(data stored in SCRATCH zone)

EMBL: FN908228

ID   FN908228; SV 1; linear; mRNA; STD; HUM; 2214 BP.
XX
AC   FN908228;
XX
DT   05-DEC-2010 (Rel. 107, Created)
DT   30-AUG-2011 (Rel. 109, Last updated, Version 2)
XX
DE   Homo sapiens mRNA for transcription factor Sp1 (SP1 gene), splice variant c
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2214
RA   Infantino V.;
RT   ;
RL   Submitted (04-JUN-2010) to the INSDC.
RL   Infantino V., Universita degli studi di bari, Farmaco-biologico, Via
RL   orabona 4, 70125 bari, ITALY.
XX
RN   [2]
RX   DOI; 10.1016/j.bbrc.2011.07.047.
RX   PUBMED; 21798247.
RA   Infantino V., Convertini P., Iacobazzi F., Pisano I., Scarcia P.,
RA   Iacobazzi V.;
RT   "Identification of a novel Sp1 splice variant as a strong transcriptional
RT   activator";
RL   Biochem. Biophys. Res. Commun. 412(1):86-91(2011).
XX
DR   MD5; 16e1a7647f49a1cfd978aeb25301b12f.
DR   Ensembl-Gn; ENSG00000185591; homo_sapiens.
DR   Ensembl-Tr; ENST00000327443; homo_sapiens.
DR   Ensembl-Tr; ENST00000426431; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2214
FT                   /organism="Homo sapiens"
FT                   /chromosome="12"
FT                   /map="12q13.1"
FT                   /mol_type="mRNA"
FT                   /cell_line="Hek293"
FT                   /db_xref="taxon:9606"
FT   mRNA            1..2214
FT                   /gene="SP1"
FT                   /note="splice variant c"
FT   CDS_pept        1..2214
FT                   /gene="SP1"
FT                   /product="transcription factor Sp1"
FT                   /db_xref="GOA:P08047"
FT                   /db_xref="H-InvDB:HIT000647288.2"
FT                   /db_xref="HGNC:HGNC:11205"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="PDB:1SP1"
FT                   /db_xref="PDB:1SP2"
FT                   /db_xref="PDB:1VA1"
FT                   /db_xref="PDB:1VA2"
FT                   /db_xref="PDB:1VA3"
FT                   /db_xref="UniProtKB/Swiss-Prot:P08047"
FT                   /protein_id="CBM42955.1"
FT                   /translation="MSDQDHSMDEMTAVVKIEKGVGGNNGGNGNGGGAFSQARSSSTGS
FT                   SSSTGGGGQGANGWQIISSSSGATPTSKEQSGSSTNGSNGSESSKNRTVSGGQYVVAAA
FT                   PNLQNQQVLTGLPGVMPNIQYQVIPQFQTVDGQQLQFAATGAQVQQDGSGQIQIIPGAN
FT                   QQIITNRGSGGNIIAAMPNLLQQAVPLQGLANNVLSGQTQYVTNVPVALNGNITLLPVN
FT                   SVSAATLTPSSQAVTISSSGSQESGSQPVTSGTTISSASLVSSQASSSSFFTNANSYST
FT                   TTTTSNMGIMNFTTSGSSGTNSQGQTPQRVSGLQGSDALNIQQNQTSGGSLQAGQQKEG
FT                   EQNQQTQQQQILIQPQLVQGGQALQALQAAPLSGQTFTTQAISQETLQNLQLQAVPNSG
FT                   PIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIA
FT                   SAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQL
FT                   GLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKK
FT                   QHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGE
FT                   KKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSA
FT                   LITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF"
XX
SQ   Sequence 2214 BP; 595 A; 617 C; 562 G; 440 T; 0 other;
     atgagcgacc aagatcactc catggatgaa atgacagctg tggtgaaaat tgaaaaagga        60
     gttggtggca ataatggggg caatggtaat ggtggtggtg ccttttcaca ggctcgaagt       120
     agcagcacag gcagtagcag cagcactgga ggaggagggc agggtgccaa tggctggcag       180
     atcatctctt cctcctctgg ggctacccct acctcaaagg aacagagtgg cagcagtacc       240
     aatggcagca atggcagtga gtcttccaag aatcgcacag tctctggtgg gcagtatgtt       300
     gtggctgccg ctcccaactt acagaaccag caagttctga caggactacc tggagtgatg       360
     cctaatattc agtatcaagt aatcccacag ttccagaccg ttgatgggca acagctgcag       420
     tttgctgcca ctggggccca agtgcagcag gatggttctg gtcaaataca gatcatacca       480
     ggtgcaaacc aacagattat cacaaatcga ggaagtggag gcaacatcat tgctgctatg       540
     ccaaacctac tccagcaggc tgtccccctc caaggcctgg ctaataatgt actctcagga       600
     cagactcagt atgtgaccaa tgtaccagtg gccctgaatg ggaacatcac cttgctacct       660
     gtcaacagcg tttctgcagc taccttgact cccagctctc aggcagtcac gatcagcagc       720
     tctgggtccc aggagagtgg ctcacagcct gtcacctcag ggactaccat cagttctgcc       780
     agcttggtat catcacaagc cagttccagc tcctttttca ccaatgccaa tagctactca       840
     actactacta ccaccagcaa catgggaatt atgaacttta ctaccagtgg atcatcaggg       900
     accaactctc aaggccagac accccagagg gtcagtgggc tacaggggtc tgatgctctg       960
     aacatccagc aaaaccagac atctggaggc tcattgcaag caggccagca aaaagaagga      1020
     gagcaaaacc agcagacaca gcagcaacaa attcttatcc agcctcagct agttcaaggg      1080
     ggacaggccc tccaggccct ccaagcagca ccattgtcag ggcagacctt tacaactcaa      1140
     gccatctccc aggaaaccct ccagaacctc cagcttcagg ctgttccaaa ctctggtccc      1200
     atcatcatcc ggacaccaac agtggggccc aatggacagg tcagttggca gactctacag      1260
     ctgcagaacc tccaagttca gaacccacaa gcccaaacaa tcaccttagc cccaatgcag      1320
     ggtgtttcct tggggcagac cagcagcagc aacaccactc tcacacccat tgcctcagct      1380
     gcttccattc ctgctggcac agtcactgtg aatgctgctc aactctcctc catgccaggc      1440
     ctccagacca ttaacctcag tgcattgggt acttcaggaa tccaggtgca cccaattcaa      1500
     ggcctgccgt tggctatagc aaatgcccca ggtgatcatg gagctcagct tggtctccat      1560
     ggggctggtg gtgatggaat acatgatgac acagcaggtg gagaggaagg agaaaacagc      1620
     ccagatgccc aaccccaagc cggtcggagg acccggcggg aagcatgcac ctgcccctac      1680
     tgtaaagaca gtgaaggaag gggctcgggg gatcctggca aaaagaaaca gcatatttgc      1740
     cacatccaag gctgtgggaa agtgtatggc aagacctctc acctgcgggc acacttgcgc      1800
     tggcatacag gcgagaggcc atttatgtgt acctggtcat actgtgggaa acgcttcaca      1860
     cgttcggatg agctacagag gcacaaacgt acacacacag gtgagaagaa atttgcctgc      1920
     cctgagtgtc ctaagcgctt catgaggagt gaccacctgt caaaacatat caagacccac      1980
     cagaataaga agggaggccc aggtgtagct ctgagtgtgg gcactttgcc cctggacagt      2040
     ggggcaggtt cagaaggcag tggcactgcc actccttcag cccttattac caccaatatg      2100
     gtagccatgg aggccatctg tccagagggc attgcccgtc ttgccaacag tggcatcaac      2160
     gtcatgcagg tggcagatct gcagtccatt aatatcagtg gcaatggctt ctga            2214
//

If you have problems or comments...

PBIL Back to PBIL home page