYGEMLAHDPAYADKAARVS
FT                   ALARDLVEILEDEPLDGLSLENNGRLAFHCPCTLQHAQRLGGHVEGLLARLGFQLTPVR
FT                   DAHLCCGSAGTYSITQPTLATQLRDNKLDALEEGRPDVIATANIGCQSHLAGADRTPVR
FT                   HWIELVDEALS"
FT   CDS_pept        complement(674159..675253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcE"
FT                   /locus_tag="HELO_1586"
FT                   /product="glycolate oxidase subunit GlcE"
FT                   /EC_number="1.1.99.14"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1586"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41470"
FT                   /db_xref="GOA:E1V7C0"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C0"
FT                   /protein_id="CBV41470.1"
FT                   /translation="MASQHHSLPDRDISEALGERIRRADAEGTPLRIVGGDTKAFHGRP
FT                   VTGETLSTREHCGITRYDPVELIVSVRAGTPLAELEARLDEQGQRLPFEPPHFGDTATV
FT                   GGMVASGLSGPRRPWAGSVRDFVLGIRLIDRHGESLRFGGEVMKNVAGYDLSRLMVGAQ
FT                   GSLGLLAEVSLKVLPKPAAQRSLRLEMPLAEARRRLVEWGQKPLPITAATWFDGALHIR
FT                   LEGGPGSVEATGQRLGGDALDDAFWASLREQHLDFFTRQDDPRSLWRLSLPQQAPAPEL
FT                   EDVDEATMLHDWAGAQRWLRSAAPDESVHAEAVRLGGHATRWTAGTDSPFTPLSPVLAK
FT                   YHRRLKAELDPNGIFNPGRLYAEL"
FT   CDS_pept        complement(675263..676762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glcD"
FT                   /locus_tag="HELO_1587"
FT                   /product="glycolate oxidase subunit GlcD"
FT                   /EC_number="1.1.99.14"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1587"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41471"
FT                   /db_xref="GOA:E1V7C1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C1"
FT                   /protein_id="CBV41471.1"
FT                   /translation="MNLLFDERLDGELPRRDKAEVLAELQTALPGMTLLHREEDLRPFE
FT                   CDGLAAYRVLPMLVALPSDLDQVVTLMRRCHELGVPVVTRGAGTGLSGGALPLERGVLL
FT                   VMSRFQRILSIDPEARIARVQPGVRNLAISEAAAPHGLYYAPDPSSQIACSIGGNVAEN
FT                   AGGVHCLKYGLTVHNVLALEIVTLEGERMRLGGEALDAPGFDLLALFNGSEGMLGVVTE
FT                   VTVKLLPKPETAKVVMASFDDVGKAGKAVGDIIAAGIVPGGLEMMDNLAIRAAEDFIHA
FT                   GYPVEAEAILLCELDGVEADVDDDVDTVRGVLESAGATDIRLARDEAERARFWSGRKNA
FT                   FPAVGRISPDYYCMDGTIPRRALPEVLGTIAELSAEYGLRVANVFHAGDGNMHPLILFD
FT                   ANREGELERAEALGGRILEACVAAGGSITGEHGVGREKINQMCVQFPTGELTTFHAVKA
FT                   AFDPVGLLNPGKNIPTLARCAEFGAMHVHHGELPHPELPRF"
FT   CDS_pept        677177..677884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1588"
FT                   /product="glutathione S-transferase domain protein (homolog
FT                   to beta-etherase)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1588"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41472"
FT                   /db_xref="GOA:E1V7C2"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C2"
FT                   /protein_id="CBV41472.1"
FT                   /translation="MTRVLYDLCGLDEALRFSPYCWRVRYALAHKGLDVETRPWRFTEK
FT                   QALAFANHDKVPVLVDGETVVPESYEILRYLDRTYPEAPLLGDGVADARGRFFAHYAER
FT                   SLAPAMLRIIIMDLLSAIHPDDRAYFRESREKRFGRSLEEFHSPVRGLSQLDTALEPLR
FT                   GRLAEAPYLDGEAPGGADYIVFGNFMWARCVSSADLVSNADPVYAWLERMLDLYDGLGR
FT                   QATRITDIEGAYR"
FT   CDS_pept        complement(677900..678523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1589"
FT                   /product="phosphoribosyltransferase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1589"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41473"
FT                   /db_xref="GOA:E1V7C3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C3"
FT                   /protein_id="CBV41473.1"
FT                   /translation="MFRHRLEAAESLARRLSHLKGQNPLILAIPRGGVPMGRRIADILE
FT                   GELDVVLVRKLGAPGNPEFAIGAVGEGDRIWLEDTANRFGEAAINREIERQQALIAERR
FT                   QRYTPVRAPIDPAERIVVVVDDGSATGATMTTALESLRPRGPARLIAALGVAPPETLAR
FT                   LERLADEVICPEAPAHFRAVGQFYADFEPVDDDEVIRLLGSQPG"
FT   CDS_pept        complement(678582..679106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1590"
FT                   /product="2-oxo-4-hydroxy-4-carboxy-5-ureidoimidazoline
FT                   decarboxylase"
FT                   /EC_number="4.1.1.97"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1590"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41474"
FT                   /db_xref="GOA:E1V7C4"
FT                   /db_xref="InterPro:IPR017580"
FT                   /db_xref="InterPro:IPR018020"
FT                   /db_xref="InterPro:IPR036778"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C4"
FT                   /protein_id="CBV41474.1"
FT                   /translation="MSDKQLSPRPSTLDRAAFINQYGDIYEHSPWVAELAWERGLGAAQ
FT                   DTPEGLAAVMGEVLASADAERQLEVIRAHPDLAGKAAIAGELTDDSTREQAGAGLDQCT
FT                   PEEMARFERLNEAYKARFGFPFVMAVKGSDRHAILDAFETRLKNDPAEERRTAIEQINR
FT                   IAAFRLHDRVA"
FT   CDS_pept        679306..679659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1591"
FT                   /product="5-hydroxyisourate hydrolase"
FT                   /EC_number="3.5.2.17"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1591"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41475"
FT                   /db_xref="GOA:E1V7C5"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C5"
FT                   /protein_id="CBV41475.1"
FT                   /translation="MGYLTTHVLDTSSGLPGKGIRIEVYRLEGDERTRLTEVVTNDDGR
FT                   CDAPILEGEAFSVGEYELVFHAGEYLDRQGVPGDAPRFLDVIPLRFGVADASQHYHVPL
FT                   LLSPYSYSTYRGS"
FT   CDS_pept        679711..680967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1592"
FT                   /product="DUF989 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1592"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41476"
FT                   /db_xref="GOA:E1V7C6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR010389"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C6"
FT                   /protein_id="CBV41476.1"
FT                   /translation="MEAYLLDFANLLLRWLHVIAAIAWIGESIYFVMLDNSLRPPKADE
FT                   DKRKGVFGEMWAVHGGGFYHNQKYASAPAKLPEDLHWSFWKSYATWLSGFGLFVLLYMA
FT                   NPSFYLVNPGSDWAWAANLSGWQANVVALLFLLGGWVVYNELCKRISPNMDRDGILSLA
FT                   VAVMMVVVAYLSTQIFSGRAAFLLTGAVMATAMSANVFFWIIPGQRRMVKAMKAGETPN
FT                   PLDGKRGKQRSVHNTYFTLPVVLLMISNHYSFAYSHDLAWVIMTLFIFAGALIRQFFVL
FT                   MHAGQIKPAYPAAGVVLILVAVWIGAPASGGGDATTAPAEASATTNAESGEPVAASGVE
FT                   AAGHAEQIIIDRCAQCHAENPTYDGFAAAPAGVVLETPEQILRQVGQIKQVVASGYMPL
FT                   GNVTKMTDGERSEIANWSP"
FT   CDS_pept        681092..681832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1593"
FT                   /product="GntR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1593"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41477"
FT                   /db_xref="GOA:E1V7C7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C7"
FT                   /protein_id="CBV41477.1"
FT                   /translation="MNQRRAATEHKTNERVGRPGKNGDGPERHETIYHAISDAIIEHRL
FT                   KPGARLREDALSEVFGVSRTGIRKILQRLALEQLVTLTPRRGASVTRPTADEAKDVFDA
FT                   RQMIECGLMPEVARRMTPEAAQELRDMARREREALKGGEQSAAIKLSAAFHGRLARLSG
FT                   NATLADFVERLCSRSSLILAVYGNAGHLGCESHDHEDLLGFLEQGNGERAQAFMSRHLK
FT                   AIEASLSIHEEEEETPDLYRIFSA"
FT   CDS_pept        complement(681876..683324)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1594"
FT                   /product="NCS1 family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1594"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41478"
FT                   /db_xref="GOA:E1V7C8"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C8"
FT                   /protein_id="CBV41478.1"
FT                   /translation="MTDQELDIQHRDPRLYNDDLAPIKSERRTWGWFEIFNVWSNDIQS
FT                   LFGYTLAASLFISYGLNGWAVMAAIVLAGFVVMVLVNLTGKPSVKYGIPFPVMIRASMG
FT                   VHGANFPAMLRAIIGIFWYGVQTYFASTAVSLLLTSLFGDPGGQWLGMTALDWLSFVIV
FT                   WCFQIALFWQGIERIKHFLNWAGPLVYVVMVVLMLIIWFQAGSDLLPAISTIFSGASDY
FT                   EGNSVTAFMAITGTMIAYFAAVVINFGDFTRFVKSEREMKLGNLLGLPLNVAFFSFIAL
FT                   IITAGTLALFGETLTNPSDIIDRVDSLPLTIVAAVTFFAATVGINLVANFIPPAYDLAN
FT                   LFPRRISFRIGGLITAVIAFFVGALWMSVISKIGIAGFVNALGAVVAPFYGIIVVDYYL
FT                   LKRQRLNIQDVFSCESDGAYHYVKGWNRRALVAFALAALFSVSSVWVPALEALGGYAWL
FT                   IGAALGGLFHYLLMLGQRQPVTTG"
FT   CDS_pept        complement(683400..684782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1595"
FT                   /product="NCS1 family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1595"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41479"
FT                   /db_xref="GOA:E1V7C9"
FT                   /db_xref="InterPro:IPR001248"
FT                   /db_xref="InterPro:IPR038271"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7C9"
FT                   /protein_id="CBV41479.1"
FT                   /translation="MAPSPTGAPHGAKAAPTAPPAPESGTKSAGNESLAPQKTRIMGRT
FT                   SYLLAWFGGCVSIGTFTMGSSVVGSLNLIQATLAIAIGCFVIGLALALNGAPGYKYGIP
FT                   FMVQARSAFGFSGTRLPGLVRAVPAIVWYGFQSWIGAGALNMVSATLFGFDNLIFFFIT
FT                   FQLLQIALSVLGFQGIKWLENIGSAFILCSLVYMFYSTIQRYGDELSASMLTMDGSWGM
FT                   PFWGATMLFLGIYSTMMLNVSDYSREHKTGTGPGLLTTIYAMSILPCTMFMGLIGYMVS
FT                   EATGVADPIKVFANAVDNTPLLMTTLLFIAFAQVTTNVLNNVVPPTYVLMDAFKLKFRT
FT                   ATVIVGLLAFATFPWELVKDESAAGLQMFVQTYSAFLGPIFAVLVVDYYLIRRRTLDLG
FT                   KLYDENGPYRGVNVAALVATAVGVIAAFSISTVSWYASLIPAGLTYYLLMNYWAPCQRF
FT                   RD"
FT   CDS_pept        complement(684895..685635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1596"
FT                   /product="allantoin racemase"
FT                   /EC_number="5.1.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1596"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41480"
FT                   /db_xref="GOA:E1V7D0"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D0"
FT                   /protein_id="CBV41480.1"
FT                   /translation="MRLNVINPNTTRGMTDTIAAAARRIAAPDTHVMATQPAHGPVSIE
FT                   SHFDEAISAVGVLEEVANGDREGADAHIIACFGDPGLLAAREVTRAPVIGIAEAAFHMA
FT                   TLISTRFSVVTTLGRTGIIAEHLLEQYGFRHHCRRVRAAEIPVLDLENDGDAALVRIIE
FT                   ECRRARDEDGVGAIVLGCGGMADLTDVIAEEVGLPVVEGVTAAVKLAEALVGLGLGTSK
FT                   HGDLAFPRPKTFVGRFEHLSGSSE"
FT   CDS_pept        686226..687161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="puuE"
FT                   /locus_tag="HELO_1597"
FT                   /product="allantoinase"
FT                   /EC_number="3.5.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1597"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41481"
FT                   /db_xref="GOA:E1V7D1"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR017625"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D1"
FT                   /protein_id="CBV41481.1"
FT                   /translation="MTSSTRRDYPRDLIGYGRTPPHADWPGRARIAVQFVLNYEEGGEN
FT                   CVLHGDSGSEQFLSEIIGAESYPDRHLSMESIYEYGSRAGVWRILREFERRGLPLTVFG
FT                   VAMALERNPEVAHAFKELGHEIACHGYRWIHYQKVPEHIEREHMRKAIEIFQSLYGETP
FT                   LGWYTGRDSPNTRRLVLDEGSFLYDSDYYGDDLPFWTREADSQGREHDHLVVPYTLDSN
FT                   DMRFAAPQGFNTADHFFTYLRDAFDVLYAEGEETPKMLSVGLHCRLIGRPGRFRALQRF
FT                   LDHIEAHDRVWVTRRVDIARHWAERHPVSR"
FT   CDS_pept        complement(687296..688744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1598"
FT                   /product="YcgA family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1598"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41482"
FT                   /db_xref="GOA:E1V7D2"
FT                   /db_xref="InterPro:IPR018385"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D2"
FT                   /protein_id="CBV41482.1"
FT                   /translation="MPQQPQTTDARASRKKHKSSFQIPHIYVILFIFIALASIATYFVP
FT                   AGTYERIPGPSGRTTIDATSFQYVESTPVGPVDFMLAIPNGLMSAGQVVFFTFMIGGMF
FT                   MVLRRTGIIEIGVDKLSRRFASRSLLMIPVLMTTFAVVATLIGTQELSLVYVPVILPLM
FT                   IALRFDSVTAAAVALCATTAGFTTGVLNPINTGLGQQLSGLPLYSGFALRAVAFVIILC
FT                   IGIFFVMRYARRIHDDPSLSLMADDANEAEKRSSYQHATDEGALVASSRQKLAALAAFG
FT                   FFALLVYGVLAQGWFMMEMAGLFIIMGIVVGLIAGLKGDEICEGFNQGFRDVLVGAMIA
FT                   GIARGVAVVLEDGQIMDTLVHGLGNLVGELPSLLSAIGMYFAQLGFNFVVPSGSGQALV
FT                   TMPIMAPLADLIGVTRQTAVLAYQLGDGIGNILYPTSGYFMATLALAGVPWQKWVKFFF
FT                   PLFCTWVLTSLCFLMFAQATQWVG"
FT   CDS_pept        689141..689677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="HELO_1599"
FT                   /product="ureidoglycolate lyase"
FT                   /EC_number="4.3.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1599"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41483"
FT                   /db_xref="GOA:E1V7D3"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D3"
FT                   /protein_id="CBV41483.1"
FT                   /translation="MLELEARPLTQEAFAPFGEVIDTRIADYFHINAGRTRRYHDLARV
FT                   ETLGEEARALISIFVSQPVEVPLTLDFLERHPQGSQAFVPMHEERFLIVVAPPGESIDP
FT                   ESVRAFVTDGRQGVNYRAGTWHAIQSVLEREGEFLVVDRGGQGNNCDEYPIEIRVTLPE
FT                   HEVVASSDTEFEERQ"
FT   CDS_pept        689674..690525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allE"
FT                   /locus_tag="HELO_1600"
FT                   /product="allantoicase / (S)-ureidoglycine aminohydrolase"
FT                   /EC_number="3.5.3.26"
FT                   /EC_number="3.5.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1600"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41484"
FT                   /db_xref="GOA:E1V7D4"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017627"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D4"
FT                   /protein_id="CBV41484.1"
FT                   /translation="MSQSPVTQRQYYAPHGGHPGQKVMTTDRAMFTEAFAVIPKGVYRD
FT                   IVTSKLPHWENTRLWILSRPLSGFAETFSQYIMEVSPGGGSERPETDPGAEGVLFVVEG
FT                   ELVLTLGGERHRMVPGGYAFIPPGSDWQLRNEADEPVRFHWIRKAYEFVDGIDVPEAFV
FT                   VNENDIEPTVMPDCNEVWATTRFVDPDDMRHDMHVTIVTFQPGGVIPFDETHVMEHGLY
FT                   VLEGKAVYHLNQQWVEVEAGDYMWLRAFCPQACYAGGPGPFRYLLYKDVNRHMALPYSK
FT                   RR"
FT   CDS_pept        690841..692616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="HELO_1601"
FT                   /product="glyoxylate carboligase"
FT                   /EC_number="4.1.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1601"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41485"
FT                   /db_xref="GOA:E1V7D5"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D5"
FT                   /protein_id="CBV41485.1"
FT                   /translation="MARMTAAEAAVHVLKKEGVDVAFGLPGAAINPFYAAMRNVGGVDH
FT                   VLARHVEGASHMAEGYTRTQPGNVGVCIGTSGPAGTDMITGLYSASADSIPILCITGQA
FT                   PANKLHKEDFQAVDIKAIAGPVTKWAITVLEPAQVPRAFQQAFQIMRSSRPGPVLIDLP
FT                   IDVQMTEIEFDPDTYESLPAYKPSASRAQIEKAMGMLNESDQPLLVAGGGIINADASEL
FT                   LTEFAEITGVPVIPTLMGWGTIPDDHPLMAGMVGLQTAHRYGNATMLASDFVMGIGNRW
FT                   ANRHTGALDSYTEGRTFVHVDIEPTQIGRIFGPDYGIVSDAKAALELFVEVAKEWKAEG
FT                   KLKDRSAWAEECQERKRTLLRKTHFDNVPVKPQRVYEEMNKAFGKNTRYVSTIGLSQIA
FT                   GAQFLHVYKPRHWINCGQAGPLGWTIPAALGVRRADPETDIVALSGDYDFQFMVEELAV
FT                   GAQFNLPYIHVLVNNSYLGLIRQAQRGFDMDYQVQLSFENINCPEINGYGVDHVSVVEG
FT                   LGCKALRVTDPEKIGEAFAEARELMQQHRVPVVVEIILERVTNISMGTDLKGINEFEEL
FT                   AENQEDAPTSIAALT"
FT   CDS_pept        692690..693466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="HELO_1602"
FT                   /product="hydroxypyruvate isomerase"
FT                   /EC_number="5.3.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1602"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41486"
FT                   /db_xref="GOA:E1V7D6"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D6"
FT                   /protein_id="CBV41486.1"
FT                   /translation="MPKFAANLSMLFTEVDFLDRFEAAAKAGFKGVEYLFPYDFEAGEI
FT                   KQRLDDNGLTQVLFNLPAGDWGAGERGIACHPDRVEEFRAGVDRAIEYAKVLGNTQVNC
FT                   LAGIQPEGVSDDEARKTLVDNLRFAAEKLEAAGILLIAEPINTRDIPGFFLNRTEQALA
FT                   IFDEVGSQNLKLQYDIYHMQIMEGDLAPTIEKHFGRIAHVQLADNPGRHEPGTGEINYP
FT                   FLFDHLDRLGYDGWIGCEYKPAGSTQEGLGWLDGVR"
FT   CDS_pept        693735..694622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR1"
FT                   /locus_tag="HELO_1603"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1603"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41487"
FT                   /db_xref="GOA:E1V7D7"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D7"
FT                   /protein_id="CBV41487.1"
FT                   /translation="MSKIGFIGLGIMGRPMAGHLLDAGHELTTVKRGSLDETLASKGMK
FT                   ELDNPKAVAEGAEVVITMVPDTPDVEEVLFGEGGVIEGLKPGTLVIDMSSIAPLATQEF
FT                   AKRIHDAGGEYVDAPVSGGEGGAINAALTIMVGATQEGFERANPLLEIMGKTITHIGGH
FT                   GAGQTCKVANQIVVALTIEAVSEGLLFASKAGADVSKVRESLLGGLAQSKILDVHGQRM
FT                   IDRTFDPGFKIKLHQKDLNLALEGARSLDLALPGTANAQQLFQACAANGGADWDHAGIL
FT                   RALERLADHEVGSR"
FT   CDS_pept        694916..696241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gckA"
FT                   /locus_tag="HELO_1604"
FT                   /product="glycerate 2-kinase"
FT                   /EC_number="2.7.1.165"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1604"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41488"
FT                   /db_xref="GOA:E1V7D8"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7D8"
FT                   /protein_id="CBV41488.1"
FT                   /translation="MNALSPLLSSDRPEAVRSWLVRLGETAVEAVHPDSLLPDKLPTPP
FT                   AGRTLVVGAGKAAAAMAAALERAWQSRYPEAPLEGLVVTRYGHGPQGQGAECRHIEVLE
FT                   ASHPMPDDLSERAARRMLESVEGLGEDDLVIALISGGGSALMTLPAPGVGLDEKQALNK
FT                   ALLRCGAPIREINTVRRHLSAIKGGRLAATAHPARVLTWLISDVPGDEASLIASGPTLP
FT                   DATTPADALAILERHGIEISPDVRRHLEAPGEAPRAGDADFSRDESEILARARDALAAG
FT                   QVAAEAEGIEVRLLGDDLEGEARELGRAQGRMALSAQDGLTRPLLILSGGETSVTVRGD
FT                   GRGGRNVEYLLGLFSTLKGAPGIHALAIDTDGIDGSEDNAGAIFGPACWERMLKLGLDP
FT                   DDYLSRNDAYTFFDALDDLIVTGPTRTNVNDFRAILVLPRTS"
FT   CDS_pept        696238..697725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pykA2"
FT                   /locus_tag="HELO_1605"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="GOA:A0A1R4A4K9"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A4K9"
FT                   /protein_id="SJK83902.1"
FT                   /translation="MTLPPHAPIHEPIRRTKIVATLGPASDRPGVLERMIAAGVDVVRL
FT                   NFSHGSADDHRRRLVEVREIATRLGRSVAALGDLQGPKIRIARFRDGAVELEQGQAFVL
FT                   DVALDGEAGDAGRVGCDYKALADDVAPGDRLLLDDGRLVVDVTRVAGSEIHTTVVQGGR
FT                   LSNNKGINKQGGGLSAPALTDKDKADLATAIDIGVDYLAVSFPRSAADMHEARALLGSA
FT                   GAEIGLVAKLERAEAVADDATLDGIIEASEAVMVARGDLGVEIGDEALIGTQKRIIKHA
FT                   RSHNRAVITATQMMESMIEAPLPTRAEVFDVANAVLDATDAVMLSAETAAGDFPVETIE
FT                   AMARVCLGAERERIAQESGHRIHEGFSRIDETIALSAMYAANHLAGVAAIACMTATGYT
FT                   PLIASRIRSGLPIVGLAHNPVAQRRMALYRGVISLPFDTSEMTAGELNDRALERLVAQG
FT                   IAEPGDHVILTRGDHMNAHGGTNTLKILDVGDDHGAG"
FT   CDS_pept        697820..698551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1606"
FT                   /product="GntR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1606"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41490"
FT                   /db_xref="GOA:E1V7E0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E0"
FT                   /protein_id="CBV41490.1"
FT                   /translation="MNNAWHKEMLAEVKAGGRISDQDIVEKVRRAVLMQRLPPDTKLPE
FT                   VTLGEVFGVSRSVVRKALTRLASEHVVDQRPNQVARVRAPSIEETRETFEARRLVEGEV
FT                   VAQLAGQLDDEIMATLETQARQETEAYERGDEPARIEHSLTIHHLLAEHSPNRVLGAML
FT                   TDLVLRTSIVIALYKRPSLASCYLENDHPRLLDRLGKGDGEAARTCIHEHLHSLEALLD
FT                   LRPRENSIDLMSILGRTAEQT"
FT   CDS_pept        complement(698607..699308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azoR2"
FT                   /locus_tag="HELO_1607"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /EC_number="1.7.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1607"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41491"
FT                   /db_xref="GOA:E1V7E1"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E1"
FT                   /protein_id="CBV41491.1"
FT                   /translation="MTHILHLDASARPGRAGTDEHGSISRRLTHRFATGWTSRHAHDTV
FT                   TYRDIGAAPPSFIDQPWIQSAFTPAAQRSSWMAEVLAESDQMVDELIAADILVIGAPLY
FT                   NFGMPATLKAWVDQVVRLGRTVDYDPSQPEDPFIPLLAERPRHAVILSSRGEGGLGPGG
FT                   PLAHMNHLEPSLTTVLEFIGITRIHRIAVEHQETGGKLLADSIDAAEHQVDALIAHLAP
FT                   ALHTAEQEEPA"
FT   CDS_pept        699431..700336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1608"
FT                   /product="LysR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1608"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41492"
FT                   /db_xref="GOA:E1V7E2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E2"
FT                   /protein_id="CBV41492.1"
FT                   /translation="MSPRRLPSLSSLRAFEAAARHESAKQAAQELSVTATAISHHIRGL
FT                   EESLGVTLFVRKPRQLVLTRQGDELFRVLESAFDGIGEVVERLKTVPARQAATLSTTPA
FT                   VAARWLLPWVCMLRDAYPDIDLRIHASHDPVALDGVTADLAIRYGDGHWPGLVAEKLFD
FT                   NTFIPACSPHLALNDVTELPSQPLIHFRPQGVSIAPLDWAGWQRRACVADLDVGAGLVF
FT                   SDETHAISAAVGGEGVALMSRPLIDDELAEGRLVQPFGPELEGKPFYLVYPESRRNDPT
FT                   ILAIRDWVMQVSGGLCSMGG"
FT   CDS_pept        700503..701024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1609"
FT                   /product="DUF192 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1609"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41493"
FT                   /db_xref="InterPro:IPR003795"
FT                   /db_xref="InterPro:IPR038695"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E3"
FT                   /protein_id="CBV41493.1"
FT                   /translation="MNPTRRHLLQGMALLPLLSLWQPDVQASTLPAMTLPTTTLTVHSA
FT                   QGPHRLTVELASSTAERNQGLMERDTLAEDAGMLFLYDAVQPAANGFWMYRTRIALDVA
FT                   FLDAEGRINDIRHMQPCRSASPSDCPVTRPSQPYHAALEVNAGYFEAKGIEVGDCVSWP
FT                   ERSGGTCRQE"
FT   CDS_pept        complement(701059..701550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgpA2"
FT                   /locus_tag="HELO_1610"
FT                   /product="phosphatidylglycerophosphatase PgpA"
FT                   /EC_number="3.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1610"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41494"
FT                   /db_xref="GOA:E1V7E4"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E4"
FT                   /protein_id="CBV41494.1"
FT                   /translation="MIEGTMLLLATGLGLGWLPWAPGTFGSLLGIPLAWWLLGRPLPTQ
FT                   LITLVLLLAIGVPLCHWASIWLGGGDASAIVADEILAFPIVLLGLAAARRPWMIGVAFA
FT                   LYRLFDITKPPPIGHVEAIGGGLGIMLDDVVAALYAWLVLAVTIALWRRHARNDHSGPM
FT                   "
FT   CDS_pept        701811..703010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1611"
FT                   /product="ChrA family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1611"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41495"
FT                   /db_xref="GOA:E1V7E5"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E5"
FT                   /protein_id="CBV41495.1"
FT                   /translation="MSDASRSVERIKEVFIAFLLLGLTSFGGPIAHLGYFRSEFVERRR
FT                   WLTERTYADLVALCQFLPGPASSQVGFTLGLMRAGPWGAAAAWTAFTLPSAIVLVLFAM
FT                   GAAKLDGPVSQGIIHGLKVTAVAIVAHAVWGMARSLCPDRRRAGIALAAVFTVVLVNGP
FT                   LGQVMAIVIGALAGMMLCRSHAEADVHELALPVSARAGYLAGGVFVILLLGLPLLAWAS
FT                   PSATLAVMDAFYRAGALVFGGGHVVLPLLEAEVVQSGWVSADEFLTGYGAAQAVPGPLF
FT                   TFSSYLGAVMTPLGGSLFGAALALVMIFLPGMLLLVAVLPHWNRFRRWDSAQALMRGAN
FT                   AAVVGVLGAALYQPVWTSAILGPREFALALTGFLLLGVWKLPAWAVVAILAGGGILISL
FT                   "
FT   CDS_pept        703136..703915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1612"
FT                   /product="HAD superfamily hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1612"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41496"
FT                   /db_xref="GOA:E1V7E6"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E6"
FT                   /protein_id="CBV41496.1"
FT                   /translation="MMLFGRNTLLAAALFAGAAPVASAASDAATDGEAICAQAAYSMGL
FT                   RYQQRSAEVAALQRQGFALATLRLEQAIADHEEGANLAIITDLDETVLDNSALLARDMQ
FT                   ACHDYTTWDTWKHWEREGEPRLIPGAADFLEFADEQGVDIFYVSDRYQENEADTIASLE
FT                   ALELPQVSKDSVMLLGPPKAERRAEVVENHTLVMQLGDSLHDFSGKFADADLEGQRRLV
FT                   EENAERFGDDWIVFPNAGYGDWSEAELDAWDAPLETE"
FT   CDS_pept        complement(703947..704831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1613"
FT                   /product="homolog to potassium channel protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1613"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41497"
FT                   /db_xref="GOA:E1V7E7"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR028325"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E7"
FT                   /protein_id="CBV41497.1"
FT                   /translation="MNSLKPASEGLRTRIFQLIFESDTPLAKAFDIALIGVILGSVLVV
FT                   MLESVAPLRERYGSWFYWLEWGFTLIFTFELAVRLYCLERPWKYLRSFYGIIDLLAILP
FT                   TWLALMLPGAQSLVVVRLLRVLRIFRVLRLMEFIGEGRLLLDALKRSARQIFLFLFTVC
FT                   MLITIFASLVYLIEPAEAGFTSIPKAIYWAAVTLTTVGYGDITPVTPLGQTISVMMMLT
FT                   GYSIIAVPTGVFSAEVIRSIRADRYSDEACPGCGHDRHEKRASYCLHCGTWLDEETPDP
FT                   RAENDDAPHGDKP"
FT   CDS_pept        complement(704859..705725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ygiF"
FT                   /locus_tag="HELO_1614"
FT                   /product="inorganic triphosphatase"
FT                   /EC_number="3.6.1.25"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1614"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41498"
FT                   /db_xref="GOA:E1V7E8"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="InterPro:IPR039013"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E8"
FT                   /protein_id="CBV41498.1"
FT                   /translation="MASEIELKLALGESGPDALRRHPRLAALPSRVSQLGNTYFDTPEG
FT                   DLEAARSALRLRRDGERLLQTVKTRGQGGGGLSSRGEWEWPVEGPGLDHEGLAEIPPMA
FT                   EFGQDILARLEPRFVTDFTRETWLVEDGDAVIEVALDSGEIRAGQRTARIRELELELKQ
FT                   GAENALHALAATLAEHVPLRPSDTSKAARGGALLLGQWQLPEGGSPAAWLHRASVALDA
FT                   LSDTGDPTWRREAQAAFQCLAELGDDTASDARWLAKALDDDAWLNEAFGMHALSLSRRL
FT                   PGDAALN"
FT   CDS_pept        705834..706514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1615"
FT                   /product="UPF0111 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1615"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41499"
FT                   /db_xref="InterPro:IPR002727"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7E9"
FT                   /protein_id="CBV41499.2"
FT                   /translation="MVTSNPFSAMFGRSPFQPLLAHIVKVNDCAEQLLPFFEATLNGDW
FT                   QEAGVHRETITRLEHEADELKTELRLNLPNTMFLPVSRSDLLDLISVQDKIANKVRDIT
FT                   GIMLGRSMQVPEALAGPMRDYMQTSVACVGQARQALEELKDLLESGFGRNVSDVMQNLI
FT                   RELHTLEQQADNQQIAIRRQLFALEDSLPPVEVMFLYKIIDWVGELSDRAERVGSRLQI
FT                   MTAN"
FT   CDS_pept        706575..707840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1616"
FT                   /product="PHO4 family transport protein (probable substrate
FT                   phosphate)"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1616"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41500"
FT                   /db_xref="GOA:E1V7F0"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F0"
FT                   /protein_id="CBV41500.1"
FT                   /translation="MSIIAQHGDIFIILACLFGLFMAWGVGANDVANAMGTSVGSKAIT
FT                   IKQAIIIAVIFEFLGAWLAGGEVTDTIRKGIIDPAMLQSDPQLLVYGMLAALLAAATWL
FT                   MIASMRGWPVSTTHSIVGAIVGFAMAGLGLEAIDWSQVGQIAASWVVSPLMSGSIAFML
FT                   FRSVQHLIFENRDPFAAAKRYVPMYVFLVGFIVAMVTFTKGLKHVGLELGFGASLLYSI
FT                   LLGLALMGLGILRERRVGAGKRQDDTFGFGGVERVFGVLMLFTACAMAFAHGSNDVANA
FT                   VGPLAAVISVVESGGNVGGEALVPWWVLILGGGGIVVGLVTYGHKVIATVGTGITELTP
FT                   SRGFAATLAAATTVVLASGTGLPISTTHTLVGAVLGVGLARGMAALNLRVIGTIVMSWL
FT                   ITLPAGAALAIMFFFMFKGMFS"
FT   CDS_pept        708159..709472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="HELO_1617"
FT                   /product="N-acetylglutamate synthase"
FT                   /EC_number="2.3.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1617"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41501"
FT                   /db_xref="GOA:E1V7F1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F1"
FT                   /protein_id="CBV41501.1"
FT                   /translation="MDTRFPFVDWFRNSSPYINAHRGRTFVILIEGEAVSEGRGEQLIQ
FT                   DLALLHTLGVRLVVVLGIRPQVNAALEAASITPRRHHGRWVADDAIMERVERVAAEQRL
FT                   WLEARLSLGLPNSPLHGVEMTAVSGNLVMAKPLGVRDGVDFARSGEVRRVRETAISGLL
FT                   EQGSLVLLPPLGYSSTGEVFDLDAAEVAQKVATALAADKLILLGEAKGLFDAQGQLQRQ
FT                   LTPDEASGWLDETSPGDEAHRHLGAACAAARHGVARTHLLSWRDHDALLGELFTRDGVG
FT                   TMISRHRYEQLRAAEVADVGGLLELLEPLERRGMLVPRSRERLEYEIDDYVVIERDGMV
FT                   IGCAALHPFPDASMGELACVAVHVDYRGGARGDLLLGEVERRARRLGLDSLFALTTHTS
FT                   HWFFEHGFGAADLSDLPPLKRDTYNHARQSKVLIKPLV"
FT   CDS_pept        710252..711769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glrK"
FT                   /locus_tag="HELO_1618"
FT                   /product="sensor kinase protein GlrK"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1618"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41502"
FT                   /db_xref="GOA:E1V7F2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F2"
FT                   /protein_id="CBV41502.2"
FT                   /translation="MVLPFTFFYRTLAMTSAVSRRWRPRSLLQLVLLAFLMVMLPLAVL
FT                   MFQAGQALSELSRLADVSARQAVEETRRARTLGALALELERSARQYAVVEQESLLDIYD
FT                   ERLAEFRRLLARQRELLPDDPDVAALSEQLDELAELPDLPVEQLKERLSAFLPFAQHTE
FT                   AMRQATNRRIDERLDDIRARAESVQTRLWWQTAALVSASLLLMLLFTRLIIRPIRQLER
FT                   HILGIGSGSQQQSTAPVQGPAELVRLDERLDWLSSRLDELEEQKQQFLRHMSHELKTPL
FT                   ASVREGSALLTDGVAGELTQHQREILELIDASGSELQHLIEQLLDYNLLQHNRRLELER
FT                   LDLATVAKEVLAKHRLALQQKEMRVECFDGPVSWRIDRIATGRILDNLISNAVAYGEDG
FT                   GELEIRARTTPSSLVLEVANSGESIPDEDREHLFEAFYQGRIRRKGALKGSGIGLSVAA
FT                   DCARLQQGTLELVEDRLSVCFRLTLPVMDDDETETLPALTGTDARNG"
FT   CDS_pept        711771..712322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1619"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1619"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41503"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F3"
FT                   /protein_id="CBV41503.1"
FT                   /translation="MNARALIVCLAAAWLAGCQWLPEQSRTTTTAGVDAVAKDEIESCY
FT                   AEVPGFADDACLLHDWVAFGLASQRGDDEWRARMRERLAGSRTEARLARAVVLSWGPPS
FT                   QWKQASELFKADLHAAPPRLQPLLRYWLNEIERRRDQQGRLTDSEQARTALVEEKEALT
FT                   QKLDALTDIERNINSRQRTE"
FT   CDS_pept        712337..713728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glrR"
FT                   /locus_tag="HELO_1620"
FT                   /product="response regulator/sigma-54-interact/HTH domain
FT                   transcription regulator GlrR"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1620"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41504"
FT                   /db_xref="GOA:E1V7F4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F4"
FT                   /protein_id="CBV41504.1"
FT                   /translation="MISTGHSQANADQTAHILLVDDDVSLLKLLGMRLESRGYRVTTAE
FT                   SGREALKHLDTGRPDLVLSDMRMDEMDGLALFQEIQRRLPGLPVIILTAHGSIPDAVSA
FT                   TRQGVFGFLTKPVDRDELFSTIDDALAHTSAASGEDDSWREAIITRSPEMERILEQARM
FT                   VASSDVSVLVTGPSGSGKELLAGAIHKASRRADKPFIAINCGALPEQLLESELFGHAKG
FT                   AFTGAISDHRGLFQAADGGTLFLDEIGDMPLALQVKLLRALQERQIRPLGSTASVPVDV
FT                   RLISATHRDLGQAMHDGEFREDLFYRLNVVNLKLPPLKERAEDVPLLAKYLVTQAAERH
FT                   KPFVKGFSKEAINLLASSAWPGNVRQLVNVVEQCVALTSSPIIPEALVAQALVAEENAL
FT                   PTFNDARAGFERSYLIKVLKITEGNVTQAARIAGRNRTDFYKLLARHELEPSTFKPNAD
FT                   HSQRA"
FT   CDS_pept        complement(713782..715143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xseA"
FT                   /locus_tag="HELO_1621"
FT                   /product="exodeoxyribonuclease 7 large subunit"
FT                   /EC_number="3.1.11.6"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1621"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41505"
FT                   /db_xref="GOA:E1V7F5"
FT                   /db_xref="InterPro:IPR003753"
FT                   /db_xref="InterPro:IPR020579"
FT                   /db_xref="InterPro:IPR025824"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F5"
FT                   /protein_id="CBV41505.1"
FT                   /translation="MSSTAEQPLSVEALNRNARQLLESGIGEIWVEAELSGVSRPASGH
FT                   VYFTLKDEHAQLRCALFRTRARFVTAPMRDGDRVKVRGRVSLFEPRGNFQLIAEAVQPA
FT                   GEGELLAAFERLKAKLDAEGVFANARPLPFPPRHLLVLTSPTGAAIRDVLAVLAARWPL
FT                   SQVTLIPVPVQGREAAPALIAALGLLNRQSILDPERDAILITRGGGSLEDLWAFNDEHL
FT                   ARAIFHSRLPVMSAVGHEVDVTLADFAADSRAPTPSAAAERLVPDAAALRQRLVQLEER
FT                   LIRSQRARLDTQGQRLDHLRARLRHPGEVLAYRRRQLEQLEGRLHRAMNAGLAERRERE
FT                   RHLRQRLTLRSPQRQVEQAEQRLTLAARRLQQSMPRALARHRERLAAVSRELQAVSPLA
FT                   ILGRGYAILESPEGRVIKRTGDTRPGERLEARLGEGQLTLEVLPPSSESPAGQG"
FT   CDS_pept        715404..717203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1621A"
FT                   /product="ABC-type transport system ATP-binding/permease
FT                   protein"
FT                   /db_xref="GOA:A0A1R4A464"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A464"
FT                   /protein_id="SJK83741.1"
FT                   /translation="MGGFLEDIRRFFRVMDFSKSGKRVRSLFVVLALMSIVSSVLTVAQ
FT                   PFLYMELIDSIVGEGGGLLGFSTETIILVYGVCFLVARVIDELWKAVFTNLTLSAQRSL
FT                   AEKAFDHIIRLPSSFFLGKDKHSLSEIISKARSGVHEIISVSLETIVPVVLEFFLVSLI
FT                   VYMLFPGSVLAILIASVVVFVVVAIVGSEMIRPWQRGFTEENNKTHQVLGEILSSEETI
FT                   KSFNVEDSFKKRYLSHMAVFENYCYKFFRWSAFIGSMQMLAIGGALIPMLFISFNFLKN
FT                   DALTLGAFVMINVLTIQLIMPLRRLAYAYRQVKESAVDIEQLDKVMSIPSETQRSDDGR
FT                   GEVILESPSISFDNVCFCYEEGEEPVLNDVSFTVPEGKAYAFVGASGAGKSTISKLIMR
FT                   YYDVSSGNILLGGRNVEGFPRDAVRRFVGMVSQDVVLFNDTLRFNLDFGECVEDARLVS
FT                   ALKAVDLDGFVDALPNGVDTMVGDRGMRLSGGQRQRVGIARAILKDPKVLIFDEATSSL
FT                   DMHTEKTVSENINIVSEGKTTIVIAHRLSTIINADKILVLDQGEIVSSGTHGELIESCD
FT                   VYRKLYMSGGATSVDQPLQMLSD"
FT   CDS_pept        complement(717245..718315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1622"
FT                   /product="AbrB family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1622"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41506"
FT                   /db_xref="GOA:E1V7F6"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F6"
FT                   /protein_id="CBV41506.1"
FT                   /translation="MLSGTLANGWKATRRLLPTLLLGLVGGALAYGAGLPLPWLLGAML
FT                   VTTAASLTGVRLRSPGGSRQVVLVIIGVMLGTAFSPGMSGDLLHWGASLIIMLLATAVM
FT                   MAISVSFSRRVAGYSADTALYAGVPGGVSAVTLMAMNSRADLRIVGMTHAVRILILLLA
FT                   IPPILQGIGHVSLQPGTRDLAQWLWLPSLGETGWLIAAGVGGSWLGRRLRLPNALLFGP
FT                   ALVSAALHITGMSQAAIPPTVMALAQVVIGVSVGVRFAGTSLREMGRNLLMAALQAVML
FT                   LLVAVLAAWGAHELTGYSPAAALLAYMPGGAPELSLVALSLNIDPAFVTSHHLLRISVL
FT                   ILAMPVLLNYYKKRSA"
FT   CDS_pept        complement(718404..719906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1623"
FT                   /product="TTT family transporter large transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1623"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41507"
FT                   /db_xref="GOA:E1V7F7"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F7"
FT                   /protein_id="CBV41507.1"
FT                   /translation="MFDFLIHGFGVALTPMNLGLAFLGALLGTLFGSLPGIGPINGIAI
FT                   LMPLAYTLGLPAESALILLAGIYTGSEYGGRMSSILLNVPGDAGAVMSTLDGHPLAKKG
FT                   LAGPALGLSAVSSFVGATIAIIGLTLFAPLLAEVAVMFGPAEFFALMVFAFASMSVMMG
FT                   KDPLKTAIGAILGILIGTVGVDSGTGVMRYTFGMAELYDGIDFVVMIIGLFAISEILLM
FT                   LEHGNRRDGQDDGIPPLGRVFVSLKEILACKGAMGRSGLLGFIIGVLPGTGASVASAVA
FT                   YTTEKRISDKDDTFGQGDMRGLAAPEAANNASAAGSFVPMLTLGIPGSGTTAVLLGALM
FT                   LYNITPGPMMFTERPEVAGGLIASLYIGNVVLLALNLPLAGLFARVLTIPRWVLVPGIA
FT                   LLAFVGVYQLHSDLTAIYLMLIIGILGYLLRKLGISLAPVILGYVLGGLMEQNLRRALS
FT                   ISGGDIDILWQSGISVGLWIAAAALLILPWVLPAAKARLARG"
FT   CDS_pept        complement(719920..720366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1624"
FT                   /product="TTT family transporter small transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1624"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41508"
FT                   /db_xref="GOA:E1V7F8"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F8"
FT                   /protein_id="CBV41508.1"
FT                   /translation="MRVTADRLLGFVLLGLAAFVAVQALQWQIPFSYEPVGPRAFPLGL
FT                   ALLLSILALVLVIRPGANGQWPHRALAVKLLMVLVLLVIYAALFTQIGYIPASLLAATA
FT                   LARLFGATWGKALITGTLMAIGSYFLFTSGLGISLPDGYLEGIV"
FT   CDS_pept        complement(720363..721349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1625"
FT                   /product="TTT family transporter substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1625"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41509"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7F9"
FT                   /protein_id="CBV41509.1"
FT                   /translation="MKINTALRHASCLALLGSLLLAGSVQAQSEKTECIAPAKPGGGYD
FT                   LTCRLAANGLEETGRIEQPMMVTYMPGGIGAVAYNHLNGVRTDDSDLIVAASTGAAVNL
FT                   ALNKFGDYSGDEVRWLGALGVDYGAIVVNADAPWENLDDLMSDLKDKPGEIAFGAGGTV
FT                   GSQDWMKAALTAKAADVSPQKLRYVAFEGGGEALAALLGNHIQVFTGDLSELKSQLESG
FT                   KIRVLASLSEERMGGPFADIPTAAEQGYDVQWPIWRGYYMGPDVSDEAYSAWVERLKAL
FT                   SEDPKFAELREARGLFPMSRFGDDFDQYVQQQIADFKSLAQEVGLSQ"
FT   CDS_pept        721482..722150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1626"
FT                   /product="response regulator/HTH domain transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1626"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41510"
FT                   /db_xref="GOA:E1V7G0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G0"
FT                   /protein_id="CBV41510.1"
FT                   /translation="MRLLVVEDDLLIARSLDNALTPLGNIVEAFTHCAEAGAALRQGGF
FT                   DLVLLDLGLPDGDGLTLLEAMRERGDTTPVLILTARDGVEDRVRGLDLGADDYLAKPFS
FT                   IAELEARVRALLRRSQQRSDNQLRLGPLCFDLASGRVTLDETPLELPRRELLLLEGLLS
FT                   QAGDIAPREMLEGRLFGFGEVGSNALEVYVSRLRKRLQGSGLRIRTFRGLGYRLEEERA
FT                   "
FT   CDS_pept        722147..723547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1627"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1627"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41511"
FT                   /db_xref="GOA:E1V7G1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G1"
FT                   /protein_id="CBV41511.1"
FT                   /translation="MIEVDGSLKRRLAIWLLVTVSGLGTLLMIEAYLGAQRAAQRAYDS
FT                   QLEAAALTIAESVQWREGEPVLEIPAAALQILATRHQERVFYAVLDADGRRISANLPLD
FT                   IAEDDQHHVAREPFWRDVTWRGEDWRLYGREYDSAGWETQDPVQIWVGHTMAGRRALAG
FT                   ELFERAVTRFLAMVLLAGLLMLLAMRVALTPMRRLRQLLRRRDADDMGPLDARVPEELR
FT                   ELAETLDTLFSRQRDSRDALLRFTADASHQLKTPLAGLQSTSELALAQDDPETWRTALV
FT                   DVNEGAARTSRLASQLLSLARLRHVGGDGDMTHLDLAAMLREVTLDWAGRDAAREHDLG
FT                   LAELPSAPVVILGSSWALRELLGNLIDNALTYTPAGSEITLGIEIDTRVATLYIEDDGP
FT                   GVPVDLLERLHHPFERGGRQDTRGSGLGLAVVDSIAKRHGAAWQVSNREPRGLRVTLRF
FT                   TLSSPEER"
FT   CDS_pept        723547..724575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1628"
FT                   /product="ABC-type transport system periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1628"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41512"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G2"
FT                   /protein_id="CBV41512.1"
FT                   /translation="MRPWSLVACIGLLMATVSDVVDAESLVVEAALDRRVVAPLLEAFE
FT                   QSHPDIELVFHDRSTLEVDTLVERADPAPDVVISSAMPWQMARVNQDYARPLHSREARA
FT                   WPDWAKWRDEVFGFTFEPIVMAYRLDLPRHMMPPSTHADLHTLLTTRQDMLRGKVTTYS
FT                   PARSGVGYTLFQQDARYTPRFWDLVAAMGNVDARLEENTRAMLQGLTEGRYWLGYNLLG
FT                   SYAMVWAQHHPEVIVQVPQDYSLVMMRMAFIHRDAPHPRQAGEFVDFLLSRDGQRVLAG
FT                   QTPLFSVRPDVKGPYTAQRLRDQVGDRLYPIPINASLLAFVDPQRRDAFMARWRREFQQ
FT                   RR"
FT   CDS_pept        724688..726157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaB"
FT                   /locus_tag="HELO_1629"
FT                   /product="inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1629"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41513"
FT                   /db_xref="GOA:E1V7G3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G3"
FT                   /protein_id="CBV41513.1"
FT                   /translation="MLRMAQEALTFDDVLLVPGYSDVLPKDVSLRTRLTRNLFLNIPLV
FT                   SAAMDTVTEARLAIAMAQEGGIGIIHKSMTIAQQAAEVRKVKKHESVIVKDPVTVGPKA
FT                   KLADLLAMAKEYGFSGFPVVEGETLVGIVTERDMRFQPNHGDSVADIMTPREKLVTVAE
FT                   GTELSVIKGKMQEHRVEKMLVVDNDFRLRGLVTFQDIEKARTFPHAAKDADGRLLVGAA
FT                   VGTGPETPDRIAALVEAGVDAVIIDTAHGHSRGVIDRVAWVKEHYPQIQVIGGNIATAE
FT                   AAKALAEAGADGVKVGIGPGSICTTRVVAGVGVPQITAVSNVAEALKPYDVPLIADGGV
FT                   RFSGDLAKAVAAGASCVMVGGLLAGTEEAPGEVELYQGRTYKAYRGMGSMGAMSQTQGS
FT                   SDRYFQDKSEGVEKLVPEGIEGRVPYKGLMGAIVHQMMGGLRASMGYTGCRDIEEMRTK
FT                   PEFVKITGAGFNESHVHDVQITKEAPNYRAG"
FT   CDS_pept        726288..727865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="guaA"
FT                   /locus_tag="HELO_1630"
FT                   /product="GMP synthase (glutamine-hydrolyzing)"
FT                   /EC_number="6.3.5.2"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1630"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41514"
FT                   /db_xref="GOA:E1V7G4"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G4"
FT                   /protein_id="CBV41514.2"
FT                   /translation="MTDIHAHKILILDFGSQYTQLIARRVREIGVYSEVRAFDITEDEI
FT                   RAYNPNGIILAGGPESVTELDSPRAPQCVFEMGLPVLGICYGMQTMAEQLGGGVEGSQK
FT                   REFGYAQIRLDGESALFEDIADHIEDESGKRLLDVWMSHGDKVARVPEAFSVIASTESC
FT                   PIAAMAWEEKRFYGVQFHPEVTHTLQGQRILEHFVLGICQAERWWTPAQIIEDQVARVR
FT                   EQVGDRHVLLGLSGGVDSSVVAALLHRAIGDQLTCVFVDNGLLRKDEGDQVMKTFSSHM
FT                   GVRVIRVDAEEQFLSRLEDVHDPEAKRKIIGNTFIDVFDAEAAKIEGVEFLAQGTIYPD
FT                   VIESAAAKTGKAHVIKSHHNVGGLPETMKLQLVEPLRELFKDEVRKLGVELGLPYDMVY
FT                   RHPFPGPGLGVRILGEVKKEYADILREADAIFIEELHKADWYHKTSQAFAVFLPVKSVG
FT                   VVGDGRRYEWVIALRAVETIDFMTARWAHLPYELLETVSNRIINELEGVSRVTYDVSSK
FT                   PPATIEWE"
FT   CDS_pept        complement(728072..729058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1630A"
FT                   /product="PfpI/HTH domain protein (homolog to transcription
FT                   regulator CdhR)"
FT                   /db_xref="GOA:A0A1R4A462"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A462"
FT                   /protein_id="SJK83742.1"
FT                   /translation="MTYIERFIVIVLFEQVDLLDVTGPPEVFSLLQREMEEPTGYKVVL
FT                   AAETMDPVTTSAGVQILPDTTFTEIANKAIDTLVVPGAVEVDQHRRVRALIDPMVVEWV
FT                   RKLADNTRRVTSVCVGAHVLAAAGLLDGKRATTHWSTAQQLAAEHPQITVDADPIFIRQ
FT                   DDVWTGAGLSACIDLALALVADDYGEVLAQRVARQLVVYLKRPSGQKQFSVPLEPISTT
FT                   RRVDKIRHYITLHAANPLTVTELAEHIHVSDRQLTRIFKTELGMTPAAYIESARVEIAR
FT                   NRLETTDDPLDRIAAISGLNTVDTLIRAFHRTLKMTPTEYRNRFRIN"
FT   CDS_pept        729212..729802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1631"
FT                   /product="isochorismatase family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1631"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41515"
FT                   /db_xref="GOA:E1V7G5"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G5"
FT                   /protein_id="CBV41515.1"
FT                   /translation="MTTTTLRQLNGFDDAPASLRDSTVIMVDYQNTYTRGVMELDGWEP
FT                   ALYAAAELLEKAREVGATVIHIVNDGGDGTPYDIKTEIGQIHSKVAPIEGEAVIAKTCP
FT                   NAFVNTDLNQHVDAAGNESVVIAGFMTNMCVQFTAEGAFLRGNKPTIVADACATRPLQT
FT                   VVSDVSASQLHNSALATIADLYGVVVRASSDLK"
FT   CDS_pept        729980..731065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1631A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A459"
FT                   /protein_id="SJK83743.1"
FT                   /translation="MNHMEKQCPVGHNNKHCSGSEVYPEGYRNGEIDPHDLEMVAYWSD
FT                   SKVRARNAIFQVDSEMRRNYADLKAELIDHLTPVIVVNNDPKGGEYTLIYKGKIETLQP
FT                   VSEIFEMAKSIAHVPLGIFSIIAPYLKGSDTDAWIAKLEEFSNTLRTARAELKSSEIPE
FT                   ELERSCARILDSGIRFIEKSVDMGYVSIRSFEMFSGSVYDCIRTNMWYASEAQITGVSK
FT                   TMKRWRKKVGDQNWQDLYVVVLSIWTTSVLNQNSIIVREFMDSRAVDTHLIDIPTAETP
FT                   DDYLYVALDNLARIVQDNVAAEMVFPTDQEIADALKGTEDLLSDTIIQQLHCPFQGERY
FT                   PAGSNGSSCSQGGDELVRSSR"
FT   CDS_pept        731193..731642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1631B"
FT                   /product="cupin domain protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A465"
FT                   /protein_id="SJK83744.1"
FT                   /translation="MRKVVKIALVLAVVLPFSSLVLAEDVEPEGGIVSAATHELNWVEL
FT                   PESGGIKYANVRGDIVGEGPYEAFVLFPAGKDNPFHYHSEAIPTVVIQGTFYAEIDGER
FT                   TEYPAGSFYDVPGKKDHYSGCLPGMDCLLFQYQEDRFDLVPQPEE"
FT   CDS_pept        731990..732853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rlmA"
FT                   /locus_tag="HELO_1632"
FT                   /product="23S rRNA (guanine(745)-N(1))-methyltransferase
FT                   RlmA"
FT                   /EC_number="2.1.1.187"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1632"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41516"
FT                   /db_xref="GOA:E1V7G6"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G6"
FT                   /protein_id="CBV41516.1"
FT                   /translation="MSTTPFGALACPLDGDPLGKSDRVWRCAAGHSFDIARQGHVNLLP
FT                   VQNKRSRDPGDSKEMVTARRRFLEAGHYQPIAEAVSRAVLADAPAGASLSCLDAGCGEG
FT                   YYLRELARACEEAVGDERSLALLGVDISKWAILAAAKQWKGATWAVGTNAHLPVQANSL
FT                   DRVLCLFGFPVYPEFARVLKPGGELLQVDAGPDHLRELREIIYPTLKPPRADDEKLPEG
FT                   FTLLGSETLRESIELSGPEPIADLLAMTPHLHRASAEGRARVASLTSLRLTVDVRLTRW
FT                   KPEDVA"
FT   CDS_pept        complement(732911..733900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1633"
FT                   /product="TerC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1633"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41517"
FT                   /db_xref="GOA:E1V7G7"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G7"
FT                   /protein_id="CBV41517.1"
FT                   /translation="MHVPLWVWLATVAGIIVLFLFDFFFHVRRPHEPSFKEAAVWSCIF
FT                   IAIAMAFGGGLWWVWGAQHGAEYFAGFITEKSLSVDNLFVFVIIMSKFAVPRIHQQKAL
FT                   LIGIVIALVMRGVFIAVGAAAIHQFSWVFYIFGAFLLWTAYKLGKESFEDSDEEEKYHP
FT                   NLAERLAQRWLPVTNEYHGQRLLAKVDGKRMVTPLFMVIVALGFTDLLFALDSIPAIYG
FT                   LTREPYIVFTTNAFALLGLLQLYFLLGNLLSRLVYLGLGLSIILAFIGVKLVLEALHEN
FT                   TLPFINGGHPIEAIPEIPIWLSMTIIVGTLVATGMASWLKDRRDRASA"
FT   CDS_pept        734316..735047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="anr"
FT                   /locus_tag="HELO_1634"
FT                   /product="Crp family transcription regulator Anr"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1634"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41518"
FT                   /db_xref="GOA:E1V7G8"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G8"
FT                   /protein_id="CBV41518.1"
FT                   /translation="MTRTAALSESHDSCQHCRLRTLCLPDNLTKSDIGKLEGIIQRRKP
FT                   VSRGASLFQSGQRFQAIYAVRSGAVKTLMPMANGDEHVSGFHLPGEIIGLDAIVMRRHP
FT                   SSAVALETASLCEFPYSALEALSDRMPALQRQLMRVMSRELLAEQNTNRLLARRSAEQR
FT                   LAHVLLKFSERFASRGLSARRFRLPMSRLDLGNYLGLVPETMSRTFRRLEEQDMVNIDR
FT                   KEVEIVDIDAMKSLAFGTEGA"
FT   CDS_pept        complement(735076..735996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhbV"
FT                   /locus_tag="HELO_1635"
FT                   /product="peptidase U32 family protein YhbV"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1635"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41519"
FT                   /db_xref="GOA:E1V7G9"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7G9"
FT                   /protein_id="CBV41519.1"
FT                   /translation="MPIEQTLQLSLGPVLFYWTRERYAAFYREAADWPVNIVYLGELVC
FT                   SRRRDMKLDDWLGIGRELAQSGKQVVLSSQALIESEADLRDLRKLCDNGEFSIEANDQS
FT                   ALQYLSTARLPFIAGPALNLYNPATIGVLARANMQRWHAPVEMSRSDLARLLADCRAQG
FT                   LHHACEVFAYGHLPLAWSSRCFTARRHRTPKDRCQFVCQQYPEGLALRSQESRDVFTLN
FT                   GIQTLSGACQDLRHEVSDMLEMGVDVARLSPRAEGMAEVVAAFDAARQGELPAPDPLAL
FT                   VDVEICDGYWNARPGIDNSRGRTAP"
FT   CDS_pept        complement(736005..737000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1636"
FT                   /product="peptidase U32 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1636"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41520"
FT                   /db_xref="GOA:E1V7H0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7H0"
FT                   /protein_id="CBV41520.1"
FT                   /translation="MELVSPAGNLPALKRAVDEGADAVYFGFQNATNARQFAGLNFSDK
FT                   RAREGIDYAHARGTRVFCAINTYPQPDSWAQWTHAVDQAAELGVDALILADMGLLDYAT
FT                   RHHPALSRHLSVQGSATSHAALRFYHDHFGIKRAVLPRVLSITQVRDLAKQSPVELEVF
FT                   AFGSLCIMAEGRCYLSSYLTGESPNTRGVCSPAAHVRWEQTGEGLESRLNGVLIDRYGE
FT                   SERAGYPTLCKGRFEVDGEIYHAIEEPTSLNTLELLPELAELGISAVKVEGRQRSPAYV
FT                   SKVTRIWRQALDRLAGTPERFHPEPAWIAGLGEVSEGTTTTLGAYERRWK"
FT   CDS_pept        complement(737096..737821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1637"
FT                   /product="radical SAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1637"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41521"
FT                   /db_xref="GOA:E1V7H1"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012840"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7H1"
FT                   /protein_id="CBV41521.1"
FT                   /translation="MTQATPHRPRLAVAGLTPLTSLDYPDHLSCVVFLQGCPLRCGYCH
FT                   NPQMLAPRQAEPSEWAEVEAFLERRRGLLEAVVFSGGEPTLHADLAQAIERVHALGFKV
FT                   GLHTAGIYPRRLQTLLPRLDWVGLDVKGPGADFDRIVGRPGMAAAHERSLALLLESGIR
FT                   FECRTTVHWHDFDLASLQRLALGLAERGVAHYAIQMARPGQCLAPRYAEPGPGPWHADA
FT                   LASLVETLRPAFQRLELRR"
FT   CDS_pept        complement(737860..738027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1638"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1638"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41522"
FT                   /db_xref="GOA:E1V7H2"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7H2"
FT                   /protein_id="CBV41522.1"
FT                   /translation="MTSRIDTLPTDQRQPCEVWTRVMGYHRPISQFNRGKQSEHRERRH
FT                   FTERAATSGS"
FT   CDS_pept        complement(738057..739790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1639"
FT                   /product="NrdD domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1639"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41523"
FT                   /db_xref="GOA:E1V7H3"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7H3"
FT                   /protein_id="CBV41523.1"
FT                   /translation="MTGLSTPRHHTVDVAATVNEYLQRADWRINANANQGYSLGGLILN
FT                   ASGKLIANYWLNEVYPAAVGEAHRQGDLHIHDLDMLSGYCAGWSLRSLLIEGFNGVPGR
FT                   AESAPPRHLTSALGQMVNFLGTLQNEWAGAQAFSSFDTYLAPFVRKDRLDYPTVKQAVQ
FT                   EFIYNLNVPSRWGSQTPFTNLTFDWTCPADLRDQVPSIGGEEQAFTYGELQAEMDLLNR
FT                   AYLEVMEEGDYRGRVFTFPIPTYNITADFDWHSDNAERLFALTAKYGLPYFQNFLNSDL
FT                   EPHMVRSMCCRLQLDLTELLKRGNGLFGSAEQTGSLGVVTINCARLGHRFAGNRAGLFA
FT                   ELDRLLELGRDSLEIKRECIQQWMDDGLYPYSQRYLGTLRNHFSTLGVNGLNEMVRNFS
FT                   DDRLDIATPEGQQLALELLDHVRARMREFQATTGHLYNLEATPAEGTTHRFAREDQKRF
FT                   PGILQAGTPQAPYYTNSSQLPVGHTDDPFEALLHQDPLQTRYTGGTVLHLYMREKLSSP
FT                   RACKQLVHTALSRFRLPYLTVTPTFSICPVHGYLAGEHEFCPKCDDALRAKRTPQADLS
FT                   A"
FT   CDS_pept        740152..740724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1640"
FT                   /product="YhbT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1640"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41524"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR039543"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7H4"
FT                   /protein_id="CBV41524.1"
FT                   /translation="MALPLPSPLLLLRALDQTAPLAVKRRLVEPLLNRTFAEPLAEGEF
FT                   DALEGRRISLMVEDLDLMLTLGLEAGRLVLCREAGEATIRGGWREFLCLATRHEDPDAL
FT                   FFQRRLLIGGDTELGLTAKNLLDGREEGLAQGRLGKWLERLERWQGHSGAALMGNPPGH
FT                   DMRVPARRFISRTSRGCLPPLPRSSPG"
FT   CDS_pept        complement(740666..741136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1641"
FT                   /product="uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1641"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41525"
FT                   /db_xref="GOA:E1V7W2"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W2"
FT                   /protein_id="CBV41525.1"
FT                   /translation="MEYYLARVVHVLAIVLWIGGVAMVTTVLLPAVKRFKHEEERVEFF
FT                   ERVEARFAWQSRITTLLAGLSGFYMLHVLGWQRLAVAEFWWIHAMIAVWLIFTLMLFVF
FT                   EPLFLHRWFKERAKRAPASTFRLIQGLHWFLLAISLVTIAGAVAGSHGWFWI"
FT   CDS_pept        741321..742604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1642"
FT                   /product="SDF family transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1642"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41526"
FT                   /db_xref="GOA:E1V7W3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W3"
FT                   /protein_id="CBV41526.1"
FT                   /translation="MFAPLTSLWRGYRDSSLILRVTLALVLGAVVGLVGGPAVGQALAP
FT                   LGELLMRLLKFIILPIVLFTLMAGINQGQAGRLGRIGRKVFLYYLVTSALAIIVGLTVA
FT                   SLLSPGEGMSLEGAASVSVPENPGILSVVLGIVPTNIIGAFAEQDLLGIIFTALVFGLA
FT                   VAGLRQSQTHGELGERLAGLIEALNVVTLKVMSGILHVVPVGVFAIVAGTVAEQGMGTL
FT                   LSLGDMVVVLYVALGVHLLVYIGLLKGFGVPLRAFFREARTPMATAFATQSSSGTLPLT
FT                   LDAARRLGLSRGLYGFSLPLGATLNMDGAAIRIAISAVFAANVAGAPLDFVSMLQVVVI
FT                   GTLISVGTAGVPGAGIVMIATVFSQVGLPIQAVALLTAIDALVGMGCTALNVTGDLVGT
FT                   ALIGRSEGERIDESGSAEAEVVSNPEGP"
FT   CDS_pept        742735..743604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yghU"
FT                   /locus_tag="HELO_1643"
FT                   /product="disulfide-bond oxidoreductase YghU"
FT                   /EC_number="1.8.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1643"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41527"
FT                   /db_xref="GOA:E1V7W4"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W4"
FT                   /protein_id="CBV41527.1"
FT                   /translation="MSQDTEYTPPRVWTWSQASGGQFASINRPIAGPTHDKELPVGKHP
FT                   FQLYSLATPNGVKVTVMFEELLAKGHEGAEYDAWLIKIGDGDQFGSGFVEVNPNSKIPA
FT                   LMDHGTEEPTRVFESGAILLYLAEKFGDFLPTDFKARTEALNWLFWQMGSAPFLGGGFG
FT                   HFYAYAPVKLEYPIDRYAMETKRQLDVLDRHLAEHRYLAGDEYSIADMANWAWYGQLVL
FT                   GRLYDAAEFLQVHTYENVVRWAREVDARPAVQRGRMVNRTFGEPELQLHERHDASDFEH
FT                   KTQDVIGS"
FT   CDS_pept        complement(743813..744019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspA1"
FT                   /locus_tag="HELO_1644"
FT                   /product="cold shock protein CspA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1644"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41528"
FT                   /db_xref="GOA:E1V7W5"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W5"
FT                   /protein_id="CBV41528.1"
FT                   /translation="MTTGTVKWFNDSKGFGFISPADGGDDVFAHFSEIQAEGFKSLQEG
FT                   QSVSFDVTQGKKGLQASNIKALG"
FT   CDS_pept        complement(744317..745123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1645"
FT                   /product="AraC family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1645"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41529"
FT                   /db_xref="GOA:E1V7W6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W6"
FT                   /protein_id="CBV41529.1"
FT                   /translation="MRNIPLDDVDGIPREVMAIGTDYLPGTLLDTHRHRRAQFLYGMTG
FT                   LMEVGTEDGTWVVPPYTGVWIPAGKPHQVKMLGVSTRSLYIEPAVAPRPGPLCEVLLVT
FT                   PLLHQLLLASAELPARYDVEGRDGALVRLILHELRQSATLPLFAPLPRDPELARQCSAF
FT                   LQCPDLRSSPAHWAQRLNRSHRTFTRFFKQQTGLSFSAWRQQACLLAALPQLSAGVPVT
FT                   RIALTLGYASPSAFATMFRRTLGESPSEFTERTRNQDTLNEPPADS"
FT   CDS_pept        745231..746040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1646"
FT                   /product="UPF0721 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1646"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41530"
FT                   /db_xref="GOA:E1V7W7"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W7"
FT                   /protein_id="CBV41530.1"
FT                   /translation="MYLLLLACGGLAGVTTVLFGFGGGFFMVPLLYAVLLATHGADSAV
FT                   GQVAMHIAVATSTSVMIVGAGLATRRHHRAGTLDWRWIRPLVGYIAIGAIAGAATAMAM
FT                   RGDWVRWAFIAYLAITILDALLRPGFLAHTAAPPRTPSNGAMAVFGLGIGMVAALLGVG
FT                   GSVMTVPLMRRRGLPMARATAMATPLSLPMALAGTAAYMLLARGELAVQGPWQAGYVDL
FT                   RALAALAAGSWIGIRLASPWIGRLPDGIHARAYLALLAGVLATMVAL"
FT   CDS_pept        complement(746108..746995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldcA"
FT                   /locus_tag="HELO_1647"
FT                   /product="murein tetrapeptide carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1647"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41531"
FT                   /db_xref="GOA:E1V7W8"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W8"
FT                   /protein_id="CBV41531.2"
FT                   /translation="MPLAVSLIAPSSYTAPEAIDAGIRGLEALGAEVRCNEPLQTPRRY
FT                   LAGSREHRLAQLHAAFDDPETRAVWAVRGGYGAAQLVDGIDWSRLARSNKPLIGYSDVT
FT                   VLLDHCHRHGVPAIHGPVAKAAAGVLEGEADQREIVRRQFEETLALIQEPTPLDYPLAP
FT                   YKDAPATLEGPVVGGNLATLASLVGTPLSFRAPPGSLVILEDVGEPYYRLERALWQLVH
FT                   GGALDRAAAVCLGTFEGCQPYGDTPLEAIVAETLTPLGLPLYTGLPSGHGLHNRPWRYG
FT                   ATGRIAGSRLTIDD"
FT   CDS_pept        complement(747130..747450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1647A"
FT                   /product="uncharacterized protein"
FT                   /db_xref="UniProtKB/TrEMBL:A0A1R4A457"
FT                   /protein_id="SJK83745.1"
FT                   /translation="MKVYKPEWRCTLSVTEGAEASDSWKTRLAWRLRQLADRLDGGGRT
FT                   IKLDCYTEPRISREDVDDCLGKGFVMSQELLTELTQQAACEGIMRDAKAELFEQATTGP
FT                   KP"
FT   CDS_pept        complement(747550..748419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argP"
FT                   /locus_tag="HELO_1648"
FT                   /product="LysR family transcription regulator ArgP"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1648"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41532"
FT                   /db_xref="GOA:E1V7W9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7W9"
FT                   /protein_id="CBV41532.1"
FT                   /translation="MLDYKLLEALATVMESGGFERAGELLGLSQSAISQRIKALEVRLG
FT                   QPVLVRHPHLAATPAGQRLLNHYQQVCLLERELGKTLPTLEVATPRLRIALNADSLVTW
FT                   WASVVSDFCQNEDVLLDLVVEDQDVGLKRLRDGDVAACLCASDQPIAGARCVPLGQMTY
FT                   HPMATPAYIERYFPDGPTEAAFRRAPAIVYGPHDQLQHRFLAQCGYHGHFPYHLCPESE
FT                   GFVRLACAGMGYGMMPMMQVPGPVARGELTSLAPGHALEVPLYWHFWRHSGALLERLTS
FT                   TLRTVQLT"
FT   CDS_pept        748517..749134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argO"
FT                   /locus_tag="HELO_1649"
FT                   /product="LysE family arginine export protein ArgO"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1649"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41533"
FT                   /db_xref="GOA:E1V7X0"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X0"
FT                   /protein_id="CBV41533.1"
FT                   /translation="MFESYLTGLVVSGGIIIAIGAQNAYVLGLAVRREYHWWSAGLCMS
FT                   TDLLLVTAGMFGVSAMLLAVPEALAVMRWLGVAFLAWLAVQGLYRAATGRQGLVRDETG
FT                   ERGLAPVLLATLGVTVLNPQVYLDTLLLIPSVGAQQENAAAFVAGAGSASVLWFSLLAW
FT                   GGSLLSPWLSRPMAWRLIDGGIAVMMAAIALQLAGTGVDQFV"
FT   CDS_pept        749297..749737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1650"
FT                   /product="DUF4399 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1650"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41534"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X1"
FT                   /protein_id="CBV41534.1"
FT                   /translation="MQRLITTIAVSLFGSALMASSAMAEMEATAPAEGAEVYFISPQDG
FT                   DTLSSPVTVRMGLEGMGVAPAGTEVENTGHHHLLIDKPLDEVDLSAPLPATEQTLHFGG
FT                   GQTQTTLDLPPGEHTLQLLFMDYRHFSFDPPVHSEPITITVE"
FT   CDS_pept        749820..750593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1651"
FT                   /product="DUF306 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1651"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41535"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR007298"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X2"
FT                   /protein_id="CBV41535.1"
FT                   /translation="MKRMFLFCYFLLAAVFLVGCAAAERSGTEKAEATFGELPASFRGT
FT                   LPCADCPGIRYQLSLFADGVYTLETVYLGSDEANRYHEKGEWSLDGAGKTLTLTDDEGT
FT                   RLWRVQDASTLEALDLEGNEIESSLDYTLKRTDGFVTETLEDSYWRLVELKGESVEASQ
FT                   GQREAHLVLHSEANRVAGATGCNQLSGSYRLEGDRLSFGPLATTRMACMNGADVESRFL
FT                   AALEDTTSYRVLADRLELYDDEGKLLALFAVQHLT"
FT   CDS_pept        complement(750673..751392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1652"
FT                   /product="PmpR family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1652"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41536"
FT                   /db_xref="GOA:E1V7X3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X3"
FT                   /protein_id="CBV41536.1"
FT                   /translation="MGRAFQNRKESMAKTSDAKAKVYGKYGRELYVCAKQGGSDPHANL
FT                   ALRGLIERAKKAQVPAHVIDKALDKASGGGGEDYSPARYEGFGPGNAMVIVECLTDNPN
FT                   RTIGDVRTCFTKCKGKLGTPGSVSHMFDHCAILAFDGEDEEAILEALMEADVDVTDIEN
FT                   EEGRITVFAPHTEYAKAKQALLDAFGELEFEIDEIQFVPQTTTPVEGDDIAMFEKLLSM
FT                   LDDLDDVQNVFHSGELP"
FT   CDS_pept        751572..752768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1653"
FT                   /product="peptidase M24 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1653"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41537"
FT                   /db_xref="GOA:E1V7X4"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X4"
FT                   /protein_id="CBV41537.1"
FT                   /translation="MDYQAYRQALAATQQGSELTFMPQEFTARRREVRRRMRQMGIDAL
FT                   LLTDPADLYYLTGYHSFEVSVHACLVVTAERLVLQVPSIETGPAVVTAMVDEILGYRWE
FT                   SIDEVVEPLAETLAPHGVIGLDAFNAGLRHGVIGELQARLGAARFRNDGGELLDGVRIV
FT                   KSAAELECLRESARITSLGLGAAEAIIEPGVTDNQVAAEGARAMLAAGSEFMSLQPIVT
FT                   SGHRSGTIHVNHKRRTIEQDEPVFLEFGAAFQRYTAPMMRTVVAGQPSRDMLALGELCR
FT                   EIGETLCTAMRPGNTFDEAARAAEAVLASQSERAFFSGVFGYAVGAQFPPSWVEGTGFI
FT                   ARGQVRAFESDMVFHLPLCLRLPGEWGIGLSDTVRVTPEGGVALTDNDWRLATPDNAS"
FT   CDS_pept        752803..754782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1654"
FT                   /product="ABC-type transport system ATP-binding/permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1654"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41538"
FT                   /db_xref="GOA:E1V7X5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X5"
FT                   /protein_id="CBV41538.1"
FT                   /translation="MSLLTSSLLEELSCKLALPVFLFESVAMFRYFENLVNPYPEGEPR
FT                   VPPRGLLPFIVHFSRPVAGLLVAMSLATALVSAAEVVFFHYMGELVDWLSSAEREGFLA
FT                   EHGWRLVGMGLLVVVGLPLLVLLQSLLTHQGIFGNYPMLGRWLSHRHMLRQSMSFFQDE
FT                   FAGRVSQKVMQTALAIRETVMKLMDLLVYVAVYFTGAMLLLGNAEPWLMAPLVVWLVGY
FT                   VGIMWFFVPRLRNVSMAQADARARMTGRVVDSYSNIQTIKLFADTRREQDYARDAMEKF
FT                   MVTVHRQMRLATRLSVSLTLLNSLLLVGVAAMAVGAWYLEAVSLGVIAVAIGLVMRIRF
FT                   MSDWILWEVAGLFENIGTVQDGINTIARTPAVLDAPDAAELEVPSGEIRFEAVRFGYDL
FT                   PDGEARRVFDGLDLNIAPGEKVGIIGRSGAGKSTLANLLLRFYDLESGAIRIDGQNIAE
FT                   VTQESLRRHIGMVTQDTSLLHRSVRDNIRYGSPDASEEDIQRAVRQAHADSFLDDLVDP
FT                   QGRRGLDAHVGERGVKLSGGQRQRIAIARVLLKNAPILVLDEATSALDSEVEAAIQEQL
FT                   YALMEGKTVIAIAHRLSTIAMLDRLVVIDEGHIVETGNHEQLLARDGIYAALWRRQSGG
FT                   FLGLEASSETDERRDQRPMEEMPS"
FT   CDS_pept        754779..755204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1655"
FT                   /product="RutC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1655"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41539"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X6"
FT                   /protein_id="CBV41539.1"
FT                   /translation="MMRESINPHSVADTLQYGFSQAVVVSGGHRVYLSGQVGIDAHEVL
FT                   AGPDIATQTRTALDNIDTILRGVGGCLADVVMLRLNVAECARYEQESVIGVLRERFPAS
FT                   PPATSWTVVRGLAEPEWLIELVAEAVIREVLPGEETA"
FT   CDS_pept        755204..755479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1656"
FT                   /product="YrhK domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1656"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41540"
FT                   /db_xref="GOA:E1V7X7"
FT                   /db_xref="InterPro:IPR025424"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X7"
FT                   /protein_id="CBV41540.1"
FT                   /translation="MKAPHLDDPLTLRIGHEELIIRRRYETLSIANDFLIAIWFLVGSV
FT                   LFLYPSQETLAVWMFIIGSFQFLVRPAIRLASHLHLKRIPDSEWQK"
FT   CDS_pept        755743..756486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1657"
FT                   /product="OmlA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1657"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41541"
FT                   /db_xref="GOA:E1V7X8"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X8"
FT                   /protein_id="CBV41541.2"
FT                   /translation="MPSGVVRQASLGAALAVSLMLSGCSTVGGDGDGFPDPDDAYMRGG
FT                   TLESAQAIKTIHSGMTKDQVRDLLGNPHFSEGLFNVRTWNYLFELGADDDHESMMCQFQ
FT                   LAFDEEMRVAETRWKTARCAMRFSSIQVEPIEGSSMVQYYRLPIKGMFSADGNLTDKGR
FT                   RVLGDFVDISRHELLDPVLSIGSYPEPGQYLAQRQAVQRFLEARGGNAIEDISLTSAAV
FT                   SPCLGHDGTKSCRNTQQIVIEIREP"
FT   CDS_pept        complement(756503..758839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1658"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1658"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41542"
FT                   /db_xref="GOA:E1V7X9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007890"
FT                   /db_xref="InterPro:IPR017181"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7X9"
FT                   /protein_id="CBV41542.1"
FT                   /translation="MPHTSRNLLHGLTRTWLLIGLCLIVLTWWAGQRSWSTDAYVYDRL
FT                   LTTRIQPPNDDILIVAIDERSLNALGQWPWPRDMHAALLDRLAATDISAVLFDVVFIEP
FT                   SRQPDHDQRLADAIRRQGHTYLPIILPETSGRSSIPRYLLPAEPLRNAARGLGHIDIRA
FT                   DDDGTVRRIHLRGRSVPQLTLRLYEDLIEDDRVAPPEVTRHLLSRDNAGLDILIPYRGP
FT                   TYHYPRVSYVDILEGRLPPSLLEDRIIMVGATAKGLGDRHPTPFGAADGGMPGVEIQAN
FT                   LLDGLLQGDIIRDVPTWLASIFSILPLLVFMGLVRALQFRHMAKLTLAVLTVIAMSTWG
FT                   LLVSGWWWPPTISFGAVIAASILISWRCQATALTWFQQEIGHLENEPGIIPAPVAVPTK
FT                   EWGLVLHRRLFSLKRAITRLRNTHRFISDAMDSMPIATLVVDMQGRIILSSAQAKQLLR
FT                   HYEIPDEGSVHDLLVSMTPEGQAAGRRLETDDLGALDDQLYKGNDERHYRLKVSSLVTA
FT                   VDAFEVGWLIGLVDVTSKRQAEEQRASLLRFLSHDLKAPQSSILALIQLQHSASSRLSE
FT                   KELLDRVAQQARNALTLTDSFLQLTKIEFGAMEKEFVLLSDVILEAIDQAWPAAQQRGI
FT                   RIKHDIEDECPMEGDRAYLLRAIFNLLDNAIKYSLPDTCISIEARETAKGIVFDIQDQG
FT                   IGIPEQDLPHIFDSYQRSSGAHLSTGHGLGLSLVKSVIERHGGTIECQSTENVGTRFRL
FT                   TLPSYSESPGTADVDGTIHDDPATT"
FT   CDS_pept        complement(758820..760085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1659"
FT                   /product="LysM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1659"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41543"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7Y0"
FT                   /protein_id="CBV41543.1"
FT                   /translation="MNRWYRYGLAGLCCTAFFLSAAAPAHDPVETERYRVQPGDTLWEI
FT                   TERYRGDASEWPILRETNGVKDPRRLQPGDILDLPRLPELTAEVRHCEGSAWLIGEDGR
FT                   RVPLHEDMLIAPGDTLETGSRTFVSLRLPHGEDVVLPSNSRVTLKQQNRRHARLYLKQG
FT                   ELEAHVPTQRDYHEVLDIDTPTGVIGVRGTRLRVTHAEDGIRVSTLEGKVVLKQGERTT
FT                   SVPAGQGVLARTNAFPQVAILLPPPELKADEHSFDHPLQIQLSEVAGAESYRVQLARDP
FT                   DFQTIFRDEQSNTRLLTFDSVPRGFYYARGSALDALGIEGRYGRRLVLHRPVETALDTS
FT                   DDGYTFRWTDIPGLEYRLQLSEDSSFSDPFLSRSFSDSQGVTLRNLPTDEFFWRLQVSG
FT                   DAGKFVDSPVVASGRQGAAHQP"
FT   CDS_pept        760789..762228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1660"
FT                   /product="YadA domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1660"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41544"
FT                   /db_xref="GOA:E1V7Y1"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7Y1"
FT                   /protein_id="CBV41544.2"
FT                   /translation="MINMFHLIWNGSRGCLEGCSMTRCTGRFMISRGIAGGMLLGVAFI
FT                   MGLGASGDVQARKFASDGSTCVSSTGDTAVGRTVTPLTDSDPMDGSGTYSTVAGCNADG
FT                   NGQLAATVYGTFSEVTGRGGSAFGFLSETGKWASALGLEAVATGTGGSAMGFGSRATAL
FT                   NSVAIGGAAGDGANPLAVENSTTASGQHAIAIGANDVRGAQATGTSAIAIGGEATASAV
FT                   STIAMGSGATSTADGAMALGDGASAKDTGSVATGHGARAETAGGVALGAGSQATREGMN
FT                   GAEEAFSSEVVASTQGAVSVGRDGGERQVTHVAGGTEDTDAVNVRQLESVQAGAVNYDR
FT                   HDDGSVDYRAVTLGHGGRPTQFHNVAPGEASTDAVNVGQLEELNGRFSRQISGLGSRID
FT                   NVEDNANAGTASAIAAASVPQAYLPGKSMVAAGAGTYSGESAVSVGVSRLSDNGRWAVK
FT                   LNATGDSQGNFGTGIGAGFHW"
FT   CDS_pept        762945..763688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1661"
FT                   /product="response regulator/HTH domain transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1661"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41545"
FT                   /db_xref="GOA:E1V7Y2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7Y2"
FT                   /protein_id="CBV41545.1"
FT                   /translation="MFIAILEDDPVCLDQLTRLLHTASEKSSQEWQVDEGETGWQVDGY
FT                   QNAKDFVRAVKRKTYNLVLLDWMLPDMNGPEILYWMDEYFQSPPPVIMVTNRDSEQDVV
FT                   EALKAGAEDFVSKPFRSEELIARVLTTLRRHHVSGRHRNESFSQGNITISPKEETIYIN
FT                   DEAVKLTHQEYRLALLLLRNLNHPLSRSYLYETVWGQEESPMSRTLDVHIYRLRRKLGL
FT                   NAESGWKLSSVYRYGYRLQRVDEGE"
FT   CDS_pept        763919..764980
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="npd"
FT                   /locus_tag="HELO_1662"
FT                   /product="probable 2-nitropropane dioxygenase"
FT                   /EC_number="1.13.12.16"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1662"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41546"
FT                   /db_xref="GOA:E1V7Y3"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7Y3"
FT                   /protein_id="CBV41546.1"
FT                   /translation="MSSADAFLQRLGLRYPIIQAPMAGVSTPEMAAAVTQAGGLGSLGL
FT                   GALSVERAREQIHAARELTTEPINVNLFCHCSAGRDSGRELSWLGHLAPYFAEFDARPP
FT                   DELREIYRSFVGHDEMLEMLCMEQPAVVSFHFGLPGREVVQRLREAGCMTLACVTSLEE
FT                   AERAESEGVDALVAQGIEAGGHRGVFNAERDDGIGTLALVRLLVARTRLPVVAAGGIMD
FT                   GAGINAALQLGAAAAQLGTAFVLCPESAADAAYRERLKGEGAHHTRITAAISGRPARGL
FT                   VNRFHEIADDTALPDYPVAYDAAKALHAAARATGNHDFAPHWAGQGAPLARELPAASLV
FT                   GKLAEEMQEAQRH"
FT   CDS_pept        complement(765256..765741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ibpA"
FT                   /locus_tag="HELO_1663"
FT                   /product="small heat shock protein IbpA"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1663"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41547"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR037913"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7Y4"
FT                   /protein_id="CBV41547.1"
FT                   /translation="MSTALSLEPLFRHSIGFDRFSDLFDRALEGSSASTFPPYNIEKHG
FT                   ENQYRIVLAVAGFSEEDLSIKLENGVLTVTGTKADDKNDQNITYMHHGIGRDSFKLTYR
FT                   LEDHIEVQGANLENGLLVIDLLREIPEEAKPREIEINSLGSGKSQFQQIESRNESTA"
FT   tRNA            complement(766034..766100)
FT                   /locus_tag="HELO_TRNA11"
FT                   /product="tRNA-Thr"
FT                   /note="anticodon=CGT"
FT   CDS_pept        766255..767610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1664"
FT                   /product="integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:HELO_1664"
FT                   /db_xref="EnsemblGenomes-Tr:CBV41548"
FT                   /db_xref="GOA:E1V7Y5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:E1V7Y5"
FT                   /protein_id="CBV41548.1"
FT                   /translation="MAKQTEKLTTRVLERLARELPEGDEVWDSDQAGYHVRAGKRGLSL
FT                   RVSYYNLAGKRRVLTLGRYGVGNMTAAKARKDAGEVLGIVAQGGDPRAVLEEARAEAER
FT                   QDQQTLRAYLDGPYTAYQNRLKDGAATLRRIKQDFPGWLDKPMGSLTRADVERWQADQE
FT                   AVDKPRAFGTLKRNYDALCGLLAHAAERKVIPAHPLKGVKLQKPALNEEELAEQGAERR
FT                   YLEPEEVEALFTGLEAYQDQRRQQRRNSRAHGKPYLSDLDGAAYVDHVKPWILTMYFTG
FT                   FRPGDLFGLRWEHVNLTFATIRKVIEKTAHKRPEPQTFPLSSAAVDVLKTWHKQQGEPK
FT                   AGLVFPSPITGKRMSATAMQKPWAAVRGLGGLPEDRQLYTLRHNFASQLVMSGTDLLTV
FT                   SKLMAHADIQTTIAHYAHLAPDHKRDAVEVFAQLAPGQGGETAKEEAAYVTA"
FT   CDS_pept        767597..768277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="HELO_1664A"
FT                   /product="uncharact