(data stored in ACNUC7421 zone)

EMBL: FP103042

ID   FP103042; SV 2; circular; genomic DNA; STD; PRO; 5943768 BP.
XX
AC   FP103042;
XX
PR   Project:PRJNA16093;
XX
DT   17-JUL-2009 (Rel. 101, Created)
DT   22-MAR-2018 (Rel. 136, Last updated, Version 6)
XX
DE   Methylobacterium extorquens str. DM4 chromosome, complete genome.
XX
KW   Complete genome.
XX
OS   Methylorubrum extorquens AM1
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Methylobacteriaceae; Methylorubrum.
XX
RN   [1]
RP   1-5943768
RA   Genoscope - CEA;
RT   ;
RL   Submitted (09-OCT-2017) to the INSDC.
RL   Genoscope - CEA (Commissariat a l'energie atomique et aux energies
RL   alternatives) : BP 191 91006 EVRY cedex - FRANCE (E-mail :
RL   seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
DR   MD5; d2b07e945af4c666a0040ca4a3d7e0a0.
DR   BioSample; SAMEA3138288.
DR   EnsemblGenomes-Gn; EBG00001276578.
DR   EnsemblGenomes-Gn; EBG00001276579.
DR   EnsemblGenomes-Gn; EBG00001276580.
DR   EnsemblGenomes-Gn; EBG00001276581.
DR   EnsemblGenomes-Gn; EBG00001276582.
DR   EnsemblGenomes-Gn; EBG00001276583.
DR   EnsemblGenomes-Gn; EBG00001276584.
DR   EnsemblGenomes-Gn; EBG00001276585.
DR   EnsemblGenomes-Gn; EBG00001276586.
DR   EnsemblGenomes-Gn; EBG00001276587.
DR   EnsemblGenomes-Gn; EBG00001276588.
DR   EnsemblGenomes-Gn; EBG00001276589.
DR   EnsemblGenomes-Gn; EBG00001276590.
DR   EnsemblGenomes-Gn; EBG00001276591.
DR   EnsemblGenomes-Gn; EBG00001276592.
DR   EnsemblGenomes-Gn; EBG00001276593.
DR   EnsemblGenomes-Gn; EBG00001276594.
DR   EnsemblGenomes-Gn; EBG00001276595.
DR   EnsemblGenomes-Gn; EBG00001276596.
DR   EnsemblGenomes-Gn; EBG00001276597.
DR   EnsemblGenomes-Gn; EBG00001276598.
DR   EnsemblGenomes-Gn; EBG00001276599.
DR   EnsemblGenomes-Gn; EBG00001276600.
DR   EnsemblGenomes-Gn; EBG00001276601.
DR   EnsemblGenomes-Gn; EBG00001276602.
DR   EnsemblGenomes-Gn; EBG00001276603.
DR   EnsemblGenomes-Gn; EBG00001276604.
DR   EnsemblGenomes-Gn; EBG00001276605.
DR   EnsemblGenomes-Gn; EBG00001276606.
DR   EnsemblGenomes-Gn; EBG00001276607.
DR   EnsemblGenomes-Gn; EBG00001276608.
DR   EnsemblGenomes-Gn; EBG00001276609.
DR   EnsemblGenomes-Gn; EBG00001276610.
DR   EnsemblGenomes-Gn; EBG00001276611.
DR   EnsemblGenomes-Gn; EBG00001276612.
DR   EnsemblGenomes-Gn; EBG00001276613.
DR   EnsemblGenomes-Gn; EBG00001276614.
DR   EnsemblGenomes-Gn; EBG00001276615.
DR   EnsemblGenomes-Gn; EBG00001276616.
DR   EnsemblGenomes-Gn; EBG00001276617.
DR   EnsemblGenomes-Gn; EBG00001276618.
DR   EnsemblGenomes-Gn; EBG00001276619.
DR   EnsemblGenomes-Gn; EBG00001276620.
DR   EnsemblGenomes-Gn; EBG00001276621.
DR   EnsemblGenomes-Gn; EBG00001276622.
DR   EnsemblGenomes-Gn; EBG00001276623.
DR   EnsemblGenomes-Gn; EBG00001276624.
DR   EnsemblGenomes-Gn; EBG00001276625.
DR   EnsemblGenomes-Gn; EBG00001276626.
DR   EnsemblGenomes-Gn; EBG00001276627.
DR   EnsemblGenomes-Gn; EBG00001276628.
DR   EnsemblGenomes-Gn; EBG00001276629.
DR   EnsemblGenomes-Gn; EBG00001276630.
DR   EnsemblGenomes-Gn; EBG00001276631.
DR   EnsemblGenomes-Gn; EBG00001276632.
DR   EnsemblGenomes-Gn; EBG00001276633.
DR   EnsemblGenomes-Gn; EBG00001276634.
DR   EnsemblGenomes-Gn; EBG00001276635.
DR   EnsemblGenomes-Gn; EBG00001276636.
DR   EnsemblGenomes-Gn; EBG00001276637.
DR   EnsemblGenomes-Gn; EBG00001276638.
DR   EnsemblGenomes-Gn; EBG00001276639.
DR   EnsemblGenomes-Gn; EBG00001276640.
DR   EnsemblGenomes-Gn; EBG00001276641.
DR   EnsemblGenomes-Gn; EBG00001276642.
DR   EnsemblGenomes-Gn; EBG00001276643.
DR   EnsemblGenomes-Gn; EBG00001276644.
DR   EnsemblGenomes-Gn; EBG00001276645.
DR   EnsemblGenomes-Gn; EBG00001276646.
DR   EnsemblGenomes-Gn; EBG00001276647.
DR   EnsemblGenomes-Gn; EBG00001276648.
DR   EnsemblGenomes-Gn; EBG00001276649.
DR   EnsemblGenomes-Gn; EBG00001276650.
DR   EnsemblGenomes-Gn; EBG00001276651.
DR   EnsemblGenomes-Gn; EBG00001276652.
DR   EnsemblGenomes-Gn; EBG00001276653.
DR   EnsemblGenomes-Gn; EBG00001276654.
DR   EnsemblGenomes-Gn; EBG00001276655.
DR   EnsemblGenomes-Gn; EBG00001276656.
DR   EnsemblGenomes-Gn; EBG00001276657.
DR   EnsemblGenomes-Gn; EBG00001276658.
DR   EnsemblGenomes-Gn; EBG00001276659.
DR   EnsemblGenomes-Gn; EBG00001276660.
DR   EnsemblGenomes-Gn; EBG00001276661.
DR   EnsemblGenomes-Gn; EBG00001276662.
DR   EnsemblGenomes-Gn; EBG00001276663.
DR   EnsemblGenomes-Gn; EBG00001276664.
DR   EnsemblGenomes-Gn; EBG00001276665.
DR   EnsemblGenomes-Gn; EBG00001276666.
DR   EnsemblGenomes-Gn; EBG00001276667.
DR   EnsemblGenomes-Gn; EBG00001276668.
DR   EnsemblGenomes-Gn; EBG00001276669.
DR   EnsemblGenomes-Gn; EBG00001276670.
DR   EnsemblGenomes-Gn; EBG00001276671.
DR   EnsemblGenomes-Gn; MEDTI5954.
DR   EnsemblGenomes-Gn; METDI0023.
DR   EnsemblGenomes-Gn; METDI0107.
DR   EnsemblGenomes-Gn; METDI0124.
DR   EnsemblGenomes-Gn; METDI0234.
DR   EnsemblGenomes-Gn; METDI0235.
DR   EnsemblGenomes-Gn; METDI0245.
DR   EnsemblGenomes-Gn; METDI0260.
DR   EnsemblGenomes-Gn; METDI0262.
DR   EnsemblGenomes-Gn; METDI0296.
DR   EnsemblGenomes-Gn; METDI0359.
DR   EnsemblGenomes-Gn; METDI0360.
DR   EnsemblGenomes-Gn; METDI0361.
DR   EnsemblGenomes-Gn; METDI0406.
DR   EnsemblGenomes-Gn; METDI0407.
DR   EnsemblGenomes-Gn; METDI0408.
DR   EnsemblGenomes-Gn; METDI0709.
DR   EnsemblGenomes-Gn; METDI0710.
DR   EnsemblGenomes-Gn; METDI0711.
DR   EnsemblGenomes-Gn; METDI0715.
DR   EnsemblGenomes-Gn; METDI0718.
DR   EnsemblGenomes-Gn; METDI0719.
DR   EnsemblGenomes-Gn; METDI0743.
DR   EnsemblGenomes-Gn; METDI0746.
DR   EnsemblGenomes-Gn; METDI0773.
DR   EnsemblGenomes-Gn; METDI0791.
DR   EnsemblGenomes-Gn; METDI0792.
DR   EnsemblGenomes-Gn; METDI0793.
DR   EnsemblGenomes-Gn; METDI0797.
DR   EnsemblGenomes-Gn; METDI0812.
DR   EnsemblGenomes-Gn; METDI0824.
DR   EnsemblGenomes-Gn; METDI0825.
DR   EnsemblGenomes-Gn; METDI0841.
DR   EnsemblGenomes-Gn; METDI0847.
DR   EnsemblGenomes-Gn; METDI0848.
DR   EnsemblGenomes-Gn; METDI0852.
DR   EnsemblGenomes-Gn; METDI0860.
DR   EnsemblGenomes-Gn; METDI0869.
DR   EnsemblGenomes-Gn; METDI0870.
DR   EnsemblGenomes-Gn; METDI0871.
DR   EnsemblGenomes-Gn; METDI0872.
DR   EnsemblGenomes-Gn; METDI0882.
DR   EnsemblGenomes-Gn; METDI0885.
DR   EnsemblGenomes-Gn; METDI0886.
DR   EnsemblGenomes-Gn; METDI0906.
DR   EnsemblGenomes-Gn; METDI0907.
DR   EnsemblGenomes-Gn; METDI0908.
DR   EnsemblGenomes-Gn; METDI0921.
DR   EnsemblGenomes-Gn; METDI0922.
DR   EnsemblGenomes-Gn; METDI0923.
DR   EnsemblGenomes-Gn; METDI0929.
DR   EnsemblGenomes-Gn; METDI1142.
DR   EnsemblGenomes-Gn; METDI1177.
DR   EnsemblGenomes-Gn; METDI1178.
DR   EnsemblGenomes-Gn; METDI1192.
DR   EnsemblGenomes-Gn; METDI1193.
DR   EnsemblGenomes-Gn; METDI1217.
DR   EnsemblGenomes-Gn; METDI1219.
DR   EnsemblGenomes-Gn; METDI1238.
DR   EnsemblGenomes-Gn; METDI1239.
DR   EnsemblGenomes-Gn; METDI1240.
DR   EnsemblGenomes-Gn; METDI1252.
DR   EnsemblGenomes-Gn; METDI1253.
DR   EnsemblGenomes-Gn; METDI1254.
DR   EnsemblGenomes-Gn; METDI1258.
DR   EnsemblGenomes-Gn; METDI1286.
DR   EnsemblGenomes-Gn; METDI1288.
DR   EnsemblGenomes-Gn; METDI1289.
DR   EnsemblGenomes-Gn; METDI1310.
DR   EnsemblGenomes-Gn; METDI1330.
DR   EnsemblGenomes-Gn; METDI1332.
DR   EnsemblGenomes-Gn; METDI1333.
DR   EnsemblGenomes-Gn; METDI1334.
DR   EnsemblGenomes-Gn; METDI1344.
DR   EnsemblGenomes-Gn; METDI1387.
DR   EnsemblGenomes-Gn; METDI1388.
DR   EnsemblGenomes-Gn; METDI1406.
DR   EnsemblGenomes-Gn; METDI1409.
DR   EnsemblGenomes-Gn; METDI1415.
DR   EnsemblGenomes-Gn; METDI1417.
DR   EnsemblGenomes-Gn; METDI1422.
DR   EnsemblGenomes-Gn; METDI1453.
DR   EnsemblGenomes-Gn; METDI1454.
DR   EnsemblGenomes-Gn; METDI1459.
DR   EnsemblGenomes-Gn; METDI1589.
DR   EnsemblGenomes-Gn; METDI1590.
DR   EnsemblGenomes-Gn; METDI1591.
DR   EnsemblGenomes-Gn; METDI1625.
DR   EnsemblGenomes-Gn; METDI1627.
DR   EnsemblGenomes-Gn; METDI1655.
DR   EnsemblGenomes-Gn; METDI1656.
DR   EnsemblGenomes-Gn; METDI1704.
DR   EnsemblGenomes-Gn; METDI1705.
DR   EnsemblGenomes-Gn; METDI1758.
DR   EnsemblGenomes-Gn; METDI1860.
DR   EnsemblGenomes-Gn; METDI1861.
DR   EnsemblGenomes-Gn; METDI1863.
DR   EnsemblGenomes-Gn; METDI1864.
DR   EnsemblGenomes-Gn; METDI1931.
DR   EnsemblGenomes-Gn; METDI2181.
DR   EnsemblGenomes-Gn; METDI2182.
DR   EnsemblGenomes-Gn; METDI2329.
DR   EnsemblGenomes-Gn; METDI2343.
DR   EnsemblGenomes-Gn; METDI2344.
DR   EnsemblGenomes-Gn; METDI2360.
DR   EnsemblGenomes-Gn; METDI2363.
DR   EnsemblGenomes-Gn; METDI2550.
DR   EnsemblGenomes-Gn; METDI2648.
DR   EnsemblGenomes-Gn; METDI2649.
DR   EnsemblGenomes-Gn; METDI2650.
DR   EnsemblGenomes-Gn; METDI2652.
DR   EnsemblGenomes-Gn; METDI2653.
DR   EnsemblGenomes-Gn; METDI2660.
DR   EnsemblGenomes-Gn; METDI2663.
DR   EnsemblGenomes-Gn; METDI2684.
DR   EnsemblGenomes-Gn; METDI2892.
DR   EnsemblGenomes-Gn; METDI2893.
DR   EnsemblGenomes-Gn; METDI3026.
DR   EnsemblGenomes-Gn; METDI3027.
DR   EnsemblGenomes-Gn; METDI3375.
DR   EnsemblGenomes-Gn; METDI3381.
DR   EnsemblGenomes-Gn; METDI3454.
DR   EnsemblGenomes-Gn; METDI3476.
DR   EnsemblGenomes-Gn; METDI3477.
DR   EnsemblGenomes-Gn; METDI3886.
DR   EnsemblGenomes-Gn; METDI3889.
DR   EnsemblGenomes-Gn; METDI3896.
DR   EnsemblGenomes-Gn; METDI3897.
DR   EnsemblGenomes-Gn; METDI3929.
DR   EnsemblGenomes-Gn; METDI3971.
DR   EnsemblGenomes-Gn; METDI4117.
DR   EnsemblGenomes-Gn; METDI4152.
DR   EnsemblGenomes-Gn; METDI4153.
DR   EnsemblGenomes-Gn; METDI4163.
DR   EnsemblGenomes-Gn; METDI4166.
DR   EnsemblGenomes-Gn; METDI4167.
DR   EnsemblGenomes-Gn; METDI4320.
DR   EnsemblGenomes-Gn; METDI4321.
DR   EnsemblGenomes-Gn; METDI4337.
DR   EnsemblGenomes-Gn; METDI4338.
DR   EnsemblGenomes-Gn; METDI4341.
DR   EnsemblGenomes-Gn; METDI4342.
DR   EnsemblGenomes-Gn; METDI4343.
DR   EnsemblGenomes-Gn; METDI4344.
DR   EnsemblGenomes-Gn; METDI4436.
DR   EnsemblGenomes-Gn; METDI4459.
DR   EnsemblGenomes-Gn; METDI4460.
DR   EnsemblGenomes-Gn; METDI4461.
DR   EnsemblGenomes-Gn; METDI4494.
DR   EnsemblGenomes-Gn; METDI4495.
DR   EnsemblGenomes-Gn; METDI4522.
DR   EnsemblGenomes-Gn; METDI4524.
DR   EnsemblGenomes-Gn; METDI4634.
DR   EnsemblGenomes-Gn; METDI4635.
DR   EnsemblGenomes-Gn; METDI4767.
DR   EnsemblGenomes-Gn; METDI4768.
DR   EnsemblGenomes-Gn; METDI4788.
DR   EnsemblGenomes-Gn; METDI4789.
DR   EnsemblGenomes-Gn; METDI4868.
DR   EnsemblGenomes-Gn; METDI4869.
DR   EnsemblGenomes-Gn; METDI4870.
DR   EnsemblGenomes-Gn; METDI5095.
DR   EnsemblGenomes-Gn; METDI5365.
DR   EnsemblGenomes-Gn; METDI5407.
DR   EnsemblGenomes-Gn; METDI5552.
DR   EnsemblGenomes-Gn; METDI5560.
DR   EnsemblGenomes-Gn; METDI5561.
DR   EnsemblGenomes-Gn; METDI5566.
DR   EnsemblGenomes-Gn; METDI5601.
DR   EnsemblGenomes-Gn; METDI5755.
DR   EnsemblGenomes-Gn; METDI_16S_1.
DR   EnsemblGenomes-Gn; METDI_16S_2.
DR   EnsemblGenomes-Gn; METDI_16S_3.
DR   EnsemblGenomes-Gn; METDI_16S_4.
DR   EnsemblGenomes-Gn; METDI_16S_5.
DR   EnsemblGenomes-Gn; METDI_23S_1.
DR   EnsemblGenomes-Gn; METDI_23S_2.
DR   EnsemblGenomes-Gn; METDI_23S_3.
DR   EnsemblGenomes-Gn; METDI_23S_4.
DR   EnsemblGenomes-Gn; METDI_23S_5.
DR   EnsemblGenomes-Gn; METDI_5S_1.
DR   EnsemblGenomes-Gn; METDI_5S_2.
DR   EnsemblGenomes-Gn; METDI_5S_3.
DR   EnsemblGenomes-Gn; METDI_5S_4.
DR   EnsemblGenomes-Gn; METDI_5S_5.
DR   EnsemblGenomes-Gn; METDMtRNA1.
DR   EnsemblGenomes-Gn; METDMtRNA10.
DR   EnsemblGenomes-Gn; METDMtRNA11.
DR   EnsemblGenomes-Gn; METDMtRNA12.
DR   EnsemblGenomes-Gn; METDMtRNA13.
DR   EnsemblGenomes-Gn; METDMtRNA14.
DR   EnsemblGenomes-Gn; METDMtRNA15.
DR   EnsemblGenomes-Gn; METDMtRNA16.
DR   EnsemblGenomes-Gn; METDMtRNA17.
DR   EnsemblGenomes-Gn; METDMtRNA18.
DR   EnsemblGenomes-Gn; METDMtRNA19.
DR   EnsemblGenomes-Gn; METDMtRNA2.
DR   EnsemblGenomes-Gn; METDMtRNA20.
DR   EnsemblGenomes-Gn; METDMtRNA21.
DR   EnsemblGenomes-Gn; METDMtRNA22.
DR   EnsemblGenomes-Gn; METDMtRNA23.
DR   EnsemblGenomes-Gn; METDMtRNA24.
DR   EnsemblGenomes-Gn; METDMtRNA25.
DR   EnsemblGenomes-Gn; METDMtRNA26.
DR   EnsemblGenomes-Gn; METDMtRNA27.
DR   EnsemblGenomes-Gn; METDMtRNA28.
DR   EnsemblGenomes-Gn; METDMtRNA29.
DR   EnsemblGenomes-Gn; METDMtRNA3.
DR   EnsemblGenomes-Gn; METDMtRNA30.
DR   EnsemblGenomes-Gn; METDMtRNA31.
DR   EnsemblGenomes-Gn; METDMtRNA32.
DR   EnsemblGenomes-Gn; METDMtRNA33.
DR   EnsemblGenomes-Gn; METDMtRNA34.
DR   EnsemblGenomes-Gn; METDMtRNA35.
DR   EnsemblGenomes-Gn; METDMtRNA36.
DR   EnsemblGenomes-Gn; METDMtRNA37.
DR   EnsemblGenomes-Gn; METDMtRNA38.
DR   EnsemblGenomes-Gn; METDMtRNA39.
DR   EnsemblGenomes-Gn; METDMtRNA4.
DR   EnsemblGenomes-Gn; METDMtRNA40.
DR   EnsemblGenomes-Gn; METDMtRNA41.
DR   EnsemblGenomes-Gn; METDMtRNA42.
DR   EnsemblGenomes-Gn; METDMtRNA43.
DR   EnsemblGenomes-Gn; METDMtRNA44.
DR   EnsemblGenomes-Gn; METDMtRNA45.
DR   EnsemblGenomes-Gn; METDMtRNA46.
DR   EnsemblGenomes-Gn; METDMtRNA47.
DR   EnsemblGenomes-Gn; METDMtRNA48.
DR   EnsemblGenomes-Gn; METDMtRNA49.
DR   EnsemblGenomes-Gn; METDMtRNA5.
DR   EnsemblGenomes-Gn; METDMtRNA50.
DR   EnsemblGenomes-Gn; METDMtRNA51.
DR   EnsemblGenomes-Gn; METDMtRNA52.
DR   EnsemblGenomes-Gn; METDMtRNA53.
DR   EnsemblGenomes-Gn; METDMtRNA54.
DR   EnsemblGenomes-Gn; METDMtRNA55.
DR   EnsemblGenomes-Gn; METDMtRNA56.
DR   EnsemblGenomes-Gn; METDMtRNA57.
DR   EnsemblGenomes-Gn; METDMtRNA58.
DR   EnsemblGenomes-Gn; METDMtRNA6.
DR   EnsemblGenomes-Gn; METDMtRNA7.
DR   EnsemblGenomes-Gn; METDMtRNA8.
DR   EnsemblGenomes-Gn; METDMtRNA9.
DR   EnsemblGenomes-Tr; EBT00001808690.
DR   EnsemblGenomes-Tr; EBT00001808691.
DR   EnsemblGenomes-Tr; EBT00001808692.
DR   EnsemblGenomes-Tr; EBT00001808693.
DR   EnsemblGenomes-Tr; EBT00001808694.
DR   EnsemblGenomes-Tr; EBT00001808695.
DR   EnsemblGenomes-Tr; EBT00001808696.
DR   EnsemblGenomes-Tr; EBT00001808697.
DR   EnsemblGenomes-Tr; EBT00001808698.
DR   EnsemblGenomes-Tr; EBT00001808699.
DR   EnsemblGenomes-Tr; EBT00001808700.
DR   EnsemblGenomes-Tr; EBT00001808701.
DR   EnsemblGenomes-Tr; EBT00001808702.
DR   EnsemblGenomes-Tr; EBT00001808703.
DR   EnsemblGenomes-Tr; EBT00001808704.
DR   EnsemblGenomes-Tr; EBT00001808705.
DR   EnsemblGenomes-Tr; EBT00001808706.
DR   EnsemblGenomes-Tr; EBT00001808707.
DR   EnsemblGenomes-Tr; EBT00001808708.
DR   EnsemblGenomes-Tr; EBT00001808709.
DR   EnsemblGenomes-Tr; EBT00001808710.
DR   EnsemblGenomes-Tr; EBT00001808711.
DR   EnsemblGenomes-Tr; EBT00001808712.
DR   EnsemblGenomes-Tr; EBT00001808713.
DR   EnsemblGenomes-Tr; EBT00001808714.
DR   EnsemblGenomes-Tr; EBT00001808715.
DR   EnsemblGenomes-Tr; EBT00001808716.
DR   EnsemblGenomes-Tr; EBT00001808717.
DR   EnsemblGenomes-Tr; EBT00001808718.
DR   EnsemblGenomes-Tr; EBT00001808719.
DR   EnsemblGenomes-Tr; EBT00001808720.
DR   EnsemblGenomes-Tr; EBT00001808721.
DR   EnsemblGenomes-Tr; EBT00001808722.
DR   EnsemblGenomes-Tr; EBT00001808723.
DR   EnsemblGenomes-Tr; EBT00001808724.
DR   EnsemblGenomes-Tr; EBT00001808725.
DR   EnsemblGenomes-Tr; EBT00001808726.
DR   EnsemblGenomes-Tr; EBT00001808727.
DR   EnsemblGenomes-Tr; EBT00001808728.
DR   EnsemblGenomes-Tr; EBT00001808729.
DR   EnsemblGenomes-Tr; EBT00001808730.
DR   EnsemblGenomes-Tr; EBT00001808731.
DR   EnsemblGenomes-Tr; EBT00001808732.
DR   EnsemblGenomes-Tr; EBT00001808733.
DR   EnsemblGenomes-Tr; EBT00001808734.
DR   EnsemblGenomes-Tr; EBT00001808735.
DR   EnsemblGenomes-Tr; EBT00001808736.
DR   EnsemblGenomes-Tr; EBT00001808737.
DR   EnsemblGenomes-Tr; EBT00001808738.
DR   EnsemblGenomes-Tr; EBT00001808739.
DR   EnsemblGenomes-Tr; EBT00001808740.
DR   EnsemblGenomes-Tr; EBT00001808741.
DR   EnsemblGenomes-Tr; EBT00001808742.
DR   EnsemblGenomes-Tr; EBT00001808743.
DR   EnsemblGenomes-Tr; EBT00001808744.
DR   EnsemblGenomes-Tr; EBT00001808745.
DR   EnsemblGenomes-Tr; EBT00001808746.
DR   EnsemblGenomes-Tr; EBT00001808747.
DR   EnsemblGenomes-Tr; EBT00001808748.
DR   EnsemblGenomes-Tr; EBT00001808749.
DR   EnsemblGenomes-Tr; EBT00001808750.
DR   EnsemblGenomes-Tr; EBT00001808751.
DR   EnsemblGenomes-Tr; EBT00001808752.
DR   EnsemblGenomes-Tr; EBT00001808753.
DR   EnsemblGenomes-Tr; EBT00001808754.
DR   EnsemblGenomes-Tr; EBT00001808755.
DR   EnsemblGenomes-Tr; EBT00001808756.
DR   EnsemblGenomes-Tr; EBT00001808757.
DR   EnsemblGenomes-Tr; EBT00001808758.
DR   EnsemblGenomes-Tr; EBT00001808759.
DR   EnsemblGenomes-Tr; EBT00001808760.
DR   EnsemblGenomes-Tr; EBT00001808761.
DR   EnsemblGenomes-Tr; EBT00001808762.
DR   EnsemblGenomes-Tr; EBT00001808763.
DR   EnsemblGenomes-Tr; EBT00001808764.
DR   EnsemblGenomes-Tr; EBT00001808765.
DR   EnsemblGenomes-Tr; EBT00001808766.
DR   EnsemblGenomes-Tr; EBT00001808767.
DR   EnsemblGenomes-Tr; EBT00001808768.
DR   EnsemblGenomes-Tr; EBT00001808769.
DR   EnsemblGenomes-Tr; EBT00001808770.
DR   EnsemblGenomes-Tr; EBT00001808771.
DR   EnsemblGenomes-Tr; EBT00001808772.
DR   EnsemblGenomes-Tr; EBT00001808773.
DR   EnsemblGenomes-Tr; EBT00001808774.
DR   EnsemblGenomes-Tr; EBT00001808775.
DR   EnsemblGenomes-Tr; EBT00001808776.
DR   EnsemblGenomes-Tr; EBT00001808777.
DR   EnsemblGenomes-Tr; EBT00001808778.
DR   EnsemblGenomes-Tr; EBT00001808779.
DR   EnsemblGenomes-Tr; EBT00001808780.
DR   EnsemblGenomes-Tr; EBT00001808781.
DR   EnsemblGenomes-Tr; EBT00001808782.
DR   EnsemblGenomes-Tr; EBT00001808783.
DR   EnsemblGenomes-Tr; MEDTI5954.
DR   EnsemblGenomes-Tr; METDI0023.
DR   EnsemblGenomes-Tr; METDI0107.
DR   EnsemblGenomes-Tr; METDI0124.
DR   EnsemblGenomes-Tr; METDI0234.
DR   EnsemblGenomes-Tr; METDI0235.
DR   EnsemblGenomes-Tr; METDI0245.
DR   EnsemblGenomes-Tr; METDI0260.
DR   EnsemblGenomes-Tr; METDI0262.
DR   EnsemblGenomes-Tr; METDI0296.
DR   EnsemblGenomes-Tr; METDI0359.
DR   EnsemblGenomes-Tr; METDI0360.
DR   EnsemblGenomes-Tr; METDI0361.
DR   EnsemblGenomes-Tr; METDI0406.
DR   EnsemblGenomes-Tr; METDI0407.
DR   EnsemblGenomes-Tr; METDI0408.
DR   EnsemblGenomes-Tr; METDI0709.
DR   EnsemblGenomes-Tr; METDI0710.
DR   EnsemblGenomes-Tr; METDI0711.
DR   EnsemblGenomes-Tr; METDI0715.
DR   EnsemblGenomes-Tr; METDI0718.
DR   EnsemblGenomes-Tr; METDI0719.
DR   EnsemblGenomes-Tr; METDI0743.
DR   EnsemblGenomes-Tr; METDI0746.
DR   EnsemblGenomes-Tr; METDI0773.
DR   EnsemblGenomes-Tr; METDI0791.
DR   EnsemblGenomes-Tr; METDI0792.
DR   EnsemblGenomes-Tr; METDI0793.
DR   EnsemblGenomes-Tr; METDI0797.
DR   EnsemblGenomes-Tr; METDI0812.
DR   EnsemblGenomes-Tr; METDI0824.
DR   EnsemblGenomes-Tr; METDI0825.
DR   EnsemblGenomes-Tr; METDI0841.
DR   EnsemblGenomes-Tr; METDI0847.
DR   EnsemblGenomes-Tr; METDI0848.
DR   EnsemblGenomes-Tr; METDI0852.
DR   EnsemblGenomes-Tr; METDI0860.
DR   EnsemblGenomes-Tr; METDI0869.
DR   EnsemblGenomes-Tr; METDI0870.
DR   EnsemblGenomes-Tr; METDI0871.
DR   EnsemblGenomes-Tr; METDI0872.
DR   EnsemblGenomes-Tr; METDI0882.
DR   EnsemblGenomes-Tr; METDI0885.
DR   EnsemblGenomes-Tr; METDI0886.
DR   EnsemblGenomes-Tr; METDI0906.
DR   EnsemblGenomes-Tr; METDI0907.
DR   EnsemblGenomes-Tr; METDI0908.
DR   EnsemblGenomes-Tr; METDI0921.
DR   EnsemblGenomes-Tr; METDI0922.
DR   EnsemblGenomes-Tr; METDI0923.
DR   EnsemblGenomes-Tr; METDI0929.
DR   EnsemblGenomes-Tr; METDI1142.
DR   EnsemblGenomes-Tr; METDI1177.
DR   EnsemblGenomes-Tr; METDI1178.
DR   EnsemblGenomes-Tr; METDI1192.
DR   EnsemblGenomes-Tr; METDI1193.
DR   EnsemblGenomes-Tr; METDI1217.
DR   EnsemblGenomes-Tr; METDI1219.
DR   EnsemblGenomes-Tr; METDI1238.
DR   EnsemblGenomes-Tr; METDI1239.
DR   EnsemblGenomes-Tr; METDI1240.
DR   EnsemblGenomes-Tr; METDI1252.
DR   EnsemblGenomes-Tr; METDI1253.
DR   EnsemblGenomes-Tr; METDI1254.
DR   EnsemblGenomes-Tr; METDI1258.
DR   EnsemblGenomes-Tr; METDI1286.
DR   EnsemblGenomes-Tr; METDI1288.
DR   EnsemblGenomes-Tr; METDI1289.
DR   EnsemblGenomes-Tr; METDI1310.
DR   EnsemblGenomes-Tr; METDI1330.
DR   EnsemblGenomes-Tr; METDI1332.
DR   EnsemblGenomes-Tr; METDI1333.
DR   EnsemblGenomes-Tr; METDI1334.
DR   EnsemblGenomes-Tr; METDI1344.
DR   EnsemblGenomes-Tr; METDI1387.
DR   EnsemblGenomes-Tr; METDI1388.
DR   EnsemblGenomes-Tr; METDI1406.
DR   EnsemblGenomes-Tr; METDI1409.
DR   EnsemblGenomes-Tr; METDI1415.
DR   EnsemblGenomes-Tr; METDI1417.
DR   EnsemblGenomes-Tr; METDI1422.
DR   EnsemblGenomes-Tr; METDI1453.
DR   EnsemblGenomes-Tr; METDI1454.
DR   EnsemblGenomes-Tr; METDI1459.
DR   EnsemblGenomes-Tr; METDI1589.
DR   EnsemblGenomes-Tr; METDI1590.
DR   EnsemblGenomes-Tr; METDI1591.
DR   EnsemblGenomes-Tr; METDI1625.
DR   EnsemblGenomes-Tr; METDI1627.
DR   EnsemblGenomes-Tr; METDI1655.
DR   EnsemblGenomes-Tr; METDI1656.
DR   EnsemblGenomes-Tr; METDI1704.
DR   EnsemblGenomes-Tr; METDI1705.
DR   EnsemblGenomes-Tr; METDI1758.
DR   EnsemblGenomes-Tr; METDI1860.
DR   EnsemblGenomes-Tr; METDI1861.
DR   EnsemblGenomes-Tr; METDI1863.
DR   EnsemblGenomes-Tr; METDI1864.
DR   EnsemblGenomes-Tr; METDI1931.
DR   EnsemblGenomes-Tr; METDI2181.
DR   EnsemblGenomes-Tr; METDI2182.
DR   EnsemblGenomes-Tr; METDI2329.
DR   EnsemblGenomes-Tr; METDI2343.
DR   EnsemblGenomes-Tr; METDI2344.
DR   EnsemblGenomes-Tr; METDI2360.
DR   EnsemblGenomes-Tr; METDI2363.
DR   EnsemblGenomes-Tr; METDI2550.
DR   EnsemblGenomes-Tr; METDI2648.
DR   EnsemblGenomes-Tr; METDI2649.
DR   EnsemblGenomes-Tr; METDI2650.
DR   EnsemblGenomes-Tr; METDI2652.
DR   EnsemblGenomes-Tr; METDI2653.
DR   EnsemblGenomes-Tr; METDI2660.
DR   EnsemblGenomes-Tr; METDI2663.
DR   EnsemblGenomes-Tr; METDI2684.
DR   EnsemblGenomes-Tr; METDI2892.
DR   EnsemblGenomes-Tr; METDI2893.
DR   EnsemblGenomes-Tr; METDI3026.
DR   EnsemblGenomes-Tr; METDI3027.
DR   EnsemblGenomes-Tr; METDI3375.
DR   EnsemblGenomes-Tr; METDI3381.
DR   EnsemblGenomes-Tr; METDI3454.
DR   EnsemblGenomes-Tr; METDI3476.
DR   EnsemblGenomes-Tr; METDI3477.
DR   EnsemblGenomes-Tr; METDI3886.
DR   EnsemblGenomes-Tr; METDI3889.
DR   EnsemblGenomes-Tr; METDI3896.
DR   EnsemblGenomes-Tr; METDI3897.
DR   EnsemblGenomes-Tr; METDI3929.
DR   EnsemblGenomes-Tr; METDI3971.
DR   EnsemblGenomes-Tr; METDI4117.
DR   EnsemblGenomes-Tr; METDI4152.
DR   EnsemblGenomes-Tr; METDI4153.
DR   EnsemblGenomes-Tr; METDI4163.
DR   EnsemblGenomes-Tr; METDI4166.
DR   EnsemblGenomes-Tr; METDI4167.
DR   EnsemblGenomes-Tr; METDI4320.
DR   EnsemblGenomes-Tr; METDI4321.
DR   EnsemblGenomes-Tr; METDI4337.
DR   EnsemblGenomes-Tr; METDI4338.
DR   EnsemblGenomes-Tr; METDI4341.
DR   EnsemblGenomes-Tr; METDI4342.
DR   EnsemblGenomes-Tr; METDI4343.
DR   EnsemblGenomes-Tr; METDI4344.
DR   EnsemblGenomes-Tr; METDI4436.
DR   EnsemblGenomes-Tr; METDI4459.
DR   EnsemblGenomes-Tr; METDI4460.
DR   EnsemblGenomes-Tr; METDI4461.
DR   EnsemblGenomes-Tr; METDI4494.
DR   EnsemblGenomes-Tr; METDI4495.
DR   EnsemblGenomes-Tr; METDI4522.
DR   EnsemblGenomes-Tr; METDI4524.
DR   EnsemblGenomes-Tr; METDI4634.
DR   EnsemblGenomes-Tr; METDI4635.
DR   EnsemblGenomes-Tr; METDI4767.
DR   EnsemblGenomes-Tr; METDI4768.
DR   EnsemblGenomes-Tr; METDI4788.
DR   EnsemblGenomes-Tr; METDI4789.
DR   EnsemblGenomes-Tr; METDI4868.
DR   EnsemblGenomes-Tr; METDI4869.
DR   EnsemblGenomes-Tr; METDI4870.
DR   EnsemblGenomes-Tr; METDI5095.
DR   EnsemblGenomes-Tr; METDI5365.
DR   EnsemblGenomes-Tr; METDI5407.
DR   EnsemblGenomes-Tr; METDI5552.
DR   EnsemblGenomes-Tr; METDI5560.
DR   EnsemblGenomes-Tr; METDI5561.
DR   EnsemblGenomes-Tr; METDI5566.
DR   EnsemblGenomes-Tr; METDI5601.
DR   EnsemblGenomes-Tr; METDI5755.
DR   EnsemblGenomes-Tr; METDI_16S_1-1.
DR   EnsemblGenomes-Tr; METDI_16S_2-1.
DR   EnsemblGenomes-Tr; METDI_16S_3-1.
DR   EnsemblGenomes-Tr; METDI_16S_4-1.
DR   EnsemblGenomes-Tr; METDI_16S_5-1.
DR   EnsemblGenomes-Tr; METDI_23S_1-1.
DR   EnsemblGenomes-Tr; METDI_23S_2-1.
DR   EnsemblGenomes-Tr; METDI_23S_3-1.
DR   EnsemblGenomes-Tr; METDI_23S_4-1.
DR   EnsemblGenomes-Tr; METDI_23S_5-1.
DR   EnsemblGenomes-Tr; METDI_5S_1-1.
DR   EnsemblGenomes-Tr; METDI_5S_2-1.
DR   EnsemblGenomes-Tr; METDI_5S_3-1.
DR   EnsemblGenomes-Tr; METDI_5S_4-1.
DR   EnsemblGenomes-Tr; METDI_5S_5-1.
DR   EnsemblGenomes-Tr; METDMtRNA1-1.
DR   EnsemblGenomes-Tr; METDMtRNA10-1.
DR   EnsemblGenomes-Tr; METDMtRNA11-1.
DR   EnsemblGenomes-Tr; METDMtRNA12-1.
DR   EnsemblGenomes-Tr; METDMtRNA13-1.
DR   EnsemblGenomes-Tr; METDMtRNA14-1.
DR   EnsemblGenomes-Tr; METDMtRNA15-1.
DR   EnsemblGenomes-Tr; METDMtRNA16-1.
DR   EnsemblGenomes-Tr; METDMtRNA17-1.
DR   EnsemblGenomes-Tr; METDMtRNA18-1.
DR   EnsemblGenomes-Tr; METDMtRNA19-1.
DR   EnsemblGenomes-Tr; METDMtRNA2-1.
DR   EnsemblGenomes-Tr; METDMtRNA20-1.
DR   EnsemblGenomes-Tr; METDMtRNA21-1.
DR   EnsemblGenomes-Tr; METDMtRNA22-1.
DR   EnsemblGenomes-Tr; METDMtRNA23-1.
DR   EnsemblGenomes-Tr; METDMtRNA24-1.
DR   EnsemblGenomes-Tr; METDMtRNA25-1.
DR   EnsemblGenomes-Tr; METDMtRNA26-1.
DR   EnsemblGenomes-Tr; METDMtRNA27-1.
DR   EnsemblGenomes-Tr; METDMtRNA28-1.
DR   EnsemblGenomes-Tr; METDMtRNA29-1.
DR   EnsemblGenomes-Tr; METDMtRNA3-1.
DR   EnsemblGenomes-Tr; METDMtRNA30-1.
DR   EnsemblGenomes-Tr; METDMtRNA31-1.
DR   EnsemblGenomes-Tr; METDMtRNA32-1.
DR   EnsemblGenomes-Tr; METDMtRNA33-1.
DR   EnsemblGenomes-Tr; METDMtRNA34-1.
DR   EnsemblGenomes-Tr; METDMtRNA35-1.
DR   EnsemblGenomes-Tr; METDMtRNA36-1.
DR   EnsemblGenomes-Tr; METDMtRNA37-1.
DR   EnsemblGenomes-Tr; METDMtRNA38-1.
DR   EnsemblGenomes-Tr; METDMtRNA39-1.
DR   EnsemblGenomes-Tr; METDMtRNA4-1.
DR   EnsemblGenomes-Tr; METDMtRNA40-1.
DR   EnsemblGenomes-Tr; METDMtRNA41-1.
DR   EnsemblGenomes-Tr; METDMtRNA42-1.
DR   EnsemblGenomes-Tr; METDMtRNA43-1.
DR   EnsemblGenomes-Tr; METDMtRNA44-1.
DR   EnsemblGenomes-Tr; METDMtRNA45-1.
DR   EnsemblGenomes-Tr; METDMtRNA46-1.
DR   EnsemblGenomes-Tr; METDMtRNA47-1.
DR   EnsemblGenomes-Tr; METDMtRNA48-1.
DR   EnsemblGenomes-Tr; METDMtRNA49-1.
DR   EnsemblGenomes-Tr; METDMtRNA5-1.
DR   EnsemblGenomes-Tr; METDMtRNA50-1.
DR   EnsemblGenomes-Tr; METDMtRNA51-1.
DR   EnsemblGenomes-Tr; METDMtRNA52-1.
DR   EnsemblGenomes-Tr; METDMtRNA53-1.
DR   EnsemblGenomes-Tr; METDMtRNA54-1.
DR   EnsemblGenomes-Tr; METDMtRNA55-1.
DR   EnsemblGenomes-Tr; METDMtRNA56-1.
DR   EnsemblGenomes-Tr; METDMtRNA57-1.
DR   EnsemblGenomes-Tr; METDMtRNA58-1.
DR   EnsemblGenomes-Tr; METDMtRNA6-1.
DR   EnsemblGenomes-Tr; METDMtRNA7-1.
DR   EnsemblGenomes-Tr; METDMtRNA8-1.
DR   EnsemblGenomes-Tr; METDMtRNA9-1.
DR   EuropePMC; PMC3621897; 23593113.
DR   EuropePMC; PMC4161386; 25211235.
DR   EuropePMC; PMC5585157; 28919881.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00489; ctRNA_p42d.
DR   RFAM; RF00490; S-element.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02223; sX4.
DR   SILVA-LSU; FP103042.
DR   SILVA-SSU; FP103042.
DR   StrainInfo; 159963; 1.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (SPRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MicroScope annotation system
CC   ~CC   http://www.genoscope.cns.fr/agc/microscope.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..5943768
FT                   /organism="Methylorubrum extorquens AM1"
FT                   /strain="DM4"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272630"
FT   CDS_pept        710..2215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="METD_I0001"
FT                   /product="DNA replication initiator protein,
FT                   transcriptional regulator of replication and housekeeping
FT                   genes"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0001"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21681"
FT                   /db_xref="GOA:C7C6F7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6F7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21681.1"
FT                   /translation="MHLDGSMSDGDGGNGRGSVDLPAAWTRVKRRLRAELGEDVFASWF
FT                   ARLELETVEGGVARLTVPTRFLKSWIESHYIDRVLTTFRAEADGVSRIEVGVRGPSGPA
FT                   RPSAGVPAKPNATSGPLNRLHAIATPAALQGPGPMIETEIASPRGDSASVDLNGAPLDA
FT                   RLSFANFVVGRSNALAHAAAERIARSDSDGALYNPLYVHAGVGLGKTHLLHAAGHAARE
FT                   AGRRVIYLTADRFMYGFVNALKTQNALAFKERLRAIDLLILDDVQFIQGKSIQTEFGHT
FT                   LNALIDSGRQVVVASDRPPTELEALDERVRSRLAGGLVVEIGGLDEGLRASILSARLDA
FT                   VRQSHPNFEVSPAVSAYVARAITANGRDLEGAVNRLLAHATLTGAPVTVETAETAIRDL
FT                   VKNREPKRVKIEDIQKLVASRYNVSRSDILSERRTAAVVKPRQIAMYLSKVLTLRSLPE
FT                   IGRRFGGRDHTTVLHAVRKIEKQIGEDAVLGDEVELLKRMLQD"
FT   CDS_pept        2535..3656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="METD_I0002"
FT                   /product="DNA polymerase III, beta-subunit"
FT                   /function="15 : Cellular processes"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0002"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21682"
FT                   /db_xref="GOA:C7C6F8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6F8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21682.1"
FT                   /translation="MRVTVERAALLKSLGHVHRVVERRNTIPILSNVLLRTGENGLQLK
FT                   ATDLDIEVTETVAADVLDAGATTVPAHVIYDIVRKLPEGAQVSLETSGETGQMTIRSGR
FT                   SRFALGALPEGDFPDLAAGELPHSFAIPAAELKQLIEKTQFAISTEETRYYLNGIYFHT
FT                   LEVEGALKLRAVATDGHRLARVETEAPEGSRGMPGIIVPRKAVAEIQKLVDDGGESVQV
FT                   ELSPAKIRLTFAGGVILISKLIDGTFPDYQRVIPTGNDKRLTVERDAFAKAVDRVSTIS
FT                   SERGRAVKLAVSEGRLALSVTNPDAGSATEELDVDYEASALDIGFNARYLLDITAQLQG
FT                   DTALFKLADPGSPTLIQDRDGAPALYVLMPMRV"
FT   CDS_pept        3697..4851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="METD_I0003"
FT                   /product="putative RecF protein"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0003"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21683"
FT                   /db_xref="GOA:C7C6F9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6F9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21683.1"
FT                   /translation="MDILPGGPRLTRLIARDFRNHVDLDLATTRRFVALVGENGAGKTN
FT                   ILEAVSLFCPGRGLRRADLATMARVGGPGGFAVSATLEASEAEHRFGSGYEPPGYDGRG
FT                   TRVCRIDGANAPSPVAFSEFLRIVWLTPDFDGLFRGAAGDRRRFLDRLVLAVDAGHGAR
FT                   VSAMERALRSRNRLLDERPDDGRWLDAVEREVAELGVAVALARRETVERLDRLIAETRD
FT                   DAAPFPWASLRLEGDLDDLVAVWPALEAEDRFRRALMQGRHRDRAAGRTLIGPQTTDLV
FT                   VRHGPKDVPAATASTGEQKALLIGLVLAHARLVRAMSGLAPLILLDEVAAHLDPRRRGG
FT                   LFDALEALEGQVWMTGADPALFAELEGRADLIGVADGRLVPAGA"
FT   CDS_pept        complement(4855..5259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0004"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0004"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21684"
FT                   /db_xref="GOA:C7C6G0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21684.1"
FT                   /translation="MFVDASAIVAIIAREPQAETLTARLEEAPVRYTSAVAVLETVMAL
FT                   RRLGAGSIAQAEQLVRHLLEHADIEEVPITTRESAAAIAAYARYGKGQGHPAQLNLGDC
FT                   FAYACARTRNVPLLFVGNDFSQTDIAAALA"
FT   CDS_pept        complement(5259..5498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0005"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0005"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21685"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21685.1"
FT                   /translation="MPLNIRSEEVNRLAEKLASQARVSKTEAVRMALANELQRRESSLP
FT                   LSERIKPIQDAFARWPKTGMKADKAFFDDMNGES"
FT   CDS_pept        5601..7448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="METD_I0006"
FT                   /product="ATP-dependent DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 3027506; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0006"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21686"
FT                   /db_xref="GOA:C7C6G2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21686.1"
FT                   /translation="MTARLDEARAALKKTFGYDDFRPGQDEVIGAVLDGTDVFAVMPTG
FT                   SGKSMTYQLPALVDAGLTVVVSPLIALMHDQVQQMHAFGIEAATLNSTIAETASRETWR
FT                   KIRSGELRLLFVSPERLLMDGCMEALRGAGVRRLAVDEAHCVSQWGHDFRPEYREIARA
FT                   REALGNVQTLALTATADAATRAEIAERLFPAGRPPKTFVHSFDRPNIRLTFQPKDNPTR
FT                   QLERFLRDRRAESGIIYCSSRKRVEQLADTLKGDGFNALPYHAGLDQGTRARNQDTFLQ
FT                   EDGVVMTATIAFGMGINKPDVRYVCHSDMPTNIEGYYQEIGRAGRDGLPSDTLTLYGLD
FT                   DMALRRRQIDEKEISEERRRVERRKLEAMIALCEGAACRRQSLLGYFGEASERCGRCDL
FT                   CRGGISLIDGTVAAQKLLSAIVRTGQRFGAAYVCDVVHGKESESIRRNGHAALKTFGVG
FT                   NDKPVAAWRALLRQLFAAGAVAENTDGYGGLVMTEKGEAILFGRETIEVRPDPEPKKAE
FT                   PRSRRATPRDDEANALSEADEALFQHLRGLRATIARAEGIAAFMVFPDRTLIEMARSKP
FT                   VDLWALRTVHGVGERKREAYGERFTDTIREFLADAKRAG"
FT   CDS_pept        complement(7506..7784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0007"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0007"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21687"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21687.1"
FT                   /translation="MASDYAFKLHNRAEGYSITGFYTYQNGRWSRNWIGGSINPGQSAS
FT                   LDWNSNDGDCVVPFRVKWRDYGSDDFKLDWCKGVSNVYMKDKGFTYD"
FT   CDS_pept        8160..8846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0008"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0008"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21688"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21688.1"
FT                   /translation="MRTADKQIADILVRFGEPFAGNVWRVQGTAVIYHKTLERIAAHTK
FT                   IRFDPPTLLRSERDEAVILVTGHMPGEKAGEERVEWSIGEALVNVNYRVSGRQAAYVYA
FT                   MAEKRAKDRVILKLIELHGLVYSEEEADEFRQNQPMAIRAVDEDFDAPPAFDEVTEQEA
FT                   DLKRLIDEAESINAVTDLMLDERTQGILNAMPHGTREEVRDYAKARLRALGWPPAKKGG
FT                   RGSRAA"
FT   CDS_pept        8968..11169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="METD_I0009"
FT                   /product="Helicase"
FT                   /EC_number="3.1.11.5"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0009"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21689"
FT                   /db_xref="GOA:C7C6G5"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21689.1"
FT                   /translation="MNTSVRPGDLDGSTPLDMLAGSVERVTFHSAETGFCVLKVHARGR
FT                   RDLVPVVGHAPAIAAGEWLTASGRWVTDREHGLQFRADTLQVTPPTGIEGIERYLASGQ
FT                   MRGIGPMMAKRIVARFGEAVFEIIEAEPARLTEVEGIGRKRAARIVKGWAEQKAVREIM
FT                   IFLHAHGVGTARATRIFRTYGGDSLKVMAEDPYRLARDIRGIGFRTADAIALRLGLARD
FT                   APQRLAAGVSYALQTAMDEGHCGLPVERLVRLAAELLDVAPDLIRLAAALVLREGREVV
FT                   ADTLRGEPCLFLKGLHGAERVIAMQLAERAAGPPPWAAIDFALARPWVEAKTGKTLSAS
FT                   QAEAVGLVLRSKLCVLTGGPGVGKTSTLDAILRILTAKGVRVLLAAPTGRAAKRMAEQT
FT                   GLDARTLHRLLEIDPRNGGFQRNEDNPLDCDLLVIDETSMVDVPLMHALLKAVPERAGL
FT                   ILVGDVDQLPSVGPGQVLADVIASGTVPVARLTEIFRQAAQSRIVVNAHNINTGRMPAA
FT                   PAKGEDSDFYLVEIEDADEGVETLIELVTRRIPRRFGLNPTRDIQVLTPMIRGSLGSRN
FT                   LNNALQRVLNPSPSAEVERFGWRFAPGDRVMETRNDYDRDVFNGDLGTISAIDAEDEAL
FT                   VVDFDGRAVIYPFNELDTLVPAFATTIHKAQGSEYPAVVIPVVTQHRTMLARNLLYTGV
FT                   TRGRRLVVLIGQRRALAMAVREGASRRRWTKLREWLDAA"
FT   CDS_pept        11313..12497
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0010"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0010"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21690"
FT                   /db_xref="GOA:C7C6G6"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21690.1"
FT                   /translation="MRQVFYLPGFDPREPETYWGLFRRESRITAERRGMAIVVGDPVRS
FT                   ADGISLDWDVESEAEGEATRVRYSLLRWDDIVRDRFPRSNLRRLASLPGLWWRLWRSGY
FT                   LRKFQREARRFYRVIVSVHQFYLVFVLASLALAVAAVTLTPLAALPTLAGIALVPLLAY
FT                   AILALVTHLTRGKPLYVTHLVDDTAFTHDHASGRETAMRERLGPWAERIRAAEGRASEI
FT                   VVIGHSSSSFLAFECLDRILKADPEFGRRGTPVTLVTIGSVIPWLTLDPLAEDARGSLG
FT                   RIGGDAAIGWLDIRASWDWLSIHLRDPVSASGLPAPPPGRFAVMRVEIEDLIEPALVAR
FT                   RRWNLFRMHFQLLMSSRERKAFDYVAFVAGPEPVHAAVERCRTQRPVTASAEFT"
FT   CDS_pept        12688..14913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purL"
FT                   /locus_tag="METD_I0011"
FT                   /product="phosphoribosylformylglycinamide synthetase"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="6.3.5.3"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 1398079, 8828210;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0011"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21691"
FT                   /db_xref="GOA:C7C6G7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21691.1"
FT                   /translation="MFRNDVPITPELVRQHGLTPDEYERFRALVGREPTLTELGIVSAM
FT                   WNEHCSYKSSRKHLRGLPTSGPHVIQGPGENAGVIDIGDGLACVFKMESHNHPSFIEPY
FT                   QGAATGVGGILRDVFTMGARPIAALNALRFGSPDHPRTRHLVSGVVAGVGGYGNSFGVP
FT                   TVGGLVGFHRRYDGNILVNAMAVGLARTDAIFYAAATGVGNPIVYLGSKTGRDGIHGAT
FT                   MASAEFDESSESKRPTVQVGDPFAEKLLLEACLELMASGAVIAIQDMGAAGLTCSAVEM
FT                   GAKGDLGVELHLEKVPTREEGMTPYEMMLSESQERMLMVLKPGMEAEAQAIFVKWGLDF
FT                   AVIGHTTDTLRFVIKHNGETVADLPIKELGDEAPLYDRPHIANTHQPVIAAASVEASVP
FT                   NAEALKRLVGSPELASKRWVYEQYDHFILGNTVQKPGGDAAIVRVEDGPKGLAISTDVT
FT                   PRYCEADPVEGGRQAVAEAWRNITAVGARPLAITDNLNFGNPEKPEVMGQLVGCLKGIG
FT                   EACLALDFPVVSGNVSLYNETNGVGILPTPTIGGVGVIDDVECHATVALKREGDVLVLI
FT                   GRTEGWLGQSLYLSEIAGREEGAPPPVDLAIERRNGDFVRSLIVSGIADTVHDLSDGGL
FT                   AVALAEMAMAGGLGAALPAAPEGVPVHAYLFGEDQGRYLIAVPAEAAADLLYSASAQGI
FT                   DASTVGIVAGDSLVLPGEETISVAELKAAHEGWFPAYMASQPAAPAA"
FT   CDS_pept        14941..15177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0012"
FT                   /product="BolA-like protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0012"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21692"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21692.1"
FT                   /translation="MPMDAREIESMIREALPDAHVEIKDLAGDGDHYAATVISAAFKGK
FT                   TRVAQHQMVYGALQGRMGGVLHALALTTGVPQD"
FT   CDS_pept        15251..15586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0013"
FT                   /product="glutaredoxin-like protein"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0013"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21693"
FT                   /db_xref="GOA:C7C6G9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6G9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21693.1"
FT                   /translation="MTDVNSTIKNEIDSQDVVVFMKGTPQFPMCGFSGQVVQILNYLGV
FT                   PFKGVNVLDDMAVREGIKAFSNWPTIPQIYVKGEFVGGCDIAREMFQSGELQQFLSEKG
FT                   VPVKSAA"
FT   CDS_pept        15659..16561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0014"
FT                   /product="putative FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /EC_number="1.8.1.9"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0014"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21694"
FT                   /db_xref="GOA:C7C6H0"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21694.1"
FT                   /translation="MHDVIIVGGGPAGLNAALILGRARRKVLLCDASQPRNAATPLTWG
FT                   LFTRDGTPPFDLRAKGRADLDRYETVECRDIAVTEAARDADGFTIIQADGTVERARRLI
FT                   LATGLAQDIPEIEGFETYWGTGVHSCPYCDGFEVRDRPLVVYGRGHGGCGLALELTGWS
FT                   QDVTLCTSGHDGDLSDKDRDRLARNGVAVIEAEIERLEGDGSRPTCLRFRDGSQTACTA
FT                   LFLMPFACSPSPLITQLGCELDETRSVVPTREYEKTNVPGLYVAGDASRRVQFAVVAAA
FT                   EGAMAAFAINAEFVAEATR"
FT   CDS_pept        complement(16174..16434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I16174R"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01950.1"
FT                   /translation="MVFSYSRVGTTLRVSSSSQPSWVMSGEGLQANGIRKSAVQAVWLP
FT                   SRKRRQVGRDPSPSSRSISASITATPLRASRSRSLSDRSPS"
FT   CDS_pept        16670..17554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0015"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0015"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21695"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21695.1"
FT                   /translation="MTPPVHPHTPRVAVACGCTLGEEVVWDARDGSLLWVDIENPAIWR
FT                   HWPATGETVRLPLDEKIGFAVLTPDPDRVVAGFKSGVAALRLSDGSRTPLVRPDDYPAG
FT                   NRLNSGNAGPDGWLYFGSMDDAEEAETGGFHRWDGARVETFGSPAAVTNGPVVSPDGRH
FT                   VYTIDTANGIVQVHALEDGRIGEARPLIRFEEGWGKPDGLTLDAEDHLWICHYGAGRIT
FT                   RFDPDGHVAYVVPMPTPLVTKCAFGGDDLSTLYVTTCLRGRDPTLEPMAGHLYKVETGF
FT                   RGFPANLLALPQT"
FT   CDS_pept        17728..17955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0016"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01951.1"
FT                   /translation="MEQVMPVFDGKYLTEHGESEALLAMILRPTPKAREEALERGRMRL
FT                   ERATMLAELAPAVPGTTLAAVKRADILPVD"
FT   CDS_pept        complement(17983..18816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0017"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0017"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21696"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21696.1"
FT                   /translation="MPETIEPRKGATGQPIAQPSPVEMLKQAVAGGPKAAAKATPPAAA
FT                   PTRKAFHLGANGRLAAASVTALVGGVCLGLVAAPQERSGAALAQVQAELSAGRSEAARF
FT                   AQEIDRLARTVTALRDASEAARGENKALGHTLTDRLSRTEQTLDKRLANFTETVARVER
FT                   DQTERMTSAIAQWEKKLQPVAAAPAKAESKLETRAAEPTQTGSLPDKPKSDTLEGWALR
FT                   DVYDGVAVLEDRRRRLVEVGRGDAVPGIGRVEAIERRGRQWVVVTRQGVITPQAW"
FT   CDS_pept        complement(19186..21231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0018"
FT                   /product="putative sensor hybrid histidine kinase with
FT                   PAS/PAC motif and response regulator receiver domains"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0018"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21697"
FT                   /db_xref="GOA:C7C6H3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21697.1"
FT                   /translation="MSSTEERVLILTPRGRDAAVIEGVLDRSGIHATVCANVAAWLTGL
FT                   REGAGTALVTEEALADGDTADVFAWLDAQQPWSDFPFIVLATRQAGRRTQSAAELLRRL
FT                   GNVVLLERPINAETLTSAVVSSLRARRRQYQARQHLLERERAQEQLRLANEELERRVAE
FT                   RTREVETAHETLAFALDAAGMSSWDIDYVAGTHRRSPRFDAVFGYAGTGQSWDRETFLA
FT                   HVVDEDRETAEDAFASVPKTGRLDLECRIRRADGAVRWIAMRGRVKSGEADRPERIAGI
FT                   LMDRTDQHVTEEALRQAQKMEAIGQLTGGVAHDFNNLLTVIVGGLDMMLRRPDQPDRVK
FT                   RLAEAAMGAARRGEQLTQQLLAFSRRQMLRPQTLNPNRLLLDFRPLAERAATGAVELAF
FT                   DLDPALDPIRIDPAQFESAVLNLIVNARDALEGRGGHARIAVTSRNVRLGTAAVADRGV
FT                   PPGPYVVISVTDTGSGIPPDKLQRVFEPFFTTKEVGKGTGLGLSQVYGFTRSAKGFAQI
FT                   ESEVGKGTTVSLYFPRSTDPAGEEIGPGPVGAIPLRRAGEGETVLLVEDDEQVLGMAVE
FT                   SLEELRYRVIVTRNAAEALEHLHGVERIDILFSDVVMPGGMNGSQLAVEARRVRPDIKI
FT                   LLTSGYVANLDEGQVIGQGELPVLNKPYRRDELARSLRLVLGGERA"
FT   CDS_pept        complement(21231..22757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0019"
FT                   /product="conserved protein of unknown function,
FT                   ATP-binding domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0019"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21698"
FT                   /db_xref="GOA:C7C6H4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010624"
FT                   /db_xref="InterPro:IPR014774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030665"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21698.1"
FT                   /translation="MNEAMSTTSTRSGSETRISTGISGLDEVLCGGLTPDRLYLLEGTP
FT                   GTGKTTLALQFLLEGAARKGRSLYVTLSETADELRAAALSHGWSLDGIELYELVNEMGL
FT                   DPDSEQSILHPSEIELGETVREVMARVESLKPERVVFDSLSELRLLAQNPLRYRRQILA
FT                   LKQFFAKRACTVLMLDDRTSEAGDLQLHSIAHGVISLDQNPREFGSERRRLRIVKMRGI
FT                   KFRGGYHDFVLETGGVQVFPRLIAAEHRATFDPTAQSTGSDELDLLLGGGLVPGTNTLL
FT                   LGPSGVGKTTTGLRCMLAALERGETATYYLFDEGLATMIARATMLGMDLRPHLGTERLT
FT                   IMQIDPAELSPGEFASIVREAVEERGSTFVAVDSLNAYLHAMPGEEHLILQMHELLSYL
FT                   NQKGVTTLLVLGQHGVIGEVRTDIDLSYLSDCILLFRFFEASGEIRTALSVVKSRVNPH
FT                   ERTIRELRLSTDGLRVGEALSDFEGVLTGLPAYRGRVEMLKGPRETGDGA"
FT   CDS_pept        23143..24348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0020"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0020"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21699"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018721"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21699.1"
FT                   /translation="MLVNGAYGPEERALVLERQRTLKMAQSAHAYVRGNTLKFYEWLEG
FT                   LTRGTLPEGPPVWICGDCHLGNLGPLADADGRVDIQIRDLDQTVIGNPTHDLVRLGLSL
FT                   ASAARGSDLPGVVTARMLEQMLLGYAAGLGQNETNREPSEPDAVRSVRRRALGRHWKHL
FT                   ARERLKGVEPAIPLGRKFWKLDTEEREALDGVFQEDAVRHLVLALNGRSDEAEIRLIDA
FT                   AYWMKGCSSLGFLRYAALVGITEPGNKRRLALVDLKEAIEPAAPTAPGVAMPSEPAERV
FT                   VAGARALSPNLGERMLPVRLLGKSAVMRELAPQDLKLDVDQFGREEAVRAAHYLAHVVG
FT                   KAHGRQMGAETRAAWRTEITRGSDVDEGAPSWLWSSVVELAGRHEVGYLQHCRRYAGQE
FT                   AA"
FT   CDS_pept        complement(24379..25377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0021"
FT                   /product="putative short-chain dehydrogenase/reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0021"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21700"
FT                   /db_xref="GOA:C7C6H6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21700.1"
FT                   /translation="MGHKPLNEQVIVITGASSGIGLATARMAARRGARVVLAARSEDVL
FT                   ADIAAEFGTRATYVVADVGRREDVQAIADHAVATFGGFDTWVNVAGLTVYGPLRKIALE
FT                   DHERLIQTNLWGTVYGSLIAAEHLRGRGGAIINVGSIASDLAFPFQGLYATSKHAVKGF
FT                   TDTLRMELIAEGAPVSVTLVKPASIDTPLPNRARNYMDREPTLPPPIYPPKEVANAILH
FT                   AAVHPQRDIFVGGGGKLFVMGKEFAPGAYDELASAIIAQQKRTEPPRNPKGALHAPQGA
FT                   GRERGDPPIYVMRSSAYTRATLHPLATAGLAAGLAATAALVLGGKSARRRP"
FT   CDS_pept        complement(25500..26186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0022"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0022"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21701"
FT                   /db_xref="GOA:C7C6H7"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21701.1"
FT                   /translation="MGEGDVMDGMAEGRGLLSDQIRNALTDEIASGVLAAGIALDEQDL
FT                   ADRFGASRTPVREALRQLASSGLVEMRPRRGVVVTRMTPERIMEMFETTAEFEALCVRL
FT                   ATYRMTPLELSALMDLHEQSAEPVAAQDYDTYDALNRAFHEALYRGTHNGFMAEQALAI
FT                   RSRLSAFRRTQLRQGERILRSRAEHGEILQAIAEGDGDAAARRMRAHMLNAASALGRYV
FT                   ADHASD"
FT   CDS_pept        complement(26192..26509)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0023"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t :
FT                   transporter;malonate transporter (C-terminal fragment)"
FT                   /db_xref="PSEUDO:CAX21702.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        26832..28478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="METD_I0024"
FT                   /product="malonate decarboxylase, alpha subunit"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0024"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21703"
FT                   /db_xref="GOA:C7C6H9"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6H9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21703.1"
FT                   /translation="MSGWGRERAARDARIEAGRAHAAGKVVTAANVVALLEAILQPGDR
FT                   VCLEGDNQKQADCLARGLSQCDPACVHDLHMVQSGIVLPEHLDIFEQGIAKRLDYSYSG
FT                   PQGARIARMLYGGQIELGAVHTYLELFARYFVDLTPNVALIAGVSADRDGNLYTGPNTE
FT                   DTPTVVEATAFKNGVVVAQVNEIVDRVPRVDIPGDRIDFVVKADRPFYVEPLFTRDPAA
FT                   MTETQILMAMMAIKGIYAEYGIRRLNHGIGFGTAAIELLLPTYAERLGLKGQIATHWAL
FT                   NPHPTLIPAIESGWVKQVHCFGSEVGMDRYIRERSDIFFTGADGSLRSNRAFCQTAGLY
FT                   ACDLFIGSTLQIDLAGHSSTVTQNRVAGFGGAPNMGSDPHGRRHPSDTWMKAGREAQVT
FT                   GDPALMRGRKLVVQIVETFGEGLVPAFVEQLDALELARKIGLELAPVMVYADDVTHIVT
FT                   EEGIANLLLCRTADEREQAIRGVAGYTEIGRGRDRAMVERLRQRGIVRRPEDLGIEPLD
FT                   ADRSLLAARSIKDLVHWSGGLYEPPAKFRNW"
FT   CDS_pept        28486..28794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcC"
FT                   /locus_tag="METD_I0025"
FT                   /product="Malonate decarboxylase acyl carrier protein
FT                   (Malonate decarboxylase delta subunit)"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0025"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21704"
FT                   /db_xref="GOA:C7C6I0"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21704.1"
FT                   /translation="MEKLSFRHTTQRALAGAKAQAITGVVASGNLEVLLERALAPTECS
FT                   VEIETPIRGYGEVWAAVVADFVARSQPGGLRITINDGGARPDTVSLRLLQGARLMEV"
FT   CDS_pept        28797..29729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="METD_I0026"
FT                   /product="malonate decarboxylase, beta-subunit"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="6.4.1.3"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10339824; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0026"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21705"
FT                   /db_xref="GOA:C7C6I1"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21705.1"
FT                   /translation="MSERIIDPAAKGWATSWYEASARARLDGLLDAGSFREVIGPEQRQ
FT                   MSPHLPLFDLPRAFDDGMIVGSGRLDGKPVLVAAQEGRFMGGAFGEVHGAKLVGLLRAA
FT                   LSLKPDAVLILFDTGGVRLQEANAGETAIAEVMRAITKLRAAGVPVIGLIGGRAGAYGG
FT                   GGLIAGTCSRLVVSEGGRISVSGPEVIETNKGAEEFDSRDRALVWRTMGGKHRRLIGGA
FT                   DAYADDTVAAFRQAALDQIGRAPAFDLATLEAEQARLEQRLTRFGDCRDGTEIWARLGV
FT                   NDPEAVPALTTADFDVLLASLGETTHDAR"
FT   CDS_pept        29716..30432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="METD_I0027"
FT                   /product="Malonate decarboxylase, gamma subunit"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0027"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21706"
FT                   /db_xref="GOA:C7C6I2"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21706.1"
FT                   /translation="MTLAEILTSLFPEGHSVTVAEGLVNGEGPFRNGRLAVIGIDGDTA
FT                   LGVDGACRLAGYVLDVVRRGGATPILVAIDSDSQRMSRRDELLGLNEYLAHLAKTLLLA
FT                   DAKGHPTVGLIYGHSAAGAFIATALATRVLVGLPGANPSVMDLPSVARVTKLPLDRLEA
FT                   MAKDTPVFAPGLDNMVRTGAVQAVLDPDQPLAEQIAAVIDALPTEDTRDRAGRERGGRP
FT                   VAEAIAAQVVREAAVG"
FT   CDS_pept        30425..31084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0028"
FT                   /product="phosphoribosyl-dephospho-CoA transferase"
FT                   /EC_number="2.7.7.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0028"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21707"
FT                   /db_xref="GOA:C7C6I3"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21707.1"
FT                   /translation="MAEAHRRHDLLDVEPGAWAAAVTARADLAGVPHVAAWVDDGRPVI
FT                   LRRSHPGEDAGLVPVGLPLPPRDGKRRIGLALPPDAVRPRAHVLLSEARAACPPSWAAT
FT                   LEALIALGERYDLAPRPFGSLLWQSLTGLPYLSERSDLDLLWPVSDAIPSRLMEGIAAI
FT                   EARAPMRLDGEILLSDGGGVNWRELHGAGPGGTVLVKHRDRLALREAAALLAGDPE"
FT   CDS_pept        31081..31938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="METD_I0029"
FT                   /product="2'-(5''-triphosphoribosyl)-3'-dephosphocoenzyme-A
FT                   synthase"
FT                   /EC_number="2.4.2.52"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0029"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21708"
FT                   /db_xref="GOA:C7C6I4"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21708.1"
FT                   /translation="MSALFAPRARPPEDARCPADAIARSAATALRLELETYPKPGLVSH
FT                   VDRGSHADMDADTFRASTVAITPFFRALAIAGAAGAPMPALRRIGLEAEAAMRAATGGV
FT                   NTHRGAIFGLGLLCAAAGALKRPGAGALGALVRDRYGSAILDGPVLLHAPGARARRRHG
FT                   VGGAPAEAAAGFPSLYRVALPALRRGRQCHPGDAEAARVEACLALIAHVEDTNLLHRGG
FT                   TEGFAFARGEAARFIADGGVAQPRWRARAEALHRAFVTRNLSPGGAADLLAMTLFVESV
FT                   EASA"
FT   CDS_pept        31935..32858
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0030"
FT                   /product="Acyl transferase domain protein, putative malonyl
FT                   CoA-acyl carrier protein transacylase (MCT, fabD-like)"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="2.3.1.39"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 9642179; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0030"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21709"
FT                   /db_xref="GOA:C7C6I5"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21709.1"
FT                   /translation="MTLAVLLSGQGGQHPGMFDLTADWAPAAPVFAAAERVLGQDPRAL
FT                   VRAPGADLHGNRTGQILCCVAALAGWTLVQAAHPARTIVAGYSIGDLAAWGCAGRFDAE
FT                   TILRLAATRAEAMDAAAGDGAGLAGIRGLPIAAIETLAAAQGCELAIRNASDSAVIGGP
FT                   SPALETLCAEALAAGALRAVVLPVRTPSHTPLLREASQRFEAALAGMQPMRLQPGAPRL
FT                   ISGLDGAPVFDVHAGLSKLARQISHTIDWAACLEACREYGCDTVLELGPGHALATMARN
FT                   AIPEARVHALDEFRSASGVTEWIGGR"
FT   CDS_pept        complement(32996..35380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0031"
FT                   /product="putative General secretion pathway protein D"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0031"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21710"
FT                   /db_xref="GOA:C7C6I6"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21710.1"
FT                   /translation="MAIRAHVLALTFGLALGPSGAAFAAEPLSGPGYGPRPSGGFILRG
FT                   NDRFIAGEAPAAQALPGGLVSLNLVEAPLPNAAKAVLADTLGLGYTLDPQATGTVTLQT
FT                   GGAVTREALLQMFEAALASRGLVLRRRGRIAQIAPVATDPNAVRAVRGPAAEAGAVAVP
FT                   LRWVSAVEMQAILTSVAPRDVVLRADRARNLLILNGDATQIRALRQTIEMFDVDWMRGM
FT                   STAMLPVRSASPVTLARDMTQMFGGEAAGTGDVIRFIPNEALSAILVVSSRAVYLDRAR
FT                   VMLEQMEVLAAERERQLFVYRIQNRSARELAAVLQGVVAAETGAPVNVSSGSGAAQAGL
FT                   GGGFAQGAGAMSGGLAAGYGGPGGSGYGSSSGSAGLSGPGAPYGAGYGSDAATGGAGAT
FT                   GAYGSTGSMPGTGSAGGMSPMGGAGMDGTGGQPAGYGAAPAAHGGGYGAETGMAGGYGG
FT                   AYGARRDAIGVVADEANNSLVISATRNQYDKILRILGRLDAMPTQVLLETVIAEVTLNN
FT                   ELQFGVQWFLKNSGSRFNLAQADTNRSVAQGTSGTDALIKAAVRGVPGFNYLLNASDFN
FT                   VVLNALQGVTRVNVISSPNITVLDNRTAKLQVGDQVPIVRQSGQSAFAAGAPILNQIEM
FT                   KDTGVILSVTPRVNKNGLVVLDINQEVSDVVKTTTSEINSPTIRQRRVATSVAVNDGHS
FT                   LAIGGMVQEKAQITNESVPVLGDLPIVGPAFRNRIDGRVRTELIVFIRPKVIRGTVEAD
FT                   RIAEDFRQQFRAMMPIRPVPAPLPMAAMPIGPDGVLRRMID"
FT   CDS_pept        complement(35472..36341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0032"
FT                   /product="putative general secretory pathway protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0032"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21711"
FT                   /db_xref="GOA:C7C6I7"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21711.1"
FT                   /translation="MASGEQGFVLPAVLAVMIVVSAAALIATDRHRTRTAVAESQTRGL
FT                   RLQGLADGAARLVATGIVLERTRGMPGLGLPRNGAAIACGLPEGRRLVLALQDQAGLID
FT                   LNAAPRPLLEAAFRALGIGDADALRLAAEVIDYRDADDDPEPGGAERSQYAARGLSHGP
FT                   RNALFTSIDEIDRLPSMTPERAALLRGALTIYNPGGGLDPGLAPVRALAEGVAGDRLRP
FT                   HAALSSGQYVEIRAAVSDGRGRALRSAIISASGTGTPVLSWQPDGPDLVGGVAHPACGP
FT                   LSAALIRP"
FT   CDS_pept        complement(36356..36967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0033"
FT                   /product="putative general secretion pathway protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 1944223, 2129543;
FT                   Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0033"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21712"
FT                   /db_xref="GOA:C7C6I8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21712.1"
FT                   /translation="MVEAGAGAAAGPGEAGFSLVEMLVSLALMSLVALLLLQAIGTAGL
FT                   LSRFGGRLAAETDLDIVRDHLRTSLSRLVGRGTDGRRPPFRGEPERFSGMVLASRDAER
FT                   GGAVRQTVWAVRRDDGTIDLVEARSLGKDGASPPEVLVSRAVALRLRYFGSDHTDPQPR
FT                   WQPAWGRRDRPPTLIEIGLDFPPGDRRRWSPLIVPLGVGQ"
FT   CDS_pept        complement(36960..37355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0034"
FT                   /product="putative general secretion pathway protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0034"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21713"
FT                   /db_xref="GOA:C7C6I9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6I9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21713.1"
FT                   /translation="MTPHRSIPEGAEDGFTLVEMLVAFAIVALCTVTALQISASLTRQG
FT                   AGVEAALRASDEAQGIVWLRFALGSLRPGQETGRFSDGSPWVLTVSDVAPVLGWRDVPP
FT                   VWHLRLTRDGPRGAIVYETVLAAGLGG"
FT   CDS_pept        complement(37352..37825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0035"
FT                   /product="putative general secretion pathway protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0035"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21714"
FT                   /db_xref="GOA:C7C6J1"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21714.1"
FT                   /translation="MTGAPARSGTAGFSLVEMLVVLAVLGLVASLAVPALGNLLPGRRL
FT                   DGTASAVAGELTRLRAQARRTGAPASLTYDPARALFVSSRPGAAPIAAADLAVTVLRSE
FT                   ASRAGPGEIRFLADGGSTGGAIRLDGRAGARLLSVSSLTGRVTERVTEAEAPR"
FT   mobile_element  37880..38291
FT                   /mobile_element_type="insertion sequence:MiniMdi3"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Potential MITE associated with ISMdi3; Evidence 3 :
FT                   Putative function from multiple computational evidences"
FT   CDS_pept        37946..38257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0036"
FT                   /product="protein of unknown function associated with
FT                   transposase of ISMdi3"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 5 : Unknown function; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0036"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21715"
FT                   /db_xref="GOA:C7C6J2"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21715.1"
FT                   /translation="MRRGQKTSAEQVVLKLRQIEVQTAQGKSLALACKEAEISEQSYRD
FT                   VCLRQEIFYSSREAQIVIGLWQNTYNRVRPHLSLGYRPPAPVSFPDLAFRLPMAAVLQ"
FT   CDS_pept        38421..38633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0037"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0037"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21716"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21716.1"
FT                   /translation="MKSLKKLARVLTDEVHGEFCLTLEAEDGEAFGIRMTEKQIEDLIQ
FT                   ELDDLLGDDTDEEDAVTERKEMGDE"
FT   mobile_element  complement(38647..38751)
FT                   /mobile_element_type="insertion sequence:ISMdi3"
FT                   /function="17.3 : Transposon functions"
FT                   /note="fragment of Insertion Sequence ISMdi3(1142-1246,
FT                   Id=90.48%), IS3 family; Evidence 5 : Unknown function"
FT   CDS_pept        complement(38830..39207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0038"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0038"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21717"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21717.1"
FT                   /translation="MSVAAKSISAVKKKNRGAAARRPIPLLGRDRDLVSRANMPDPYEP
FT                   GAFRDVQVNRRVDVLAQELASERIEFEVGRIIQAVFERDSGARLGSGGWNAGGSRDQTV
FT                   AHELAIIYAIDDAEQVRKFTA"
FT   CDS_pept        40276..40584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0039"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0039"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21718"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21718.1"
FT                   /translation="MNGRVPPRQTLCNGERNTQVHPALASGMAWQEAAMKIFQVRQRIT
FT                   DSVLWVGSAHNEVGALDAMAHEAGYYDYSDLPDEVRHGGLMVEAVTLKVQPMIISQS"
FT   CDS_pept        40718..41089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0040"
FT                   /product="protein of unknown function; putative membrane
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0040"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21719"
FT                   /db_xref="GOA:C7C6J7"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21719.1"
FT                   /translation="MPLTSLLPPIAAATVLNAFLFALAWRAVKRERNSGRQSSLLSFGL
FT                   MIYGALSMGGLYIIRGQSLAAYTEVFFVAAVGEALGGGIVYATLSAFVFMRGQNIERRV
FT                   VPIFAAIFLIGILVAVALS"
FT   mobile_element  42082..42913
FT                   /mobile_element_type="insertion sequence:ISMex15"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Insertion Sequence ISMex15, IS5 family; Evidence 3 :
FT                   Putative function from multiple computational evidences"
FT   CDS_pept        42149..42574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0041"
FT                   /product="transposase of ISMex15, IS5 family (ORF 1)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0041"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21720"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21720.1"
FT                   /translation="MGEFWLTDEQFAKIAPHLPTDTRGKERVDDRRVISGIIHVLKSGG
FT                   RWTDAPREIYGPKKTLYNRFVRWAAKGIWRDLFETLARAGGPPSQVLIDSSAVKAHRCA
FT                   SGGKGGSKAMPSAARGVDAPPRSTRSPTGSAARSPSC"
FT   CDS_pept        42349..42903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0042"
FT                   /product="transposase of ISMex15, IS5 family (ORF 2)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0042"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21721"
FT                   /db_xref="GOA:C7C6J9"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21721.1"
FT                   /translation="MGGQGDLEGSVRDPGPGRWATLPGADRLLGREGASLRLRWKGGEQ
FT                   SHAIGRSRGGRTTKIHALTDRFCRPLAFLLTGGQVADCKAGAQLLEGAPACRIMLADKG
FT                   YDSDAIRRQIEATGAAPNIPPKSNRRWKPCFSPVLYKGRNAIERMFGRLKDFRRIATRY
FT                   DRLAANYLAAVCIAATVSYWL"
FT   CDS_pept        42563..43543
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_ICDS42563D"
FT                   /note="Evidence 5 : Unknown function;Protein of unknown
FT                   function"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        43148..43609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0043"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0043"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21722"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21722.1"
FT                   /translation="MIALENILISLLAGATDRQLDLAREMVGYISPRPGFTQHPLTTQA
FT                   ASQMIDLLQRANQFREPPPLAEPYKITDVFDEISLPAGLRKEHRTKLGTWGVIRVLNGR
FT                   LRYVILNPASETIIEPGHPGLISPDQAHFVEPLGSMRMQIEFYHQRPDL"
FT   CDS_pept        43940..44143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0045"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0045"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21723"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21723.1"
FT                   /translation="MTDEEFAELERVIQGREEEVAARIATLLSLSEAGFDTTEAEAALW
FT                   RKTDSLTVLRQYQATIVEERDP"
FT   CDS_pept        45341..45859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0046"
FT                   /product="putative integrase/resolvase recombinase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0046"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21724"
FT                   /db_xref="GOA:C7C6K2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21724.1"
FT                   /translation="MASQGRHGPRNRASLMLSYLAGLRVGEIATLCWCDLLDGGGKVRE
FT                   QLRLSAAVTKGGHARVVFLNARLRREIEQYRGTLGQHPALLQPVLITQKRSAFSANTLC
FT                   QLMRSWYDQAGLDGGSSHSGRRWFITRLAHSGISPKAIMMLAGHRHLSTTQRYIDVNDE
FT                   MMRAAVEVL"
FT   CDS_pept        complement(46637..46999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0047"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0047"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21725"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21725.1"
FT                   /translation="MRISDAWHHKRTHAFKFRLSVDEGVAPPPLPAGGCMPRYHFNVYD
FT                   GVNFLDKKGVELPDFMFARREAIRYAGVLLEEGARLESLGSEWRMEVTDGTELILLRLD
FT                   FFVTPSSAVGSLKKSE"
FT   CDS_pept        complement(48233..48526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0048"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0048"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21726"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21726.1"
FT                   /translation="MIGRHKIETLIILQPVTLDTGSSDQDGRLVLANGRVVAILVRLDA
FT                   SRHDGMEGWFLEVGLGHLRDLRPAPFDSLEAATRWLRQHLRGATVSTEGKTS"
FT   CDS_pept        complement(48529..49293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0049"
FT                   /product="Regulatory protein, Crp (cAMP Receptor Protein)"
FT                   /function="12 : Regulatory functions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0049"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21727"
FT                   /db_xref="GOA:C7C6K5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21727.1"
FT                   /translation="MKQALIRKLEGYEELSDQDRWALNGLVTKVRQVGARVDLIQEGDP
FT                   PENVHLILNGFACRYKVLPNGQRQIMAFLVPGDFCDLNVFILDHMDHSIGTISACQVVD
FT                   IPRQAIEEITANHPRITRALWWCNLVDEAVLREWLVNLGGRPANERIAHLLCELLVRLS
FT                   AVGCTKDNSYEFPFTQTDIADTMGLSAVHVSRSYRELRETGRITLKHRNLTIHDVEQLK
FT                   SYCGFNPNYLHLSNTRWKDRRNPTWLNQARSS"
FT   CDS_pept        49566..50198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0050"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family, with N-terminal cNMP-binding domain"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0050"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21728"
FT                   /db_xref="GOA:C7C6K6"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21728.1"
FT                   /translation="MTLALGEVLIRADTPIAYVHFVERGIVSLVAVARDGEQIEIGLIG
FT                   CEGMVGIPVLLGAESTPNEARVQAAGLAYEVPVDALRNVMRRNPELHEQLLRYAQVLNT
FT                   QVACTALANGRYKVAQRLARWLLMCHDRTEGDTLPTTHRFLSLMLGVNRPGLTTAVAAL
FT                   EREGIITTKRGTITICDREALLARADASYGVPEAEYERMMKGTVKPT"
FT   CDS_pept        complement(50602..50811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0051"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0051"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21729"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21729.1"
FT                   /translation="MLASGKPAKDARAYLFIGPSMRISPVVTAPAERPHARSEITIGPL
FT                   TTFARETPEEVVRAPCVERRQPAL"
FT   CDS_pept        complement(50850..51383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0052"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0052"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21730"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6J3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21730.1"
FT                   /translation="MSDLTRWDPAGLTAPTHPLALAACEALLRAKHTGQRPSASPSECQ
FT                   PAGAPASAQRSRPSPPQSVSQPQAHRTAAALLVPLTGFLKTFFDYRIETQKAEAMKPEA
FT                   ARDVAQGSGAALIDSMAVADLTTAIKDLTVAIRADTASDEAQHASQFAQVLQRLTDVLD
FT                   VHDNTHGHPPRRGR"
FT   CDS_pept        complement(51430..52740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0053"
FT                   /product="putative site-specific recombinase"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0053"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21731"
FT                   /db_xref="GOA:C7CLX8"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21731.1"
FT                   /translation="MSTPANAPGERYQLFRRSGSTRWQVRFSIKGQGQFKRSLDTDDER
FT                   EAERRAEAIWYEATYRAKQGLTAKTHTFDSVAEAYIAQIHREVERGERRADQGKSEPAV
FT                   IRRYFIGYFGDKPVDAVTEADLERYAEWRRTYWTEGPGKLIEHIEYERDGHRLRRPVRR
FT                   SAPSLSRQRGETVVLRWAARQGYMKTPPEISIKARRSPDNRRPSFEPHEFARLEAVSLS
FT                   RLVDPIMDGTGAEVRASNRRSWRIKRLDDHTRRDRTVLHAYVMIGAFSGLRPTEMYNLT
FT                   WGDVLGYRAGRGKSVDDRDIRLQVRGKGKSGKAIPQKAAIPWFDTLWMLFERSLGREPV
FT                   DSDPVFASETGKRITSVANGFTELLKAAGLERDHRGIKRTPYSLRHFYISEQLANGAEV
FT                   LDVARNCRTSLAMIDKHYGQVRLERVVDRLRPEWTRA"
FT   tRNA            complement(52943..53019)
FT                   /gene="trnM"
FT                   /locus_tag="METD_MTRNA58"
FT                   /product="tRNA-Met"
FT                   /note="Met-tRNA (tRNA1); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        complement(53123..54364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="METD_I0054"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="4.2.1.20"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 2271543; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0054"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21732"
FT                   /db_xref="GOA:C7CLX9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21732.1"
FT                   /translation="MTLNPAPNSFRTGPDERGRFGIFGGRFVAETLMPLILDLEKAYAD
FT                   AKADPSFKADMESYGTHYIGRPSPLYYAERLTEHLRAQAPAGQGAKIFFKREELNHTGS
FT                   HKVNNVLGQILLARRMGKPRIIAETGAGQHGVATATLCARFGLKCVVYMGAVDVERQAP
FT                   NVFRMKMLGAEVIPVQSGTRTLKDAMNEALRDWVTNVSDTFYCIGTVAGPHPYPAMVRD
FT                   FQSVIGIETKQQMLEMEGRLPDSLIACIGGGSNAMGLFHPFLDDRDVEIYGVEAAGHGV
FT                   QSGLHAASLTGGRPGVLHGNRTYLLMNEDGQIADAHSISAGLDYPGIGPEHAWLHEMGR
FT                   VTYLSATDAETLEAFKLCSMLEGIIPALEPAHALSKVMELAPTKPAEHLMVLNLSGRGD
FT                   KDIPQVAQIFGQTL"
FT   CDS_pept        complement(54487..55134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="METD_I0055"
FT                   /product="putative phosphoribosylanthranilate isomerase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="5.3.1.24"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 10360571, 9166771;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0055"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21733"
FT                   /db_xref="GOA:C7CLY0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21733.1"
FT                   /translation="MADICVKICGLSTEPTLDAALDAGADLVGFVHFPKSPRHVTLEQG
FT                   RGLAQRARGRAQRVVLLVDPDDALLAAAIEALDPDLIQLHGRETPQRVAEIRARTGRPV
FT                   MKAVGIAAVADLRALPAYAIVADRLLLDAKPPPGADLPGGNGRCFDWDILKGSELPAGT
FT                   MLSGGLDSGNVGTALARTGLVAVDVSSGVEIRPGEKDPDRIAAFVAAARRRA"
FT   CDS_pept        complement(55158..55526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0056"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0056"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21734"
FT                   /db_xref="GOA:C7CLY1"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21734.1"
FT                   /translation="MIRFLKALILLPIAVVVVLLAVANREAVTLSFDPFSPEPVFSLVL
FT                   PLYAVVFGSVALGILVGGIGSWLGQSRTRQRARYHRREADRLAKEAAELKTFGTPGVEP
FT                   GYAGAGTYTALPAPAAAR"
FT   CDS_pept        complement(55752..56060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="METD_I0057"
FT                   /product="integration host factor, beta subunit"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 8407826; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0057"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21735"
FT                   /db_xref="GOA:C7CLY2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21735.1"
FT                   /translation="MIKSELVLKIAEQNPHLYQRDVETLVNAILDTIADALAQGDRVEL
FT                   RGFGAFSVKRREARRGRNPRTGESVAVSEKAIPVFKTGKEMRLRLNRAGIGDEQPGA"
FT   CDS_pept        complement(56102..57067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sppA"
FT                   /locus_tag="METD_I0058"
FT                   /product="putative peptidase"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0058"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21736"
FT                   /db_xref="GOA:C7CLY3"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21736.1"
FT                   /translation="MAADAEFLIDRRRLRRKLTLWRMLGIGAAIVAVGALGYRARVGEG
FT                   RLFPATENQIARISIGGFIAGSDSTRKLIERVGESNAVKGVVISISSPGGTTTGSEELY
FT                   RNLRALAAKKPMVAFVDGTAASGAYITAIAADHIVARETALVGSIGVLFQYPDVSGLLD
FT                   KVGVKVESVKSSPLKAEPSGFSPTSPEARAALSSIVLDTYGWFKGLVAERRGMDESQIA
FT                   AVADGRVFSGRQSLPLKLVDELGGERQAVAWLEKEKKVPEKLPVKDWKPKADGGFKLWS
FT                   TLGLGADLLGLEGLASRLRAVEDEAAGLSGGLLAVWRPAP"
FT   CDS_pept        complement(57328..58653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0059"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0059"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21737"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030807"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21737.1"
FT                   /translation="MANRLSSLGANLRWLRGQRPGRRSDPLPSHFDSERYLDLNADVAM
FT                   AVEAGLVASAEEHYRVFGRREGRPIQVPSATAELGGGIAGQWTYRYPYRAWPELPAIAF
FT                   AAPRPGPEDDAIARRLIAAWQSGAGRASVQADSEGMWAARTQGFPGFHRALQGGDASAL
FT                   AGLLNNLFQSHLAHGIAMGRTMATLARHAPTPFAASWCDRLLRLSEAVGLAPIRSPEQG
FT                   DYAAALPGPLAHHVAPARLEAELGFPLAFPEVGAPFGVRYGAGILPEHALTHAYAAWRV
FT                   GQLGRFDRVVEIGGGFGGLAWFLRHPGRHYTILDLPFTNVLQGWFLLKAGLDVSLAGEP
FT                   DAAIRVRPWWEIERNERYDLAINQDSLPEMPPETAAMYIARIRAIAPLFYSINQEAAAP
FT                   NTDAFRQAVVADLVARDGGYRRLGRHLFWMRDGYVEEIYARR"
FT   CDS_pept        complement(58746..60458)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="METD_I0060"
FT                   /product="30S ribosomal protein S1"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0060"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21738"
FT                   /db_xref="GOA:C7CLY5"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21738.1"
FT                   /translation="MSAGLNVSSSAREDFAALLEESFLQHEITEGSVVKGTVVGIEKDV
FT                   AVIDIGAKTEGRVPLKEFTGPGREGELKVGDEVEVYVDRIENALGEAVISRDKARREES
FT                   WVKLEKAFEANERVTGTIFNQVKGGYTVDLDGAVAFLPRSQVDIRPVRDVTPLLGTPQP
FT                   FQILKMDRRRGNIVVSRRTVLEESRAEQRSELVANLEEGQVIDGVVKNITEYGAFVDLG
FT                   GIDGLLHVTDMAWRRVNHPSEVVTIGQTVKVKIIKINHETHRISLGIKQLLADPWEGIA
FT                   ARYPEEAKLKGRVTNITDYGAFVELEPGIEGLIHVSEMSWTKKNVHPGKIVSTSQEVEV
FT                   QILEVDSVKRRISLGLKQTLQNPWDAFAEKHPVGSEVEGEVKNKTEFGLFIGLEGDVDG
FT                   MVHLSDLDWNRPGEQVIEEFKKGDMVRAQVLDVDVEKERISLGVKQLGGDPFAEAGEVK
FT                   KGQIVTCEVVEVKDSGLEVKLVDTDMQTFIRRAELARDRGDQRPERFAAGEKFDARVIQ
FT                   FDRKARRVQVSIKALEVAEEKEAMAQFGSADSGASLGDILGAAFNKKKGGDEE"
FT   CDS_pept        complement(60873..61679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rrm1"
FT                   /locus_tag="METD_I0062"
FT                   /product="rRNA methylase"
FT                   /EC_number="2.1.1.34"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0062"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21739"
FT                   /db_xref="GOA:C7CLY6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004441"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21739.1"
FT                   /translation="MTPPRDRPAKPYGFRPRPRTQPPGPAAREGRDHVVLYGWHPVSQA
FT                   LANAGRHFHRLLATENALARLKEAGIELPIEPEMVRPSAIDRLLGPDAVHQGLYAEAEP
FT                   LAAPALDAMPDDALLLALDQITDPHNVGAIVRTAAAFGVTAIVTTARHSPNATGVLAKS
FT                   ASGGLEHVPLVIVRNLAEALITLGERGFTRIGLDSDAGTTLDAVGPRRPAVLVLGAEGK
FT                   GLRQRTTECCDLLVRIDATGAIRSLNVSNAAAITLYALTRSAGTAA"
FT   tRNA            61827..61901
FT                   /gene="trnE"
FT                   /locus_tag="METD_MTRNA1"
FT                   /product="tRNA-Glu"
FT                   /note="Glu-tRNA (tRNA2); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        complement(62331..62798)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0063"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0063"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21740"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21740.1"
FT                   /translation="MATSAGYLWGAGGFPLMQADGVVPEHAAHHRPQEQEGATAMADIR
FT                   SHDPLGRSDGGPASGRGGSSSGGGAADQARQALRDATDKASDAWDSASEYGSRYYRQGS
FT                   RAVGNVDSTTMTGFLVAGAIGFGLGWLVFGQHSYSGDYVARRMSRSSERDY"
FT   CDS_pept        63245..64183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0066"
FT                   /product="Pirin-like protein"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0066"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21741"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21741.1"
FT                   /translation="MSWHSADDPIPGDHFSCDAIQTLIVPRSRDLGSFAVRRALPSTEC
FT                   RMVGPFIFFDQMGPSEFLLGQGMDVRPHPHIGLSTVTYLFDGEIMHRDSLGTELPIRPG
FT                   ELNWMTAGRGITHSERTAPTLRQTGSRLFGIQSWVALSAREEESAPAFEHYDASALPVL
FT                   TGEGKTVRLIAGEAFGARSPVRTSSPMVYADVVLEAGAVLPLDPTYDERAIYTVAGAIE
FT                   IAGDGFGPGQLLVFRPGDRISVRATEAARFMVLGGEPMDGPRHLWWNFVSSRPERIAQA
FT                   KEDWRQGRFDTVPNDAEFIPLPEDPPPVRYP"
FT   CDS_pept        64286..66052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="METD_I0067"
FT                   /product="potassium:proton antiporter (CPA2 family)"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0067"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21742"
FT                   /db_xref="GOA:C7CLY9"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21742.1"
FT                   /translation="MAIEASGAANELVQVVSLLAAGVVAVPLFKRLGLGSVLGYLVAGL
FT                   AIGPFGVGLFTDAHAILHVAELGVVMFLFIIGLEMEPSRLWGMRREIFGLGLAQVGACI
FT                   AALTLVGVAMGFPVVVAFVAGTGFVLTSTAIVMQLLEERGSLSTPKGQRIVAILLLEDL
FT                   AIVPLLAAVALLAPGGAETSGAERAIAVAIALVSIAALVAAGRWLLNPLFRLLAAAKAR
FT                   EVMTAAALLVVLGSALAMQLGGLSMAMGAFLAGVLLSESSFRHQLEADVEPFRGILLGL
FT                   FFLGVGMSLDLAVIAANWGLILMSVAAYMAVKSLVIYGVARALRTKHAEALERTALMAQ
FT                   GGEFAFVLYAAAASAGIIDGTTNAILTATVILSMAITPLTVIAFDRFGPKATASTDGVE
FT                   APEDLVGSALIIGFGRFGQIVSQPLISRGCSVSIIDTNADNIRLAEGFGFKVYYGDGAR
FT                   LDILRAAGAATARAILICIDDRAMAKRIAEMAKAEFPLVPVLARARDREHAVELIEAGV
FT                   AYQMRETLESAFALGEQALVTIGADPDAAGEIMAEVRRRDAERLDLQVVGGLYAGRELI
FT                   RGNASMPTHGHG"
FT   CDS_pept        66232..66951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0068"
FT                   /product="Putative cytochrome biogenesis protein"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0068"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21743"
FT                   /db_xref="GOA:C7CLZ0"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21743.1"
FT                   /translation="MASHLGLAFLAGLLSVLSPCVLPLLPLVLGAAVAEHRFGPVALAA
FT                   GLALSFVAIGLFIATIGFALGLDSDRFRAIGAVLLVLLGIIMIVPAAQNRFAVAAGPLS
FT                   NWAEQRFGGVATAGLAGQFAVGLLLGAVWSPCVGPTLGAASLLAAQGRDLGTVAVTMLV
FT                   FGLGAALPLVALGMLSREVLIRWRARMMGVGKGLKLALGVILVATGALIVSGYDRALET
FT                   TLVDASPDWLTALTTRF"
FT   CDS_pept        67059..67673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0069"
FT                   /product="putative 3-methyladenine DNA glycosylase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0069"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21744"
FT                   /db_xref="GOA:C7CLZ1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21744.1"
FT                   /translation="MLDADIYERMLGTAATVAEPLRAAIAAIGPIEIAPPAHASLAERL
FT                   FVEVVNQQLSTKAALSIWTRIEAAAAAQDGTPRDLFIPGAEVLLRSCGVSANKVRALHA
FT                   IREAEEAGLLGPELATYPHAERSAVLCRIRGVGPWTADMAGIFHFLDPDIWPVGDVAAV
FT                   GVLRRLAGIEDTVAVAAQFAPYRSILARYMWRSRDAAPVAA"
FT   CDS_pept        complement(67679..67936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0070"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0070"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21745"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21745.1"
FT                   /translation="MSNDTIIWTQGGIAEVPLQRLTGRIGAIEVATVEYDGSNRLWTWW
FT                   SPLAEDIWGHAQEPEAAKQAAELWLRNWLENFRPFFEAGR"
FT   CDS_pept        68264..68482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0071"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0071"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21746"
FT                   /db_xref="GOA:C7CLZ3"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21746.1"
FT                   /translation="MTDSNVISRRARSRAAKSGGNGSVVLVVALMMALVFVPVLALHAA
FT                   ALSGAVAGDEVRPDEVAAAVTHKKVPG"
FT   CDS_pept        complement(68597..70294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0072"
FT                   /product="Methyl-accepting chemotaxis receptor/sensory
FT                   transducer"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0072"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21747"
FT                   /db_xref="GOA:C7CLZ4"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21747.1"
FT                   /translation="MRWFTNLKLIGKLAIPVALVALVAAGIVGLARNTLGQLQRGTQEV
FT                   VDVRAARVITALQTALAIDEAVISEKNIILETDAAILSAQHERFEAARARALTGADHLI
FT                   AIADTDARRAMLTEVKATISGFFATVERSIALGLKNQKEQAFKVSADEVRPVRTKAIEA
FT                   IQKRIAANISDLEDAKREAAEIGSSAALTLTVIAVVGLLLAFGLLGVIVIVGVVRPIGR
FT                   LVRVLQRMAEGAIETEIAEARRGDEIGAVARAVEAIKALVARKAAEQAEMKRVADEAAA
FT                   IERRRTMNELADGFERAVGGVVGMVSSSATELQATAQQMTATATETASQSTTVAAAAEE
FT                   AASNVGTVAAAAEELGASVHEIGRQVGASADMAQRAVGEADHSAALIHELSQAAARIGD
FT                   VVNLIATIASQTNLLALNATIEAARAGEAGRGFAVVASEVKELAAQTSRATEEISGQIA
FT                   QIQGATGQAVTAIGGITGRIREINAVATTIAAAVEEQGAATQEIVRNVSQAAVGAGEVT
FT                   SNIAGVAQASEETGAAATQVLASASELSRQSEHLRAEVARFLATVRAA"
FT   CDS_pept        70677..72299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0073"
FT                   /product="putative ATP-binding protein with two ATPase
FT                   domains, ABC transporter related"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.41"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0073"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21748"
FT                   /db_xref="GOA:C7CLZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21748.1"
FT                   /translation="MIRLDKIGKQNGRQIVFIEASAALQKGEKAGLVGPNGAGKTTLFR
FT                   MMTGQEQPDEGQVSSERGITIGYFSQDVGEMAGRTVVAEVMDGAGPVSVVAAELKELEA
FT                   GLADPDRADEMEALIERYGEVQARFEELDGYALEGRAYEVLAGLGFSQEMMDGDVGRLS
FT                   GGWKMRVALARILLMRPDVMLLDEPSNHLDLESLIWLEAFLKGYDGALLMTSHDREFMN
FT                   RIVSKVIEIDGGTLTTYSGDYGFYEQQRALNEQHQQAQFERQQAMLAKEIKFIERFKAR
FT                   ASHAAQVQSRVKKLDKIERVEPPRRRQTVAFEFQPAPRSGDDVAMLKGVHKRYGSRIIY
FT                   EGLDFAIRRKERWCVMGINGAGKSTLLKLITGTAQPDAGTVAVGGSVKLGYFAQHAMDL
FT                   LDGDLTVFEDLESTFPQAGQGSLRALAGCFGFSGDDVEKPCRVLSGGEKARLVMAKMLY
FT                   DPPNFLVLDEPTNHLDIATKEMLINALAGFEGTMLFVSHDRHFLAALSNRVLEVSGDGI
FT                   RQYGGGYSEYVASTGQEAPGLRS"
FT   CDS_pept        complement(72307..72663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0074"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0074"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21749"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21749.1"
FT                   /translation="MSCLPEDVRALSLMLPETVEGAHQGHPDYRVGGRIFATLWTDEAR
FT                   VVVRLTPEAQALWLDAEPDAFEPVPGAWGARGWTSLELDLVEEETLRGALLTAWRIVAP
FT                   PGLVARYEGLALDP"
FT   CDS_pept        complement(72673..72912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0075"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0075"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21750"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21750.1"
FT                   /translation="MTKLFIARVRNAGGERPLVTVRAAAEGEARLFVEAAYPEDEIVEI
FT                   TEPGEWVSDSDTGTKNGDVREHPGTAWQAPTSRA"
FT   CDS_pept        complement(73127..73771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0076"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0076"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21751"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21751.1"
FT                   /translation="MSTLITVLKSGGRYDAVWVERLARGVRRHAPAFERILCLTDLPLA
FT                   VAGVERAPLRHHWPAWWAKMEAFRPGLTEGTTLLCDLDTVFNGPADTLAEPGLAAMEDY
FT                   FHKGRLSSALLRWSGDELAGLYERFATEPERWMTAGSCGPVPNAVHGDQVVIDYLLREA
FT                   GMRPNFFQDIAPDLLDFYDPRRAAHGPVVIFIGESKPDTVRGPVHEAWAGA"
FT   CDS_pept        complement(73782..74417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0077"
FT                   /product="conserved protein of unknown function; putative
FT                   hydrogenase accessory protein"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms; PubMedId : 8121412"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0077"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21752"
FT                   /db_xref="InterPro:IPR038578"
FT                   /db_xref="UniProtKB/TrEMBL:C7CLZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21752.1"
FT                   /translation="MPADFDRPEAERFALPPAASLAIVGNAPEIGAAAHEIDEADCVVR
FT                   FNNAEGFGGRTGSRVTHLALVNRGGQMREWLADRAFLERPAVRAAQAFILPFPMLPAEE
FT                   NGPEPICWTREALALLRPTGRPIHILPEELHERARRLLAPSTAGRPNPSTGFLVTLALL
FT                   NDRPLEATPARAYGFGFAGWPGHPWAAERAWFAEAQAAGRVRLHPLAD"
FT   CDS_pept        74524..75507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0078"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0078"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21753"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21753.1"
FT                   /translation="MRRCFVCAADMLAPSERHLIYPDGRRRPFPLACASCGVLIEGGAD
FT                   ASRCRAHLTEALAAQVFVPDPDAPYGLDLYTLRTAATGLGRGIRPLDAEGSAALRHPHD
FT                   GHAARAALYALNAAEERPISLGLLCRPSEVDAALASLPAQAGWTDDIMILLDSDITPPG
FT                   AVSVAGFPAGAVRMASRPLEGDFAAQRNALQALARHAWMLQLDADETLDAATGHLLPAL
FT                   VALAEAGAVRSIGLARFNRVDGVLSDVYPDVQYRLNRNDVRYAGRVHERPQLAGGWPES
FT                   FISLHGGIEHCLSRAHVAARSRRYEALDPGRGRPEEENALLRPYRD"
FT   CDS_pept        complement(75528..76712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0079"
FT                   /product="putative glycosyl transferase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 8631780; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0079"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21754"
FT                   /db_xref="GOA:C7CM01"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21754.1"
FT                   /translation="MRTALLAWDYPPAPSGLSTAAREIAESLAAAGADVTVFTLDRSGR
FT                   ERVGGVTVEGLALPPGGGLARLRLWGSAGHLAAPLAFRRAVLAAHARAPFDVIEATNWY
FT                   APAVLLARRRDLPLVTRSSTPAAFTRGPGASLRDRLDGRTADALERAQARGSAGLIANT
FT                   AEHGEVIARAYRLSGRQPSAVIGLSLPPEICSSARAAAYPETDAPLRLLFVGRAEARKG
FT                   FDALLDAVAILAAEQEAGALPPFRLDLVGVPPNDLPPDLPDAARQRISARGRIDAAALA
FT                   QAYADAHAVLAPSRYESFGLVYQEAMAYGRPVVACAEDASARAFVGASGAGPLAQTATG
FT                   PALADALRPLLLDPGLRRAYRMRALAAAGRFDRASLGRETLALYEAAIAAARHP"
FT   CDS_pept        complement(76712..77752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0080"
FT                   /product="putative glycosyl transferase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 11583114; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0080"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21755"
FT                   /db_xref="GOA:C7CM02"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21755.1"
FT                   /translation="MIRVAQVAPNIFPVPPEHHGGTERIVHDLSVALRSLGIDVTLFAS
FT                   SDSATDLPRVGDHPSLAALQHRNRQVPPGVPAALDALQLEALRQRLDQFDIVHCHGEFA
FT                   HAALLGPRRRQSLTTVHWRVDELDRALFFAGFPDLPVAAISAAQEAGILASNRAGVVHH
FT                   GIARDRYTFRPEPGAHVAFVGRMTDQKRPDTAIRVARAAGLPIRLGGTIDVGNPDYFER
FT                   SVRPLLGPNATYLGPVDDRAKGDLLGGARALLFPIDWPEPFGLVMIEAMACGTPVIAWN
FT                   LGSVPEIVEEGVTGFIVTSEAEAVAALDRIGQLDRAGVRRRFEERFTAERMARDYIALY
FT                   RRLLAA"
FT   CDS_pept        77810..79864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0081"
FT                   /product="conserved protein of unknown function; putative
FT                   HAD superfamily hydrolase; putative glycosyl transferase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /note="EC_number:2.4.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0081"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21756"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR006380"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21756.1"
FT                   /translation="MFVLHIALQGCLRGRDVVYGLTSDTGGHIRYLLDLVAASAQDSRI
FT                   ARIVMATRRFEGPPGPDYAVPEERISDKVALVRLASASPGYRSKEAMHGEVESYAENLI
FT                   AWIGRQPRAPDIIHAHYADAAAVAEIVEDRLGIPFVFTAHSLGRVKAAMVGDGAANDLE
FT                   LSRRIITEEAALARASLVIASSRDEAEVQYAGYAAYDPGRARVLPPGSDLARFAQSRPH
FT                   PRIDAAIDRFLHDPGKPAVLALARPVARKNLAALVQAYGESPELQACANLVIVAGTRDD
FT                   IDRLDGDMAATMRDLLVLIDRYDLYGRVAYPKTHRPEDVPAIYAYARERGGVFVNPALN
FT                   EPFGLTLLEASAAGLPLVATDSGGPNDIVETCGNGLLVDPRAPATIAAACLHILTDAPF
FT                   RARCVAGGARAAAAYDWDRHAARYHDLLGALLARNPPLRTPRQLLICDIDNTLVGCESA
FT                   LATFRRWRSRQTGLAFGVATGRSFHSAMAVLEQQASPRPQVMITSVGSEIYHLDANGVT
FT                   YTADAAWREAVSNAWDRGAVGAALGRLDGLVPQGPLEQRAHKLSFFGDEATAHRVRDRL
FT                   VQAGLPANVIHSHGRYLDVLPATASKGTAVDHVRALYGLPEQAVFVAGDSGNDVEMLRA
FT                   RTQAIIVANYSDGLATNAALKHSYVARTSHARGIIEGVLHFRRALAYAS"
FT   CDS_pept        79886..80776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0082"
FT                   /product="putative glycosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 15294902; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0082"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21757"
FT                   /db_xref="GOA:C7CM04"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21757.1"
FT                   /translation="MTGTAVPPPPPSVLTLVRGRADRLRNLIRGLARQTLRPRELVIAW
FT                   MQLDPAPDLPDPGCPVRHLHVPGEPMPLAAARNRAAAAACGDLLVFLDVDCIPGPTLVA
FT                   AYANADAAERGLFLGEVLYLPPDAIVGGPAPDPAALDRLGRAHPARPPLPETGLRREPD
FT                   AGQLWGLSFALPAEAWHAVGGMDERYVGYGGEETDLAARLAGSGLPTFWVAGARAYHQH
FT                   HPVHVPPLQHFAPILANATRFHARHGRWCMTYWLEQFRAAGLIAWDAEAAAIRVLRQPS
FT                   APEIAAALRPQALFS"
FT   CDS_pept        80825..81973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0083"
FT                   /product="putative glycosyl transferase; putative
FT                   UDP-N-acetylglucosamine, LPS N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0083"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21758"
FT                   /db_xref="GOA:C7CM05"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21758.1"
FT                   /translation="MKKPIAFFVHHQGRGHANRTMAVAAEFARDRPVSVLTAGPHLFDG
FT                   FSRDIEIVTLPNMIGALVPTPRLFAEPTPPVMHCVPLGLAEMRRTMRQILDHLDERAVG
FT                   LFVVDVSAEIAMLARIASVPAVQIRMHGDRNDIAHIGAYEACVGMLAPFDERLEQDDYP
FT                   AHLREKTFYSGGLCTSVDRVPDRAEARARLGLDPHREIVVAVTGGGGSGTPYAPLTVAA
FT                   RAAPDALWLTLGPTHREGHETDFANLRELGWVPSVTDYLAAADIVVASAGDNTVHEVAR
FT                   VAGRLIVMPEWRYFGEQTRKAEALVRLGAAVQAPYWPGDFHGWCDLLDRARSLDGTILR
FT                   SLYAPDAATRAAGWLEGLTDALWQGGSAVKEPDATPLRVVAG"
FT   CDS_pept        82024..82965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0084"
FT                   /product="conserved protein of unknown function; putative
FT                   glycosyl transferase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0084"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21759"
FT                   /db_xref="InterPro:IPR019290"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21759.1"
FT                   /translation="MSTVSVVTLAKGRPAHLRNVLLGLERQTRPPAEFIIAVMQDAPYD
FT                   LPETAFPVRQILVSGAELPLAAARNRGVAAATGENIVFLDVDCIPAPDLVADYARALSE
FT                   LDGLLMGEVLHLPERATAGDWRYADLAAVAEKHSDRRGPPAAGIEICNDYRCFWSLNFA
FT                   IRRATFQAVGGFDERYTGYGGEDTDFGKILDQCGLPIAWMKGALAYHQYHPHHMPPIHR
FT                   LDSVVRNAELFEAKWGYRTMGHWLHAFKVMGLIDDTPEQPIRILRRPDAEDLALTGQLS
FT                   HQPYTNSASVIRHLEARARERDLPPASVPVTA"
FT   CDS_pept        82962..84017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0085"
FT                   /product="putative glycosyl transferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 12068013; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0085"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21760"
FT                   /db_xref="GOA:C7CM07"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7CM07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21760.1"
FT                   /translation="MRIALLAHLRHPITPPFAGGLEAYTWHLAEGLTARGHEVVLFAAG
FT                   DSDPLFSIDPVIPVHHERSFPGLEHRGDPGLKAHVDAGYAAACDRIAAGGFDVLHNNSL
FT                   SRLPLERRRTAAVPTVTSLHVPPYDALRWCVHDSVTAGHRITVTSQAQAQAWWPDGAPP
FT                   EVSVLHNGIDPALWPYQAQGDGSAVWCGRIAPIKGTHLAVRSAQRAGLPLTLFGPIEEP
FT                   DYWETQVAPLIGGPIRYGGHLGGPALAQEVGRASVFLFTPCWDEPFGLVAVEAMACGLP
FT                   VAGFARGAAAEVVGEAGCLVPPEDDAALAQAIGTALMIPRTVPHARVHRLFTRDLWLDR
FT                   CEALYAGARAG"
FT   CDS_pept        84063..84731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0086"
FT                   /product="putative methyltransferase, putative
FT                   O-methyltransferase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 14523113, 9791104;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0086"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21761"
FT                   /db_xref="GOA:C7C6K7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21761.1"
FT                   /translation="MTRQDIIAALWHGRDPFADPPDTLRPLDLQGWRSVHPYLEEAVIE
FT                   HRPGVVIEIGTWKGASALYLARTMAEHGIDGTVIAVDTWLGAVDHWMDESLFTELATEH
FT                   GFPSLYRTFLANVLHEGLADRMVPLPLDSVNAAELMRLRGVTADVIHLDAGHEEASVAA
FT                   DLRAWWPVLRPGGLFIADDYDRLGGSFPGVTRAVDAFCTEFGVKGPWSFQGKANFIKLG
FT                   "
FT   CDS_pept        85417..86526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0087"
FT                   /product="putative metal dependent phosphohydrolase with a
FT                   response regulator receiver domain; HD-GYP domain protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0087"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21762"
FT                   /db_xref="GOA:C7C6K8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21762.1"
FT                   /translation="MDALLVDDSATMRLRLRGLLEAEPDVAVTDHADPAAGLLEATMRA
FT                   FDLVVVDYHMPAMDGIEFIQSLRKVPHYSLVPIVMVTSDVSDSVRLAALDAGATDFIDK
FT                   SMRGIELTVRLRNLIRLAQAVRKLAEQATWLDGEVEMALRHLREREEEIIFRLSLAVEY
FT                   RDNDTGDHTWRVARYSQIVAEALDLAPEVCRNLYLAAPLHDVGKVAIPDGVLLKPGRLD
FT                   PEEFSLVRTHAAIGKRILGDSSSELISLAAEIAESHHEKWDGSGYPQGLAGTDIPLSAR
FT                   IVAVADVFDALTTQRPYKGAMSFDDALDCIRAESGRHFDPACVEAFCSRWPDILIVGGQ
FT                   NDALGRLHNQQATEPWARVPMLLREIAKS"
FT   CDS_pept        86691..89387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="METD_I0088"
FT                   /product="excinuclease ABC, subunit A"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.5 : Detoxification"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0088"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21763"
FT                   /db_xref="GOA:C7C6K9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6K9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21763.1"
FT                   /translation="MDQAKPKERVRIARAGAGRPGYVTVRGAREHNLRDVDVEVPRDAL
FT                   VVFTGVSGSGKSSLAFGTLYAEAQRRYFESVAPYARRMIDQVGVPDVDSIEGLPPAVAL
FT                   QQQRGTPSARSSVGSVTTLSSLVRMMYSRAGSYPPGQPMLYAEDFSPNTPQGACPSCGG
FT                   LGRVYQATEASMVPDPSLTIRERAVAAWPQAWGGQNLRDILVSRGVDVDTPWKDLPRAL
FT                   RDWILFTDDQPQEPVYAGLSPEQTRLARRRRLEPSYMGTFTSARRHVLGTFTNSQSALM
FT                   RRRAASYLVSEDCPVCQGKRLKPEALSVTFAGLDIGELSRMPLADLAEAMRPAAEDRLP
FT                   DEADGTAPDTLDRDTGLRDRAKRAASGGSAHASAPDVRATPNLSIEKRLAAQRLAADLI
FT                   DRIGTLTELGLGYLSLDRVTTTLSSGELQRLRLATQLRSQLFGVAYVLDEPTAGLHPAD
FT                   GDAMHDALAGLLASGNSLFVVEHDLGTMRRADWLVDVGPAAGEHGGTVLYSGPPEGLRD
FT                   VEASRTRLHLFGTAEPPQRPRREPSGWLRLEGIIRNNLRGVSAAFPLGCLTAVTGISGS
FT                   GKSSLVSQALLELVGDRLGRPVEIDDEPEDPLDDAPGPTEGRIVGGMDGIRRLVKVDQK
FT                   PIGRTPRSNLATYTGLFDAVRKLFAATPEARKRRYDAGRFSFNVAKGRCQACEGEGFVS
FT                   VELRFMPSVYAPCPTCHGTRYAPDTLEVTWNGLTIADVLGLTVERACDAFADEPSVLRP
FT                   LAVLRDLGLGYLRLGQPATELSGGEAQRIKLATELQRGQRGGTLYVLDEPTTGLHPTDV
FT                   DRLMLQLNGLVDAGNAVVMVEHDMRVVAGADHVIDVGPGAGNLGGTVVAAGHPEDVAEA
FT                   RGSRTAPYLRDELMAYAGQESSPRLAG"
FT   CDS_pept        complement(89429..90385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0089"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 11481431; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0089"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21764"
FT                   /db_xref="GOA:C7C6L0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21764.1"
FT                   /translation="MRQVGFILEDGFQVMGLAALSAFEFANTDLGREAYGLRVMSERGG
FT                   TVRSSLRIGIETVPLADAPDTLMVVGELQPRPLSPGLRAYIAEAGRTSRRVAGLCTGAF
FT                   ALAEAGLLDGRVATTHWAHARDMRERFPLIRVDDDRIFVADGNVWTSAGMSAAIDLTLA
FT                   LIEDDHGAELSRAIARKLVVYHRRPGGQSQFSALLELEPRSDRIRRALVYAKENLRRPL
FT                   TVEEMAEAARVSPRQFSRVFREETGQSPAKAVERLRLEAAKAMLEDGRHSLDLVARDTG
FT                   FTDRDRMRRAFLRAFGHPPQSLRRSLRLIEGGDEAAG"
FT   CDS_pept        90513..91301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0090"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0090"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21765"
FT                   /db_xref="GOA:C7C6L1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21765.1"
FT                   /translation="MSQGSVLITGASSGIGAVYADRFAGRGHDLILVARNKARLDAVAE
FT                   DLTRRHGVSVRTVEADLTDRAGLAAVEAILKDDADITHLVNNAGFGSAAPLASASVDEM
FT                   ERMIAINVTAPMRLTYAAVPAFTSRGQGTIINIASIVAIGPEVLNGVYGGSKSFVLGFS
FT                   HALRKELAGTGVAVQVVLPGATGTEFWDVAGLPASNLPKEWVMSAEDLVDAALAGLDRG
FT                   EFATIPSLHDAAEWDAWEAARATMLPHLSSAVPAARYRAA"
FT   CDS_pept        91494..91940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0091"
FT                   /product="oxidoreductase, 2Fe-2S subunit"
FT                   /EC_number="1.3.99.16"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 7782304, 8157655; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0091"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21766"
FT                   /db_xref="GOA:C7C6L2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21766.1"
FT                   /translation="MISLSINGHQHSIDVEPDTPLLFVLRDTIGLTGTKYGCGIGQCGA
FT                   CTVLIDGQAIRSCQMPVESVGAQTVTTIEAIEADPVGARVVAAWVGIEVPQCGYCQSGQ
FT                   VMAATGLLKETPKPSEDAIAAAMTNLCRCGTYNAIAAAVRQAAA"
FT   CDS_pept        91951..94209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0092"
FT                   /product="oxidoreductase, molybdenum cofactor binding
FT                   subunit"
FT                   /EC_number="1.3.99.16"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0092"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21767"
FT                   /db_xref="GOA:C7C6L3"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21767.1"
FT                   /translation="MNDLTPHHRLGIAARPASEPVRNLSRRGFLGIVSGALLLGIDLSK
FT                   DAAAQTRAEGPAAVAAKPGTRVAAFLEIRRDGDVRLLSPFVEGGQGINTGLAQTIGEEL
FT                   DLDPARFTVECAPPGPDYAVVNGLRMTGGSFSTRSSFEAMRRLGATAREMLLRAAAARL
FT                   AVPQDSLTTEDGRVIHAASGRTLGYGEVAQAALALLPRDDVALKNSKDFRWIGRPVARL
FT                   DMRDKATGRATYAIDIRLDAMLHAAVQHAPHLGTEPRAVANEAEVRAMPGVHSVHRLPG
FT                   AVAVLADSWWRARKGAEALRVTWSEPAPEGIATVSATFSSAAMLAALKDTTEPGLPAEQ
FT                   EGDPGAAFANAAKVIEAEYDAPYLAHAQLEPPSAVARFTADGSLDLWVPNQMPELFQQI
FT                   AAKTAELEPEQVRIHSPMLGGFFGRHFSYGPANPFPQAILLAKATGQPVRVLWSREEEF
FT                   GMDAVRPLSFARFRAALGPDGMPVALQTTAVGEGPISRWFGALFTSPVDSSVVEGLDKK
FT                   PYAIPNRRLDYVRVAHPVTIAFWRSVGHSMNDYFYESFLDEIAEAGGRDPFDLRMALLT
FT                   NSPRHATLLRRVAELAGGWRRGPFVAEDGTRRARGVSMASPFGSETATIAEVSLEDGEA
FT                   RVHDLWIAIDPGSVVNPAIVRRQVESAAALGLSSTLLEQVVYENGQRQARNFDTYPILD
FT                   RTRMPRVHVAIVESGAPMGGIGEPGLPGVPPAVVNAVAVLTRQRVRSLPLAKTRLSGV"
FT   CDS_pept        94220..95227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0093"
FT                   /product="putative voltage-dependent anion channel"
FT                   /function="7.2 : Anions"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0093"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21768"
FT                   /db_xref="GOA:C7C6L4"
FT                   /db_xref="InterPro:IPR004695"
FT                   /db_xref="InterPro:IPR038665"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21768.1"
FT                   /translation="MAAPLAPAAPEAPAVPVPRFDYLPVALFGSVMGLTGLSVAWRLAA
FT                   ARYGLPVLVADAIGWGALLSFIALALAYGAKAVTAWPAVTAEFRHPIAGNLFGTVLISL
FT                   LLLPFVLHDLSPALAAAAWIVGTGGMALFAVLIVSRWMGSRQQLAHATPAWMVPVVGLL
FT                   DIPLAAPALGLPHTQTLAMAALSIGLFFAGPLFTLVFARLVFEEPLPPAQRPTLMILVA
FT                   PFAVGFSSYTATFGRIDAFAEALFLVGLFMFVVLLGRLRDLPRCCPFRVSWWAVSFPLA
FT                   AMAVAALRYAEHVRAVPADILALALLALATAGIAALATRTLVGIARGELRRLAG"
FT   CDS_pept        95459..96709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="METD_I0094"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /function="1.5 : Serine family"
FT                   /EC_number="1.1.1.95"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 7719856; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0094"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21769"
FT                   /db_xref="GOA:C7C6L5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21769.1"
FT                   /translation="MPGTDSFTLQDQVNIVLAENIAPSAVEVLARASLHHVRRLPRAIG
FT                   SADADVLAGAHVLGIRSRTQVTTGLLDAAPALVAVGCFSVGTNQVDLEAARARGIPVFN
FT                   APFSNTRSVAELTIGEIVMLLRRITPRSASAHEGGWDKSAENSYEVRGKTLGIVGYGNI
FT                   GAQLSNLAEAMGMRVIFFDLTDRLRHGNTEPADSLDALLAASDVVSLHVPETPLTHGLM
FT                   SAERIGRMKPGAYLINNSRGTVVDLDALADALKEGRLRGAAVDVFPVEPRSNDERFVSP
FT                   LQGIPNVILTPHIGGSTEEAQDRIGSEVARKLVDYVETGSTLGAVNFPQVQIPPRIGGV
FT                   RFLHVHRNVPGVLGHVNQAFARRGVNIASQYLQTEGELGYVVVEADAAPADRAGILAEL
FT                   DAIDGTVRTRLIQARIA"
FT   CDS_pept        96725..98122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="d2hgdh"
FT                   /locus_tag="METD_I0095"
FT                   /product="D-2-hydroxyglutarate dehydrogenase"
FT                   /function="1.5 : Serine family"
FT                   /EC_number="1.1.99.-"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 28827360; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0095"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21770"
FT                   /db_xref="GOA:C7C6L6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21770.1"
FT                   /translation="MSATGLPPDLLARLDGLLGPGGLLTDEADCAPFAIDWRRLFPGRP
FT                   AAVARPSSTAQVASVVGLCREAGIALVPQGGHTGLAGGATPDASGRQLVLSLARMNAVR
FT                   AIDPVGLTLEVEAGCVVQAVQAAAEAAGRLFPVSYGAEGSAMVGGMIATNSGGINVLRY
FT                   GMTRNLVLGLEVVLADGSVVDGLRALRKDNAGYDWKQLFIGSEGTLGIVTAAVLRLVPR
FT                   PRHTETALLAVPDPEAALRVLAAAQDGLGDTIQAFELISRCSFDLLERYAGLPSPLPPS
FT                   PWCILLEAGSSLSGLRDAVEGTLGEVLERGDAVDGVLAESKAQAAGLWGLRERITECEA
FT                   HQGKSVKHDVSVPIPAIPAFLEAADRALAEGAPGTVPNVFGHMGDGNLHYNVLIGPEHD
FT                   SAAINRLVHDVVDRFAGSISAEHGIGQYRVDELARRRRPEEMALALRLKRALDPDGLLN
FT                   PGKVLRV"
FT   CDS_pept        98856..99515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0096"
FT                   /product="putative nitrite reductase, formate-dependent,
FT                   penta-heme cytochrome c"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0096"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21771"
FT                   /db_xref="GOA:C7C6L7"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21771.1"
FT                   /translation="MVQAFHPGADTVARVVLASIGAAPVLAVGLAYALWRSPYATAQDV
FT                   TREQPVPFSHEHHVGGLGIDCRYCHTSVEKAAFAGIPPTETCMSCHSQEWTNAPMLAPV
FT                   RQSLAEERPLQWNRVHNLPAYVYFNHSVHVAKGVGCSTCHGEVQTMKLMRQAAPLTMGW
FT                   CLDCHRDPAPNLRPHEAVFDMNWKPPADQAAIGARFMEERHIKSTERLSECSICHR"
FT   CDS_pept        99503..102313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0097"
FT                   /product="putative 4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0097"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21772"
FT                   /db_xref="GOA:C7C6L8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21772.1"
FT                   /translation="MPPLTPPSRREALRLLGAGITLAAGGCSKPVEEIVPYVRAPEQLL
FT                   PGVPVRYATTLSLSGWARGVHAIAVDGRPIKIEGNPLHPSSLGATDVFAEAAILDLYDP
FT                   DRSRTVTERVNGIASWEMFERAVSGPLSTVRGERGRGLHLVTGRVTSPTLARQIDALLQ
FT                   ALPEAVWHIHEAIDEANAERGAELAFGRPLRALPRLDRAETILCVGADPLGAGPDQIRL
FT                   ARAFAERRRDPARFGRLYVAESALTLTGVKADARRAVTPLEQAAILTSVANALGAGLAA
FT                   PDLPEAARRFAQAAAADLTAHQGRALVLAGPALPPEWHALTHWINARLRAPVDVIAPPD
FT                   RIEGRSPATLADLAQALDRGSVTCLAILGGDPVATAPADLDLARRIARARFSVHAGLHG
FT                   DETAGATHWHLPLTHELESWSDLRATDGAVSLVQPLLRPLYDGRSLHEILPLFIGRSAT
FT                   SGYALVRETWRERGGGDFEGWWRRCLHDGVIADSAAPIVDPGEPRLPTLPEIRQTEGLT
FT                   VELRPDPCLWDGRFANNAWLQECPKPISKQVWGNALALSRAEARRRGLAAGDVVRASAG
FT                   EHAIEVPVIIESGVAEGVGVLTLGYGRERAGAIGNGIGANAYGLATQASPWLVTGVDLA
FT                   KSDRPETILRTQNYVEIEGETKKLFRQIDLAALASAEPKGTGADQPSLLDPWKGDADGH
FT                   AWAMVIDTDACIGCNACVVACQSENNVPVVGPEEIARGRMMHWLRVDIYDEGSPEAPRA
FT                   GFQPVPCMHCEHAPCEPVCPVAASVHDGEGLNLQVYNRCVGTRFCEANCPYKVRRFNFF
FT                   GYADGQPYANLGAESVKAQRNPNVTVRARGVMEKCTYCIQRIATERQAAERDGREMGVV
FT                   VTACQSACPTRAIRFGDLAKPGNAITELRGDPRHYALMEELNTRPRTTYLANLRSPNPD
FT                   LKEDRA"
FT   CDS_pept        102310..103680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0098"
FT                   /product="Polysulphide reductase, NrfD"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0098"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21773"
FT                   /db_xref="GOA:C7C6L9"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6L9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21773.1"
FT                   /translation="MSGHAQPHRWIARKRLGYGEICAAVADPIQRRGPGRAWVIAFLGV
FT                   LPLVLATAIAIGAVLTVGIGLSGVNTTVVWGFSIANYVWWIGIGNAGTLISSMLLLTRQ
FT                   HWRASINRFAEAMTLFAAAIAGIFPIIHLGRPLYSYWLAPYPNTMDLWPQWRSALVWDF
FT                   WAILSYLLFSLIFWFTGLLPDLATMRDRAQSRFGRRLYGALALGWRGSARHWAVYETFH
FT                   KTMAALAVPLVCSVHSIVGLDFAASLMPGWQESIFPPYFVVGAMYSGFAMVVVLAIIIR
FT                   WGLNLQAVITPAHFDAMAKVMLFASIVMTFSYATEWFMGWYGGDHADRAVIAYFFTGDY
FT                   RWLYYSLLFCNCLVPQALWFARVRINLWALAIISIVINLGMWLERILIVWNTLSHGHAV
FT                   SLWRTYHVSFYDVVILIAPLGLFAFGFLVLARIFPIVSIHEVSQLAHDEGTARGVTA"
FT   CDS_pept        103677..104195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0099"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0099"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21774"
FT                   /db_xref="GOA:C7C6M0"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21774.1"
FT                   /translation="MSAPLLAEFDNPEALVRAMRLAAADGHRALDAFTPFPVPDLTNAF
FT                   APPRNLVRPVMALTGFGAAAAMYALQWYSSVIDYPLNTGGRPLHSWPVFLLVPFEFGVL
FT                   IAAITGLIALFWTCGLPRLHHPLFAIPQFERASQDRFLLLVASKDTDATALRESLERAG
FT                   ALLVAEMHP"
FT   CDS_pept        104192..104719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0100"
FT                   /product="putative cytochrome c family protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0100"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21775"
FT                   /db_xref="GOA:C7C6M1"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21775.1"
FT                   /translation="MRRALPLLLPLLATIGACEDQSMRQQARYEVYGKAPLFPDHAEAR
FT                   RPPEGTVAIGALERETALREPPAVDAALLERGRQRYDAICTPCHGYTGHGDGMVVQRGF
FT                   PAPPSYHDDRLRAAPAAYFVDVITRGYGVMYAYANRVEPRDRWAITAYIRALQLSQGAR
FT                   VAEAPDLAEKLP"
FT   CDS_pept        104716..105672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0101"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0101"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21776"
FT                   /db_xref="GOA:C7C6M2"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21776.1"
FT                   /translation="MSDALFRGWLLAWIVWSAVPFGALVLMMIHRVTGGRWGEVLAPVL
FT                   RPATALVPLAAVTFLGVALGLHAAYPWAAGTGAKPDVLRLYLDPTLFLVRAAVTLLGWS
FT                   ALAGMFLSGRAGTLAAALGLTFYGLSISLVSIDWILSVEPGFNASAFPADVALHHILAA
FT                   LAFAALVSPPSLDAQGASDLAGLMLATLLGVIYLELMSYIVAWYGDLPPKAAWYLKRGA
FT                   SPWGGVLVASLILGGILPFLALLFSAVRNSPALMRGVGLLVLVGVAVHFAWLVLPAYGD
FT                   EAGSAAAAAVVALAVLVLLSRFASRLIIRRAGRLRHV"
FT   CDS_pept        105647..106186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0102"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0102"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21777"
FT                   /db_xref="GOA:C7C6M3"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21777.1"
FT                   /translation="MPGGFVMSDAARGQLHTRVHDDVVGHAPPGTEAPDIRLKPLLLTG
FT                   LFIVVFTAVTIGGLRYYYNRQGLGPLVQTARMFPAPRLQQSPAADLAEMLRDQRAKLDG
FT                   YAWIDRANGIARMPIEEAMRRLAARGNAAYAAPLQPERTPALGSRGGASSRVLSPGAGP
FT                   GAVSTPVSTGPGIGAR"
FT   CDS_pept        106186..107274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0103"
FT                   /product="putative Cytochrome c oxidase, subunit II
FT                   (coxB-like)"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0103"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21778"
FT                   /db_xref="GOA:C7C6M4"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21778.1"
FT                   /translation="MLDSLIPAFLRPESASVQAAKVDTIFVGLLLISSAIVLLVVGLVL
FT                   TFAIRFRRGSPAKRGEMPSVVSREFEIGWTAATLFIFVFIFWWAASVEIVAFSPPKDAI
FT                   EIHVVGKQWMWKTQGPSGTREINELHVPVGAPVRLLLTSQDVIHSFYVPAFRLKRDALP
FT                   YQQTETWFQATKTGTYHLLCTEYCGTDHSRMLGRVIVMEPQDYAQWLTRQPERDGLAEL
FT                   GERLFSARGCSGCHNAGAKVHAPSLAGIWGQSVPLEGGRMASVDEAYIRDSILQPQRDV
FT                   VAGYEPIMPSYEGKLSDGEIQALTAYIRHGTDRFDLIGSLNLVTAQNICAPGQTPQDGA
FT                   ANQTLRSPAMVPGAPASGETPQ"
FT   CDS_pept        107306..108997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coxA"
FT                   /locus_tag="METD_I0104"
FT                   /product="cytochrome c oxidase subunit I"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0104"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21779"
FT                   /db_xref="GOA:C7C6M5"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21779.1"
FT                   /translation="MSGASSDASTLANPRELDLGLPVSYLGEGHSVASWLFTTDHKRIA
FT                   ILYALSITFFFFIGGAAATLVRLELFTPQGDVVGADTYNKLFSLHGIVMVWFFLIPSIP
FT                   TTMGNFLLPLMIGARDLAFPKLNLISWYLNLAGGLLTLAAVLAGGIDTGWTFYVPYSTV
FT                   FSNTFVTLAVLGVFVSGFSTIATGINFIATVHYLRAPGMTWFRLPLFVWSMYTTSLIFV
FT                   LATPVLALTLVLVIAERTFNLPIFDPARGGDPILFQHLFWFYSHPAVYIMILPAMGVIS
FT                   EVITCYARRRIFGYSFMVYALVAIAVIGFFTWGHHMFTSGMSPFAALVFSFLSFIVAVP
FT                   SAIKVFNWTATLYRGQIGFESPMLYALGFLGLFTMGGLTGLFLASVPIDVHVQDTYFVV
FT                   AHFHYIMVGASVSAYFAGLHFWWPKVTGRMYPESWARFAALLMFFGFNLTFFPQFIAGY
FT                   LGMPRRYYAYPPEFQVWNVLSSSGAAVLAVAYLMPLGYLTWSLFYGSRALNDPWNASGL
FT                   EWRTTSPPPRQNFFGNPEVLGRPYDYHPESAAPAEDDRIAEQGALT"
FT   CDS_pept        108994..109683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0105"
FT                   /product="putative Cytochrome c oxidase, subunit III"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0105"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21780"
FT                   /db_xref="GOA:C7C6M6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21780.1"
FT                   /translation="MNSGGDITPPTAGRHLREPWDGLRLPETGAFAYQRAGATFGMWVF
FT                   LASEVLFFGALFLLYTVLRLEHATDFATAARETNIVYGTLNTALLLTSGLTAAIAAQAS
FT                   EQDGLRRLTLICLATTVLLGLAFLMVKGLEYREDIEKHLVPGAHFALKEPATQLFFGFY
FT                   WLSTSVHAIHLSIGVGLIARLIWREWRAPGFLLASPQVEVATLYWGFVDMVWIFLYPML
FT                   YLDGRSA"
FT   CDS_pept        109680..109982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0106"
FT                   /product="putative cytochrome oxidase subunit IV"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0106"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21781"
FT                   /db_xref="GOA:C7C6M7"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR011743"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21781.1"
FT                   /translation="MRARLRTRDGAIWLRSLVVWLLLLGLLTASLLAAYHLKAPWAPAV
FT                   NFGLAATQAALVALLFMRLNRADHLVRLAAACGLFWLAILFVLTLTDTLSRLANT"
FT   mobile_element  complement(110113..110474)
FT                   /mobile_element_type="insertion sequence:ISMdi3"
FT                   /function="17.3 : Transposon functions"
FT                   /note="fragment of Insertion Sequence ISMdi3(756-984 and
FT                   1113-1246, Id=80%), IS3 family; Evidence 5 : Unknown
FT                   function"
FT   CDS_pept        complement(110124..110474)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0107"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 5 : Unknown function; Product type e :
FT                   enzyme;fragment of transposase of ISMdi3, IS3 family (ORF
FT                   2)"
FT                   /db_xref="PSEUDO:CAX21782.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(110498..110782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0108"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0108"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21783"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6M9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21783.1"
FT                   /translation="MYNIKHTALVLVTAVGALAAVTTGASAKAVAPAQACSGSCTSSIV
FT                   SAWTAGPMPREEFFETDTDSANANNPALPPYARGRGQEAGGPARELIPN"
FT   CDS_pept        111049..111579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0109"
FT                   /product="RNA polymerase sigma factor"
FT                   /function="12 : Regulatory functions"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0109"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21784"
FT                   /db_xref="GOA:C7C6N0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21784.1"
FT                   /translation="MSDIIRLIEPLIPALRRYARALLHNPTDADDLVQDCLERAIGRWH
FT                   QRRADGDVRTWLYAILHNLAVSQMRQRARRGSSVAVEDAPEATLAVAPNQDDGLLQRDV
FT                   TAALDALPEEQRGVLLLVSVEGLSYAEAAQVLAIPIGTVMSRLSRARDRMIQLIDGESA
FT                   SAPVKRPLLRRVK"
FT   CDS_pept        111582..112349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0110"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0110"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21785"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21785.1"
FT                   /translation="MRPITEDDLQAFVDERLEAARRAEVESYLTRHPDLSRRVERMRAL
FT                   GDDLRGAFGPVAAEPVPAQLNFAHLVEAQRRPRLPTWQAAAAAVLLALGGLGGWGLRGT
FT                   LSSPMTGVDALAQEASANYAVYAPDRLRPVELAASDSDELARWFSARLDRRVGVPDLTS
FT                   SGYRLMGGRLVATPHGPAGLLMYDDHHGTRLVMLMRPMAQPGDAPMREHRSGSAAGYAW
FT                   AQDGLGYSLVGASDPALLHPLANEIRRTTATNT"
FT   CDS_pept        112357..113469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0111"
FT                   /product="putative catalase"
FT                   /EC_number="1.11.1.6"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0111"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21786"
FT                   /db_xref="GOA:C7C6N2"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21786.1"
FT                   /translation="MTLLHHLTGAPPGMTTRALMLRLAGIGAVLAGTAGAFTYAGGWLS
FT                   PDALTPARVVDRFEQVNGPHPGFRRNHAKGLCVAGTFASNGAGARLSKASVFSAGRVTR
FT                   VEGRVALAGGQPYAADAAATVRSLALRFRLPEGEEWRTGMNNIPVFPVRTPEAFYEQLL
FT                   AAKPDPATGRPDPERLKAFFALHPESAKAAALIKARTITSGFADSTFQSLNTFRFVASD
FT                   GRTTPVRWAFVPERRPEPGSAAQEAKADRNVLFDTLAAELRQEPLHWHLVVTLGQASDA
FT                   TDDATLPWPSDRESVDVGTLTLTGAAPEDADTCRDINFDPLVLPDGIAPSDDPLLSARS
FT                   AAYARSFTRRAGEEKVPSAVAGTSPDGASL"
FT   CDS_pept        113466..114032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0112"
FT                   /product="Cytochrome B561"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0112"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21787"
FT                   /db_xref="GOA:C7C6N3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21787.1"
FT                   /translation="MTDSTRFNLPARLLHWSMAALILTMLLIGVAMVTSLADYHALVAV
FT                   HRPLGLLILLLAVLRLANRWRRPPPPLPRNLPVWQRRAAHASHIVLYGLMLAMPLVGWA
FT                   MLSAARYPVTLVGPFVLPPILPQSPMVYAWLRELHTVLAYGLFATILAHIGAALLHALI
FT                   RRDGVFASMAFQSGVRSPATPRAGT"
FT   CDS_pept        complement(113991..114251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0113"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0113"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21788"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21788.1"
FT                   /translation="MPGRQAACRSLQAPEALRSLDLGRAALLLTFIDQGGTGEKPATAA
FT                   RKHGTELEVMKQPLDCFCGAARIETEARSSPCSRRRRRANP"
FT   CDS_pept        114518..114607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0115"
FT                   /product="conserved protein of unknown function; putative
FT                   potassium-transporting ATPase, KdpF subunit"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0115"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21789"
FT                   /db_xref="GOA:C7C6N5"
FT                   /db_xref="InterPro:IPR011726"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21789.1"
FT                   /translation="MTLDLALGALVTTGLLVYLTYALVRPERF"
FT   CDS_pept        114629..116344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="METD_I0116"
FT                   /product="Potassium-transporting ATPase A chain
FT                   (Potassium-translocating ATPase A chain, ATP
FT                   phosphohydrolase [potassium-transporting] A chain,
FT                   Potassium binding and translocating subunit A)"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.9"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 6146979; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0116"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21790"
FT                   /db_xref="GOA:C7C6N6"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21790.1"
FT                   /translation="MTLNGWMQIALYSAVVLALVRPLGGYMTRVFDGERTLLSPALAPI
FT                   ERGLYRVSGIDVRQEQTWLGYAGAMVLFNVAGFVLLYALLRLQALLPLNPAEQGAVAPD
FT                   LAFNTATSFVTNTNWQSYGGETTLSYLSQMLGLTHQNFVSAASGMAVAVALIRGFARAS
FT                   TKTLGSFWVDMTRATLYVLLPLCTVLALFYVSQGMPQTLSPYVEATTLEGAKQTIAVGP
FT                   VASQVAIKMLGTNGGGFFNANAAHPFENPTALSNFLQMLSIFVIGAALTNVFGRMVGDE
FT                   RQGWAILTAMGLLFLAGVTVTYWAEANTHGVLSNLGLTGGNMEGKEVRFGIAASALFAV
FT                   ITTAASCGAVNAMHDSFTALGGLIPLLNMQLGEVIIGGVGAGLYGMLVFVVVAIFVAGL
FT                   MVGRTPEYLGKKIEAREVKMAMLGILCLPLMMLGFTAFATVVPAGLAGPANAGPHGFSE
FT                   ILYAYTSAAANNGSAFGGLTANTLFYNTTLAIGMLVGRFFVKIPVLAIAGSLAAKKRLP
FT                   ASAGTFPTHGGLFVGLLVGVVLIIGGLTFFPALALGPVVEHFAGAAGQTFAPGG"
FT   CDS_pept        116373..116534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0117"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0117"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21791"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21791.1"
FT                   /translation="MPRHHPMLHHRAHGAEARPVRISDLVLALLGVALLGGLALAAAFT
FT                   LAAGATAS"
FT   CDS_pept        116594..118684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="METD_I0118"
FT                   /product="Potassium-transporting ATPase B chain
FT                   (Potassium-translocating ATPase B chain) (ATP
FT                   phosphohydrolase [potassium-transporting] B chain)
FT                   (Potassium binding and translocating subunit B)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number="3.6.3.12"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 6146979, 9858692; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0118"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21792"
FT                   /db_xref="GOA:C7C6N8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21792.1"
FT                   /translation="MSRKTSSLFSAALVRPAFLGSVRKLDPRAMIRNPVMFVVEVVAAL
FT                   TTVLFVRDLVTGGSDLFFSGQIILWLWFTLVFANFAEALAEGRGKAQADSLRRTRTEMT
FT                   AKRLTGQGRAYETVSGTSLKVGDVVLVEAGDLIPSDGEVIEGVASVNEAAITGESAPVI
FT                   RESGGDRSAVTGGTQVLSDEIKVRITAAAGSTFVDRMIALVEGAARQKTPNEIALNILL
FT                   AGLTIVFVFAVATIPSFASYAGGSIPVIVLVALFVTLIPTTIGALLSAIGIAGMDRLVR
FT                   FNVLAMSGRAVEAAGDIDTLLLDKTGTITLGNRQATAFRPVRGVTEQDLADAAQLASLA
FT                   DETPEGRSIVVLAKETYGIRARDMAGLKATFVPFTAQSRMSGVDLEGSSIRKGAVDAVI
FT                   ASVSAPPMATRGSSAALAYRPAAETEVVAEIRAVAEEIAKAGGTPLAVAKDGRLLGVVA
FT                   LKDIVKGGIRERFAELRRMGIRTVMITGDNPMTAAAIAAEAGVDDFLAQATPEDKLALI
FT                   RREQAEGKLVAMCGDGTNDAPALAQADVGVAMNTGTVAAREAGNMVDLDSDPTKLIEIV
FT                   GIGKQLLMTRGALTTFSIANDVAKYFAIIPAMFLTLYPQLQALNVMGLASPQSAILSAI
FT                   IFNALVIVALIPLALRGVTYRPVGAASLLRRNLLIYGLGGILVPFVAIKAIDLAVTALH
FT                   LA"
FT   CDS_pept        118708..119313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="METD_I0119"
FT                   /product="Potassium-transporting ATPase C chain
FT                   (Potassium-translocating ATPase C chain) (ATP
FT                   phosphohydrolase [potassium-transporting] C chain)
FT                   (Potassium binding and translocating subunit C)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number="3.6.3.12"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 9858692; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0119"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21793"
FT                   /db_xref="GOA:C7C6N9"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6N9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21793.1"
FT                   /translation="MLNQLRPALVLLVALTAVTGLAYPLAVTGIAGALFPAKAAGSLIE
FT                   RDGTIVGSSLIGQSFTGEGYFHGRPSATTAADPADPSKTVPAPYNAASSAGSNLGPTSA
FT                   ALAERVKGDLDALKAENPGRPVPVDLVTTSGSGLDPDISPEAALFQVPRIARARKLPED
FT                   RLRDLVDGQVQGRTLGLLGEPRVNVLALNLVLDDLAKR"
FT   CDS_pept        119324..122041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="METD_I0120"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system wtih KdpE, regulation of potassium
FT                   translocation in E coli"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0120"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21794"
FT                   /db_xref="GOA:C7C6P0"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21794.1"
FT                   /translation="MPGTGRDPNRPSPDALLEAARREERTRGRLKVFLGAAPGVGKTYE
FT                   MLTIGRARLTAGADVVVGVVETHGRAETEALLDGFETIPRRAVPYRGTVLEEMDLDALL
FT                   ARRPALALVDELAHTNAPGSRHPKRYQDVEELLDAGIDVLTTLNIQHVESLNDVVASIT
FT                   RIRVRETVPDSILDRADDIEVVDLNPDDLIERLKVGKVYVPANAERALKHYFSRGNLTA
FT                   LRELALRRTADRVDDELLSHMRANAIPGPWAAGERVLVCVSEDPRSAGLVRYAKRLADR
FT                   LHAPWTALVVEGPRAASLSEAARDRVAEALRLADRLGGDAVTLPGGRRIADDILAYARA
FT                   ANVNHIVVGKATRSWIFELVNGSVVHDLVRRSGNISVHVVPGEVAPTETASRRAVATAA
FT                   PPATFDARSYALALLVTGAGLGLTLLLEPSTGVENADLMLLTAVVAVAVRWGLGPSLAA
FT                   VVAASLSYNFFFLPPVYTFTIADPTNVAAFLLFTLVAVLVSNLAARARLSAVVSQGRAK
FT                   ATERLFGFSRKLAACGTLDDVLWATSAQVAAMLRVRVVLLLPDAQTVAVRAGYPPEDML
FT                   DEADLAAAQWAFDNERPAGRGADTLPGAKRLFLPMRTGRGTIGVIGLDADGTGPILTPE
FT                   GRRLLDALADMGALALERVRLVEDLDRAERDAETDRLARALLTSISHDLRTPLASVLGA
FT                   ASTLRDLDGALPVEAKAELLTTIIEESERLNRFIVNLLDMTRLEAGAVAPNLAPQDVAE
FT                   TIDTALRRTQKILAGHRVAVEIAPDLPTLRLDPVLFEQVLVNLLDNAAKYAPEGSTVTL
FT                   RARQDGRTVRIEVLDEGFGLPEADVERVFDKFYRVRKSDRVRAGTGLGLAISRGFVEAM
FT                   GGTVTAGNRRDRSGATFTVTLPVPAQPTPRDIAA"
FT   CDS_pept        122038..122784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="METD_I0121"
FT                   /product="response regulator in two-component regulatory
FT                   system with KdpD, regulation of potassium translocation
FT                   (OmpR family)"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0121"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21795"
FT                   /db_xref="GOA:C7C6P1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21795.1"
FT                   /translation="MSPTILVIDDEPPIRKLLRMGLATQGYAILEAPNAATALEVLGRA
FT                   SPDLVILDLGLPDMRGHDLLRAIRASHPGLPVVVLSSRDDEGGKVEALDLGADDYVTKP
FT                   FGMAELLARLRAALRHQLAARGERPVFRIDGLSVDLVRRIVKVDDVEVKLTPREYAFLR
FT                   IMVLHAGKVLTHAQLMNEVSVSSDPQYLRVYMRQLRQKLEADPERPRILLTETGVGYRL
FT                   RAPDDEPNLKLRAANDLKPAVTEAGS"
FT   CDS_pept        complement(123034..123267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0122"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0122"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21796"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21796.1"
FT                   /translation="MSPTLQVAAIHADASATDADRFIVGQDPAGHWVAIEIHGRAGGLF
FT                   RSRKDAVDYAEDETDHRPDAVLLSGACIELRI"
FT   CDS_pept        123528..124838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0123"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0123"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21797"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21797.1"
FT                   /translation="MALLLVLGAVAAFHLTRPTTLTIAVAPNGGTEPALLRAYADELAR
FT                   RNLGIRLKVVSFAGVRESAEALKAGKADLAVVRPDVAMPGNGLTLAVLRTLAAFVAAPG
FT                   ASGTKDIPDLAGKRLGMLASRTADRTLLHDLVGHYGFELLTDAPGGAVNNTAVVLVPIE
FT                   EADVATALRDGRIDAMALVTTPSSPAARRVVALVGEASDGGDVALIGLPDTAAVLARRP
FT                   RLQPVTVPAALYGGNPRLPAEDVATVGSSYRLMARADLSRSVAAEVTQHLFEMRAALAE
FT                   TVPAAEDVSHPDYEDTADATSARLPIHPGALDYYEREQETLIERYESWIYLVAILGGGL
FT                   GSTAAWLRQRIGRQRRERIEVATARLLELRSDARRETDRERLEAMAGEVDDLAASIARH
FT                   ALNKPTEPRTLSAATVAIDAARSTLKRVLSGAGSPIG"
FT   mobile_element  complement(124890..124964)
FT                   /mobile_element_type="insertion sequence:ISMex5"
FT                   /function="17.3 : Transposon functions"
FT                   /note="fragment of Insertion Sequence ISMex5(1209-1283,
FT                   Id=88%), IS3 family; Evidence 5 : Unknown function"
FT   CDS_pept        complement(124924..125088)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0124"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 5 : Unknown function; Product type e :
FT                   enzyme;fragment of transposase of ISMex5, IS3 family(ORF
FT                   2)"
FT                   /db_xref="PSEUDO:CAX21798.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   mobile_element  complement(124982..125074)
FT                   /mobile_element_type="insertion sequence:ISMex5"
FT                   /function="17.3 : Transposon functions"
FT                   /note="fragment of Insertion Sequence ISMex5(514-606,
FT                   Id=82.8%), IS3 family; Evidence 5 : Unknown function"
FT   CDS_pept        complement(125145..126083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0125"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0125"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21799"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21799.1"
FT                   /translation="MIEAVMLWNEPNNKSHWDPEIDPDWFLFGEMVKQASRAIRAEAPD
FT                   LTQVLGGISPIDPVFMQHMQARGVLDGLDAVAVHGFPLDWNLWPIHDWPQKIAEIRAVT
FT                   HLPVWVSEVGVSSFGAEEVQAWGCRRTAELLRGQAPRIHWYSLYDLPREWEATTRHREA
FT                   EGSSYYRHFHMGLLRQDGTPKLALEEFARCTPDFGLCQWFHYQDHRLDEAVAWMKRLGV
FT                   TYLRTGLSWADSFRPDALDWFDRQMTALQDFKVTVTFCFTPEHRGIAAHHTSPPLVREE
FT                   FAEFCAAMVRRYADRQPVQVEALPVPEMPFL"
FT   CDS_pept        complement(126080..126868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0126"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0126"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21800"
FT                   /db_xref="InterPro:IPR027554"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21800.1"
FT                   /translation="MTRLATDAANSETLRREADALGPWFHNIDLGGVWTAPDHFLGDYP
FT                   GLKWRRFASALPADLAGKSVLDIGCNGGFYSIEMKRRGASRVLGLDSDERYLAQARFAV
FT                   SHLGHDIEFRNLSVYDVGALAERFDVVLFMGVLYHLRHPLLALDLIHEHVAGDLLVFQS
FT                   MLRGSSQVEPVAHDYDFWDMDQFERPGYPRLHFVEHSYAHDWTNWWIPNRAGMEAMLRA
FT                   SGFTIESRPEAEVYLCRRAPAPAGAEAVYPARGINGREGR"
FT   CDS_pept        complement(126865..127650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0127"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0127"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21801"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21801.1"
FT                   /translation="MRRVFLVRHASHDRLGQVLCGRMPDVSLSAQGRAEAEAMATALAR
FT                   RLAPDLHTSPTEQDRAPLLSLAGRWEEPEVAQDEAPRYPLPAPDSPGGGERTRLAPVIG
FT                   GERTPRSGIRVLSSPQTRSRETAAPLAQKLAAAIETADEIDEIEFGAWTGRAFAEFASD
FT                   PAWVAWNAERATARPPGGESMGEVQARALRLLDRLGREEAPPAILVSHADTIRAASLGV
FT                   LGLSLDAYDRLVVAPASWSELALWPGGGRVVSINERVSP"
FT   CDS_pept        complement(127647..128744)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ino"
FT                   /locus_tag="METD_I0128"
FT                   /product="inositol-3-phosphate synthase"
FT                   /EC_number="5.5.1.4"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10448034; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0128"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21802"
FT                   /db_xref="GOA:C7C6P8"
FT                   /db_xref="InterPro:IPR002587"
FT                   /db_xref="InterPro:IPR013021"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21802.1"
FT                   /translation="MASAPIRVGIVGVGNCASSFVQGLHYYREADADTAVPGLISPELG
FT                   GYRIGDIEVVSAFDVAADKVGRDVADAILAPPNNTHRFAAVPRTGVTVRRGPTLDGIGR
FT                   YLQGIIAESDEPVADVVAELQRSRTQVLLSYLPVGSQAAGEFYAHCALEAGCALVNCIP
FT                   VFIASDAGWRKRFEERSLPIVGDDIKSQVGATIVHRMLANLLRERGVKLERTYQLNFGG
FT                   NADFLNMLERERLESKKLSKTRAVTSQLATPLADGDIHVGPSDHVPWLEDRKWAQIRLE
FT                   GTGFGGVPLNIELKLEVWDSPNSAGVVVDAVRCARIALDRGIGGALLGPSGWFMKSPPV
FT                   QFTDAEAHARTLRFAAGEAEEPATR"
FT   CDS_pept        complement(128744..129784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0129"
FT                   /product="putative dTDP-glucose 4,6-dehydratase"
FT                   /function="2.6 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="4.2.1.46"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0129"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21803"
FT                   /db_xref="GOA:C7C6P9"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6P9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21803.1"
FT                   /translation="MDRQAEWVLVAGGAGFIGSHLVDALLARGARVVALDSLLTGRRDN
FT                   LAHLSHEPRFEFVEADITEPLPRLPRFERVFNLACAASPPHYQADPIHTMLTSVVGTLR
FT                   LLERARNDGARFLQASTSEVYGDPLVHPQPEAYWGNVNPTGPRACYDEGKRAAETLAFD
FT                   FERGQGLEVRVARIFNTYGPRMRADDGRVVSNVICQALADAPVTVYGDGEQTRSFCYVT
FT                   DLVEGLMRLMACEAAPGGPVNLGNPREMTVAELVSLVAEMTGTRSPVVRRPLPVDDPQR
FT                   RRPDIARAQALLGWSPKVALEQGLEATIAWFAGEIRAPEQPVAKPRSIGGRHLRPVEAA
FT                   LARQAP"
FT   CDS_pept        complement(129796..130911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0130"
FT                   /product="conserved protein of unknown function; putative
FT                   glycosyltransferase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0130"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21804"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21804.1"
FT                   /translation="MTCTPLRLVVLGLSLSSSWGNGHATTYRALLRAFAARGHDVLFLE
FT                   RDVPWYAAHRDLTDPDFCRLALYADLDDLEDHRAAIEQADAVVVGSYVPDGIAVGRRVL
FT                   AWAEGTRAFYDIDTPVTLANLAAGTCTYLEANQIEAYDLYLSFTGGPTLERLEERYGSP
FT                   AARALYCSVDPEAYPPFAGEKAYDLSYLGTYSPDRQPILEQLLIEPARRAPDLRFAVSG
FT                   PQYPDGIDWPDNVTRSDHLPPEAHPAFYGQSRYTLNVTRADMTAAGYSPSVRLFEAAAC
FT                   AIPILSDRWDGLDTILAPDREILCPEGPDAVLAILRDRPEPERRRIGEAGRAAILARHS
FT                   AARRAAEFETHLREAAARLAFLRTPPRTVIN"
FT   CDS_pept        complement(130908..132014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0131"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0131"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21805"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21805.1"
FT                   /translation="MKIAFYGSSLLSSYWNGAATYYRGMLADLARRGHRITFYEPDAFD
FT                   RQSHRDIDPPDWAEVQVYPATIEASRAVIAQAAEADVVVKASGVGVFDDELLEGVVAAA
FT                   RPDAIRIFWDVDAPATLAEMRANPDHALHRAMPALDFVLTYGGGPPVIAAYEGFGARAC
FT                   IPVYNALDSETHHPVPPDPRFSADLAFLGNRLPDREARVERFFLAAAARLPERSFLLGG
FT                   SGWESRGLPLNVRHLGHVSTRDHNAFNVTPRAVLNIARDSMAAVGFSPATRVFEAAGAG
FT                   ACLITDAWEGLGLFLKEGDEVLVARDGRDVADHVAALTPERARAIGEAARLRIAAEHTY
FT                   ARRGAQVDAILRDERERRACGALRRSVA"
FT   CDS_pept        complement(132011..133138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0132"
FT                   /product="conserved protein of unknown function; putative
FT                   UDP-Glycosyltransferase/glycogen phosphorylase domain"
FT                   /function="5 : Central intermediary metabolism"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0132"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21806"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21806.1"
FT                   /translation="MRIVYFTHSLASCWNHGNAHFLRGVLRELAGLGHAIEAYEPEGAW
FT                   SRENLLRDHGPAGLEASLAPYPELSPKTYATIEAAVEYVEGADLVVVHEWNEPALVAAL
FT                   GRARKGGRIDTLLFHDTHHRAVSAPDAMRCFDLSGYDGILAFGETLAEVYRSWGWGARA
FT                   YVWHEAADTRLFRPPPETDVPRAGLVWIGNWGDGERTQELETFLFRPAQAAGLSLDIHG
FT                   VRYPAEALATLERYGARYHGWAPNAAAPALFAHALATVHVPRRFYVEALPGIPTIRVFE
FT                   ALACGLPLACAPWNDAEGLFTPGSDYLIARDGEQMESHLLALRGDASLRRSLTAHGLAT
FT                   IRARHTCRHRADELLAIHDSLTTSLNVPVRMEAAP"
FT   CDS_pept        complement(133135..134241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0133"
FT                   /product="putative glycosyl transferase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 12068013; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0133"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21807"
FT                   /db_xref="GOA:C7C6Q3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21807.1"
FT                   /translation="MPLTAARPHILMSADALGGVWQYTLDLAAGLTRRGASVSVALMGP
FT                   APAPERIARAQEISGARILTTNLPLDWTAESAAEVRDASDALAQLAEETGADLVHLHSP
FT                   ALALADFTAPVVAVCHSCVATWWATVGSGPLPADLAWRRDLNAQGCRKADRLIAPTHAF
FT                   ARTTQAAYGLAQAPLVVRNGRAVPVSPGAEPASHVFTAGRLWDLAKNAAALDRLAARLS
FT                   VPLRAAGPVAGPMGQRVALTALDCLGRLDDEEIARELGLRPVFVSLARYEPFGLAVLEA
FT                   AGAGCALVLSDIESFRELWDGAALFVPSDDDAAAARAVQGLFADPACRAALGRAARTRA
FT                   AAYGTEAMVAGVARIVRGLHPALDEAAA"
FT   CDS_pept        complement(134232..135527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0134"
FT                   /product="Radical SAM domain protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0134"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21808"
FT                   /db_xref="GOA:C7C6Q4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR027559"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21808.1"
FT                   /translation="MRVAFVNPPWDYRNSIYFGCREPHLPLELGYAAALLEAGGHETLL
FT                   VDCHLEGLCAAEGAERIAAFAPAMTVITTAPTYLFWRCAPPEMRVTRAFLDALQGRGGR
FT                   TVAVGPHGSATPRPTLEKLGCDVVVRGECEEIVARLAETDDLRSLPALAYRDAEGRVVV
FT                   TGPPHAGRFTDLPALAWPDAWIARHHHHHHRFDTAPDGPGAEIEASRGCPYTCSFCAKI
FT                   DFRDAYRRRDLPIVLEEIDGLISQGVTYLYFVDEIFLPQKPLLEALVGLRVKFGVQTRI
FT                   DLWKPDMLDLLGAAGCVSIEAGIESLTEEGRAALDKRCRASTDDLAERLIHARRTVPFV
FT                   QANLIAVAGDDPDLVAAWRDRLRGAGVWANDPVPLYPYPSSPDYRRLWGEPDDTAWERA
FT                   HAHYLSQFTRFSDIQEERPLPLPELEATCGCR"
FT   CDS_pept        complement(135524..136615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0135"
FT                   /product="putative dTDP-glucose 4,6-dehydratase"
FT                   /function="2.6 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /EC_number="4.2.1.46"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0135"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21809"
FT                   /db_xref="GOA:C7C6Q5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21809.1"
FT                   /translation="MSGPATTTTRPVLVTGGAGFVGANLADQLAAEGQTVLVYDALTRP
FT                   GVEANLAWLTERHGARIVPVIADIRDGAELALAVREAGAVFHFAAQVAVTTSMTAPWED
FT                   MEVNLGGTLTLLEALRARRGAVPLLFASTNKVYGGLPDVELAVEGDAYRPTDPNLRAHG
FT                   VGEDRPLDFHTPYGCSKGAADAYVLDYARSYGLPTVVMRMSCIYGPRQMGNEDQGWVAH
FT                   FLIRALTNRTVTLYGDGRQVRDILHVRDAVAAYRAALARIDRVAGRAFNLGGGPDNAVS
FT                   LRGLIAHLGTLLGREVGIETGAWRPGDQRYYVSDTRRAASMLGLAPPLPWREGVADLAA
FT                   WLTQWLDAEAETSRAACQPEAVL"
FT   CDS_pept        complement(136612..137724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0136"
FT                   /product="Putative UDP-glucose 4-epimerase"
FT                   /function="2.6 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /function="6.11 : Sugars"
FT                   /EC_number="5.1.3.2"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0136"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21810"
FT                   /db_xref="GOA:C7C6Q6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21810.1"
FT                   /translation="MKKLALITGGAGFIGRHLASALLARGYRVRVLDSLIEQVHGGTGQ
FT                   PLSLDPAVEFVEGDVRDAEAVARAIAGATHVVHLAAEVGVGQSMYAVERYVSVNDCGTA
FT                   TLFQALIEAPVQRVVVASSMSIYGEGLYRTEADATVEDAVRPPRRPGEPWDPPDQQGRP
FT                   MRPVPTPESKRPALASVYALTKYMQERLTLTLAPAYGMEGVALRLWNVYGPGQALSNPY
FT                   TGVLAIFAARLLHGQPPMIFEDGEQRRDFVHVEDVAQAFVLALEHPAAAGQVYNVGSGE
FT                   DRTVNEVARLLARAMGREEIAPQVTGQARAGDIRHCIADIGKIARELGYAPKRNFAEGL
FT                   AELAAWVAEQQAVDRVAEARRELEARGLVA"
FT   CDS_pept        137916..138104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0137"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0137"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21811"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21811.1"
FT                   /translation="MAGSRLTGSASELAYASLWRHPPPRRAVDGLPGSTVAVIALKPIG
FT                   RFVCGVSLRSMRTALIF"
FT   CDS_pept        complement(138526..138993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0138"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0138"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21812"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21812.1"
FT                   /translation="MQTKDPELVRPRFVHAMHEIEARWARLTAGPAVLSEREAHELAAP
FT                   AHDRWITKHRDNLSQNPWRTDLFARVWQKRRLGLWRRPDVVYQVRSGEDEMEAWCLKQT
FT                   DTLTAKKGLQTNDDGRRILAKAFSPAIQRASLKLGRGLIKLAAPRVWLRIL"
FT   mobile_element  139188..140376
FT                   /mobile_element_type="insertion sequence:ISMdi3"
FT                   /function="17.3 : Transposon functions"
FT                   /note="fragment of insertion sequence ISMdi3 (1-1189,
FT                   90.33%), IS3 family; Evidence 3 : Putative function from
FT                   multiple computational evidences"
FT   CDS_pept        139254..139535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0139"
FT                   /product="transposase of ISMdi3, IS3 family (ORF 1)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0139"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21813"
FT                   /db_xref="GOA:C7C6Q9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Q9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21813.1"
FT                   /translation="MRRGQKTSAEQVVLKLRQIEVQTAQGKSLALACKEAEISEQSYYR
FT                   WRKEFGGLQVDQARKMKDLERENARLRRLVADLSLEKQVLADVASGNL"
FT   CDS_pept        139643..140395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0140"
FT                   /product="transposase of ISMdi3, IS3 family (ORF 2)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0140"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21814"
FT                   /db_xref="GOA:C7C6R0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21814.1"
FT                   /translation="MPTVLADEDDLTRAIIALASEYGRYGYRRVTALLQADGWQVGKDR
FT                   VQRIWRREGLKVPSRHRPRSRLWLNDGSCVRLRPLRRNHVWSFDFVQAQTHDGRSLRIL
FT                   TLIDEHSRACLALKVARRINSLGVIEALADAMCLHGIPEHIRCDNGPEMISKALRKWVA
FT                   KAGSQIQYITPGSPWENGYCESFNGKLRDECLRQEIFYSLKEAQAVIALWQNTYNRVRP
FT                   HSSLGYRPPAPVSFPHLAFRLPMAGAMQ"
FT   mobile_element  140399..141530
FT                   /mobile_element_type="insertion sequence:ISMex17"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Insertion Sequence ISMex17, IS110 family; Evidence 3
FT                   : Putative function from multiple computational evidences"
FT   CDS_pept        140581..141510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0141"
FT                   /product="transposase of ISMex17, IS110 family"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0141"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21815"
FT                   /db_xref="GOA:C7C6R1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21815.1"
FT                   /translation="MDAPVVGIDVARDRLDIHVHPSGANFAVDRTTEGVEQLCERLRPL
FT                   KPKLVVLEATGGLEAMVARALTTWRLPAVIVNPAQVRAFAHALGQRAKTDRIDATVIAR
FT                   FAAATNPPVRARADAETQALADLVTRRRQIVGLIASERQRASQAPPCIRDSVRRVIEAL
FT                   EQEQSVIDRSIDAEVDRSLEWRRKETLLTSVPGVGPTIARTLIAELPELGSLNRKQVAA
FT                   LVGLAPWTRQSGQWRGRSFIAGGRAPVRTALFMGAMVASRHNAALKTFRDRLIAAGKPK
FT                   LVALIATARKLITILNAILRDGTPWQPA"
FT   CDS_pept        141912..142367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="METD_I0143"
FT                   /product="component of DNA polymerase V, subunit D"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0143"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21816"
FT                   /db_xref="GOA:C7C6R2"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21816.1"
FT                   /translation="MSLFRADELPDQGFSAVRVPLMGPSLCAGFPSPADDFVENALELP
FT                   RWLVPNPPATFLWRIAGDSMRDAGIFDGDLACVDRSLKPGHGSVVVAAVDDEMSIKRMV
FT                   VEGNRAHLSFDNSELPIYALEELAEVNVWGVVRFTSRWHVSSAGQGR"
FT   CDS_pept        142364..143515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="METD_I0144"
FT                   /product="component of DNA polymerase V, subunit C"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0144"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21817"
FT                   /db_xref="GOA:C7C6R3"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR036775"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21817.1"
FT                   /translation="MSSAEARLRDRIGGGRALALIDGNSFYCSCERVFDAKLARVPVIV
FT                   PSNNDGCAIARTPEAKALGIKMGDPYFKIRGLCEAQGVRVFSSNYTLYGDMSARINAIY
FT                   RDATPDVEVYSIDESFLDLTAFVRRDRVALALDIRATVQAWTGIPTCVGIGPTKTLAKL
FT                   ANHIAKTVPELDGVCDLTEPVAYEHWLCRIHVGELWGVGRASLPKLEALGIDTVADLRD
FT                   IDPRPVRNALSVVGKRMIHELRGVSCLGLELVPARRKGCAVKRSFSGRVTERAELDQAV
FT                   AAHATRLGEKLRREGLGTDHITVFDHTSEHDRGEPMRSVSTVVTLPEATNDTLALIPAA
FT                   LHGVARTWREQGSPPWRYSKACVVTVDLVPLEASQRVLIGRLD"
FT   CDS_pept        complement(143998..145128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I143998R"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="InterPro:IPR007577"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01952.1"
FT                   /translation="MRLPRLLKKLWSAPSERHMPGFDEAYYLEHHPTVRHSADSPLQHY
FT                   LQHGWKDGCDPSVGFSSSEYLAANPDVAASGRNPLAHFLEHGLAEGRGGWRKGFALDEH
FT                   LSIDQRVSADWFSDNNAGLPLIFMYWESRNLAEPISAPSWRSFYPNFRVFYEEDVIPLL
FT                   PEKFVDLFVCINIPAAKSDIARMYLLKEYGGLYIDAHVGPASSANLMMTLSRLAGCNLM
FT                   LFSRKWMMGEGSDFLDLMNTVIAARKGAPELDLVIDKIVRNVREHKRKEEEASEYVPYD
FT                   LFNLTGTWLIVESFLEVPALTPRVKVGFRENVIVNLMESDDSSGFHLYKFHEYRKQGNH
FT                   WSERQRYERFFETEEITSLSDARARAATRRPPPPRS"
FT   CDS_pept        complement(145156..145413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0146"
FT                   /product="putative protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01953.1"
FT                   /translation="MSAPGHTLEDDGAGNFIVKVGWDEAGTIAEDHEYPGLLACGTRTA
FT                   CSWSGQIRRKRQRPSWRHGSFRKSRISLDEATAREKTLVV"
FT   CDS_pept        complement(145410..145631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0147"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0147"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21818"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21818.1"
FT                   /translation="MRLWWTAPQIFGVHPKHGTLRIDWCGVMITGGNKAIGIGPNRILF
FT                   GNVSGYRNTPGAPTGVPIWEFAARAQKA"
FT   tRNA            complement(146033..146122)
FT                   /gene="trnS"
FT                   /locus_tag="METD_MTRNA57"
FT                   /product="tRNA-Ser"
FT                   /note="Ser-tRNA (tRNA3); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        146255..147568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rarA"
FT                   /locus_tag="METD_I0148"
FT                   /product="recombination protein"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0148"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21819"
FT                   /db_xref="GOA:C7C6R5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21819.1"
FT                   /translation="MSDLFVSAGLETGAPRPLADRLRPRRLAEVVGQEHLTGPDGALTR
FT                   LLASRSLGSLVFWGPPGTGKTTVARLLAHETALHFEQISAIFSGIGDLRKVFEAARKRR
FT                   ATGQGTLLFVDEIHRFNRAQLDAFLPVMEDGTVTLVGATTENPSFELNAALLSRARVLL
FT                   FRALDAPALARLLARAEEMDGQPLPLDEEARAALIRMADGDGRAALTLAEEVWRSARPG
FT                   EILDAETLQSLVQRRAPIYDKAQEGHYNLISALHKTVRGSDPDAALYYLCRMLDAGEDR
FT                   LFIARRLVRMAVEDIGLADPQALVVANAAKDAFDFLGSPEGELALAQVTVYLACAPKSN
FT                   AVYNAYKAATRVAKAAGSLAPPRTILNAPTGLMRRIGYGEGYRYDHDEPDAFSGQDYWP
FT                   EALGRQHFYEPTDRGMETRYRERLAYWERLRQERRGDD"
FT   CDS_pept        147604..149097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0149"
FT                   /product="putative carboxypeptidase 1"
FT                   /EC_number="3.4.17.19"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="GOA:A0A2P9HAW9"
FT                   /db_xref="InterPro:IPR001333"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01954.1"
FT                   /translation="MQAYATLTATFARLGALEDASGILGWDTQTQIPDGASDTRGEQLA
FT                   VLSVLAHEILTDPRNAERFDAAEAEAHLGEWERANLREMRRAYAHAAAVPGDLVEAASK
FT                   AATRCEMVWREARRDSDFARLRPHLEEVLRLRRRVGEAKGAALGLAPYDALLDGYDPGM
FT                   RRARIDPIFAALRAVLPDLVVAARERQAADAPPLPLPGPFPVATQREIGLQLMRAVGFD
FT                   FARGRLDISLHPFCGGATDDVRITTRYDEASATGALMGVLHETGHALYEQGRPAAWRHQ
FT                   PVGQARGMSLHESQSLLVEMQACRSAEFCAYLAPTLRAAFGGEGPAWEAKNLHRLYTRV
FT                   EPGFIRVDADEVTYPAHILLRYRLETAMIAGDLTVADLPGAFNDGMKELLGLTVPDDRH
FT                   GCLQDIHWPGGSFGYFPTYTLGALAAAQLFKAACAAHPSIRPALAEGDFSQLRGWLREN
FT                   VHARASLMETDELLTAATGKPLGADDFLAHLRSRYLGTV"
FT   CDS_pept        149260..150507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0150"
FT                   /product="molecular chaperone, HSP70 class"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0150"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21821"
FT                   /db_xref="GOA:C7C6R7"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR042054"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21821.1"
FT                   /translation="MAACGLDFGTSNTTLGIGMGARPTLVPLEGTHRTLPSAIFFAPGQ
FT                   EAQIGRGAIEAYVEGTPGRLMRALKSVLGSPLIEETTPVGRERIRFRDVIARYLTLVKA
FT                   RGEAEAGVELDTVVHGRPVHFVDNDPAADRKAEDTLRQIAESIGFRHVRFQYEPIAAAL
FT                   DYERTVTSEEIALIADIGGGTSDFSIVRLSPERHRRDERAEDILANDGIRIGGTDFDRN
FT                   LSLGAVMPLLGLGSPMKRADLAVPNAYFHDLATWSSINRLYNSKTLREIDEVVRDAARP
FT                   ELVTRLRTVVEAERGHSLAMAVEGAKIAASDAGAGMVDLEWVESGLAADVDRARLAGHT
FT                   DELARRMAQRISRCLDQAGLTADRIDALFLTGGSTGLPHVRAALTACVPGARVVDGDTF
FT                   GSVGLGLTLEAAWLAA"
FT   CDS_pept        150492..150722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0151"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01955.1"
FT                   /translation="MVGGLRRQFGAARPPAAPTFESGFRRVCRRSDRSRPFMDEREWHW
FT                   SQGLAASARRGIVGKDSAAQPAAALCAVISG"
FT   CDS_pept        150735..152141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluC"
FT                   /locus_tag="METD_I0152"
FT                   /product="pseudouridylate synthase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number="4.2.1.70"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 14704707; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0152"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21822"
FT                   /db_xref="GOA:C7C6R8"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21822.1"
FT                   /translation="MKGRPPHRGSGAKRGPSGFAPRAGTGPRTSAKDAAQRAARNRGED
FT                   AAERSPWDDGAATEGAPRPNRVPEAAAPKPDAPRARAKTPSDKPRAAKPSFAKPSFAKP
FT                   PLAKPDPAKAPPAEAPAGPTRREQRAAASATLASGVQTLTVDPDEAGMRIDRFLGARFP
FT                   QLPFTRVQSIVRKGELRVDGKRAKPNDRLEPGSSVRVPPLKLDQPTERPRSAAKIDGDA
FT                   EFLRSLILYEDADMMILNKPFGLAVQGGSGTVRHVDGLLEALTGPDGQRPRLVHRLDKD
FT                   TAGCLIVAKTRLAASTLAKSFRSRAARKIYWALVAGVPRTRQGRVSTYLVKDEPTDADA
FT                   RMRVAKHGDDGASHALTYYATVDQAAQKLAWLSLKPVTGRTHQLRAHAAHIGHPIVGDP
FT                   KYFDVENWELPGGIQNRLHLLARRIVIPHPRTGQPVDVSAPLPPHMAQSWNLLGFDAAR
FT                   YDPIVEAPEA"
FT   CDS_pept        152750..153475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0153"
FT                   /product="putative haloacid dehalogenase family hydrolase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0153"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21823"
FT                   /db_xref="GOA:C7C6R9"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6R9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21823.1"
FT                   /translation="MSRRGAPAVLKLIVFDVDGTLIDSQHLIVEAQHRAFSEHGLVAPP
FT                   RKEALSVVGLSLPEAFRRLVGEAGPIESLAHSYRKAFQALRVDPDYEEPLFPGMAELVE
FT                   RLHCRDDIQLGIATGKSRRGVNHLVDKYGWERWFATIQTADDAPSKPDPAMLLQAMAET
FT                   GAEPSMTVMIGDTTFDMMMARSASVAAVGVGWGYHTPGALFSAGAVTVVDSAATLSDLF
FT                   SGPLDDSQPGPVTERLATQ"
FT   CDS_pept        153536..154339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0154"
FT                   /product="conserved protein of unknown function; putative
FT                   domain ATP12 chaperone protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0154"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21824"
FT                   /db_xref="GOA:C7C6S0"
FT                   /db_xref="InterPro:IPR011419"
FT                   /db_xref="InterPro:IPR023335"
FT                   /db_xref="InterPro:IPR042272"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21824.1"
FT                   /translation="MSTSGDDVTRDWLGEPGENGKPDRVQASRAGTGPTLPKRFYAQAG
FT                   LAEAEGGFRLVLDGRGANTPGRRPLVVPDRVLGEALVAEWEAQADVIDPRTMPLTRLVN
FT                   TTIDGVVERRAAVAEDLAAFAGTDLVAYRAGAPERLVAVQSEAWDPLVAWVAETLGARL
FT                   FLAEGVMHVEQPEGSVAALRAAIEAVDDPFRLAALHTLTTLTGSLVIALAVLHGRLSAD
FT                   DAWAAAHVDETYQASVWGRDAEAEARLAHRRTEFETAAMVAQRPN"
FT   CDS_pept        154934..156466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pccB"
FT                   /locus_tag="METD_I0155"
FT                   /product="propionyl-CoA carboxylase beta chain"
FT                   /EC_number="6.4.1.3"
FT                   /note="Evidence 1c : Function from experimental evidences
FT                   in the studied genus; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0155"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21825"
FT                   /db_xref="GOA:C7C6S1"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21825.1"
FT                   /translation="MKDILEKLEERRAQARLGGGEKRLEAQHTRGKLTARERIELLLDH
FT                   GSFEEFDMFVQHRSTDFGMEKQKIPGDGVVTGWGTVNGRTVFLFSKDFTVFGGSLSEAH
FT                   AAKIVKVQDMALKMRAPIIGIFDAGGARIQEGVAALGGYGEVFRRNVAASGVIPQISVI
FT                   MGPCAGGDVYSPAMTDFIFMVRDTSYMFVTGPDVVKTVTNEVVTAEELGGAKVHTSKSS
FT                   IADGSFENDVEAILQIRRLLDFLPANNIEGVPEIESFDDVNRLDKSLDTLIPDNPNKPY
FT                   DMGELIRRVVDEGDFFEIQAAYARNIITGFGRVEGRTVGFVANQPLVLAGVLDSDASRK
FT                   AARFVRFCNAFSIPIVTFVDVPGFLPGTAQEYGGLIKHGAKLLFAYSQATVPLVTIITR
FT                   KAFGGAYDVMASKHVGADLNYAWPTAQIAVMGAKGAVEIIFRAEIGDADKIAERTKEYE
FT                   DRFLSPFVAAERGYIDEVIMPHSTRKRIARALGMLRTKEMEQPWKKHDNIPL"
FT   CDS_pept        complement(156528..157082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0156"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0156"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21826"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21826.1"
FT                   /translation="MPILVIFTAVIVSVLIWLLRAHYTVKQLKEIDQDTKGLQRKAKSA
FT                   FENFVGTPLQRVNDVRLAAVILMIQIVRTGSPITASEKTRIFELMENPLEIQTISATFE
FT                   RAWRYTQERRPFSLVADPLLPLLREKLTGEERMQLVEMLTKVASAHSAPSELQREALAR
FT                   LKRRLIVGKPELATSRAGHFG"
FT   tRNA            complement(157221..157295)
FT                   /gene="trnV"
FT                   /locus_tag="METD_MTRNA56"
FT                   /product="tRNA-Val"
FT                   /note="Val-tRNA (tRNA4); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        157519..158166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0157"
FT                   /product="transcriptional regulator TetR family"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0157"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21827"
FT                   /db_xref="GOA:C7C6S3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21827.1"
FT                   /translation="MQLSPLISDELSAETHTPRQQAVLDAALALMVDGRDPLTMDAVAR
FT                   RASCSKETLYRWFGDRDGLLTATVRWQASRVHAGRYDVSGLDAVALRKNLLDFAESWLA
FT                   VIASPTSVALNRIAIADAGSRRSNLGGIVLANGRFAIGERVKPVLEAGRAAGLLAFEDS
FT                   EAAFRTFFGLVGRDIQIRLLLGDALDLDAAEIRSDAARAVEQFLALYGRAKP"
FT   CDS_pept        158200..159219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="METD_I0158"
FT                   /product="acetohydroxy-acid isomeroreductase"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number="1.1.1.86"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 1903397; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0158"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21828"
FT                   /db_xref="GOA:C7C6S4"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21828.1"
FT                   /translation="MRVYYDRDADLNLIKGKNVVIVGYGSQGHAHALNLRDSGVKDIVI
FT                   ALREGSATAKKAEHEGFKVMNVADAAKWGDVVMMLTPDELQGDIYKESLEPHMKQGAAL
FT                   LFAHGLNVHFNLIEPRKDLDVLMVAPKGPGHTVRGEYLKGGGVPTLIAIAQDASGNAHD
FT                   LGLSYASANGGGRAGIIETTFKEECETDLFGEQAVLCGGLVELIKAGFETLVEAGYAPE
FT                   MAYFECLHEVKLIVDLIYEGGIANMNYSISNTAEYGEYVTGPRIVTPETKAEMKRVLND
FT                   IQSGIFTRNWMLENKVGQTSFKATRAKLAAHPIEEVGAKLRGMMPWISEKALVDKTKN"
FT   CDS_pept        159387..160040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0159"
FT                   /product="putative pyridoxamine 5'-phosphate oxidase,
FT                   putative flavin-nucleotide-binding protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0159"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21829"
FT                   /db_xref="GOA:C7C6S5"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21829.1"
FT                   /translation="MASLYSEAHRALQEEFGTTKLAVRLDEDWVHETIQPNEAAFIASR
FT                   DMFFLSTVDPGGMPTVSYKGGPTGFVKVVDGSTLVFPGFDGNGMFYSMGNIAGQAKIGL
FT                   LFIDFETPHRIRVQGHASLLRDDPLMAEYTEAKYLVRVGVTKIWINCPRYIHKYKKLEQ
FT                   NKYVPRPDRETPLAAWKRLDLAGDVISDEDKARVAREGRLEVPEYEALVARGEA"
FT   CDS_pept        160104..160976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0160"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0160"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21830"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21830.1"
FT                   /translation="MLRARDLGQHDGPHLGMTFFRRTLHNHPQIKRALKSVAKSVGLFR
FT                   SSPANDFYRDLAEVRTRGDDAFSKLFYGYDGDHLINKWNHFLPIYSRLFVPFRDSRPDG
FT                   RPLRFLEIGVYEGGSLDLWRRFFGPSAILYGIDVDPRCAVFDGRAAQVRIGSQADPAFL
FT                   RSVVEEMGGVDVVLDDGSHVASHQCVTFETLFPLLAPDGLYVAEDLHTAYWRDYEGGYR
FT                   RKGTFLEMTKGFIDDMHAWYHDRGAQEIGRSIGAIHVFDSIVAFEKGSGERPFHTTIGT
FT                   PQRVIDRVR"
FT   CDS_pept        complement(161049..162347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccr"
FT                   /locus_tag="METD_I0161"
FT                   /product="crotonyl-CoA carboxylase/reductase"
FT                   /note="Evidence 1b : Function from experimental evidences
FT                   in the studied species; PubMedId : 12730156, 15687219,
FT                   16926146, 17548827, 8704985; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0161"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21831"
FT                   /db_xref="GOA:C7C6S7"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21831.1"
FT                   /translation="MAASAAPAWTGQTAEAKDLYELGEIPPLGHVPAKMYAWAIRRERH
FT                   GPPEQSHQLEVLPVWEIGDDEVLVYVMAAGVNYNGVWAGLGEPISPFDVHKGEYHIAGS
FT                   DASGIVWKVGAKVKRWKVGDEVIVHCNQDDGDDEECNGGDPMFSPTQRIWGYETGDGSF
FT                   AQFCRVQSRQLMARPKHLTWEEAACYTLTLATAYRMLFGHAPHTVRPGQNVLIWGASGG
FT                   LGVFGVQLCAASGANAIAVISDESKRDYVMSLGAKGVINRKDFDCWGQLPTVNSPEYNT
FT                   WLKEARKFGKAIWDITGKGNDVDIVFEHPGEATFPVSTLVAKRGGMIVFCAGTTGFNIT
FT                   FDARYVWMRQKRIQGSHFAHLKQASAANQFVMDRRVDPCMSEVFPWDKIPAAHTKMWKN
FT                   QHPPGNMAVLVNSTRAGLRTVEDVIEAGPLKAM"
FT   CDS_pept        complement(162528..163997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="katA"
FT                   /locus_tag="METD_I0162"
FT                   /product="catalase (hydroperoxidase II)"
FT                   /function="15 : Cellular processes"
FT                   /EC_number="1.11.1.6"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 14702393, 8955300; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0162"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21832"
FT                   /db_xref="GOA:C7C6S8"
FT                   /db_xref="InterPro:IPR010582"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024708"
FT                   /db_xref="InterPro:IPR024711"
FT                   /db_xref="InterPro:IPR037060"
FT                   /db_xref="InterPro:IPR040333"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21832.1"
FT                   /translation="MADQGPRLTTAFGNPISDNQNSLTAGSRGPVLMQDYHLIEKMAHF
FT                   NRERIPERVVHAKGYGAYGTFRLTRSLSEFTRAKVLTEVGKDVPMVARFSTVGGESGSA
FT                   DTARDPRGFALKFYTEEGNWDLVGNNTPIFFVRDAIKFSDFIRTQKRDPRTHLKPHWRR
FT                   WDFWSLSPEAIHQVMFLYSDRGTPKSARFMNGYGSHTFSLWNDRGERHWVKFHFHTKQG
FT                   IQNFSADEADEVAGKDPDYSSADLSTAIEQGDFPKWKVSVQLMPELDADTYRINPFDLT
FT                   KVWPHGDYPLIEIGEMELNRNPENYFAEIEQSAFEPSNVVPGIGFSPDKMLQNRVLSYA
FT                   DAHRYRLGVNYQQIPVNQAKNADVQTYHRDGAMRTDGNHGAQVDYEPNSFGGPKQDPSF
FT                   SEPPLRIQGDAGRYGWPGDDEDLYGQPMLFWTKVLDEGGRKRLVENIVTSMGDSPRHIQ
FT                   ERMIAHWFKVHEDFGRGVAQGLGNDAAEAAE"
FT   CDS_pept        164364..166430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ecm"
FT                   /locus_tag="METD_I0163"
FT                   /product="ethylmalonyl-CoA mutase"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 11872727, 17548827,
FT                   18819910; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0163"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21833"
FT                   /db_xref="GOA:C7C6S9"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6S9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21833.1"
FT                   /translation="MSAQASVAEVKRDKPWIIRTYAGHSTAAESNKLYRGNLAKGQTGL
FT                   SVAFDLPTQTGYDPDHELARGEVGKVGVSIAHLGDMRALFDQIPLAQMNTSMTINATAP
FT                   WLLSLYLAVAEEQGAPLAALQGTTQNDIIKEYLSRGTYVFPPAPSLRLTKDVILFTTKN
FT                   VPKWNPMNVCSYHLQEAGATPVQELSYALAIAIAVLDTVRDDPDFDEASFSDVFSRISF
FT                   FVNAGMRFVTEICKMRAFAELWDEIAQERYGITDAKKRIFRYGVQVNSLGLTEQQPENN
FT                   VHRILIEMLAVTLSKRARARAVQLPAWNEALGLPRPWDQQWSMRMQQILAFETDLLEYD
FT                   DIFDGSTVIEARVEALKEQTRAELTRIAEIGGAVTAVEAGELKRALVESNARRISAIEK
FT                   GEQIVVGVNKWQQGEPSPLTAGDGAIFTVSETVEMEAEARIREWRSKRDDRAVGQALAD
FT                   LEQAARSGTNIMPPSIAAAKAGVTTGEWGQRLREVFGEYRAPTGVTLQTVTSGAAEDAR
FT                   LLIADLGERLGETPRLVVGKPGLDGHSNGAEQIALRARDVGFDVTYDGIRQTPTEIVAK
FT                   AKERGAHVIGLSVLSGSHVPLVREVKAKLREAGLDHVPVVVGGIISTEDELVLKNMGVT
FT                   AVYTPKDYELDKIMVGLAKVVERALDKRAADRADTEAGVPGAPKRNESGAQVF"
FT   CDS_pept        complement(166540..167226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0164"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0164"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21834"
FT                   /db_xref="InterPro:IPR019619"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21834.1"
FT                   /translation="MIRHTRLLLASLCLIATGAWASAEPVQDGQLWINTTLFGSVGDVA
FT                   YFAEVQPRIGNGISQLDQLILRPAVGWKVNDALVLYQGYAYVEDHGMRDNVRIEDRSFQ
FT                   EINWKIGEFSGVKVSSRTRFEQRWQSAGRDVGFRLRENLRFAMPLPQGWGGVSAVGWTE
FT                   LFVALNDTDWGTRAGFDRVRAFIGLELPIGGKSTVEVGYLNQTARTQASGIELDHILSL
FT                   NLFVRY"
FT   CDS_pept        complement(167498..168244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0165"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0165"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21835"
FT                   /db_xref="GOA:C7C6T1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21835.1"
FT                   /translation="MSKLEGKVAVVTGASKGIGAAIAKALAKDGAAVVVNYASSKAGAD
FT                   AVVDAITAAGGKAIAVQADVSQAVQARGLVEAAVQQFGRLDVLVNNSGVYEFAAIEEVT
FT                   EEHYRRIFDVNVLGVLLATQAVSKHLGEGGSIINISSVVTDVLMPTSAVYSGTKGALNA
FT                   ISGVLANELAPRKIRVNVVSPGYVVTEGTHTAGIAGSEMEAGLVAQTPLGRSGQPDDIA
FT                   GVVAFLASDDARWVTGEVINASGGVR"
FT   CDS_pept        168353..168682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0166"
FT                   /product="putative transcriptional regulator, arsR family"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0166"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21836"
FT                   /db_xref="GOA:C7C6T2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21836.1"
FT                   /translation="MRPLFHPAIEDVQPEAILHALSDPRRAAIFARITKAGCVEACSAL
FT                   SSVGDQVIPKSSLSSHFKVLREAGLIRCERHGVEMRNHSRCAEVETRFPGLLSAIMNAY
FT                   AARAS"
FT   CDS_pept        168834..169895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="METD_I0167"
FT                   /product="Tryptophanyl tRNA synthetase"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number="6.1.1.2"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 6171561; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0167"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21837"
FT                   /db_xref="GOA:C7C6T3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21837.1"
FT                   /translation="MAAFTELVFSGVQPTGNLHLGNYLGAIKRFVEMQARDAQCLYCVV
FT                   DLHAITMWQDPEALKGQIREVTAAFLAAGIDPKRSIVFNQSQVPQHAELAWIFNCVARL
FT                   GWLNRMTQFKDKAGKDRENASIGLYDYPVLMAADILAYRATHVPVGEDQKQHLELTRDI
FT                   AQKFNNDFAGSILAHGHGEQFFPITEPLIGGPAARVMSLRDGTKKMSKSDPSEYSRIAL
FT                   TDDADAIAQKVRKAKTDPEPLPSEVAGLAGRPEADNLVGIFAALRGITRDEVLADFGGA
FT                   QFSSFKPALVDLAVETLAPIGAEMKRLVADPAYIDSVLGDGAGRAEAIAAPTLDAVKDI
FT                   VGFVRRGPALRAV"
FT   CDS_pept        complement(170011..170184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0168"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0168"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21838"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21838.1"
FT                   /translation="MADTSDTFKKAPKRKPAKGKSVSVSPEMRQAYADLIKEREEKEQA
FT                   YGRHLRKDEPRR"
FT   CDS_pept        170344..170949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="METD_I0169"
FT                   /product="3-isopropylmalate dehydratase (isomerase), small
FT                   subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0169"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21839"
FT                   /db_xref="GOA:C7C6T5"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21839.1"
FT                   /translation="MEKFTTLEGVAAPMRIINIDTDRIIPKQYLKTIKRTGLGQGLFSE
FT                   MRYNDDGSENPDFVLNQPAYRHAKTLVVGDNFGCGSSREHAPWALADFGIRCVISTSFA
FT                   DIFFNNCAKNGILAIVVSPEDLEKLFQDAERGANATLTIDLAAQTIKGPDGGTLHFDID
FT                   EGRKHNLLNGLDEIGLTLDQKAPAIDAYEAKLAQREWA"
FT   CDS_pept        complement(170957..171598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0170"
FT                   /product="putative pyrrolidone-carboxylate peptidase"
FT                   /EC_number="3.4.19.3"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0170"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21840"
FT                   /db_xref="GOA:C7C6T6"
FT                   /db_xref="InterPro:IPR000816"
FT                   /db_xref="InterPro:IPR016125"
FT                   /db_xref="InterPro:IPR036440"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21840.1"
FT                   /translation="MSRLLITGFGPFPTVPDNPSARLARRVAASPHLRRLLGHAPDCLV
FT                   LETRYGALDTQLAPALARRPRAVLMIGVAARRSRVCVETRAVNRVSRLFPDVSGAVGRF
FT                   LAFEPDGPAQRWSGAAAQVRVALQRAGLDAAASRDAGRYLCNASYYRVLATGCPAVFVH
FT                   IPMPPRTRRPKAGGGRRPKAGGGRRPALDRWTEALIEAARVLALRGRAQP"
FT   CDS_pept        complement(171595..172584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="meaB"
FT                   /locus_tag="METD_I0171"
FT                   /product="methylmalonyl-CoA mutase accessory protein"
FT                   /function="5 : Central intermediary metabolism"
FT                   /note="Evidence 1b : Function from experimental evidences
FT                   in the studied species; PubMedId : 11872727, 14734568;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0171"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21841"
FT                   /db_xref="GOA:C7C6T7"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21841.1"
FT                   /translation="MSATLPDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLI
FT                   DAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILG
FT                   DKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSET
FT                   AVADLTDFFLVLMLPGAGDELQGIKKGILELADMIAVNKADDGDGERRASAAASEYRAA
FT                   LHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRAKLTATGEIAGKRREQDVKWMW
FT                   ALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLIGL"
FT   CDS_pept        172731..173765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0172"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0172"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21842"
FT                   /db_xref="InterPro:IPR010297"
FT                   /db_xref="InterPro:IPR014586"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21842.1"
FT                   /translation="MQPSDATRRSLLRLMGLAGVAGLSPALSGCVMDGLATGTVGETQS
FT                   ALDVSPVLLIATTRRPAAGNPPKAPFFGSERGRGLSFAEARMTAPDRSLIGKVSAVVGG
FT                   DWGVRSVGDVTTGSGAAAAFAQSAFGRDVLIYVHGYRESFESAAISAARLSDGIRFNGA
FT                   SALFTWPSAAATFDYGYDRESALWSRDAFEDLLKTVATTPSGGRIHIVAHSMGTLLTLE
FT                   TLRMLRAEAGEAAVARIGAVVLAAPDIDIDLFTNGVERLGPDAKRITVISATNDRALEL
FT                   SGAIAGGVVRAGAADRERLEALGVRVADASDYGGGLFNHDLFLSNREVQAVVKRAVSRG
FT                   SSGT"
FT   CDS_pept        173951..174298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0174"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0174"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21843"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6T9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21843.1"
FT                   /translation="MFTLEIDGKAIAVINGDEATARDLFTCDGFKEDIRTMTIDGQPIW
FT                   NGTSDLIVRKANEDEIEEFEDALASDDGEGDFEPDAQHEAEGDGSDDEDEADIVFLVDI
FT                   DDEDEDQTLDA"
FT   CDS_pept        complement(174376..176256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0175"
FT                   /product="putative Acylaminoacyl-peptidase"
FT                   /EC_number="3.4.19.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0175"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21844"
FT                   /db_xref="GOA:C7C6U0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21844.1"
FT                   /translation="MVDLIPRAHLFGNPTRYGHQISPDGRRLGWVAPHEGVLNIWSAPI
FT                   DDLDAAVPVTTDRRRGIDAYAFAYDGRHLLYVQDADGDENHHLYAVDLTTGERRDLTPI
FT                   PGIAAAIVGLSRIVRDRVLVAINDRDPRFHDLHSIDLATGERSLVIENPGFAGFLIDER
FT                   YAVRFAFRNLPDGSSQLIAPDGANWKPWLTFPPEDARVSGAENLDAAGTALFCRDSRGR
FT                   NTAALTRIDLATGETRVLAAHEEADIGAVLQDAETHEPVAYSVTHARKSWHVLDPRLTD
FT                   DFAFLETQGLGDWYPASRTEDDALWIVMARADTRVGEAAIYDRQAKTLRSLGSARPELE
FT                   GAPLAPMSPAIIRSRDGLDLVSYLSRPLDAQAPGPLVLLVHGGPWARDSFGFDGLHQWL
FT                   ANRGYAALSVNFRSSTGFGKAFLNAGDREWGRRMDDDLSDAVAWAVAQGVADPARVAIM
FT                   GGSYGGYATLMALTRNPESYACGIDLVGPANLETLVRTIPPYWEAMRAQLHRAIGDPDT
FT                   EEGMALIRERSPVYFADRIKAPLLIVQGANDPRVKQAESDQMVAAMERGGIPVTYLLFP
FT                   DEGHGLVRPANRLAFFARAEEFLARHLGGRCEPIREDESAGTSMQVVREG"
FT   CDS_pept        complement(176325..177203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0176"
FT                   /product="putative L,D-transpeptidase catalytic domain
FT                   (YkuD)"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 16647082, 18456808,
FT                   17369299; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0176"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21845"
FT                   /db_xref="GOA:C7C6U1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21845.1"
FT                   /translation="MTSFGLASLPARVLAQSFEGFDDDRLYQDSAGQLYRRRGGQYVPY
FT                   NGRVSNGRPVPDSQTDLDAEAYARRRAERYGEPPAAEAPNQTPRQQQAGYPVPPQEPDN
FT                   GPIDYTRAYAAIANEPFPVQAIPYKKFDPVFLRQEVDFRTNEAPGTIVVDPKAHFLYLV
FT                   LPNGRARRYGVGVGKQGFSWSGSATVNSKQAWPDWYPPKEMIARRPDLAREVDKLQSGL
FT                   GVPGGSRNPLGARAMYLWQNNKDTLFRIHGTLEPHSIGKSVSSGCIRMINQDAIDLFNR
FT                   VEVGAKVVVLG"
FT   CDS_pept        177583..177828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0177"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0177"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21846"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21846.1"
FT                   /translation="MRASLLRSSLGLLCLGLMLPGEALAARKAAPPRPAVAQAAPQPLG
FT                   PQTAWTAAESPNCNRVRRKLWQADEGWIVKTVTVCH"
FT   CDS_pept        177960..179207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcD"
FT                   /locus_tag="METD_I0178"
FT                   /product="ATP-dependent dsDNA exonuclease"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0178"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21847"
FT                   /db_xref="GOA:C7C6U3"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21847.1"
FT                   /translation="MIRVLHTGDWHIGQTLRGFSREREHDAVFGCLESIVVEREVDALV
FT                   VAGDVFDSQNPSGESQARFYTLMARLHAARPAMTIVITAGNHDAAGRLEAPRPLLEAIG
FT                   VHVVGNVRRRDGAIDLDRHLVPVRSANGEVAAQVLAVSYPTAACLPPLSSLGQQPRIGE
FT                   TSPIVRAVRDLYGQLFEAARPRLAGLPLLVTGHLHVAGGLESEGAERRILVGGEHAVPS
FT                   DVFPEEARYVALGHLHRAQVLGRGQVRYCGSLIPLSAAEQPYRHGVTLVTLGAGAAEIE
FT                   HIAIPRPVPFLRLPASGDMPLADLGDHLAALALDPDLPMEARPYIQVRLAREGLLPGYR
FT                   AEVDRIGESFPVRVVDVRVTVPPRAAIAIEESEAPPPRLSERDPEELFRLAYRAKWDED
FT                   PEPAHLDVFHRARAEA"
FT   CDS_pept        179219..182965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcC"
FT                   /locus_tag="METD_I0179"
FT                   /product="Nuclease sbcCD subunit C"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0179"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21848"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21848.1"
FT                   /translation="MRILAIRGENLASLAAPFAVDLAAEPLGATGLFAITGETGAGKST
FT                   ILDALCLALYGRYPRVAVSRREDVPDPGGEALSASDGRAILRRGAGSGYAEVDFIGQDG
FT                   VAYRVGWEAFRARNRATGKLQAERRRLHRLDDGSAVAAGKTQVLDRVVALTDLTFDQFR
FT                   RTVLLAQGEFDAFLLAAEGERAELLEKITGTAIYSEISKRVHLGFEEHRRAVEALELRR
FT                   GEIGLLDAEGLSSRNAEREALRAGLETWRGEQAAVGRILETARRIEAARTALAEAERRA
FT                   VSAGESLDAAGPDRARLAELDAVEPLRGRAEALGETARERGEAQARVEATAARVRDARA
FT                   AAAAAEAKRAEANAGDEAAETVFKSFGPLWDRAAALDATIAIAEQEAAAAAQVALRSNE
FT                   AAAAADAALTAIERRLDEARAARDAAARQLEADRSHAPLAERGDDFARRIRERARLQEQ
FT                   AEAAGKEGVARRSEIAGCDGEAEAGTARLAAFRARRETLAGARAEREAALAALAEPAAQ
FT                   ARSAAFEGLLDALREAYALAGRHGTALADRAAATEAEAEAGLVATEAAARYGVEDQALH
FT                   EAGIRRAEIAPLAELAEESVSREAARLRSLLVAGGPCPVCGSSDHPHAHESDGALGRLA
FT                   EEMRTRRAELDVRIGEHQAARDRARGDFAAAEGRRDDAQERAAAAAEAAAATAARYRAT
FT                   LPGLLASLEAAGLKAVLPPGPDAPALAAAGTTARAERDATLHVLATARTLRGEIDGLIR
FT                   ERDAAEARAEAEARALDALTRRRTEAGLAAERAESMRAALIQRVAELADEIAPALSAAD
FT                   LSLADLDRAPEMCADRVSRLGQAYAALRTRLAGLEAQLGALAPERAAAASSREAETRAA
FT                   VKARAEAEERQTRLKQARAERAGLLGGEPTGTHRTRLNNERRAAREALQAAQTVCAEAA
FT                   RALTGAVTDEAGAIAASERAAARHKAAEDAFAQACGERGREAVAALLAVPTETRDAMRA
FT                   GLDRLEREAAETRTALATRRTDVEALDTESGIDVAAAEAETTRIAEAMAQAQQRLGALD
FT                   AELRRDEAARAKAADLAGEIEAATAELTTWHRVEEAIGSAGGDRFRRFAQGVTLDHLVH
FT                   LANEQLRALSPRYRLARSVGADLALHVVDRDMGDERRATRSLSGGERFLVSLALALALS
FT                   GLEGRQSFVDTLFIDEGFGSLDAETLDLAVDALETLQGRGRKVGVITHVAGMMERIAVQ
FT                   IRVEKRGSGRSVVRVVDRGAAIV"
FT   CDS_pept        183228..184487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="narK"
FT                   /locus_tag="METD_I0180"
FT                   /product="putative nitrate transporter narK"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0180"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21849"
FT                   /db_xref="GOA:C7C6U5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21849.1"
FT                   /translation="MASFKTVMKSGHPPTLFAAFLYFDFCFAIWVLNGAMGPFITETYG
FT                   LTPAQTGFMISLPILAGAIMRFPLGILAQYIGRKNAALTEMGVIVLAMAYGFFFVSSYN
FT                   DVLAMGVLLGIAGASFGVALSLGSGWFPPEHKGLAMGIAGAGNSGTVLAVLFAPPLAQA
FT                   YGWQAVYGFAGLVMIIPILVMIFLAKEPPDCHGQTFKEHVSCLFTKDGWSFSLIYIITF
FT                   GGFIGLSNFLPTFFYEQFAVTKVEAGRLTMLAALMGSGIRILGGYFADRMGGILVLSLV
FT                   LLAAIGSFLALTATPSLAVTTLLFMLCFAALGAGNGALFQLVPLRWPTNTAVAGSMIGE
FT                   VGALGGAILPNVMGFSKQYTGGFATGFVAYALFTGLVLGCLFLWQRKWVGAWVGPRGKV
FT                   LDQPAEAQVQAGGRMEPANA"
FT   CDS_pept        complement(184570..185337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0181"
FT                   /product="putative phosphoribosyltransferase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0181"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21850"
FT                   /db_xref="GOA:C7C6U6"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21850.1"
FT                   /translation="MAAPGLPALSGGIRRIASTLIGLIYPPTCVSCGAATGRPHALCAA
FT                   CWSGLRLIERPYCERLGTPFALDLGVGRLLSPGAITEPPAFGRARAVAVYEGTARDLVH
FT                   RLKYNDRLDLARTMARMMASAGRELLDEAELLLPVPLHGLRLWRRRFNQSALLAREIAR
FT                   VSGTPCDLQALARVKATRPQVGLTRHQRAMNLQGAFRVPEDARSRIAGRRLLLIDDVAT
FT                   TGATGNAAARVLLRGGAASVDLLTFATVTRDGL"
FT   CDS_pept        complement(185367..185594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0182"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0182"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21851"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21851.1"
FT                   /translation="MTRILIRAALILAAVALASTAEAKGCLKGAAVGGVAGHMAGHGVM
FT                   GAAAGCAIGRHQANKRDKAAQQGGPGNSAR"
FT   CDS_pept        185798..186691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0183"
FT                   /product="conserved protein of unknown function; putative
FT                   SAM-dependent methyltransferase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0183"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21852"
FT                   /db_xref="GOA:C7C6U8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21852.1"
FT                   /translation="MNESAPLFDPALVRRRIARARRSSYAGFLLERVAEDLEDRLAAVT
FT                   RSFPLGLDLGTPLPLVSERLLQTGRVERMIRLAPVSEPGGSVVGDPEVLPFGGHAGFDL
FT                   AVSALALQHVNDLPGALLQVRRALKPDGLFLAGLLGGATLTELRQAFLQAESETEGGAS
FT                   PRVAPFAELRDLGGLLQRAGFALPVVDADTITVRYGDPFALMRDLRAMGLTNALHDRRR
FT                   TPLRRATLMRAAAIYAERFSDPDGRLRATFEILWLSGWAPHESQQKPLRPGSAKVRLAD
FT                   ALGAAEHRFPIREEPA"
FT   CDS_pept        186688..187044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0184"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0184"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21853"
FT                   /db_xref="InterPro:IPR007361"
FT                   /db_xref="InterPro:IPR038694"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6U9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21853.1"
FT                   /translation="MREPGPAHPITITPHPTPVRVRLGGRIVAETRRALKLCEAGYEPV
FT                   LYLPREDVDADALGPNPKRSFCPYKGEAFYFDLTVGGATREAAAWSYENPFPAVARIRG
FT                   HVALYPDRVDAIEA"
FT   CDS_pept        complement(187053..188594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0185"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0185"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21854"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21854.1"
FT                   /translation="MARRAKAAVEKAAEAPTPAAATPRKSRSTTPTAENLAALSQERLI
FT                   ALILQEVGQSAPFKKRVSAAIAALQGPDRVAALIDRRLSALEKARGYIDWQKRRAFVAD
FT                   LDATLATIIADLKPLDAGMALDRLLRFLRGASATLERVDDSSGQVHGLYEAAAEAAAGL
FT                   AAGLSADAALSFATRALDGLDDDGFGLVGALLVDLLPKLPKAALEPLDAHLVEALAKLP
FT                   ASAGKKTGPAASERAGQEWERRYQRLSLTRLRQVIADARGDADAFIALELEMSPERPDL
FT                   AAVAERLLAAGRAKEALDWIRRKQKRGMAVVTREDLIVGGFDSEGPEREREAVEIRILD
FT                   ALGHKDEAQALRWSRFEKSLDPQALRDYLARLPDFEDEEALERAFAHAASRKDPHGGLY
FT                   FLIRWSNLDRAARLVLDRRDAWSGRIWELLAPAAEALEPDHPLAASVLYRALIDDILER
FT                   GRSPAYGHGARHLTRLGELARELAPGDLTPSHAEYLAQLRKAHGRKSGFWSQVES"
FT   CDS_pept        complement(188626..189042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudG"
FT                   /locus_tag="METD_I0186"
FT                   /product="NUDIX hydrolase (nudG), putative dihydroneopterin
FT                   triphosphate pyrophosphatase (ntpA-like)"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 17698004, 11053429; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0186"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21855"
FT                   /db_xref="GOA:C7C6V1"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21855.1"
FT                   /translation="MNTPLKLLLVVAAALVDADGRVLMAQRPEGKALAGLWEFPGGKVE
FT                   PGERPEETLIRELAEELGITVKEPCLAPLTFASHAYPDFHLLMPLYICRRWEGLPQSRE
FT                   AQALRWVRPGGLRDLPMPPADLPLIPFLIDLLGP"
FT   CDS_pept        complement(189039..189761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0187"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0187"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21856"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21856.1"
FT                   /translation="MRFFSALAVPVLLLTVAAPAMADDETGRIRVIGRASQEVAPDFAS
FT                   VEIGVETGGATPAAALDAASQAAKGIVASAREMGVAEADIGTSSITLQPRTKTVRQPDG
FT                   TMGERDDGYTAGNRVRVRLAEMGKLGELMRRTLESGANRIQGISFGLRDPAAAEAAVQV
FT                   AAVKDARAQAERIAEATGVKLGTVISIESPPRAESPRPMPYGMAMKAAAPRGRTAVPVV
FT                   AGSIETSAEVDAVFAISR"
FT   CDS_pept        complement(189758..191002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argJ"
FT                   /locus_tag="METD_I0188"
FT                   /product="glutamate N-acetyltransferase/amino-acid
FT                   acetyltransferase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="2.3.1.1"
FT                   /EC_number="2.3.1.35"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0188"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21857"
FT                   /db_xref="GOA:C7C6V3"
FT                   /db_xref="InterPro:IPR002813"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="InterPro:IPR042195"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21857.1"
FT                   /translation="MSSTEISPLAPATSPSLPEIAGVRIATAQAGIRYKNRTDVLYVAL
FT                   AEGTEVAGVFTRSRCPSAPVDWCRDALKAGKGARALVVNSGNANAFTGLKGREAVALTA
FT                   DIAGRVAACAPEAVMIASTGVIGEPLDARKFDGVLADCAGRAEGGAEAWAQAAQAIMTT
FT                   DTFPKLATRRVEIDGVPVTINGIAKGAGMIAPDMATMLSFAFTDAALPQDVLQNLLSAG
FT                   TKTSFNCVTVDGDTSTSDTLLLFATGAAGNAAVTRADDPRLAGFRAALDDLLIELAQLV
FT                   ARDGEGANKLVTVEVEGAESDPSAHRIAMSIANSPLVKTAVAGEDANWGRVVMAVGKAG
FT                   EPADRDRLAIWFGDVRVAVQGARDPDYSEEAASAVMRRPEITVRVDLGLGQGRARVWTC
FT                   DLTKAYVAINGDYRS"
FT   CDS_pept        191384..191854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0189"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0189"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21858"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21858.1"
FT                   /translation="MMQRTQDREEVTIDLDPVRSDLQVGAVAAPRSCYGVQVLVAGRRK
FT                   QWRDEINGQIRRAGYSAISVDSAVDALTVLVLGLPVDVLVTDAELHGALGLSELAAEAR
FT                   ALRPNLGIVVACDSAVNDCADLVPADALLISSLGEEEAVASSVREAMAARAG"
FT   CDS_pept        191947..192501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0190"
FT                   /product="putative glutathione peroxidase"
FT                   /EC_number="1.11.1.9"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0190"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21859"
FT                   /db_xref="GOA:C7C6V5"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21859.1"
FT                   /translation="MTIRRRDCLAMLAVLAASRSHAAEAGPASAFAFDKPEGGGLPLSA
FT                   YAGKPILVVNTATACGYAPQFVGLQGLWTRFGGRGLTVIAVPSPDFGNQEPLDGAAIAD
FT                   AARKNHGVTFPVTDKTHVRGPAAHPFYRWAAEQKPGQSPQWNFHKYLVGRDGTLRAAFA
FT                   TQVDPSDPRIVSVIVAELGQA"
FT   CDS_pept        complement(192518..192784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0191"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0191"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21860"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21860.1"
FT                   /translation="MPARVPADRKISPPMRPSTVFAAASLCLAALPCRAQGVPSNPFAS
FT                   NYPSAPPRMVEREGRLQAPRARRPLPLGRIERGLLPPADVPGR"
FT   CDS_pept        192844..193071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0192"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0192"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21861"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21861.1"
FT                   /translation="MEPHSFEQDGTEYEVRFERTPEGWIAHIRPEGWTEAHVVAFPEGV
FT                   GFDRDDVRGSLIAGCEAAVARLPRRAPTRH"
FT   CDS_pept        193262..193504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0193"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0193"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21862"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21862.1"
FT                   /translation="MTEVTYHIVEHDGGFAYKVGDVFSETFPSRAEALQAAQAAAAEQQ
FT                   VPGSTEGIRYQDGRGQWHDETAQGSDRPVARVVED"
FT   CDS_pept        complement(193511..196603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="METD_I0194"
FT                   /product="proline dehydrogenase PutA"
FT                   /EC_number="1.5.5.2"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 12514740; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0194"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21863"
FT                   /db_xref="GOA:C7C6V9"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6V9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21863.1"
FT                   /translation="MSAPRFQAAYAPDDAALAEALLREAPLPAATEAAVDRLASDLIGA
FT                   IRADAGHGAVEALLREYALTTREGLALMSLAEALLRVPDAATADRLIADKLREGGFVHH
FT                   AVRSESGLAHAASWALGLGARLVGPQDTPEATLGSMVRRLGRPAVRAAAHRAMRVMGGQ
FT                   FVLAEEIGAALKRAGSGAARRSRFSFDMLGEGARTADDAESYRQAYARAIARIGREAGN
FT                   APLPARPGISVKLSALHPRYTPTQGARVMAELVPVVRDLARDARAHDLNFTLDAEEAER
FT                   LELSLDVFEAVLADPALAGWDGFGLAIQAYSKRCLPVIDYVAELAERHDRRLMVRLVKG
FT                   AYWDTEVKLAQTQGAADYPVFTRKAMTDLNYLAAARRLLALRPRLYPQFATHNAQTVAS
FT                   VLGLAGLLDRPADEEAGFEFQRLHGMGEALYQRLAERAPGVGQRVYAPVGGHRELLAYL
FT                   VRRLLENGANSSFVARAADPSVPAAELLARPQALVETPSQARHPKIPLPRDLFGPERRN
FT                   SPGLAFGDGAALRRWTDAVARAAGPADAAPIIDGAVQTGRARPVVSPIDGAALGSVIEA
FT                   DPATAALAMEAAAGGFPAWAATPARERAACLERAADAFVREQGRLLHLLQAEAGKTLDD
FT                   AVAEWREAIDFLRYYAAQGRDLFGEPQDLPGPAGEANSLRLVGRGVFVAVSPWNFPLAI
FT                   FTGQVAAALMAGNAVVAKPAPQTPLVADLAVRLLHTAGIPGSALHLVPGGPETGAALIE
FT                   HPALSGVVFTGSTATAQRINRALAARDGAILPLIAETGGINAMIVDATALPEQVADDVV
FT                   LSAFRSAGQRCSALRLLLVQEDVADRMIAAVAGAARELTVGDPRDLATDLGPVIDAGAK
FT                   QRLDAHIAAMTASARLHYAGAAMSGLTVAPHIFEIGGVADLREEVFGPILHVARYPADG
FT                   LGSVIAAIRAGGYGLTLGIHSRIEETAERITEALPHGNVYVNRNMIGAVVGSQPFGGSG
FT                   LSGTGPKAGGPHYLARFATERTMTVNTAAAGGSVGLITLEG"
FT   CDS_pept        complement(196706..200233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0195"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0195"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21864"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21864.1"
FT                   /translation="MRDSLTALAGAVVLVLVAALAVPPFIDWSAHRALIDRTLSDSLGA
FT                   GARSEGAIDLRLLPSPHLRLARLRLGAEDGPALDAQAVDAEIALAPLLKGEVRFVQTSV
FT                   ERAGLTLPVSDEALLLPREPQTLRRDIVIDDLRIRRLTVATLRTGEAPQEQFAAENLRL
FT                   RAPALAGPWLAEGTAKGSPFHLATSVAGSDGSLSLKLTGGGDTMPRLELDARITLKPED
FT                   ASDADRVRRGLVPEAEGTARLTVGPPVQPAGAVLPLTLAAKFASRGPLVQAETVELELD
FT                   PGGKAARLSGNGRLDLREARLGLTLRTRRLDLDGLLLSGGARGLLAQGLTSGALTPPLL
FT                   LDLDLSAESVALGLDDWADVGFRGTFDRTGGLVLRRFEGRAPGAATVAATGEAELSGSP
FT                   RFTGHIDVATRNSEALGRYLGRIGAEESVTAILDGRAFEIGTDLSAAGTDLSLRNLRLA
FT                   LGEARVTGNARYLRADANGRGRLDAQLSATGIDIAELPPLGELMSGLHRHDLGLTLKAR
FT                   DVRYGPAGAHSGNGTIAVSLQSDGASLVVDTLDIADLAGASAQLAGRIAPDGSGRIEGR
FT                   VTAGKAAPLLALLERGFLPEARFVPQSVRQSGLALDLTLERESGEADALRASAKGKAGE
FT                   GDLDLALLTRSGRIDRLDATLTTQKTGRWFGRDDIAALRQPGRLRLTGARPSAEAGQQS
FT                   TPPLALGIEGDLAGLTVSTPRPILFDALDRPPAGGTLRLAAPDLAPFLILAGGAAPAAG
FT                   PLPASLTLALSRRNAALHADVTGQVAGTDLTAALDRAPDGALTGTATLARLSLPALVAA
FT                   TVLPTDAGGRFAPLPVQPQVNLGLTIRQLDLGRGLVADNASLTLVREGDALSLRDLSAG
FT                   LAGGRLGGSITLARPAGAAAVSGEGSVEGADLTGLVGAGPVTGRLSAALRFGATGVSLS
FT                   ALANDLSGNGEIRLTDLVLPGADAGAVDRALGKALAEDDPLREGRLQVLVSEELSAGPL
FT                   RAKGPVSAAFTLSVGTLRTGPFGIDLGPARWNGTLQVDLRNRVLDARGALTAAAGPKGW
FT                   TGAAPSIQLGFGGPLGAPERRLDAAPLTTGLAALVLQRELEKIELFDADQSERQRRRAR
FT                   IEMDRARLAAEEAARQARLKAQLAAEEAARLARQREAEEATRRARIEAEPAPAPATQPL
FT                   DISPPSARP"
FT   CDS_pept        complement(200394..200645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0196"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0196"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21865"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21865.1"
FT                   /translation="MRAPSLALLTLLTTLTPALTPAWAQSPGNRGATSRQNQSFEYQNQ
FT                   NRNFEQRQTLENSAIRNQIQRAPLNVPPPAGPSFGIRR"
FT   CDS_pept        200761..203148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="METD_I0197"
FT                   /product="DNA-dependent ATPase I and helicase II"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 2254268, 2943729, 6324092,
FT                   6379604, 8419285; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0197"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21866"
FT                   /db_xref="GOA:C7C6W2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21866.1"
FT                   /translation="MMQEPNDAHGAFRPRPSDDEAPSAPTSIAARAMAALRPEGASYLS
FT                   GLNPEQRRAVEATEGPVLVLAGAGTGKTRVLTTRIAHLIATGKARPYDILSVTFTNKAA
FT                   REMKHRIGGLIGPAGEGMPWLGTFHAIGTKILRRHAELVGLKSDFTILGTDDQLRLMKQ
FT                   VISDQNIDEKRWPARSLAHTIDGWKNRGLSPEQVPPGEAQSFAFGKGGQLYAAYQARLA
FT                   TLNAVDFGDLLLLCLKLWRENPDILANYQDRFRYILVDEYQDTNVAQYLWLRLLAQARK
FT                   NVACVGDDDQSIYGWRGAEVDNILRFEHDFPGATVVRLERNYRSTGHILAAASGLIAKN
FT                   EGRLGKTLRTEDEAGEPVTVTGSWDSEEEARQVAESIESLQRRGHALSEIAVLVRISAQ
FT                   MREIEDRFVQVGLPYRVIGGPRFYERAEIRDALAYLRVTMNGADDLAFERIFNTPKRGL
FT                   GDATLQTLHAFARADRIPLLAAARKLIETDELKPRARSMLRGLVESFTRWVRLVETKPH
FT                   PEVAQTILEESGYTEMWQKDRSADAAGRLENLKEFVRSMEEFPDMAAFLEHVSLVMEAS
FT                   EAEGADRVSLMTLHAAKGLEFDTVFLPGWEDGLFPNQRAIDESGRAGLEEERRLAHVGL
FT                   TRARKRAKLSFAVNRRIHGLWSSTIPSRFIDELPPQAVDVVEAPAHFSAGASRFDRNPT
FT                   PFGSSYGTPGWQRAQANTAGGFGGGLNGGQGRGGRASGPREIEGELVAKSTGAPSTFEH
FT                   GQRVFHTKFGPGTVAGIDGNKLTVDFDKAGRKMVLDSFLQPG"
FT   CDS_pept        complement(203278..203517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0198"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0198"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21867"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21867.1"
FT                   /translation="MTLANSLFQPVSTSATLLRFGEDIADLRSTIRKSKAKPYESVPRR
FT                   NMKAVESGFQATLRPRRKGCRRGQRERDGFAKKR"
FT   CDS_pept        203545..204261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0199"
FT                   /product="putative phosphate starvation induced PhoH-like
FT                   protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 2160940; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0199"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21868"
FT                   /db_xref="GOA:C7C6W4"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21868.1"
FT                   /translation="MKRRRARLELVEDRPIRMHRTRFDEERNPAPIQPLTDRQGQYLDA
FT                   LASSSQVIVLGPAGTGKTFIAGTRAADLLRQRRISKVVITRPNVPSGRSLGFFPGTLEE
FT                   KIAPWVAPLTETMKERMGAAAFDIAVKAGDIEVVPFEVMRGRTFKNCLVILDEAQNTTT
FT                   AEIKMFLTRIGDDCQVIINGDVSQTDLRETSGLRTVIHLVKSRMMTIPIVEFTLDDIVR
FT                   SGICAEWVRAFEEEKL"
FT   CDS_pept        complement(204331..205071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aqpZ"
FT                   /locus_tag="METD_I0200"
FT                   /product="water channel (aquaporin Z) (MIP family)"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0200"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21869"
FT                   /db_xref="GOA:C7C6W5"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21869.1"
FT                   /translation="MDHDTMRRTTAEFFGTFWLTFGGCGAAVLSAAFPELGIGFLGVAF
FT                   AFGFTVLTMAYAVGHISGGHFNPAVTLGLWSAGRCASRHVLPYVIAQVIGATVAAFALY
FT                   TIASGKAGWVPNGFASNGYGELSPGKYGLAACLITEVLTTFIFLFIIVGTTSKGAAAGF
FT                   AGIPIGFALVLIHLISIPVTNTSVNPARSTGPALFAGPEYIAQLWLFWLAPIAGAIAAG
FT                   VVGRWLYEPADMVETRVLERGAEI"
FT   CDS_pept        complement(205453..206346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0201"
FT                   /product="protein of unknown function, putative exonuclease
FT                   domain"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0201"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21870"
FT                   /db_xref="GOA:C7C6W6"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21870.1"
FT                   /translation="MKVVAIDFETANERRDSACAVGLAWIEGGRVVRRESRLIRPPQLR
FT                   FSPGNIRVHGILPADVRDAPTFPEVIAEFLPDLSGGLMLAHNAGFDMGVLAASLAAWGE
FT                   PVPDMAGHCTLQIARRVFPDPAGHGLAKVAGRLGIRFEHHDAGEDAFACAEIALAALRE
FT                   TGAADIADLARGLGLTPIRALTTPRRDMTRSTSAKALRASGIVDLRPTNALRFAMRGST
FT                   GNRYQLEFEERTDGPYLRCSCPAGTHRRRCRHVDALVEGDITELTSNNFDDVERLRQLL
FT                   DGKSVGPLRIKGVAAA"
FT   CDS_pept        complement(206397..209360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="METD_I0202"
FT                   /product="glutamate-ammonia-ligase adenylyltransferase"
FT                   /function="1.3 : Glutamate family"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.7.42"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 11214968; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0202"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21871"
FT                   /db_xref="GOA:C7C6W7"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21871.1"
FT                   /translation="MGRRHDGQIARDDGTAPLIARLGQAPPLSNPEAAQARLDEIADAL
FT                   PDTLREGPARDLLAALADHSTFLWSLASRDPARLVRLFEEAPEATDARIIAAQRAAGRA
FT                   GEGAAPDLDAVGKTLRRNRAEHALLVALADIGGLWPLERVTAALSDFADASVSAAVDAM
FT                   LLQAAAAGRFLPKDASEPQAGSGLVVLGLGKLGGRELNYSSDIDVIVFFDPEAAPLKPG
FT                   LEPTPFFTKLAQGVSKLLQERTRDGYVHRVDYRLRPDPGSTPTAMSLASAYVYYETTGQ
FT                   NWERAAFIKARAIAGDIPGGERFLADLTPFVWRKYFDFAAIADVHAMKRQIHAVRGHEA
FT                   LAVAGHDIKLGRGGIREIEFFVQTQQLVFGGRRPMLRGRSTVPMLAKLHEDGWISAEAR
FT                   DELGAAYAFLRTVEHRLQMVRDEQTQRLPTDRTELEGFARFAGFPNLAGFEAALLAHAR
FT                   WVQAHYALLFEAGPDLSSEVGDLVFSGAADDPATLATLRSLGFRDPERVTDTVRGWHFG
FT                   RRAAVRSPRAREVLTELVPALLKALSGTPDPDAALANLDRAFGRMPAAVELLTILREHE
FT                   RLRLLFADLLGSAPRLAGTVAFSPHVLDAVIDPDFGDPSVDAGAIAAHYRALLGRPDSH
FT                   EVFLDRSRDAARQLRFLTGARLLSGILTPQAAGRAFSAIADAAVATALGAVSKTFFADH
FT                   GPIPNGRIVVLGYGRLGSHQLTAESDLDLVVLYDFDPENRTSTGPKPLDAAVAYNRLTQ
FT                   RLVAALTAPTRRGLLYEVDLRLRPGGGQGAVAAQFRSFRAYQREEAELWEHMALTRARV
FT                   IAGDESLAEEAKATIRDALMQPRDADAVNRSVRSMRATVENEKGDHGPLDLKLSPGGLL
FT                   DLDFLAQALVLGHAHAHPDLIGLDAPEVFSRAAGGGIIAADEAEPLADAYRLLDDVHQW
FT                   QRLMVEGDPTQASDVALARLARAANLPDAKALSARLDEERRTVRTIFDRRLGQPSGG"
FT   CDS_pept        complement(209602..210297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0203"
FT                   /product="conserved protein of unknown function; ''Winged
FT                   helix'' DNA-binding domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0203"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21872"
FT                   /db_xref="InterPro:IPR018679"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21872.1"
FT                   /translation="MPVAAAMSASARPPETALYAPVKGFLETLGFAVKGEIGGCDLLGV
FT                   REGEPPVLVVCELKQSFNLELVLQAVDRAGACDEVWLAARLSVRGKGREADARFRNLCR
FT                   RLGFGLLGVGADDGVHVLLGPGAPMPRRDPKRRSRLLNEHRRRQGDPVAGGGSRVPVMT
FT                   AYRQQALLCARALAPGPLRPRDLTSAVPTAAAILRRNVYGWFERTGHGVYALTPAGHEA
FT                   IGRWPSTPP"
FT   CDS_pept        210633..210929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0204"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0204"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21873"
FT                   /db_xref="GOA:C7C6W9"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6W9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21873.1"
FT                   /translation="MIPAGPERHPLAVLPADDTATEDESESMSSSTLVPFVEAAVFTLG
FT                   CALIASRRFEPQRVGAVLGLATVTLSVLLVVLALPGSPLATLADPDGVRNFLN"
FT   CDS_pept        complement(210937..212367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0205"
FT                   /product="putative sensor histidine kinase; putative
FT                   membrane protein"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0205"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21874"
FT                   /db_xref="GOA:C7C6X0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21874.1"
FT                   /translation="MSPSAASPPPDGLLARLGKIFRTTAFKLSLAYLVLFAVLASLGLG
FT                   YVAWNARRVLDDQILSTIDAEINGLSEQYTAGGLRRLIAVVERRAKEPGASLYLVTTPA
FT                   GEHIVGNVSRLPADILARSGQYESYYGRGSDSGPSEHRAIMRVFNLAGGFRLVVGRDTE
FT                   ERDHLRAAIGNTFGSSLALVVLLGVLGGWFVASRVLKRVDDMTETTRTIMAGDLDGRLR
FT                   VGGTGDELDRLAQNLNLMLERIGELMRGMREVSDNIAHDLKTPLTRLRNRADEALRTAE
FT                   TPEALRAAMEGVIEDSDGLIRVFNALLTIARLQAGNAPESVSRFDAGAVAREVAELYEP
FT                   LAEDRGLSLTVEIEPDLILDGNRELVGQAIANLLDNAIKYGARSPASGPQEITVSAGRA
FT                   DGVVELRVADRGPGIPEAERERVLDRFVRLDAARTRPGFGLGLSLVAAVARLHGGRLDL
FT                   ADNAPGLAVTLNLPAGAA"
FT   CDS_pept        complement(212364..213062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusR"
FT                   /locus_tag="METD_I0206"
FT                   /product="response regulator in two-component regulatory
FT                   system with CusS, regulation of copper resistance"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 11283292, 11399769,
FT                   20461235; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0206"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21875"
FT                   /db_xref="GOA:C7C6X1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21875.1"
FT                   /translation="MRLLIIEDDREAAAYLVKAFREAGHAVDHAGDGLDGYALAREGDY
FT                   DVLIVDRMLPKLDGLSLVRSLREQAIATPVLILSALGQVDDRVKGLRAGGDDYLPKPYA
FT                   FSELLARTEVLARRRTAATGQSEATAYRVGDLELDRLSHRVTRAGREIVLQPREFRLLE
FT                   YLMRHAGQVVTRTMLLEHVWDYHFDPQTNVIDVHVSRLRAKIDRGFEHPMIHTVRGAGY
FT                   VIRADEPQAS"
FT   CDS_pept        complement(213089..213598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0207"
FT                   /product="conserved protein of unknown function; putative
FT                   OsmC-like domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0207"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21876"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21876.1"
FT                   /translation="MDADALRALQAPLKNKYRETPDSAVITLKAKGSLDDTSIACKVET
FT                   GRALAVAGLHPATGGSGAELCSGDMLLEALVACAGVTVKAVATALEIPLKAGTVSAEGD
FT                   LDFRGTLGVDKEAPVGFRSIRLKFDLDTDAPQEKLDQLLKLTERYCVVFQTLNHKPELS
FT                   VNASRS"
FT   CDS_pept        complement(213675..214454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuB"
FT                   /locus_tag="METD_I0208"
FT                   /product="alkanesulfonate transport protein (ABC
FT                   superfamily, atp_bind)"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 20245523, 3549459, 7984428;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0208"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21877"
FT                   /db_xref="GOA:C7C6X3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21877.1"
FT                   /translation="MLSIQSLSKTYADGTRALEGIDLQMPNAEIVALIGGSGCGKTTLL
FT                   RLIAGLDRPSAGHIALDSEPITGPHPGVGLVFQESRLLPWLAVAENVGFGIDHLPRRER
FT                   RERVAHALERVGLAEQAGRWPRELSGGQQQRVSIARAFVANPRVLLLDEPFSALDAFTR
FT                   KDLHRHLLALWEEVRPTVLIVTHDVAEAVALADRAIVMRPRPGRLDDTVALPMRRPRDP
FT                   AAPTSEAATRNILAALDHSLRPRDASRTPELAGGSSF"
FT   CDS_pept        complement(214462..215301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssuC"
FT                   /locus_tag="METD_I0209"
FT                   /product="alkanesulfonate transporter subunit; membrane
FT                   component of ABC superfamily"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0209"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21878"
FT                   /db_xref="GOA:C7C6X4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21878.1"
FT                   /translation="MSVTTVLSDDTEPKAVPARRSALLGGGARLALGLLLPLVLALGWE
FT                   AAVAAGLASGRLLPPPSRVAAALWTLAASGELWTHVEATLIRVGLGFAFGAGAGILAGA
FT                   LTATLPTLRWLVDPSLQALRAVPSLAWVPLFILWFGILETPKVALIAVGVFFPVYIGVA
FT                   GAIASVDRKLVEVGRIFRLSKVALARRILLPAVLPATLTALRTGLGLGFLFVVAAELMG
FT                   ASEGLGYLLLDGQQFSKPDQILAAIISFAVVGKAADAGLVALTSPLVRWQDTARETL"
FT   CDS_pept        complement(215362..215994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0210"
FT                   /product="transporter protein"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0210"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21879"
FT                   /db_xref="GOA:C7C6X5"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21879.1"
FT                   /translation="MPDAAHLAAFALVCLGMVLTPGPNMAYLVSRTVVQGRAAGLVSLT
FT                   GVAAGFVVYLLCAAFGITALLVAVPFAYDALRLAGAAYLFFLAWQAVRPGGRSPFDTRP
FT                   LPPDGAGRLFAMGFLTSVLNPKIAVMYLSLLPQFIDPAAGGVLTQSLALGLLQIAVSLT
FT                   VNAVIVLSAGSVAAFLKGRPLWLLAQRWFMGTVLAGLALRAATDARR"
FT   CDS_pept        complement(216003..216977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0211"
FT                   /product="sulfonate transport system substrate-binding
FT                   protein"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0211"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21880"
FT                   /db_xref="GOA:C7C6X6"
FT                   /db_xref="InterPro:IPR010067"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21880.1"
FT                   /translation="MIRRRTVLSAFAGLFGLLATGSNLRAADVSEIRLDWATYNPVSLV
FT                   LKEKGFLEEALKARGIKVRWVQSLGSNKALEFLNGGAIDFGSSAGAAALLARINGNPIK
FT                   VVYAYSRPEWTALVTRKETGIAGPADLKGKRIAVTRGTDPHIFLIRALQGAGLTEKDAK
FT                   LVLLQHADGRTALDRGDVDAWAGLDPMMAAAEIESGDVLFHRDAAANTWGVLDVREDFA
FT                   KAHPDLVKVVIAAYEQARTYALANPDALKSALVSATKLPEAVIAKQIERTDLSQPAVGS
FT                   VQAESIRAAGLALQQAGVIPASTDVAAAVEGLIDPQFNPVPTR"
FT   CDS_pept        217137..219923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="METD_I0212"
FT                   /product="[Protein-PII] uridylyltransferase (PII
FT                   uridylyl-transferase) (Uridylyl-removing enzyme) (UTase)"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.7.59"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 14704707; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0212"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21881"
FT                   /db_xref="GOA:C7C6X7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21881.1"
FT                   /translation="MFDPVPVLEKIVASLDRDAREPTKLRGLLVPELRKVIETGHAEAE
FT                   RLLLKERDGLACAQRLSRLTDAVVRAIYDAVVWRLYPNDNPSTGEHLAIVATGGYGRGT
FT                   MAPGSDIDLLFLLPYKQTAWSESVVEAMLYVLWDLKLKVGHATRSVEECLREGRADMTI
FT                   RTALLESRFLFGSRSLFEEMVTRFDTELVIGSASEFVDAKLRERDARVAKAGASRYLVE
FT                   PNVKDGKGGLRDLNTLFWIAKYTYRVRNQAELVHAGLFTPDEYRLFERCEEFLWRVRCH
FT                   IHFVTGRPEERLSFGLQPKIAERLGFGSRGGLSGVERFMKAYFLIAKDVGDLTAIVCAE
FT                   LEARHAKRTPVLDRWIGRFRDRFRATSIEAEDFWIDNGRVNIRGEDAFERDPVNLIRLF
FT                   WLADRHNLPIHPDAARLANRSLKLITHAVRIDPEANRLFLDILTSKNAPETILRSMNEA
FT                   GVLGRFIPEFGRIVAMMQFNMYHHYTVDEHLLRSLGVLAAIDSGRVRDEHPLASRLIDT
FT                   IHNRRALYVAILLHDIAKGRPEDHSIAGAAIARKLGPRFGLSQAETETVSWLVEHHLLM
FT                   SMTAQSRDLSDRRTIEKFASEVQSLERLKLLAILTVADIKAVGPGVWTAWKGTLLRTLY
FT                   DETEVVLSGGHSEIARTDRVRLIQMALREQLSDWNSELFDGYAARHNQAYWLKVDSTRH
FT                   FKNARFLRTVMEEGRTSATTYETDPVRGVTELTVYSPDHPRLLAIITGACATMGGNIVD
FT                   AQIFTTTDGFALDSIFISRAFERDEDELRRAGRIATAIERALKGEIKIAELVADKHPKQ
FT                   PPKTFLVPPDVSIDNALSSRETVVEITGLDRPGLLYELTTGLNRLSLNITSAHVATFGE
FT                   RAVDVFYVTDLTGTRVVQPDRLAMIRAAVMEVFASDVAALRAEGLDALVDSPPPREL"
FT   CDS_pept        220018..220623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0213"
FT                   /product="putative heat shock protein GrpE"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type f : factor"
FT                   /db_xref="GOA:A0A2P9HAQ0"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01956.1"
FT                   /translation="MADDMEKHERHDGAEAEVPPQSGASQAGADAEGLAAAIAERDEFK
FT                   DRLLRTLAEMENLRRRTEREVADARTYAVTNFARDMLNTADNIRRALDSVPEEARAGAE
FT                   GPFKDLIEGIDLTERDLTKTLERHGVKVVDPKGQRFDPNRHQAMFEVPNTEVPNGTVVQ
FT                   VVQTGYVIGDRTLRPALVGVSKGGPKPEANKDKSADAA"
FT   CDS_pept        complement(220732..221067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0214"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0214"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21883"
FT                   /db_xref="InterPro:IPR025528"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21883.1"
FT                   /translation="MNGGSTMPADKPDRTPITTSEEAGIQAGIAADPDNPEWTEADFRS
FT                   AVPFEQAFPVLAEKLRRTRGPQSAPTKQLVSLRLDHDVLLRFRATGPGWQSRMNEALRR
FT                   AAADLPD"
FT   CDS_pept        complement(221039..221314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0215"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0215"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21884"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="InterPro:IPR038573"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21884.1"
FT                   /translation="MLIVWDEPKRLTNLQKHGLDFADFEAGFDFETALVAVAQLGATGS
FT                   ARMKIIGEFDGQTVVAAIIAPLGQEAISLISLRRASRSERRLYDAR"
FT   CDS_pept        complement(221406..222263)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0216"
FT                   /product="putative prephenate dehydratase"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="4.2.1.51"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0216"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21885"
FT                   /db_xref="GOA:C7C6Y1"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21885.1"
FT                   /translation="MTDRTIAYQGEPGANSHIICSQAYPGWTALPCATFEDAFAAVNEG
FT                   KANLAMIPIENSIAGRVADIHHLIPTSRLHIIAEHFLPIHFQLMALPGVGTERLTSVHS
FT                   HIHALGQCRRIIRRLGLKAVVAGDTAGAAREVAEARDPSRAALAPAMAAEVYGLDILER
FT                   DVEDEAHNTTRFVVFSPEPAECEPGNDSTVTSFIFRVRNIPAALYKALGGFATNGVNMS
FT                   KLESYMVEGQFTATQFYAEVDGHPEDDGLRRALEELRYFSKELRIIGTYPAHPFRETTR
FT                   QAAE"
FT   CDS_pept        complement(222280..223023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="METD_I0217"
FT                   /product="3-deoxy-manno-octulosonate cytidylyltransferase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="2.7.7.38"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 3023327; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0217"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21886"
FT                   /db_xref="GOA:C7C6Y2"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21886.1"
FT                   /translation="MSDPLILIPARLAATRLPSKPLADIAGVPMIVHVWRRAVEAGIGP
FT                   VVVATDTDAVAEVIEAQGGLAVMTRPDHPSGSDRLAEALEIVDPDGNHDVVVNVQGDLP
FT                   TIDPAIIAASVMPLADPQVDIATLCAVIHRPEEMDDPNVVKIIGHTVGPNRLRALAFTR
FT                   ARAPWGDGPLFHHIGLYAYRRKALARFVALPQGELEQREKLEQLRALEAGMRIDAMIVE
FT                   DLPLGVDTPADLERARTLLAIRRLN"
FT   CDS_pept        223331..224248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0218"
FT                   /product="putative membrane cytochrome c"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0218"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21887"
FT                   /db_xref="GOA:C7C6Y3"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21887.1"
FT                   /translation="MDSFELNKVAGAVLGALLFAVGSGFVAELIYHPKPAGSAGYPLPE
FT                   PEPKSGGAAAEAPKAEPIAVRLASADAEKGKGGTKACQACHSFEKGGPNKVGPDLWEIV
FT                   EREKAHAAGFDYSAALKEKGGTWTYEDLDHFLESPKGYVKGTKMAFAGIGSPTDRANVI
FT                   AYLRTLADSPKPLPAAEKKAETAPAGDKKAETEKPAEGKPDAKKAAEEKKPAGTKPVES
FT                   ATGDKSKTPETNAPQGNTQSGDGKDTARPVPAPQVQPQRNEVAPTQAPEAKPSGDIPTK
FT                   ADPGSESTPATEPPAKPDPDAPKP"
FT   CDS_pept        224421..226334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0219"
FT                   /product="putative ABC transporter, periplasmic protein
FT                   precursor"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0219"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21888"
FT                   /db_xref="GOA:C7C6Y4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21888.1"
FT                   /translation="MTENAVIARRSFLAGALVLLGLRGPVSAQEPAESASKVSAQEAPG
FT                   NWRHALTLLGEPKYGPDFQHFDYADPKAPVGGLVRLGSQGGFDNLNFIVNGLKGDLEGG
FT                   ITQIYDTLMEDSGDEPFSSYGLLAEAVRIAEDGQSVTYRLRPNARWHDGKPVTVEDVIW
FT                   SFDTLKANSPFYAAYYHTVAKAEPGAEREVVFRFSEAGNRELPQVLGQMQVLPKHWWTG
FT                   TDKNGKPRSATETTLEIPLGSGPYRLTKVDAGRSAVYERVADYWGKDLPVNRGRNNFGT
FT                   VRFEYFRDGSVLLEALKGDLYDFRTENIARNWATAYDDFPAVKEGRLIKEEFPGRGTGI
FT                   MQAFVFNLRRDKFKDERVRRAFNLALNFEEMNRQLFYGLYSRIDSYFYGSDLASSGLPD
FT                   GMEKVILESVKDKLPGSVFTETYTNPVNDTPEAARANLRKAVGLLREAGYELKGGKMVA
FT                   KATGEPLTVEFLEFQNVFERVILPYAAQLKLIGIESSIRVIDQAQYQNRLRSFDFDITT
FT                   SNWPESLSPGNEQREFWGSAAADKPGSRNIAGIKDAGIDALIEKVIFAQDRETLVAATH
FT                   ALDRALLAHNFVVPQWSSAATRTLRWNRFGRPAVLPKYGSSGFPTTWWYDETLAAKTGA
FT                   PR"
FT   CDS_pept        226331..228193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0220"
FT                   /product="putative ABC transporter, periplasmic protein
FT                   precursor"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0220"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21889"
FT                   /db_xref="GOA:C7C6Y5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21889.1"
FT                   /translation="MSAGATRRSVVLGTGVLALAGALPRSARAEDVRKAHGLSSFGELK
FT                   YAPDFPNFDYVNPMAPRGGRFSTTLVQTFGNQAFDTFDTLNPYVFRGNGAAGINLTFDS
FT                   LMVRALDEPDALYGLVARSVEISPDGLTYRFALRPQAHFHDGSPLTARDAAFSLTILKE
FT                   KGHPTIAQVIRDVAEATAEGDETLVVRFAPGRSRDLPLIVAGLPIFSAKFFEGRDFEAQ
FT                   TLKPLLGSGPYQVGRIDIGRFIELERVTDYWAADLPVMVGQNNFDQLRYEYFRDRQVAF
FT                   EAFKGGAYTYRQEFTSRIWATGYDFPAAREGRVKRETLPDTSPAAIQGWFFNTRREVFK
FT                   DPRVREAIGLCFDFPWTNRTAMFGSYERTVSFFQKTDLMATGKPSAEELALLEPFSGQV
FT                   PAEVFGEAWTPPVPDGSGQDRALLARAVALLKEAGCTREGGSLRLPSGKPIEFEFLDSD
FT                   SVWEPIVQPFIRNLGLIGIKARQRAVDAAQYQARVRDFDFDITSRAASGDATPGPELRE
FT                   AYGSRAAAIPGSNNLAGITDPVIDALLDRVANADSRASLTVACRALDRVMRAGRYWIPM
FT                   WYSPEYRLALWDMYGRPAKLPTYGLGVPGLWWYDEAKARRIGRG"
FT   CDS_pept        228203..229300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0221"
FT                   /product="putative ABC transporter, permease"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0221"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21890"
FT                   /db_xref="GOA:C7C6Y6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21890.1"
FT                   /translation="MLAYILRRIALMIPTIFGIMLITFAIIQFAPGGPVERVLAQLQGQ
FT                   QEGSLSRITGGQGDLGGGAARGGGEASKYRGAQGLDPAFIKKLEAQFGFDKPAYERFGK
FT                   MLWDYLRFDFGRSYFRDVSVLDLIKEKLPVSISLGLWMTLISYAISIPLGIRKAVADGS
FT                   RFDVWTSAVVIVGYAIPSFLFGILLVILFAGGSFFQIFPLRGLTSENFESLSLWGKALD
FT                   YAWHLVLPLSALVLGAFATSTLLTKNSFLDEIRKQYVVTARMKGVSERRVLYGHVFRNA
FT                   MLIVIAGFPGAFITAFFTGSLLIETIFSLDGLGLLSFSSIVGRDYPVVFATLYIFSLLG
FT                   LAVNLLSDLTYTWIDPRIDFSARGA"
FT   CDS_pept        229369..229872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0222"
FT                   /product="putative acyltransferase with acyl-CoA
FT                   N-acyltransferase domain"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0222"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21891"
FT                   /db_xref="GOA:C7C6Y7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21891.1"
FT                   /translation="MTALPLVIRPEHPDDAAAIERLHARAFGPGRFARTAYRLREGVAP
FT                   LPDLCLTALVGTYLVGSVRIGPAEAQGGSLLVLGPLTVDPSFSDRGIGTSLMQASLDAA
FT                   RAAGHGLVVLVGDAPYYRRFGFVPVPAGRLILPGPVDPARFLWLELRDGASAGLSGAIQ
FT                   PRRI"
FT   CDS_pept        229986..231518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0223"
FT                   /product="putative Long-chain acyl-CoA synthetase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0223"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21892"
FT                   /db_xref="GOA:C7C6Y8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21892.1"
FT                   /translation="MPTTDDHQPPPRFNAARYCLAENARLRGDKTALVMVGDGGTVSRL
FT                   TYGQADRAVRGIAAGLLGLGLKAGDRVMIRMGNEADYVMVYFGALAAGLVALPSSPQLT
FT                   ADEASFLMENAGVAAVVTGQGFSDPTGAAGCIHLDSETIAAMEAGEPLADYADTAADDP
FT                   ATLVYTSGTTSRPKGVLHAHRAIWGRRPMHAHWLGLTESDVMLHAGTMNWTYTLGVGIT
FT                   DPWACGATTVLYNGPRDRGIWPRLIAEQGATIFAAVPSVYRQILKYADLAEHDLSRLRH
FT                   GVTAGEALSADLLDAWTKATGKPLFEALGMSEISTYVSSGPTIPVRPGSPGRPQPWRRV
FT                   AILPADGPPEPLPPGETGLLAIHRSDPGLMLGYWQRPEEEAAVMRGEWFAGGDLASFDA
FT                   DGYLWFHGRNDDLMNAMGYRVSPVEVEGVLAGHPDIAEVGVTELSVRVDLRVIAAFVVL
FT                   RPGAEPNAEGLMAWCGERLAAYKAPRAVRFVEALPRTANGKVQRKRLAEAAG"
FT   CDS_pept        231579..232361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0224"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   glycosyl transferase (LpsC-like, kdtX-like)"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 8824620; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0224"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21893"
FT                   /db_xref="GOA:C7C6Y9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Y9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21893.1"
FT                   /translation="MAPLPISVFIIVKNEADRLGATLAAVRALADDIVVVDSGSTDGTQ
FT                   ALAASLGARVIHNDWPGYGRQKRFAEDQCRHDWVLNLDADEVVPPDLAEQIRAVFAQGE
FT                   PAHAAWSIAIAEVFPGETRPHPWAYVLTPVRLYRRDLSTYSTSPVHDRVVLGPGVTTGR
FT                   IKGRIHHFSVRSLGDQLAKLNRYSDQQADDLDARGVTIPAWRLYVELPGNFLKAYFGRR
FT                   HFVRGAYGFLTAMNYAISRHLRVAKHYERRVTTPRRPG"
FT   tRNA            232397..232489
FT                   /gene="trnS"
FT                   /locus_tag="METD_MTRNA2"
FT                   /product="tRNA-Ser"
FT                   /note="Ser-tRNA (tRNA5); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        complement(232539..233249)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0225"
FT                   /product="putative DNA-binding protein; putative AP2/ERF
FT                   domain"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0225"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21894"
FT                   /db_xref="GOA:C7C6Z0"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="UniProtKB/TrEMBL:C7C6Z0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21894.1"
FT                   /translation="MRAKRPIRIVGDVAYVTLTRGMTAIIDAEDAERVGAHNRSYCDNG
FT                   TGYALTSWRNPKTGKDSKLSLHRFVMGVPSQHVDHRHGNTLDCRKAELRVATQRQNMQN
FT                   RRKPTNNTSGMKGVIEVKPGWFKARVGHEGKSVDLGDYRSVEEAGIAYDVAAHLLFKRF
FT                   ARPNHARLNREGRPRYRNRRSPEFRAEDAVKRFLVRRRLEREAAYAKVPVESLASAVTN
FT                   SPRAAVTNRFKPAA"
FT   CDS_pept        complement(233465..233749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0226"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0226"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21895"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7W6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21895.1"
FT                   /translation="MTIEPTEFDMIALARRGLQAHLDEAIAEVKVARTYEAWDPGTGQL
FT                   TPASEEAKAKVEPAGVTSDRAGRRRRGAGRPSILNVRSFSRAHRGRPCA"
FT   CDS_pept        complement(233746..234264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0227"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0227"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21896"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7W7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21896.1"
FT                   /translation="MPSWRAVAALPQGHQDYFDGLVADERAKAADAERIAKVRAMSDED
FT                   AVQFAIKQASEFFGLGGLPERLLAALREAGFGRLTGPDMNAADENRSETGLRNIVTILR
FT                   GPRVEFEISDIVEEVRVLAKGHRPDLRAAYRLGFASSNNAFNGQTSHPAGERFRNKMDL
FT                   DLRVLESSR"
FT   CDS_pept        234279..234455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0228"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0228"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21897"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7W8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21897.1"
FT                   /translation="MCRPSCIEGPTDPRFEQRRNGNTSRLPRRPDARGLANPTGAPHVR
FT                   GVNDTTPCQLWQG"
FT   CDS_pept        234854..236551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0229"
FT                   /product="putative AAA ATPase domain protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0229"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21898"
FT                   /db_xref="GOA:C7C7W9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7W9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21898.1"
FT                   /translation="MSTTARRAALAAVRKNLPAYTKPRWPKPGEKPHNTVELLSGAEFE
FT                   GGNVLQDLATYLAPMLQPAWPHKLPKRLMQVMKGLCAEPSLARMRMVEDAAQTVLDDTD
FT                   AGRAPILAQTVSIVEDIVERMLVYAAAFGCQRAAMRCAVLCCRHWRGRPTGFADPVTHG
FT                   FMLSMLEYLHVADLHLPPVDVRGYIQESRHLQIWQADKDARRLVYLLSLVHEAIDTPEP
FT                   GASAPDDPEDRAAVAEDRAGIVRQAPPVTRTEPDFGVMWFNEDGSTHGEGDPPLAPGMV
FT                   VIGDVSHVKKGGKGDHDPVKDAEAIIGKRLTLVTPPADLGAARSELLGDAPHGERVIDR
FT                   LLRPLAAQDSVRIPPVLIWGPPGAGKTRFARRYGEVLDLSPALYSLGGSSDAMALTGVA
FT                   RGWSTGGFCAPLREILRTKIANPLLVVDEIDKVGTSRHNGHAGDALISMIGETAARYRD
FT                   PYLQAEVDLSRVQWILTANSLDNVPRPLLDRCLVLRLDEPGPAHLRQLATSILADVRAD
FT                   RGLDEQWAPAFDGVEWAALEAYWPGGSLRALRRLVETVLDAREAGPRQ"
FT   CDS_pept        236548..236793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0230"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0230"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21899"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7X0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21899.1"
FT                   /translation="MSPVVCELRLLRESIEDSLDRQRVDTNLGRGVYGYVGALIRLVED
FT                   GDRDPALALNEARSAAGFLHAVPRLPDPRPRAWSAR"
FT   CDS_pept        236778..237386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0231"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0231"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21900"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7X1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21900.1"
FT                   /translation="MECPLMARVIPAEALAFLSGALDEGAMTGIRVTGVDPTPQGPRVR
FT                   FEVPPMRRRRGDTRPLPDREAIAELVSRMVALRWKDSPEPRALPEYPPMDLILHHGLVI
FT                   GDYTETDSGWYWLLSAAAGWIEETGIPRGFKSTQIKQKFGTLRWYCSCPEDEDRLQAGK
FT                   IIRAAEWVSGAVCETCGAPGQTRTGGWIRTLCDAHARKR"
FT   CDS_pept        237422..238006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0232"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0232"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21901"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7X2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21901.1"
FT                   /translation="MRLAGRVVGRVPAIALRDVTLRSSNAARLRCLRLGTRDVHAWARG
FT                   IPIDAPRPAEATRFRYRLAEPGFRLADGAILTAAAAAWFEADGPAWCLASPGATLLQEG
FT                   RNMVTLTRYPGQAFDLAHIDTAGLLDEWELRPVRQGDGYVLHGVDERGLERETGCVQGL
FT                   DTGEGWAFAGGTGLVRLGSPRHALPTAGVTL"
FT   CDS_pept        238003..238437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0233"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0233"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21902"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7X3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21902.1"
FT                   /translation="MRLRPLNPAEIRAIEEHRRQVREALSRTGEGRRFEHTDLRSAPFL
FT                   DRWELRESPTVPGAICLSGIAYGHPTREDGHLITAPIRYRTDTWMETDDGQVFLLGRMV
FT                   EPERPRIPDGRRGRGRQPPAHPGFVTDTPDTDDDLPPMEP"
FT   CDS_pept        238441..238554
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0234"
FT                   /note="Evidence 5 : Unknown function;protein of unknown
FT                   function (N-terminal fragment)"
FT                   /db_xref="PSEUDO:CAX21903.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        238558..238995
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0235"
FT                   /note="Evidence 5 : Unknown function;protein of unknown
FT                   function (C-terminal fragment)"
FT                   /db_xref="PSEUDO:CAX21904.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        239025..239336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0236"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0236"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21905"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7X6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21905.1"
FT                   /translation="MALAALSSHAQAGPRLPASGLYCPIGVDVPPISVDGRGGLGIDLL
FT                   DCARVSLSRGRARSEVCFGNGGAQVTLDTDLAVHRDGTLRHDGVAFRLYTGPRPCPAP"
FT   CDS_pept        239600..239803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0238"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0238"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21906"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7X7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21906.1"
FT                   /translation="MAQDPRQPSDLRSMAGLVASGAAMMPFDPAQRSLAPVATRPVEEA
FT                   PVMQRPDSDEDVGADDGEIDTE"
FT   CDS_pept        complement(239861..240463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0239"
FT                   /product="conserved exported protein of unknown function,
FT                   DUF1236"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01957.1"
FT                   /translation="MGSGGAGGGAAGTGAGSAGTRSDGTGGAGGAAGTRGGDTGSGTGG
FT                   ASERGGAGERGGASDRGTAGERGNASDRNGSRDGASDRAGERGSATGERGGRGEAGTRG
FT                   EVGGRSEARGAVSRLDSSKRTEFRQSITRSGVSRVDNVNFSVSVGTAIPRSVTLHTLPP
FT                   AVLSLVPAYRSYRYILVRDDIVIIDPDTYEIVDVIQG"
FT   CDS_pept        240928..241275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0241"
FT                   /product="conserved exported protein of unknown function,
FT                   DUF1236"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0241"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21908"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21908.1"
FT                   /translation="MKRLLSAAAALALLSGAAVAQTTVTTTGTVGDTVEIAPEQRTVIK
FT                   KYVTEQRAKPVRLKERVTVGSTVPADVDFQPLPSTIVADNPRLKGYSYFSSDGGTYIVD
FT                   PGSRRVITTID"
FT   CDS_pept        241338..241586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0242"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0242"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21909.1"
FT                   /translation="MAMKVWIAPLLLTTLLAPGTADASGGNGWKEHRKEEKEFYKEREK
FT                   RAKEFHKERRKRSEEYHKERAKRGFYGPDGGFDDFDD"
FT   CDS_pept        241763..241828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0243"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0243"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21910"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21910.1"
FT                   /translation="MTANDKYDREHLIGMIETLQA"
FT   CDS_pept        241953..242165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0244"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0244"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21911"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21911.1"
FT                   /translation="MQEIAEVLAQRGHLTPAEILPELRAVTHRGATLHKEHLTPGTLKK
FT                   KTDVRLFHGRYIEPRNEGCYARKAG"
FT   CDS_pept        complement(242206..242346)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0245"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r :
FT                   regulator;putative sensor hybrid kinase (fragment)"
FT                   /db_xref="PSEUDO:CAX21912.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(242489..242698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0246"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0246"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21913"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21913.1"
FT                   /translation="MTPLARATNRARRTIRIGLSGGFCTVADRSGSAIRHLPGVQQSSL
FT                   PARSPSRPWTRIVTKNANLARALA"
FT   CDS_pept        242673..244754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0247"
FT                   /product="Putative histidine kinase and two component
FT                   hybrid sensor and regulator; putative membrane protein"
FT                   /function="15 : Cellular processes"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0247"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21914"
FT                   /db_xref="GOA:C7C7Y5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21914.1"
FT                   /translation="MVARASGVIGVAASLTVLAGWWFDVPALRRIVPGQPPMVVLTAIG
FT                   ALLVGSSLLAATAAEASKAARRIGRWIAAAAAAVGLGGLMRYVPLGETHLDDWVQRLVF
FT                   GPLKPGSGMALATATSLLGTAAGLLLQDVGNRRLRVFGTFANLSGLVTAAVGVLGYAYG
FT                   LGAFHQGTPFSRMALVTAATLSILSLGVLFSRPNRPWVATVLGTGEAGVLTRSLLPALV
FT                   AAPLLLGWLQLHAARTGLIEAETGTALLVIVLTLWLAALAIRMARNVDRRAVAERHLRE
FT                   TLQGMNEALERRVAERTLELAQAQDALVQSQKMEAIGQLTGGVAHDFNNLLTIIRSSTD
FT                   FLRRPDLPEERRRRYLDAVSDTVDRAAKLTAQLLAFARRQALKPEVFDAGGRIRGISQM
FT                   LDSLTGARIKIATQVPETPCLVHADAIQFETALVNLAVNARDAMDGEGTLTIALACGHP
FT                   MPAIRAHSGSARPFVAVSVTDTGSGIAREQLTQIFEPFFTTKEIGKGTGLGLSQVIGFA
FT                   KQSGGDVDVASVVGRGSTFTLYLPQAEAAVEEAAAAPEPEGQAWEQGNQCVLVVEDNTE
FT                   IGRFCTQILHDLGYGTVLTQTAEAALAEIEAVPFRFDAVFSDVVMPGMGGIEMAKRLRD
FT                   IHPEMPIILTSGYSHVLAQEGAHGFEFVRKPYSAEQVGKVLRAAIARKPKVRAAAADA"
FT   CDS_pept        244812..245063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0248"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0248"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21915"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21915.1"
FT                   /translation="MKDGQVAPQRQTVDAMPATHMAEHVRGGVVAVLLQLMGQPGQLMG
FT                   QAFFLENLRDCRVHNLPARVGHASSSACEDALRSGISP"
FT   CDS_pept        245176..246444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0249"
FT                   /product="signal transduction histidine kinase; GAF domain"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 12597275; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0249"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21916"
FT                   /db_xref="GOA:C7C7Y7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21916.1"
FT                   /translation="MTNHATAPAVAPEQGGGLAEELAYRLHQQQLTAEYGRFALRTRDA
FT                   AALLQEATRVCALGLQSEFCKAMEYLPDEGQFIVRAGVGWKPGVVGQARTGADAASPTG
FT                   YAFQTGQAVISNHLAGETRFRTPDILREHGVKRAINVLIQGDGAPFGVLEVDSPEEGRF
FT                   TEADLAFLQGFANLLGVAIDRQQAEEALQASQARAEANEARAQASEARLQQALAHQEVL
FT                   TREISHRVKNSLAIVAGLLSMQGRMASDPNLQRGLEDARARVATIAQVHDRLWRKDEVH
FT                   TVNLAEFMGELCEQLRSSATPGQTLTCDCAPVMVATDQAVPLGLLANELVTNALKYACP
FT                   SGTGVVRITIQPYEPGQLRLMVCDKGPGLPPDFDAAKSKSLGMKLIATLGRQLGGRPEW
FT                   LSTNPGTRFVLDFYPQKRPAHEL"
FT   CDS_pept        complement(246551..246742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0250"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0250"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21917"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21917.1"
FT                   /translation="MKCLIWALLDLPRHLSGTVGRMPQNRAGSAVANQAIKVTNIIALL
FT                   QMSALAHSCLIADPMIGF"
FT   CDS_pept        complement(246739..247050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0251"
FT                   /product="protein of unknown function; putative
FT                   metallo-dependent phosphohydrolase/phosphoesterase domain"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0251"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21918"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Y9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21918.1"
FT                   /translation="MRPKDTVWHLGDFCYRCSEDYARSVFSRLRGRRRFLVRGNHDRFS
FT                   VRLPWDGIVDVARVVVPRTDGTAQGAWLSHYVHRVWPRMHRGDLHLYGHSYLDSVYEA"
FT   CDS_pept        complement(247242..248813)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0252"
FT                   /product="putative diguanylate cyclase (GGDEF motif)"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0252"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21919"
FT                   /db_xref="GOA:C7C7Z0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Z0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21919.1"
FT                   /translation="MSMVSRTDFRRYLWSTRSPWLLAVLNLLCVVGLCAVSAFMLWDMR
FT                   RDAERRTTAAAQSLVQVLSRDIARSIGMYDLSLRAIVDGWRLPAVMNADPETRQLILFD
FT                   RAANAENFGHTLVFDRTGTLIISSKTPSPEPLSYADREYFQYHATHADPVLHVSVPLVS
FT                   RLTGRWVLIISRRLSNPDGSFAGVVLGSIYLDYFRQLFAAIDPDHAGTVTLYGPGGTIV
FT                   MREPFDEQLVGRSVSATGSYQRMLQTRQGVFTGPAMMGEGPRTFAVAQVGELPLQLSIA
FT                   LTAEDIYAAWWQKALVLAAVVLSLCATTVVLTTLFRRELTRRKAAQRATAALNAELQQL
FT                   ASTDALTGLSNRRRFDEVLERECRRAMRTGKPLSLLILDADYFKGFNDRYGHQQGDAAL
FT                   RLIAQAMQGSIHAYSDTAYRIGGEEFAVVLPDTGEPGAVTAANRIRQAVLAQAMPHASN
FT                   PHGLVTVSCGVAAIPAGQNSDLIALVAAADAALYEAKRRGRNQVRISTSAERHFLVIEG
FT                   GQQSRL"
FT   CDS_pept        complement(249502..250413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0253"
FT                   /product="transcriptional regulator, LysR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="GOA:A0A2P9HAN4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01958.1"
FT                   /translation="MPDSPLDFDLLRAFLHIVESGSFTRAAERIGRTQSTVSLQIKRLE
FT                   DGLGRRVFDRDGRDLQLTPEGEILLGYARQILSLGNEVCARIMEPEVDGVVRLGTPEDF
FT                   ATAHLPDVLARFARAHPRVSLEVHCDFTVHLLDGFSRGLYDLVLLKREPQGPGGGVGIW
FT                   CEVLEWVASPGLALGSGPIPLVLAPAPDVYRKRALQALEAARLPWRIVYTSQSLLGLQA
FT                   AVSAGLGVTVLPKGMIQSGLIRVSGTYGFPALPATEVVLYRAPGSLPRAADLLAEHIMH
FT                   ALEAEVGYSAETRACAEFHMVP"
FT   CDS_pept        complement(250603..253731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0254"
FT                   /product="RND efflux transporter, HAE1 family, translocase
FT                   subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0254"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21921"
FT                   /db_xref="GOA:C7C7Z2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Z2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21921.1"
FT                   /translation="MPAFFIARPIFAWVVAIFICLGGLLALPFLPVAQYPVIAPPSIAI
FT                   STVYPGASTQNLYYSVTRLIEEELNGAANILNYESTSDTTGEVEIVANFRPGTDIALAA
FT                   VDVQNRIKRIEPRLPEAVRQQGIQVVEASSAILQFVTLTSPDSSLDEVGLGDVATRYVL
FT                   PELRRLPGVGRARLFSTERAMRIWLDPDKMLGLSLTAGDVEAAIRAQNAQVSSGLLGTP
FT                   PSPVTERTQNMVLVKGQLEAPEEFGAIVLRANPDGSTVRLADVARIEVGGLSYAFSTRL
FT                   NGKPAAAVAVQLAPRGNALATAEAVKTRMGQLAAFFPPGVTYEVSYDVTPVIRASVKKV
FT                   LLTLAEAVGLVFLVMFLFLQNIRYTLIPTIVVPIALLGTCVVLLWLGFSINVLTMFGMV
FT                   LAIGILVDDAIVVVENVERIMAEEGLPPREATEKAMSQITGAVIGITLVLMAVFVPMAF
FT                   FPGSVGIMYQQFSASMVLSIGFSAFLALSLTPALCATLLKPVEKGHGHAKRGFFGWFNH
FT                   RLGRLTRGYGRVTGWMVARVGRFMLLYLALLAGLGYAMWRLPSGFVPVDDQGFVMADLL
FT                   APSDASASRTLDVVRAVEDRMARTPGVDKVTFITGFSFYGQGAMTGQAFVTLKDWSKRG
FT                   ADQSAEAIISGSNAAFARLRDAEVSALAPPPIANLGTTSGFSFRLQDRSQRGYDALMAA
FT                   KDQLLAAAARSPVIRKVLVEGLPPAPQIRLDIGREKAAALGVTFADINATLSAQLGSTY
FT                   VNDFLNRGRMQRVIVQAEEEKRVRPEDLLTYSARNSAGAMVPFSSFARVAWVTGPTQVV
FT                   GFNGYPAVRLTGEPAPSYTSGDALAEMERLMGMLPAGFGYEWTGQSLQEKLAGSQAAFL
FT                   LGLSILFVFLCLAALYESWAIPLSVMLVVPLGIVGSVAAAYLRGLPNDVYFTVGLITII
FT                   GLSAKNAILIIEFAKDLRALGKPLVEATLEAAELRFRPILMTSLAFILGVVPLVIASGA
FT                   SAMSQQALGTGVLGGMITATVLAVFWVPIFFVVVMRTLGRERTAAQPALAEAA"
FT   CDS_pept        complement(253771..254967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0255"
FT                   /product="RND efflux transporter, MFP subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 15047512, 8878035;
FT                   Product type t : transporter"
FT                   /db_xref="GOA:A0A2P9HBE9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HBE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01959.1"
FT                   /translation="MSRMLDRSRTIRTRRGRALVFAAVLLAGTGPATTAFAGDAAAAPE
FT                   VGIVTVEPRPVTLIKELPGRVTPMRIAEVRPRVSGIIVERAFQQGSVVKKGEVLYRIDP
FT                   LPFEVELESAKAALARAEASLFQASRQEDRLRTLLSGQTTTQAQYDLALSAERQAEAEV
FT                   ASQKAAVKRAQINLDYATIRAPITGRIGRALVTEGALVGQNEATHLATIQQLDPIYADF
FT                   TQSVTELNQLKRDLATGRLRQVSPDAARVRLLFDDGTTYPQAGRLLFSDVTVDPGTGKV
FT                   TLRGEFPNPQADLLPGTYVRVQIEEGISARAVTLPRQAVQRNNAGGSEVFVINNAGRAV
FT                   LQPVRTGRTLGDQVVIEDGLQAGNRVVVEGFQKFVPGGAVTPVPWSASAAASAGAVQN"
FT   CDS_pept        255340..255819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0256"
FT                   /product="putative molecular chaperone, heat shock Hsp20
FT                   family"
FT                   /function="11 : Protein fate"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0256"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21923"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Z4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21923.1"
FT                   /translation="MNLKSLLTLGNRVGAPTSDHQAMMLPLQRLADQMFGDLRFGLPPL
FT                   LQGTAVPRMDVVEKDGHFELSAELPGLAREDVRIELADDVLVISGEKRRDKDETEGSRK
FT                   ITERAYGSFMRTLDLPAGIRPEDIEASMDKGVLTVRLPKTVLAARETKRIEIKAP"
FT   CDS_pept        255819..256688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0257"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0257"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21924"
FT                   /db_xref="GOA:C7C7Z5"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Z5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21924.1"
FT                   /translation="MPTREPLARLVRRLEEAGSLGERERQAVLSLRLQPRLVPARADIG
FT                   VEQDPQAAHLVLRGVACRYHMLSDGTRSIVGLFFPGDLCGGHSASPAKHHGSLGALSPS
FT                   LVADVPFRTLEALIGDHPGIGRALWWLALVELGIAQQWLANGGLEAERRIAHIVCEILA
FT                   RSEATGMAAVDAFSGGIRQGVIADLAAVCLVHVNRVLHALQDAGLIRLERGVVKVPKPS
FT                   RLAAYADFDAGYLHLAGRAATEPGSKVSLSCETGRARIRASAGGSGPGARPGSVDDARP
FT                   CQGHRGWR"
FT   CDS_pept        complement(256702..257520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0258"
FT                   /product="conserved protein of unknown function, putative
FT                   universal stress protein-like domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0258"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21925"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Z6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21925.1"
FT                   /translation="MSIVSIMVAVDDGRHASARVRLAAGLAHRLGARLVGAAAYMPDYP
FT                   QGYGETAVPMGMVIEEIRQAALVRLAGTEQAFRNASCLNDRIEWRSDLTAPVRFLEDQS
FT                   RAADLVVVGLYADDEGVADGMAVDVGDALMGLGWPVLVVPPGVEHLKAGRVIIGWKNTL
FT                   QTRRAVTDAMPILRRAEAVRVILVSDGKDRAEVEDVVRYLSLHDVNATAHPAKPSGWTV
FT                   ADEMQKAARDFDADLIVAGAYGYSRLREWFFGGVTRDLLAKASVCCLMSH"
FT   CDS_pept        complement(257685..257951)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0260"
FT                   /EC_number="2.7.1.2"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme;putative
FT                   glucokinase (C-terminal fragment)"
FT                   /db_xref="PSEUDO:CAX21926.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(258209..258577)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0262"
FT                   /EC_number="2.7.1.2"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e :
FT                   enzyme;glucokinase (N-terminal fragment)"
FT                   /db_xref="PSEUDO:CAX21927.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(258580..258957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0263"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0263"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21928"
FT                   /db_xref="GOA:C7C7Z9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C7Z9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21928.1"
FT                   /translation="MMAASLRSARILALGGLLASVAGAPAIAGPTEDHRVRGWTIATQL
FT                   CSQCHVIGRAAQPGEFVGPAFVRVAEMPSTTGPALAVFLQSHHERMPSLRLDRDEMEAV
FT                   IDYILSLKTERTAPAGANQED"
FT   CDS_pept        complement(258954..259331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0264"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0264"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21929"
FT                   /db_xref="GOA:C7C800"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:C7C800"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21929.1"
FT                   /translation="MSQAGRQVTPPPSGGRADEIQIDVLQHAAGMALVLAAWVLVFADQ
FT                   GRAAFFALLPGLLILALTGCNRIRFRPALEKAVVLAGAWTVLTPFLFGFAANDAATWAH
FT                   VVAGAVTVVVAMRRLRIARAL"
FT   CDS_pept        complement(259399..259638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0265"
FT                   /product="putative biotin/lipoyl attachment domain"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0265"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21930"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:C7C801"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21930.1"
FT                   /translation="MADIHVAEGLWSTGMLPEGVLERWLVPDGASVRAGEAVAAVRIGE
FT                   ALHDIASPAEGRLMILAPVNEVVDPGCIIAEVHA"
FT   CDS_pept        259833..260351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0266"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein; putative ion transport domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0266"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21931"
FT                   /db_xref="GOA:C7C802"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="UniProtKB/TrEMBL:C7C802"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21931.1"
FT                   /translation="MLVVLAASIVLVMVTILVLYETLRLTSEHLAELPVPPRWRIVAVV
FT                   LAAFAGHTVAVWIYAIAYWLLVLRLGLGSFSGVPVTTFEDCLFVSVVAYSSLGYGDHAP
FT                   VGHARLLTGVEALNGLLLIGWSASFTYLAMERYWPLHGKARAHRAAKARSPADGEPGRE
FT                   RLFPPTTGT"
FT   CDS_pept        260435..260650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0267"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0267"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21932"
FT                   /db_xref="UniProtKB/TrEMBL:C7C803"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21932.1"
FT                   /translation="MREYLVTFHKTVPDDTGHDHRVLQRQAVVTARSDVAAAFAAKAML
FT                   CEACGVVDWRLRADTCKVVELARNAA"
FT   CDS_pept        260660..260917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0268"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0268"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21933"
FT                   /db_xref="UniProtKB/TrEMBL:C7C804"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21933.1"
FT                   /translation="MSHELTEPVHWQGRQWAVTGYGIEALDGMYHVPFADIPDAEDGWP
FT                   GWLDDLRRRYGTDGDDLAAALRVARTVRAEAKASASKSTA"
FT   CDS_pept        260914..262245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0269"
FT                   /product="putative manganese transporter"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0269"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21934"
FT                   /db_xref="GOA:C7C805"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:C7C805"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21934.1"
FT                   /translation="MSAPSVAAEEADDPEVPSPAVGPSKPRLLRVLGPGLITGASDDDP
FT                   SGIATYGQAGAQFGYGLCWTMLYTLPLMAAVQMVSARIGRTTGHGIAGVLREHYPNGLL
FT                   QAVVLLLLAANILNLGADLGAMADALNLLLPGPRWLYVVLFAGICAFMQLVLQYTRYVA
FT                   VLKWLTLSLFAYLGVVIFARVSWWDLGLTLAVPKLDFGGGGLTTLVALFGTTISPYLFF
FT                   WQAAEEAEDLHAYPRRRDLLHAPEQGGAALHRIEVDTLVGMAFSNLVALAIMVTAAAVL
FT                   HPRGITDIQTSAQAAEALRPLAGPFSATVFALGIVGTGLLAVPVLAGSAAYAVGEARRW
FT                   PVGFGRRLLEARAFYGTVALATLVGMVISLGAVDPIRALYWSAVVNGVIAVPVMAVMML
FT                   AAARTDIMGAFAIRGSLRLLGWVATACMLLAVFAMLTTAALPLI"
FT   CDS_pept        262311..262763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0270"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0270"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21935"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7C806"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21935.1"
FT                   /translation="MDGGREGRPVVLVAEPQALPGMWLEDVLAAAGCAVSGPYATCQDA
FT                   AESLDEMPPDFAVVSVDLNQGPCFPLACALRRRGVPFALISGNARVPDAFSDVPRFDRL
FT                   FDARDMVSAVSARCAVPGCPRACPMLGRIAAGEAVALDQCPTACRA"
FT   CDS_pept        262813..263460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0271"
FT                   /product="conserved protein of unknown function; putative
FT                   phospholipid-binding domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0271"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21936"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C7C807"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21936.1"
FT                   /translation="MGDKLIRQNVIDELDFDPSINAANIGVAVENGIVTLTGHVGSYTE
FT                   RVAAEKAAQKVRGVRGVVEEIQVRFDGETPPRDEDIAQRAVQMLDWSATVPKGAVQVKV
FT                   RDGWVTLSGKVDWQYQKEEAYRAIRRLAGVAGIMNGIEVAPRASVPDVRAKIMAALKRN
FT                   AELEADAIKVTVKDAKVVLEGKVNAWYERRLAENAAWSAPGVRAVDDRLTLG"
FT   CDS_pept        263547..264356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0272"
FT                   /product="conserved protein of unknown function, putative
FT                   universal stress protein-like domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0272"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21937"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7C808"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21937.1"
FT                   /translation="MSYASIMVAVDLGEHARERVRLAGHLADDFCARLIGVAAEMPAYE
FT                   AAPVGPTLGSAYCLASVQEAVLNDLRMAHEAFKDAAGERSRVEWRSNLDFPAAFLERQS
FT                   AAADLLVVGRGDDGSPLMSVDPGDALMRLGLPLLVVPPKVDHLDAKRVAVAWKGTREAR
FT                   RAVRDALPFLKRASQVVVISVDDGKGADDTRDVVSLLQAHDVYATAIHKDAYGAATADA
FT                   LIEAASEQAADLIVLGGYGHGRLREWAFGGVTRDLLAGCPVCCLMSH"
FT   CDS_pept        264357..264632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0273"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0273"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21938"
FT                   /db_xref="UniProtKB/TrEMBL:C7C809"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21938.1"
FT                   /translation="MPVTAHTAKAYAAFLVLVAVTSQASTVQAQGPARSPDEKGTFVEP
FT                   ENAPHLHCSGACLKSGTLQWFCKPEQTCSLDCGTAPPHRHCHNPRR"
FT   CDS_pept        complement(264698..265558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0274"
FT                   /product="conserved protein of unknown function; putative
FT                   UspA and related nucleotide-binding domain protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0274"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21939"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7C810"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21939.1"
FT                   /translation="MFLRCLLVPTAPGVDATRRLDAALRLGRRLHAHIAVSFMAPGPEH
FT                   VMASMASLVPLDCATIDAIERGVREAAAEGKAALQAWCQREGVKFMSSGGRLDATFATW
FT                   TELSGEIEPLLTLAGRINDLVIVDQPDPGVPFTGRALDTALFSVGRPTLMVGETVPYDL
FT                   LDHVMIAWNGSLEATRLIGQSITLLHEATRVTVLHARTERFEEARAADLCTYLRWHGIV
FT                   AEAATLDIEDGASVGEAILADGERRHASMLAMGAYTHSRVREFLLGGVTRHVIEHARIP
FT                   VLLAH"
FT   CDS_pept        complement(265574..265906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0275"
FT                   /product="conserved exported protein of unknown function;
FT                   putative cytochrome c"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0275"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21940"
FT                   /db_xref="GOA:C7C811"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C811"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21940.1"
FT                   /translation="MRPAAIVAAGALALLPGLFSLPAHAWDRQVKQGETLARTNCARCH
FT                   AVGRLGASPLRAAPPFRELHKRYPVEDLGEALAEGIRTGHPGMPEFRFDPDQAEALIAY
FT                   LKSLER"
FT   CDS_pept        complement(265906..266721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0276"
FT                   /product="conserved protein of unknown function; universal
FT                   stress protein UspA-like domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0276"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21941"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7C812"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21941.1"
FT                   /translation="MRISNIMVSVDLGAAAADRVQLAAGLAERFGSKLTGVAGRPVLGP
FT                   MPVGDMLEVERAWAAEERLADEQLAEAKALFEREAGQAPRTDWCSAPTDPLTYLLAQAR
FT                   SAELVVVGRQGPADGDPGPTALSTGALLMEVGRPVLVVPPGIERLAAKRIVVAWKDTRE
FT                   ARRALHDALPFLGRPEQAFVVAVGPDAHHVGAEGAAEYLSGHGIKVTTHLVPSPAIGPA
FT                   DELLRFAQREEADLIVMGAYGHSRLREWIFGGTTHDVLQTTPVCCLMSH"
FT   CDS_pept        complement(266800..267000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0277"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0277"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21942"
FT                   /db_xref="UniProtKB/TrEMBL:C7C813"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21942.1"
FT                   /translation="MFRDTEPNARAGTADYELAELDLGCAADDTEALGRAAAASRCGTA
FT                   DCLRSSSSRLVTFPPAQGLLP"
FT   CDS_pept        267269..267487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0278"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0278"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21943"
FT                   /db_xref="UniProtKB/TrEMBL:C7C814"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21943.1"
FT                   /translation="MRRLDLEGPLLSPRHWEMRTIRSLLARGLVRPRLPSRDGRNGAGL
FT                   WFLSAKGAQVLPRCQLVDGAVEVRAGP"
FT   CDS_pept        267313..267648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0279"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0279"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21944"
FT                   /db_xref="GOA:C7C815"
FT                   /db_xref="UniProtKB/TrEMBL:C7C815"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21944.1"
FT                   /translation="MGDAHHPLAARTRARQAKAAKPGWPERRRPVVPERQGCTGASPLP
FT                   AGRRRRRGSSGPMIMNWLIDRLLVLGIALVVGGALAALSAAGFSRVGETCGFAALIASL
FT                   VTIWLRR"
FT   CDS_pept        267623..268219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0280"
FT                   /product="putative cytochrome b561-like"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0280"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21945"
FT                   /db_xref="GOA:C7C816"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7C816"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21945.1"
FT                   /translation="MSPSGCVADATPNPDQTEASGPMQPASSTYDRVTIALHWLTAALV
FT                   TVLWLIGTFLEDLLPKGTLRSEVWSAHFDLGFVLAVALLAFLAWRRTKGRRLPIEDPGL
FT                   LHRVAKATHAVLYLLLLIIMALGTANAFVRGVHLLGPVDLPKVGDPEWRRPLTHWHGLA
FT                   ANLLMVLALFHAAAALVHHFLWHDAVLRRMLAWRG"
FT   CDS_pept        268225..268920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0281"
FT                   /product="conserved protein of unknown function, putative
FT                   membrane protein, putative nodulin-related protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0281"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21946"
FT                   /db_xref="GOA:C7C817"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:C7C817"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21946.1"
FT                   /translation="MRAVHAERHLIDRVGWLRAAVLGANDGLVSTASLIVGVAASTAGP
FT                   GEVLVAGCAGLVAGAMSMAAGEYVSVSSQADTERADLARERRELSDDPVAEREELAGIY
FT                   VGRGLDHALALQVADQLMAKDALGAHARDELGISEITTARPVQAALTSAATFSAGAALP
FT                   LLVAVLSPGRLTVFTVSAASLVFLAILGALGAKAGGAAVPRATARVAFWGALAMAVTAG
FT                   IGSLVGKAV"
FT   CDS_pept        268930..269139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0282"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0282"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21947"
FT                   /db_xref="UniProtKB/TrEMBL:C7C818"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21947.1"
FT                   /translation="MRSAPLPGAGACRGGSWQCLRVGEALQSSEPVWSGLQSHWREPLL
FT                   RQAPEQWRCAALAGSTRVRFASGG"
FT   CDS_pept        complement(269220..270203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0283"
FT                   /product="putative alcohol dehydrogenase (Adh-like)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 1735726; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0283"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21948"
FT                   /db_xref="GOA:C7C819"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C819"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21948.1"
FT                   /translation="MLAMVLAEVGGPLVAEERPDPEPRPGEVRIRVEACAVCRTDLHVI
FT                   DGDLPQAVYPIVPGHEVVGIVEAAGAGVTEPRPGTRVGVPWLGHTCGHCAYCGTGRENL
FT                   CDAPGFTGCTRDGGFASHLVAEAAFTIPLDPALEPVATAPLLCAGLIGWRTLRTAGEAG
FT                   TVGLYGFGAAAHIVAQVCRWQGRRVFAFTRSGDREAQGFARSLGVEWAGDSDGQSPEPL
FT                   DAALIFAPDGSLVPAALRAVRKGGRVVCGGIHMSDIPAFPYDLLWGERSVRSVANLTRE
FT                   DARTFFEVVPQAGIVTHTRVYPLVQANAAVAAHRSGTLQGAAVLVP"
FT   CDS_pept        complement(270213..270860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0284"
FT                   /product="conserved protein of unknown function, putative
FT                   transport-associated protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0284"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21949"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C7C820"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21949.1"
FT                   /translation="MDDITVHRHVLDELEYAPMIDAAQIGVTVENGIVTLTGHVRNYAE
FT                   KSIAERVALRIRGVRGVVERIEVRYPDNPSVGDEALAERCARVLEWDVRIPEDSVTLKV
FT                   ERGCVTLQGSVPYYHQKAAVDKALRRLAGVTDIVNLIAVKPPAQATEVKSRILAALRRS
FT                   AKDPDTIQVHVDGGKVILDGCVDVWRDRELAERAAWSAPGVRAVEDRLTLAC"
FT   CDS_pept        complement(270890..271090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0285"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0285"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21950"
FT                   /db_xref="GOA:C7C821"
FT                   /db_xref="UniProtKB/TrEMBL:C7C821"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21950.1"
FT                   /translation="MTLVLRSTYIKTVRRVRVPVGLVPWNDAGQQVVADGCRYRSIGSL
FT                   QALALAVAASAVTPALLWLAL"
FT   CDS_pept        271224..273809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="METD_I0286"
FT                   /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase"
FT                   /EC_number="4.1.2.22"
FT                   /EC_number="4.1.2.9"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 11292814, 11823225; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0286"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21951"
FT                   /db_xref="GOA:C7C822"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7C822"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21951.1"
FT                   /translation="MDARRDARNHREDRYDGGHRDDGHGLAFVPGPLGPDSLKRIDAYW
FT                   RAANYLSVGQIYLMANPLLREPLRPEHVKPRLLGHWGTTPGLNFIYAHLNRVIRERDLD
FT                   MIAVWGPGHGAPGLVANAYLEGTYSEIYPDVALDIDGMARLFRQFSFPGGIPSHASPEL
FT                   PGSIHEGGELGYSLAHAFGSALDNPGLTVACIVGDGEAETGPLAASWHSNKFLNPRSDG
FT                   TVLPILHLNGYKIANPTLLARMPEDELRSLLVGYGYEPTFVEGDEPAPMHQAMAAALDA
FT                   AFDAIAEIRASARRGETGRPRWPMIVLRSPKGWTGPESVDGKPIEGTWRSHQVPVAAVR
FT                   EDPEHRAILEAWMRSYRPEELFAEDGSLVPDLTALSPKGPRRISANPHANAHKSAPLRL
FT                   PDLRRLAVAVPEHGRTTAEATRALGAYLRDVMTLNAEARNFRIMGPDETASNRLDAVFE
FT                   VTNRTWQEEILPGDDHLARDGRVMEVLSEHLCEGWLEGYVLTGRHGLFATYEAFVHVVD
FT                   SMVNQHAKWLKSSRDLPWRRPVPSLNILLSSHVWRQDHNGFSHQDPGFIDFVANKRGDT
FT                   ARIYLPPDANTLLCVTDHCLRTYDRINVVVAGKQPALQWLSLDEAARHCAAGAGIWEWA
FT                   SNEGDAEPDVVLACAGDVPTQETLAAVDWLRHHVPELRVRVVNVVDLMTLPGRETHPHG
FT                   LDDPTFDSLFTRDRPVVFAYHGYPWLIHRLTYKRTNHANFHVHGFVEEGTTTTPFDMCV
FT                   LNRLDRYHLAQAALRSAPRLGARGEHAEEALRDALARHREHVCRTGDDLPVVRDWTWPE
FT                   RLARSPAPGTRPDDGRVLLATTVADEVMLDEYEQGGRGESAELGPRSAS"
FT   CDS_pept        274308..276932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="METD_I0288"
FT                   /product="protein disaggregation chaperone"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 14550559, 14640692; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0288"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21953"
FT                   /db_xref="GOA:C7C824"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C7C824"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21953.1"
FT                   /translation="MNFENYTERARGFVQAAQNLAVREGNPQLAPGHLLKVLLDDPEGL
FT                   CAGLIDRAGGQSRVAHAQVEQWLAKQPKVSGNAAQPQATRELVRLFDTAEQAAEKAGDS
FT                   YVTVERLLLAFAVEKDGEAGRILTAAGVTAASLNAAINALRKGRTADNASAENAYDALK
FT                   KYARDLTEAAREGKLDPVIGRDEEIRRTIQVLSRRTKNNPVLIGEPGVGKTAIVEGLAL
FT                   RIVNGDVPESLKEKSLLALDMGALIAGAKYRGEFEERLKGVLSEVTAAEGQIILFIDEM
FT                   HTLVGAGKADGAMDASNLLKPALARGELHCVGATTLDEYRKHVEKDAALARRFQPVFVS
FT                   EPTVEDTVSILRGIKEKYEQHHGVRIQDSALVAAATLSNRYITDRFLPDKAIDLVDEAG
FT                   SRLRMQVDSKPEELDNVDREIVRLKIEGEALKKETDSASRDRLQRLEKELADLEEQSAT
FT                   ITARWKAEKDKLGAAAELKKKLDEARNELASAQRQGQYQRAGELAYGVIPGLEKQLSEI
FT                   EAAAESAVARDGMVEEAVTPAHIAGVVSRWTGVPVDKMLEGEREKLLAMEEALAKRVVG
FT                   QREAVEAVSTAVRRARAGLQDPNRPIGSFMFLGPTGVGKTELTKALAGFLFDDDTALVR
FT                   IDMSEYMEKHAVARLIGAPPGYVGYEEGGALTEAVRRRPYQVVLFDEVEKAHPDVFNVL
FT                   LQVLDDGRLTDGQGRTVDFRNTLLIMTSNLGSEYLVNQPAGQDTDVVRDEVMGVVRGHF
FT                   RPEFLNRVDEIILFHRLARSEMGAIVDIQLGRLAKLLEDRKITLDVDGEARTWLADKGY
FT                   DPAYGARPLKRVIQKNVQDPLAEAILSGVIHDGETVMVRTGEAGLIVRSEEPEAPLHPS
FT                   LAA"
FT   CDS_pept        277549..278454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0289"
FT                   /product="putative heat shock protein DnaJ"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0289"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21954"
FT                   /db_xref="GOA:C7C825"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C7C825"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21954.1"
FT                   /translation="MTDDPYEVLGVTRDASAEVIQKAFRRLAKKHHPDLNPGDATAADA
FT                   FKRLSAAYEILGDSEKRARFDRGEIDASGAERPPPRYFRDFAEAGGEHPYASSAGFEDI
FT                   LSEDDILSEILRRRTRADVRTRGADIRMRMPIDFLDAINGTIKRVTLPGGALVDLPVPK
FT                   GAEDGQVLRLRGMGEPGLNGGPRGDAYVELTVRPHRFFRRDGENLRLDLPISLSEAVLG
FT                   GRVEVPTPTGRVAMTLPKGSNTGRVMRLRGKGVPRGDGGRGDLYVELRVVLPDADPEFV
FT                   AFVERWEAGKTQDPRRDMGG"
FT   CDS_pept        278458..278760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0290"
FT                   /product="conserved DnaJ-associated protein of unknown
FT                   function; putative transcriptional regulator"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0290"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21955"
FT                   /db_xref="UniProtKB/TrEMBL:C7C826"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21955.1"
FT                   /translation="MTLNEFCQALEIERASLQVWIDEGWLRIRSARERTGAPEDYFAAE
FT                   DISDVDLARARLIRHLLDDMGVNTEGVGIILDLIDQVHGLRGALREAAGSLRSAD"
FT   CDS_pept        278944..280791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0292"
FT                   /product="putative poly-beta-hydroxyalkanoate synthase
FT                   (phbC)"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0292"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21957"
FT                   /db_xref="GOA:C7C828"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7C828"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21957.1"
FT                   /translation="MLAAAPTKLFPTSAQPAARAVRLLQDPANDAAAGSPPADGEHDMP
FT                   AVSVAIDQAVHSTLARLTGGLSPAALADAWFDWGIHIAFSPGKQAALALKATRKNRRLG
FT                   QFAFRSLTKGETAEPCIVPLPQDRRFSNPAWHSWPFNVVYQSFLLGQQWWHNATTGVPG
FT                   VAKADEAIVEFSARQMLDAVSPSNSPLSNPVVLRETLVSGGANLVLGALNAVEDARRAL
FT                   GGLKPAGAEAYEVGRDVAVTRGEVVYRNRLIELIQYTPTTETVHPEPVLIVPAWIMKYY
FT                   ILDLSPPNSLVRHLVGRGFTVFMISWRNPGPNDRDLSFDDYRRLGVMAALDAVSATVPG
FT                   ARIHTAGYCLGGTLAAIAAATMARDGDDRLASLTLFAAQVDFTEAGELTLFINESQISF
FT                   LESLMRSEGVLEARQMAGAFQLLRSNDLIWSRVVNSYLLGRREPMSDLMAWNADATRMP
FT                   ARMQAEYLRSLFLDNDLAEGRFRVEGRPVALSDIRVPVFAVGTERDHVAPWRSVFKLTL
FT                   LGDTDVTFLLTSGGHNAGIVSEPGRTDRHYRIYTKAEASPYIDPDRWLQVARLGSGSWW
FT                   PEWTGWLSARSGEHLPPPQSGLPDTPPLGPAPGTYVREA"
FT   CDS_pept        280794..281570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="METD_I0293"
FT                   /product="enoyl-[acyl-carrier-protein] reductase (NADH)"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="1.3.1.9"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 10398587, 2687243;
FT                   Product type e : enzyme"
FT                   /db_xref="GOA:A0A2P9HAM0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01960.1"
FT                   /translation="MLPGLLPLDGKVGLIVGVANDQSIATGCARAFRAAGARLALTYLN
FT                   DRAKPHVETVATEVDAEILAPLDVTRDAALDDVFAQIAATWGRLDFLLHSIAFCPMSDL
FT                   HSRVVDCSRAGFSEAMDVSVHSLIRMTNRAEPLMRDGGTILTVSYYGAEKVVGHYNIMG
FT                   PVKAALEATVRSLAVELGPKAIRVNALSPGPLRTRAASGIGHFDDLIESAKGRSPERRL
FT                   VTIEEVGHMAAALAADGARGVTGTVTFIDGGLHAVA"
FT   CDS_pept        281586..282983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0294"
FT                   /product="putative phosphate butyryltransferase"
FT                   /EC_number="2.3.1.19"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0294"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21959"
FT                   /db_xref="GOA:C7C830"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR003965"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7C830"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21959.1"
FT                   /translation="MDALQYIENRTLAEIRVGDTASLSRVLRPQDISLFAVVSGDVNPA
FT                   HLDTAYAATDRFHGVIAHGMWGGSLISAVLGTVLPGPGTIYLGQSLRFLRPVRVGDTVT
FT                   ARVTVRERDETTMRLVLDCLCLNGAGETVITGEAEVLAPTEKVRRPRVLLPEVHLHERG
FT                   AHWRAVIAAARAHPPIRTAVVHPCDAVSLAGALAARDAGLIEPVLVGPSAKVEAAATSA
FT                   GLSLDGVTRLDAPHSHAAAELAVAEARAGRVAALMKGALHTDEILTPVLDKAVGLRTGR
FT                   RMSHVYALDVPDYAKPLFITDAAVNIAPSLEDKRDIVQNAIDLCRALGVETPKVAILSA
FT                   VETVTTKLSSTLDAAALCKMAERGQIVGGIVDGPLAFDNAVSRTAAATKGIASAVAGEA
FT                   DVLVVPDLVSGNMLAKQLIHLAGADAAGLLLGARVPVVLTSRSDSADVRLASCALAQLL
FT                   VHRAAAA"
FT   CDS_pept        282980..284167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0295"
FT                   /product="putative acetate kinase (ackA)"
FT                   /EC_number="2.7.2.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0295"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21960"
FT                   /db_xref="GOA:C7C831"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C7C831"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21960.1"
FT                   /translation="MSGAILVLNAGSSSLKFALFAADGLTTHLRGSISGLGRAARLSVT
FT                   GPMADRVASAAPPDPACGQAEAVAWLLAALRRLPELVLLAAGHRVVHGGADFTGPVQVG
FT                   PGVLEALDALALLAPAHQPHNLAAIRAVEAAWPGLSQVACFDTAFHRTQPRLAQLFPIP
FT                   RALSEAGMLRYGFHGLSYQHIAETLPAVAGAPAAGRVIAAHLGHGASLCAMRGGCSIAS
FT                   TMGFTALDGLMMGTRSGAVDPGLVLHLIRERGFGADRVARMLNEESGLLGVSGISDDVR
FT                   DLAASADPRAREALDLFVYRAVREAGALIAALGGLDCLVFTAGIGEHAPSIRAGICDGL
FT                   AFAGVRLDQACNAAGAGRISAASSAVAVYVIPADEERPIARAVAALVAGQDTERA"
FT   CDS_pept        284329..284706
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0296"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 5 : Unknown function; Product type e :
FT                   enzyme;fragment of transposase of ISMex16, IS3 family"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   mobile_element  284383..284716
FT                   /mobile_element_type="insertion sequence:ISMex16"
FT                   /function="17.3 : Transposon functions"
FT                   /note="fragment of Insertion Sequence ISMex16(1111-1444,
FT                   Id=82.93%), IS3 family; Evidence 5 : Unknown function"
FT   CDS_pept        complement(284876..285352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0297"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0297"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21962"
FT                   /db_xref="UniProtKB/TrEMBL:C7C832"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21962.1"
FT                   /translation="MSHGTQEIDAAALRLARRPRKPGPSAKLHQVTLTLARCPEYPDGS
FT                   AGRGYVIVAPLGPDGRLDAALWHETRDHCRVRRFWTGELDRHGRLVHRAGGEGGATWLI
FT                   DYEDWTNEDDETGYRLDTHAFVEGEYVSIRDADDGTYHTFKVARVGPANLGGHV"
FT   CDS_pept        complement(285363..286013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0298"
FT                   /product="Conserved protein, putative transport-associated
FT                   protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0298"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21963"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C7C833"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21963.1"
FT                   /translation="MTDKDLRRDVLDELDFDPCLDAADIGVAVSGGVVTLTGHVGSYAE
FT                   KVEAENAVRRVKGVRAIAQEIQVRFPEAKKIEDDQIAARALAIIDWSVHLPKDAIKVKV
FT                   CNGWITLTGVVPWQYQAIGAEAAVRKLSGIVGVSNVIEIQPEVRPTLVKDKITEAFKRS
FT                   AMFEADEIKVSVEGDKVTLEGAVTAWTERDAAERAAWSVPGVRAVEDRIVALS"
FT   CDS_pept        complement(286067..286411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0299"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0299"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21964"
FT                   /db_xref="InterPro:IPR009945"
FT                   /db_xref="InterPro:IPR038293"
FT                   /db_xref="UniProtKB/TrEMBL:C7C834"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21964.1"
FT                   /translation="MTTFDEREQAFERRFVHDEEQRFRARVRRNLLLATWACERMRLEE
FT                   EAAARFVEDFTDRGVLTADEPLIAELRADLKAAGIDETLPALRKEMERCAALARAEQRV
FT                   GLALDQGSSA"
FT   CDS_pept        286572..286970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0300"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0300"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21965"
FT                   /db_xref="UniProtKB/TrEMBL:C7C835"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21965.1"
FT                   /translation="MSDSADKPDPFDPFGIVASMSEWCCLLKAARELKDVDEEMMATML
FT                   EANAAGPSPEPEAAAKVGTIVNLMRSLNLDPNAVRRRDPEAMRELEEACLRCTQRARCA
FT                   RELWADTAAKAYPEFCPNAARLDRLRHA"
FT   CDS_pept        286936..289653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0301"
FT                   /product="cation-transporting ATPase (P-type)"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0301"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21966"
FT                   /db_xref="GOA:C7C836"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7C836"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21966.1"
FT                   /translation="MPRALTACAMLEPGLRAGPESPDPHVESGPLESGPEPAYALPVED
FT                   VPRRHRTSLQAGLTGAEARHRLARVGPNVIATKERASALALLLHQFASPVVYLLAAACA
FT                   LSLYFGDWHEATAVIAVLAVNTGLGFFTELRAARSVEGLRALGTRSARVRRDGHVRVLA
FT                   AEDLVPGDIVLIEGGDAVPADLRLVETSNLGADESTLTGESVPVEKSVDPVAANTRLAE
FT                   RSSMLFRGTLVIRGSGTGVVVATGSGTELGGVSRLVEQAAPDASPLERRLERLSGQMVW
FT                   VVLAVAVVLAGFGVASGKDLRLMTEASIALAVAAIPEGLPIVATLTLARGMWRMARRNA
FT                   LIERLSAVETLGATTVILTDKTGTLTENRMTVRQLSLPSGETDLTESGSGGGPEIARLL
FT                   RVAVLCNDASLGQGAGQGSGDPMEQALLRAGRTAGLERASLLRDQPLVRKHAFDAGTRM
FT                   MATVHASGRGYLMAVKGAPEAVLAASRHVDDGERDRPLDEVDRDFWRRRVEDLGAKGLR
FT                   VIACAGRIVDDAGTHPFEDLTFLGLVGLEDPAREGVPEAVAACRDAGIRVVMVTGDHAV
FT                   TARSIAHAVGIAGRDGQVMEGGTVSEAADGLHGIAVFARVSPAEKLSLVRAYQEKGEIV
FT                   AMTGDGVNDAPALKQADIGVAMGRRGTDVAREAAAMVLLDDAFPTIVGAIREGRVIFDN
FT                   IRRFAAYLLACNLSEVMVIGLAVLSALPLPILPLQILYLNVVTDVFPAFALAMGEGRDD
FT                   ILKRPPRDPKEPILGRPQWVRIALHAAVMTAATFAALVVAEFWLALDRASVVTVTFLTL
FT                   AFAQLWQVFNMRASGSQAFRNEVTRNPWVWAALLLCTVLLVGPAYAPSLGTVLGLVPPD
FT                   LGMWVLILSASLMPLLLVQLGAMFAGMRKRDGQA"
FT   CDS_pept        289760..290620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0302"
FT                   /product="conserved protein of unknown function; putative
FT                   universal stress protein family"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0302"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21967"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7C837"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21967.1"
FT                   /translation="MTPHSSSQLAATRDILVCLTEEGRGDEAADALAYTLSLAGMAGAH
FT                   LTVQSAARRLTVVAGRAWGIVQDLVADENRRLRNLAQALAERSVSDAASAGVTCTAEAP
FT                   MLAYPDLIARLTARARLADLTILDAEARDADLDRDLIDGVLFRSGRPVIVVPSGWNSFR
FT                   ARRVVIAWDGSAQAARAANDALPFLRAAEAVEIVSVVGEKDLSTSVAGAEFAPHLARHG
FT                   VNVSVNVLPVAGDVAETLRTQVSLFRADMLVMGAYRHSRLQEWFLGGVTQSLLSRSPVP
FT                   LFLAH"
FT   CDS_pept        complement(290982..291305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0303"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0303"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21968"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:C7C838"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21968.1"
FT                   /translation="MNAHLAEISRAVDPGAHAVLILDGAGWHVAADLVVPDNITLLTLP
FT                   SHAPELNPVENVWQFMRENWLVDRIFASYEDILDQCCEAWNKLVAQPWIIMSLGLRQWA
FT                   YRL"
FT   CDS_pept        complement(291565..292029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0304"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0304"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21969"
FT                   /db_xref="GOA:C7C839"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:C7C839"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21969.1"
FT                   /translation="MDLREDFDADVLRRLARTSRDASQSRRLLALAAIYEGASRTQAAR
FT                   IGAVGLQTVRDWVLAFNAAGPDGLIERKKPGPRFKLDDAQRQALAAVIEEGPDLQRHGV
FT                   VRWRLKDLAAWLFERFGISLDESSVGREVKRMGYAKLSARPRHPSRTWRP"
FT   CDS_pept        complement(292124..292810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixK2"
FT                   /locus_tag="METD_I0305"
FT                   /product="nitrogen fixation transcriptional regulator
FT                   fixK2, Crp/Fnr family"
FT                   /function="5.6 : Nitrogen fixation"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0305"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21970"
FT                   /db_xref="GOA:C7C840"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C840"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21970.1"
FT                   /translation="MAPEITLLPASQVAASVVLGGQGGPVLFAGCPELIGTPFSYGREE
FT                   EVYGEGEDAEFVYKVIEGAVRTHKVLSDGRRQITGFHLPGDLFGFEQGETHRHTAEALT
FT                   DTKVLIFKRRQIERAATRSAEVACQLWGVAASSLRYAQDHMLLLGRRSAVERVATFLMD
FT                   VDQRLGGTGTFALPMTRRDIADYLGLTIETVSRTLSQLEEDGALQRTGGRQVSLRRARL
FT                   RRVVED"
FT   CDS_pept        complement(292934..293206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0306"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0306"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21971"
FT                   /db_xref="GOA:C7C841"
FT                   /db_xref="UniProtKB/TrEMBL:C7C841"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21971.1"
FT                   /translation="MSGAALDSPCLSLELRHVPDPVVLVVAASFTAGCAPVHALRRHAD
FT                   AVTLALGLLAYGLVTAIESLLAARFALIMVPDRASGWMYGTAGGG"
FT   CDS_pept        complement(293242..293322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0307"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0307"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21972"
FT                   /db_xref="UniProtKB/TrEMBL:C7C842"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21972.1"
FT                   /translation="MIGLAVATLAAFELWRLYVSPEARSV"
FT   CDS_pept        complement(293319..293534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0308"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0308"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21973"
FT                   /db_xref="GOA:C7C843"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:C7C843"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21973.1"
FT                   /translation="MAPWYLGLDSETAAASNAFISGGAIAVITVLALSKSYDREEYANL
FT                   AIGLWVAVAPWGLASQTAGRPCGRTS"
FT   CDS_pept        complement(293766..294089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0309"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0309"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21974"
FT                   /db_xref="UniProtKB/TrEMBL:C7C844"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21974.1"
FT                   /translation="MPPPPIRLLAATALAAGFEWSLPCPTGAEKQRPPRMIFPDASLLD
FT                   KDAEEFAVLRKLLKASRSRSPPRQPSWAGATSSSLSALHGLDPGQARKSGTETHFAGKL
FT                   AYN"
FT   CDS_pept        complement(294004..294216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0310"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0310"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21975"
FT                   /db_xref="UniProtKB/TrEMBL:C7C845"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21975.1"
FT                   /translation="MVAAEGASRFALSDRVIDAQVENAARQADAEINARVAIAAQRLAS
FT                   APDPAAGSDGARRRIRVVLALPYRR"
FT   CDS_pept        294379..294663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0311"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0311"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21976"
FT                   /db_xref="UniProtKB/TrEMBL:C7C846"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21976.1"
FT                   /translation="MDIPVTPLRVFTYISALGLVQAAASRESYLALVEVSPVVSVCLAG
FT                   HALLHPDGYPRIAIARHHPLQFSINSKIMTVHNAVAAISDCASMRPWCF"
FT   CDS_pept        294654..294839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0312"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0312"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21977"
FT                   /db_xref="UniProtKB/TrEMBL:C7C847"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21977.1"
FT                   /translation="MLLGTQWIFRDHGGECTCQAGNPDLAQGEPTDILEEASVCARSLD
FT                   PTTGAARVFLASSASG"
FT   CDS_pept        complement(294917..295036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0313"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0313"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21978"
FT                   /db_xref="UniProtKB/TrEMBL:C7C848"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21978.1"
FT                   /translation="MADWVAVLSRVSPSARAQAATLAVRQDDAVLNLLMFTLL"
FT   mobile_element  complement(295142..296029)
FT                   /mobile_element_type="insertion sequence:ISMdi17"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Insertion Sequence ISMdi17, IS5 family; Evidence 1a
FT                   : Function from experimental evidences in the studied
FT                   strain"
FT   CDS_pept        complement(295151..295933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0314"
FT                   /product="transposase of ISMdi17, IS5 family"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0314"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21979"
FT                   /db_xref="GOA:C7C849"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:C7C849"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21979.1"
FT                   /translation="MWTPAARAELARESLPYASSLTDAEWALIAPHLPRPSHTGRPWRW
FT                   PLRAILDGIQYVLRTGCAWRHLPLDFPPWSTVHRWFLRLSNAGVFERLAHAHPLADRER
FT                   VGREASPAGVGVAGERGYDPARRVVGRKRHALTDTDGRLLLATVSTAERHDSHGGVALL
FT                   RASRRLWPFLAHCFADQAYQGERVGSATAITVEILRPDKGQKGFAVQPRRWVIERTFGW
FT                   IARCRRRARDYEATPSSTIAFFVLAAAMILVRRLAQTL"
FT   mobile_element  complement(296144..297155)
FT                   /mobile_element_type="insertion sequence:ISMdi8"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Insertion Sequence ISMdi8, IS481 family; Evidence 1a
FT                   : Function from experimental evidences in the studied
FT                   strain"
FT   CDS_pept        complement(296144..297094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0315"
FT                   /product="transposase of ISMdi8, IS481 family"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0315"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21980"
FT                   /db_xref="GOA:C7C850"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7C850"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21980.1"
FT                   /translation="MGQVLHGSATTTEAVRRAIQLREESVRSLAKRYGVSPTTVQKWRK
FT                   RTSTADARMGPKEPRSTVLTVEEEAIVVAFRRHTLLPLDDCLYGLQPTIPHLTRSSLYR
FT                   CLERHGISRLPEIDGDKPKKQRFATYAIGYVHIDIAEVSTAEGKLRLFVAIDRTSKFAF
FT                   VRLVESAGKMEAAQFLRDFIDAVPYRIHTVLTDNGVQFTSRRQDIYDSQHIFDRVCDEH
FT                   DIEHRLTKVNHPWTNGQVERMNRTIKDATVKRYHYDSHDQLRTHLHLFVDAYNHARRLK
FT                   TLRGLTPTEFILNAWTKEPNRFRIDPSHLIPGPYT"
FT   mobile_element  complement(297156..298621)
FT                   /mobile_element_type="insertion sequence:ISMdi6"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Insertion Sequence ISMdi6, IS1182 family; Evidence 3
FT                   : Putative function from multiple computational evidences"
FT   CDS_pept        complement(297231..298565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0316"
FT                   /product="transposase of ISMdi6, IS1182 family"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0316"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21981"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C7C851"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21981.1"
FT                   /translation="MAKVFRSWNVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLSA
FT                   ILDTYTEERGYPPYHPGMMVALVLYGYSRGLYSSRQLARACEERVDVMAVTGLNRPDFR
FT                   TIADFRKRHLVALSDLFVQVLRLCRAAGLVEFAHVAVDGTKLKANASRHKAMSYGRMKT
FT                   AEPVLAAEVQAWLERAREADAAEDQAHGVDRRGDETPDWMADKQRRLEAIRAAKAALEA
FT                   EAADPPDPEDENGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRDGFVQG
FT                   YNGQIAVDAAHQVILAHRLVTNSADYRALVPLVDGVRAHLGRKPREVSGDAGFANEANL
FT                   VALQERGITGYLAPGRARHGEADAAGRRRLTKMPLMSAMAARLKRAGRRSRYRLRKQVV
FT                   EPVFGQIKQARGFRQFLLRGLDQVRSEWAMICTAHNLLKLAQARS"
FT   mobile_element  complement(298683..298808)
FT                   /mobile_element_type="insertion sequence:ISMdi11"
FT                   /function="17.3 : Transposon functions"
FT                   /note="fragment of Insertion Sequence ISMdi11(304-429,
FT                   Id=92.06%), IS481 family; Evidence 5 : Unknown function"
FT   CDS_pept        complement(299121..299513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0317"
FT                   /product="putative two component response regulator (FixJ
FT                   domain-like)"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0317"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21982"
FT                   /db_xref="GOA:C7C852"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7C852"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21982.1"
FT                   /translation="MSTPQPSPIYVVDDDPAVLHSLCFLLEGEGHRVEAFDSGACVLAA
FT                   FPGPEPHCIVVDYVMPAMDGIEVFRRLRALGVRAPVVLMTGDPGATVRRWAGEIGLPMI
FT                   EKPLAYEPLLAMLAAGSIVPGPETSP"
FT   CDS_pept        complement(299603..300211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixJ"
FT                   /locus_tag="METD_I0318"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family; putative nitrogen fixation transcriptional
FT                   regulator FixJ"
FT                   /function="9 : Transcription"
FT                   /function="9.3 : Transcription factors"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0318"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21983"
FT                   /db_xref="GOA:C7C853"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7C853"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21983.1"
FT                   /translation="MAHSLVHVVDDDPAMRDSVGFLLDTAGFEVALYQDGTRLLDTLVK
FT                   PARGCVLTDIRMPDVDGLELLRRLRAGGHMLPVVVMTGHGDVPLAVEAMKLGACDFIEK
FT                   PFDDEALLQTLYSALEQGQSSQSTDPALQEFVRRLGTLSERERQVFDQLVAGGTSKEIG
FT                   RALDISPRTVEIYRAKLMAKTQTNGLQELVRWAVLAGLA"
FT   CDS_pept        complement(300201..301751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fixL"
FT                   /locus_tag="METD_I0319"
FT                   /product="two component low oxygen sensor histidine kinase
FT                   with PAS domains; FixL"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0319"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21984"
FT                   /db_xref="GOA:C7C854"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7C854"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21984.1"
FT                   /translation="MTISFVSPSTDQGGNGTLTIDQLWQTLDEAGVCIWSLDIPTGRVT
FT                   ISPACARLFGVSPEQLTTFAATQALVHPEDRPARAEAIQRALREGGSYEVDYRAVRPDG
FT                   QVFWLRSRGRVALDADGRPAHHRGVVLTIHEQKQAEADLRAREAHLRSILDTVPEAMVV
FT                   IDEAGTIDSFSAAAERLFGYTAAEVIGQNVRMLMPEPMRGEHDGYLEHYRRTRERRIIG
FT                   TNRVVTGQRADGTTFPMELAIGEMRSGEQVFFTGFVNDLTEHQRTQQRLQELQSELVHV
FT                   SRLSAMGEMASTLAHELNQPLGAISNYTKGCRRLLANPGPEAIAKSMEVLDKTAEQALR
FT                   AGQIIRRLREFVTRGETERRLEPVSRLIEEASALALVGAREQGVAARIRIAPGLKAVLA
FT                   DRVQVQQVLVNLMRNAREAMQQSERREMAVDAHALSSEMVEISVSDTGPGIADEVADRL
FT                   FQPFVTTKVSGMGVGLSICRTIIEAHGGRLTVERNVAGGATFRLTLATASEGDTTNGT"
FT   CDS_pept        302072..302932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0320"
FT                   /product="conserved protein of unknown function; universal
FT                   stress protein UspA-like domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0320"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21985"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7C855"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21985.1"
FT                   /translation="MSKNLPSPLAAIRDVLVGTAVEGEREDASSAIGYGLTLAKAAGAH
FT                   LTVQSASWRLSGDDAWLGDFDYEGVAVIDRRLDALARSIADCSARDAAQAGVVCTTEVP
FT                   SLPYPDIVNRLAAGARLHDLTVLDAGPGTYDLDREMIEKALLYGGRPVIAVPPGHDAFA
FT                   ARRIIVAWDGSAQAARAANDALPFLRAAEAVEIVSVRDEAEIDEAVPGAEFAPHLARHG
FT                   VRISVNDLPKGESVAATLRTQAGLFRADMIVMGAYRRSPIREFFFGGVTRSLLRGSPTP
FT                   LFLAH"
FT   CDS_pept        302949..303161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0321"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0321"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21986"
FT                   /db_xref="UniProtKB/TrEMBL:C7C856"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21986.1"
FT                   /translation="MLKQRSSRCGAASRTARTRNVARRLSQSAPTHATPDEAPAQVRTS
FT                   NQPEWPAPLNEEELRALEAGWRFVE"
FT   CDS_pept        complement(303248..303583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0322"
FT                   /product="putative cytochrome c, class I"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0322"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21987"
FT                   /db_xref="GOA:C7C857"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C857"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21987.1"
FT                   /translation="MRRHALPLPVLTAVALSLLAALPIEARDASAVRGEAFAREHCARC
FT                   HALGRRGASTMREAPPFRTLAGRFPVDDLADVLAEGVDHRHPAMPDFRLDPTDAANLAV
FT                   YLKALRR"
FT   CDS_pept        complement(303583..304395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0323"
FT                   /product="conserved protein of unknown function; universal
FT                   stress protein UspA-like domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0323"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21988"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:C7C858"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21988.1"
FT                   /translation="MDYANILVSADLGDTSSDRVRLAAGLARRFDATLIGAAAHKVPAP
FT                   ILVRDVYDAIDQEERNKAEVLQILEEARALFERSAGEGIRTEWLAALAEPTTHLVEQAR
FT                   AADLVVVGRRGPEDEETGQLGVPPGPVLMEVGRPVLVVPPHLVQLKGTRIVVAWKDRPE
FT                   ARRAVTAALPFLRDADQVFVVTVGDDGGHEGAEAVTTHLARHGAHATTHLMRAARQESD
FT                   DILEFAQHQDADLVVMGAYGHSRLREWIFGGVTRDVLERSPICCLMSH"
FT   CDS_pept        complement(304490..306415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0324"
FT                   /product="putative cation transport P-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 11481432; Product type
FT                   t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0324"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21989"
FT                   /db_xref="GOA:C7C859"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7C859"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21989.1"
FT                   /translation="MMTTLTASLPGMRRSVAGWSPRLRRWLAVLPLSGLCAGLTAQALG
FT                   QIDIAATAWTLATLAVLAVLLTQVVTSLAKGDVGLDLVALLSMGGALALSQPLAGAVIA
FT                   LMYAGGQSLEAYASGRAGKAMTALVARQPRTALREDGGALTEVPLSALVPGDRILVRVG
FT                   DVVPVDGWVTTGSAVLDRSSLTGEALPVTFFANDPVLSGSVNVGTPFTLLAERPAAEST
FT                   YAGIVRLVEAAQSRKAPMARLADRYGLAFLGLTLLLAGGAWAIIGDPLRALAVLVVATP
FT                   CPLILAVPVALVSGLSRAAGIGVLIKGGGALETLARIRVLVIDKTGTLTHGSARLTSAR
FT                   TFTPFDEAEALRLAASLDQASGHPMARALVEEARRRGLTLSQPTKVTESPGDGVSGWVE
FT                   GRHILVGGPRLMRMHDVRFPRTDGAPRVVASVATVLVAAEGAPIAVLELADPLRNDGGR
FT                   TLAALRECGVARIVLATGDRRAVAETLVAKLPVDVVAADLDPTAKTDIVAAERRNGPVM
FT                   MVGDGVNDAPALAAADLGVALGARGAAAAAEAADVVLLVDSLAPLPHAIRIAQRARTIA
FT                   LQSVWVGLGLSLGGMVAAALGYLSPLQGALLQEAIDVAVILNAMRALGGPQDGREPTTQ
FT                   GVPRCP"
FT   mobile_element  complement(306792..307802)
FT                   /mobile_element_type="insertion sequence:ISMdi8"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Insertion Sequence ISMdi8, IS481 family; Evidence 3
FT                   : Putative function from multiple computational evidences"
FT   CDS_pept        complement(306792..307625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0325"
FT                   /product="transposase of ISMdi8, IS481 family"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0325"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21990"
FT                   /db_xref="GOA:C7C860"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:C7C860"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21990.1"
FT                   /translation="MQKWRKRTSTADARMGPKEPRSTVLTVEEEAIVVAFRRHTLLPLD
FT                   DCLYGLQPTIPHLTRSSLYRCLERHGISRLPEIDGDKPKKQRFATYAIGYVHIDIAEVS
FT                   TAEGKLRLFVAIDRTSKFAFVRLVESAGKMEAAQFLRDFIDAVPYRIHTVLTDNGVQFT
FT                   SRRQDIYDSQHIFDRVCDEHDIEHRLTKVNHPWTNGQVERMNRTIKDATVKRYHYDSHD
FT                   QLRTHLHLFVDAYNHARRLKTLRGLTPTEFILNAWTKEPNRFRIDPSHLIPGPYT"
FT   CDS_pept        308146..310359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0326"
FT                   /product="putative sensory box-containing diguanylate
FT                   cyclase/phosphodiesterase, PAS/PAC, GGDEF and EAL domains"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0326"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21991"
FT                   /db_xref="GOA:C7C861"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C7C861"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21991.1"
FT                   /translation="MIAVIACAGALYAFQRHAHPTVLPIWFGAVLVVCGWRVVATVRRN
FT                   ARPPRRTASASAMRNLIAEATLTVACLMSVPSWLLSQTTGTTYAILVCLLTGILWAGCL
FT                   TLATVRAAAMVYVGTGAAIVVIGLLWDNQDVEHLMLASLFPLGALTAMRSVDTQAKMFL
FT                   DNQRQQQSLTKQSDLIGLLLKDYEEQTSDWLWETDASLRYANPSDRFVEALGRPSHAIR
FT                   GVVLGSLLEDEEIAGNATARLEVRACAEARQPFRDMVVPFTRAGERRWWSISGRPVYDE
FT                   TRTFLGYRGVCSDVTTAKAAELRIAHLAHHDALTGLPNRTFLSESLHQSLRDPDRVCLA
FT                   VLSLDLDGFKAVNDRYGHPGGDALLVCVAERLQTKVSGGDIVARFGGDEFVVLNVAFTS
FT                   PSEVEDLAHRLIESLSTPIPLDNESVTIGVSIGIAFAPTDGRTAEELLKNADAALYRAK
FT                   TAGRGTFRFFEPEMDRKLQARQRLVQDLRNALTRDELRLDYQPFVRSETGVISGCEALL
FT                   RWRHPERGMISPAEFIPLAEESGLIVPIGMWVIQQACREAASWPSTHRISVNVSPVQFR
FT                   SRDLPQVILAALTSSGLAPARLEVEVTEAVLIDDADTALDILRQIRSLGVRVALDDFGT
FT                   GYSSLSYLRRFPFDKIKIDRSFVRELDTRHDSQVIVQAIHDMAQGLGMTVTAEGVETED
FT                   QAKRLRQTGCEELQGFLYSRPRPASELTFHHGEMSSETIRLRA"
FT   CDS_pept        complement(310593..310763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0327"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0327"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21992"
FT                   /db_xref="UniProtKB/TrEMBL:C7C862"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21992.1"
FT                   /translation="MEQAPSPLFDALVCLREASSNKGGHRVCSMALVQQAIEQTQAGVE
FT                   FADEHSGGGAR"
FT   CDS_pept        311020..311472
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0328"
FT                   /product="conserved protein of unknown function; putative
FT                   calcium-binding protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0328"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21993"
FT                   /db_xref="GOA:C7C863"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C7C863"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21993.1"
FT                   /translation="MMRDIHLEALEGSMGLTTLVQVTALTTLLAAASLSSADAQTSTGP
FT                   GVTPDRRVQPDQPGTMGPTMMGGMGGMGRSGMCGMMSHMMDGMPRGMMDDGPRMRMMFA
FT                   IADTDGDGSLSFDEVTAIHKRIFDAVDANKDGKVTPDELRKFFEER"
FT   CDS_pept        311743..312966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0329"
FT                   /product="putative RND efflux transporter, MFP subunit"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0329"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21994"
FT                   /db_xref="GOA:C7C864"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7C864"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21994.1"
FT                   /translation="MLKRLLIIPLAVVSGFLIATWWPAGPDALRALLTGPRHEHAIARP
FT                   EVKPASIPERSGLVRLSGEQVARAGIRVSPVGEGRLSRHLHVPGTIVPRADGTARIAVK
FT                   TTGTVVELRKGLGDKVAKGEVVALLDSREIADAKGEYLAARVTAALQKTLYERDKELWD
FT                   KRVSSEQQYLRSQASYQDLKVKEEAARRKLTFLGLSQAEIQALPNQPEAQFERQEIRSP
FT                   LSGKVVERRVDLGAAVGRDNLETELYSVVDLSTVWIDLAVSPSDLPLVREGQTVVVRVD
FT                   ATGQAARGRIVFIVPVLDQATRAARVVAELANPDEIWRPGSFVAAEIAISDKPVPVLIP
FT                   ATAIQTVEGKPTVFVRVADGFETRPVRLGRSDDDGVEVTAGLEPGEFIAVANTFTLKSE
FT                   LGKVAAED"
FT   CDS_pept        312970..316260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0330"
FT                   /product="RND efflux transporter, HME family, translocase
FT                   subunit"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 7766206; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0330"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21995"
FT                   /db_xref="GOA:C7C865"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7C865"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21995.1"
FT                   /translation="MIRSVLAFSVANRYAVILVTLIAAAFGAWSLARLPIDAVPDVTNN
FT                   QVQINVIAPALTPVEVEKQVTVLVERALAGTPGLESMRSFSRNGFAQLTAVFSDRVDVY
FT                   FARSQVNERLVEVRGTLPPGVEVRLGPISTGLGEIYWWAVEYQSPGEGSPVREGQPGWQ
FT                   PDGSYLTPEGERLSSDFERAVYLRTVQDWIVRPQMKSVPGVAGADAVGGFVKEYQVQPD
FT                   PMRLVGYGLSFADLTRAITANNVTRGANYVERNGEGYVVRAGGLIENVDQIRDIVVATR
FT                   NGVPILVKDVAEVGIGRELRTGSASENGHEVVLGTALMLIGENSRTVAAAADAKIREIN
FT                   RLLPPGIQVRTLLSRTDLVDATIKTVARNLAEGALLVIAVLFLALGNIRASLITALVIP
FT                   VTMMLTATGMLVGHISANLMSLGALDFGLIVDGAVIISENSLRHLAERQHELGRKLTQD
FT                   ERLTTVRVSAEEMIKPSVYGQAIIILVYVPLLTFTGVEGKTFAPMALTVLIALAAAFVL
FT                   SLTFVPAMIASMITGRVSEGDNALIRVLKAAYRPFLAGAIRAPLTYVAGAMVILGLAGV
FT                   LATRLGQEFTPTLDEKNIVLEARRIPSTAISQSQAMQLGVEEAMSKFPEMAFVYSRCGT
FT                   PDIAADPMPPNACDAYLILKPQSAWPDPKETKEALIGRMEAEARLIPGTLLGFSQPIQM
FT                   RFNELIAGVRDDLAVKVFGEEFGPMVEGAREIAGILRSLDGAADVKVEEAVGLPFLEIK
FT                   IDRREIARRGLSMADVQDVIGTAVGGKDAGLVYEGDRRFTIVVRLADNVRGDVEALKNL
FT                   PVPLPASQVAQGRTSTGVSAAAGPAAGSSVPLLQLASFTFTEGPNQVSRENGRRRVVVT
FT                   ANVRGRDIGSLVAEAQERIAAEVKLPAGYEVRWGGQFENLAAARQRLAVVVPACFALIL
FT                   ILLLGALGSVRDASIVFSAVPMALTGGVAALWLRDMPFSVSAAVGFIALSGVAVLNGLV
FT                   LLNHIRTLVANGMNVPEAVREGALTRLRPVVMTALVAALGFVPMALATGTGAEVQRPLA
FT                   TVVIGGLVSATLLTLLVLPALYTRFSRVTVKPAEDAPSAASGRLRPAA"
FT   CDS_pept        complement(316411..316707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0331"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0331"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21996"
FT                   /db_xref="GOA:C7C866"
FT                   /db_xref="UniProtKB/TrEMBL:C7C866"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21996.1"
FT                   /translation="MSPTAADWDARIDRLTGRLPRRVRDAVVWLRVPSRRPVRLMAALA
FT                   LIAGGMLSFLPILGLWMLPLGFALLSEDIPALKPRLEMAAQASERFLSRFRKS"
FT   CDS_pept        complement(316833..319127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0332"
FT                   /product="putative glycosyl hydrolase"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 11587643; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0332"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21997"
FT                   /db_xref="GOA:C7C867"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:C7C867"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21997.1"
FT                   /translation="MNLAGTLAEDMASEGDPTWLLRETGYELLRESTFETRFAISNGFL
FT                   GVRGGLAAHLGACRAIPPRFYVAGLFDTPTPDSVVPELVPAPDWTQVSILLPDGPLMRC
FT                   PDRSSRALTLDMRRGALVMEARQTCNAPLEVRLRSLRLVSLDARAIGMQVIELRIEGGV
FT                   SDLAFEAGLGPTDFELAPERAELDLKAWRTWRSGRSLAIAAAASLEVDGVERQPVARGD
FT                   LTWAWRWTAQPGQAVTFRRIVAVTRHHATDVNAGARARRELAAARTLGWRGILARHEAA
FT                   WAERWRCSDIRVTGDPAAQAALRFAIFHLNGAANPDDPHVSVAARALTGDDYRGHVFWD
FT                   TEIFLVPFYALTWPEAARTLLMYRFRTLDAAREKAARMGWRGALYAWESADTGAEVTPH
FT                   QTVGPDRKILDILCGSQEQHISADVAYAVWQYWQANEDEAFLQEAGAEILLETARFWAS
FT                   RATGEADGLRHIRGVIGPDEYHERVDDNAFTNVMARWNIARGLDIAALLRERWPDTWER
FT                   LARSLDLGEPELAKWGEAAETIATGRDPATGLYEQFAGFLALEAVDLNAFAERSVPMDV
FT                   VLGRERTQRAQVIKQADVVALLALLPEAFPGTSGGINFDHYEPRCGHGSSLSRVMHGLA
FT                   AARLGRPEAALGYFHRSAAIDLADTHVAIGGGIHIAALGGLWLMAIFGFAGLSLGANGL
FT                   AFDPRLPASWHGLDFRIRWRGRELAVAIDGKNRELRVTLDRGDPMTVFAGGTAFVIAMD
FT                   NPLVVRLPVDG"
FT   CDS_pept        complement(319124..319894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0333"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /function="6.11 : Sugars"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0333"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21998"
FT                   /db_xref="GOA:C7C868"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7C868"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21998.1"
FT                   /translation="MRPNVCSRRRESDGMTRPPITCRLRTPAFIFDVDGVLLASPHERA
FT                   WREALAGFADPLLFTTALYQAQVAGRARLDGARAALAALGLADAGNRAPAYAAAKQRCL
FT                   ERIVATEGVTAFPDALRFVRALADRDWSLAAASSSKNAEAMMRAVPLNAGRTLLDAFAA
FT                   RVCGRALRHSKPNPEIFLLAAAELRAAPAYCFVAEDAPVGIRAARAGGMTAIGIARLGD
FT                   ANGLRAAGADRVVTSFDEIRVGDLTPPHSSGDAT"
FT   CDS_pept        319920..320309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0334"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0334"
FT                   /db_xref="EnsemblGenomes-Tr:CAX21999"
FT                   /db_xref="UniProtKB/TrEMBL:C7C869"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX21999.1"
FT                   /translation="MPCSGSRLRRRRPCKRPGVRSRRRAAPGCSHTCFARRRPGVQGST
FT                   NMNSWALTPLFALAASAPLAQAQTVSRSPDAAPTFIEPTDAPHRHCAGACLKSGTLQWF
FT                   CRPDQTCSLDCNTSPPYRHCHDPRP"
FT   CDS_pept        321047..321370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0335"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0335"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22000"
FT                   /db_xref="GOA:C7C870"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C870"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22000.1"
FT                   /translation="MDDVTPTDLLRLQDKAADAARMLRLLANEKRLLILCLLVARGEMD
FT                   VTSLAEAVELSQSALSQHLAKLREDGLVAFRRESQTLYYRLEDPRAARLLATLKDIFCP
FT                   DMD"
FT   CDS_pept        complement(321758..323071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0337"
FT                   /product="putative integral membrane sensor signal
FT                   transduction histidine kinase precursor"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0337"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22001"
FT                   /db_xref="GOA:C7C871"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7C871"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22001.1"
FT                   /translation="MKSLRVRLFGILLLATGLIWLSAVAWIYLGSKREVEQVLDNRLQE
FT                   AARMVSSLVGAVGGTASDGTPRTFPAPTAYERQLSCQIWSLDGRMVARSSGAPERRLTD
FT                   APAGFSEREVDGETWRVFTVEDSEKGVRVLVGDRLSLRERLVTDLIMGLLTPALLVVPL
FT                   LGMLIWVSLGRGLRPLRLMARNLAARDADDMSAIDAGQAPTEVRPLADALNGLFLKVEA
FT                   ARRHEREVTAFAAHELRTPLAGLKTQAQVAMAATDPEVAKAALRQILAAVDRTTRLVRQ
FT                   LLDAARLDAEETRPLTLIDVGALVAEAVEGMRVPAEIRTVVDPELHGYTMRADPESLRL
FT                   AVRNLHENAVQHMQAGLVEWAPRPGGEGIVVRDEGPGIPEEELLHVTKRFFRGRHKSAT
FT                   GSGLGLAIAEMASRRSGLSLRLHNRSDRQGLEAEILRG"
FT   CDS_pept        complement(323068..323730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0338"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0338"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22002"
FT                   /db_xref="GOA:C7C872"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7C872"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22002.1"
FT                   /translation="MRILVVEDDPILSDGLRAGLGLSGATVECVATCADADAALAASGF
FT                   GAVVLDLMLPDGSGLDVLRGLRERGDRTPVVLLTARDAVADRIAGLDGGADDYLGKPFD
FT                   LDELAARIRAVVRRASGRASACLEHAGIRLDPAELTVTLHGEPVPVSRREFMVLTALME
FT                   RPNVLRSKAELEERLYGWQEEVESNTVEVHVHNLRAKIGKHAIETVRGLGYRMRATA"
FT   CDS_pept        323838..325247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0339"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0339"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22003"
FT                   /db_xref="GOA:C7C873"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:C7C873"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22003.1"
FT                   /translation="MPNVLANVILAVLVWAGSSLWSPGHCREPAARQAPFTLDVTRDED
FT                   LSLRLRWTIAPGTYLYRDKIGASDGSGRELPVTTAAGETKDDPNFGATEVYHGAAEAVV
FT                   PGAALVGVRDVRVTYQGCADRGIRYPPVTRVVEVPAPGPQVAAVPANPAVPASGPPIDT
FT                   NAETGSGLLSGHLAGVLATFLGLGLLLAFTPYVLPMVPVLAGMLTRSGERLTAGRGFVL
FT                   SGTYALAMALAYGTLGVVAAWSGRNLQVALQTPVALGLLAATFAALALSMFGAFDLALP
FT                   TGAAARLSRLSGRRLGPLGGAAVMGFTSALIVGPCVTPPLAAALLYVAQTGDVARGASA
FT                   LFALGLGMGLPLVAFGTFGAGILPKSGPWLVSAKQAFGVVFLGLTITMVSRLRATRGYA
FT                   RALGPVGRRHRRVRRGLRRPCGRRRCRRAAGQERRNRRGDLWLHPRRRRLGGQNRPAQA
FT                   ARRLRSGPSRA"
FT   CDS_pept        325015..325611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0340"
FT                   /product="putative thiol:disulfide interchange protein"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0340"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22004"
FT                   /db_xref="GOA:C7C874"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7C874"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22004.1"
FT                   /translation="MPPEVTLALWGLLAVGIGVFVGAFDVLAAGAGAVGRLGKSGGIVA
FT                   VTYGCTLVVGASAGRTDPLRPLAGFGQAQAVHDADTRVVASLPAFETALQAARAAGKPV
FT                   LVEFAADWCTVCKTNERTVMADAGIRERLKAVSVIRADVTRDDADTRALMRRFAVVGPP
FT                   TLILMRPDGDEVREARTEGALTVEDLTRRLALVGA"
FT   CDS_pept        325645..326280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0341"
FT                   /product="putative thioredoxin domain protein precursor"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0341"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22005"
FT                   /db_xref="GOA:C7C875"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7C875"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22005.1"
FT                   /translation="MDRRTLLALLPAVALAPALLSLAPHTEEAFAQGSDANAILNDPEA
FT                   PISGNPKGDLTIVAFLDYNCPFCKKAEPELTRLVKADGRIRVVHKDWPILGDASVYGAQ
FT                   IALAAKYQGRYDEVHRALMGIPGRKIPKERMLEVVSASGVDMARLEEDRRAHQAEIGAL
FT                   LQRNLDQADALGLQGTPVFLIGPLKVAAALDYDGFKQAVAQARAKGRS"
FT   CDS_pept        326277..327128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0342"
FT                   /product="putative L,D-transpeptidase catalytic domain
FT                   (YkuD)"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 16647082, 18456808,
FT                   17369299; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0342"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22006"
FT                   /db_xref="GOA:C7C876"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C7C876"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22006.1"
FT                   /translation="MMRRVSRLSALMALASALGACTASMGAPAPVAEARPQIAPDALRR
FT                   YAAITDEPFPVEAIDPRDLKARNVRQVVDYPTKEPPGTLVVDPYRRFLYLVMEGGKAMR
FT                   YGVGVGKAGFEFTGEATVARKASWPRWTPTPDMIRRDPARNGRWAGGMPGGDRNPLGAR
FT                   ALYLFKDGKDTLYRIHGTTEPWSIGEAVSSGCIRMLNQDVIDLHRRVPTGTKVVVLGSR
FT                   GTSHATRQVAPETTGSLGSGASAGPEPDDGLDHARLDSLSARASEAPEPFTDDGEPDDD
FT                   GL"
FT   CDS_pept        327112..327576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0343"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0343"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22007"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:C7C877"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22007.1"
FT                   /translation="MTTVFRSLALAVLLATLGMGTAHAGSEAPAGYYANQKVVYHNGGG
FT                   PDGVAYFKRLLGNLRNHVDAVGKDHVEIRVVSLGDGLALFQAAAEDKELAGRIDTLKAA
FT                   GVRFLFCANTLRERKIDRGALYAVGDDDIVPSGVAELARLQGMGFAYIHP"
FT   CDS_pept        complement(327612..328070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0344"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0344"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22008"
FT                   /db_xref="UniProtKB/TrEMBL:C7C878"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22008.1"
FT                   /translation="MIPGTAERVSLHTGARDNRRIAADLDASVRWHAEHPQDIGRRLRE
FT                   LDAEWDIERMLEANAATLALTGTVLGLTTDRRWLALPLAVTAFLLQHAVQGWCPPLPVL
FT                   RRLGFRTAREIEVERNALKALRGDFGPIGPGPGDHDMRASHALMAARL"
FT   CDS_pept        328235..328660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0345"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein precursor"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0345"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22009"
FT                   /db_xref="GOA:C7C879"
FT                   /db_xref="UniProtKB/TrEMBL:C7C879"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22009.1"
FT                   /translation="MDSFTPLSALLGGGLIGASAALLLLLNGRIAGISGILGGLLALPS
FT                   RETGWRAAFLTGLVLAPLVYAGLGGNLPAVTVDASFPLLVVAGLLVGFGARLGAGCTSG
FT                   HGVCGIGRGSPRSLVATGTFMAVAILTVLVTRHLLGA"
FT   CDS_pept        328664..329113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0346"
FT                   /product="conserved membrane protein precursor of unknown
FT                   function, DUF395, YeeE/YedE"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0346"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22010"
FT                   /db_xref="GOA:C7C880"
FT                   /db_xref="UniProtKB/TrEMBL:C7C880"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22010.1"
FT                   /translation="MAKTVSAFAVGLLFGIGLLVSGMANPAKVLAFLDVTGHWDPSLAF
FT                   VMAGAVAVSAAGYRVARRRGRPVLAPRLDIPNRRDLDPRLLVGAALFGVGWGLVGLCPG
FT                   PALTILSVVPAPAATFVAAMAVGMLMFRLVPPATSNPKAGRGADA"
FT   CDS_pept        329113..329919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0347"
FT                   /product="putative exporter, TauE/SafE family"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 17586627; Product type
FT                   t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0347"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22011"
FT                   /db_xref="GOA:C7C881"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:C7C881"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22011.1"
FT                   /translation="MPGLLTSGLATGSGGVVGVILGLVGGGGSILAVPLLTYVVGVSSP
FT                   HVAIGTSALAVSVSAAGNLIPQWRAGNVKWRCAVAFSLAGILGALAGSAAAKAVDGQSL
FT                   LALFGVVMLVVGGLMLRKRRGEGDPEVRLTKASAPVLLPWLLGIGFAVGLFSGFFGIGG
FT                   GFLIVPGLMLATSMPLSMAIGTSLVAVSAFGAATAASYAVSGLINWPVAGLFILGGVLG
FT                   GLVGARLGKRLAGHKRALTVTFAGLVILVGLYVVARGALPLLGATT"
FT   CDS_pept        329937..330848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0348"
FT                   /product="beta-lactamase domain protein, putative
FT                   hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0348"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22012"
FT                   /db_xref="GOA:C7C882"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7C882"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22012.1"
FT                   /translation="MSDQTATPLRGHPIVTGFYDEPTGSIQYVVADPETKRCAIIDPVL
FT                   DFDPKSGATATRSANALLAHIEREGYELEWILDTHPHADHFSAAGYLHDETGVPTAIGE
FT                   KVVEVQRLWKGLYNLPDTFRTDGSQWDRLFADGERFRIGNLDVEVMFTPGHTLASIAYR
FT                   VGDAAFIHDTLFMPDSGTARADFPGGNAHALWRSIQRIMALPDGTRLFTGHDYRPGGRK
FT                   AAWESTVARQQAENKHLTETGTEEAFVRMREARDRALPMPKLILHSLQVNVCGGRLPEP
FT                   EANGRRYLKIPLDALEGAAWDE"
FT   CDS_pept        complement(331090..331533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0349"
FT                   /product="putative protein disulfide reductase/isomerase,
FT                   putative thioredoxin"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 8652661; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0349"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22013"
FT                   /db_xref="GOA:C7C883"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C7C883"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22013.1"
FT                   /translation="MTGDGARHIVCPHCTRTNRIRNDRPALAGRCGACHQPLFIGRPIA
FT                   VDEAAFEKHRSGNDIPILLDVWAPWCGPCQAMAPMFERAAGLLEPDLRLLKLNSDESPQ
FT                   VAAELGVRGIPALFLIERERVRARTTGVMDVTRIVTWARSQLG"
FT   CDS_pept        complement(331650..332534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0350"
FT                   /product="beta-lactamase domain protein"
FT                   /EC_number="3.1.2.6"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0350"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22014"
FT                   /db_xref="GOA:C7C884"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7C884"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22014.1"
FT                   /translation="MPEPIIRAFFDEPTNTVSYIVADPETKQAAFIDPVLDYDHAAGTA
FT                   DTRSVEAMLKAATEAGYSVVWTLETHAHADHLSGSPYVKAKTGAKIGIGEHIKEVQEIF
FT                   RPVFNATDLKTDGSDFDRLFADGETFAIGSLTVEVLYTPGHTPADICYKIGDIVFVGDT
FT                   LFMPDYGTARADFPGGDVHKLYRSIRRLLALSPETRLFMCHDYKAPGRDSYAWETTVAE
FT                   ERVGNIHVREGVSEEAFTAIRTARDATLAAPRLLLPSIQVNIRAGKFPPAEANGVRYLT
FT                   IPVRLTGGAEALV"
FT   CDS_pept        complement(332572..332784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0351"
FT                   /product="conserved protein of unknown function, putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0351"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22015"
FT                   /db_xref="GOA:C7C885"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:C7C885"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22015.1"
FT                   /translation="MNANVGSIDRLLRLVAGLILAGFGLGLLTETWSWIALGAGVILAL
FT                   TALVGFCPAYRLLGINTCQRRLPSV"
FT   CDS_pept        complement(333170..335275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0352"
FT                   /product="methyl-accepting chemotaxis receptor/sensory
FT                   transducer precursor; histidine kinase HAMP domain"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 11114914; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0352"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22016"
FT                   /db_xref="GOA:C7C886"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C7C886"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22016.1"
FT                   /translation="MASMRFSPKIGTTLQVLFGSMTALVVVAVGTPIYREVQKLRESAA
FT                   VTQVAEAGYEVFTALQNTRTQRGPVRVALEAGALASDAFRSSLVTARQKADPATARVIA
FT                   LCASVDCTSGRPDIAAGLPASVERFAALQKEADIALTLPLEQRRVSLSREYNAAATEVI
FT                   DRLEKMSVALGEAIRMVDTTTAELMAVKQAAWLARDGIGLERTILAEVRSKGEVSPEAD
FT                   RKMADLRGRALVNWSVLNELLARPDAPSELVALARTAKAVTFGSYERVRAAAYEDAAAK
FT                   RPPSIGNDELDRLGNEGLDALSAIPNAVMSMARTHAEARQSTAVSRLAGEIGLLAAALI
FT                   LAVVGFVIVRWRVTGPITGITGVMRRLAGGDLEVEVAGAQRRDEVGEMARAVQVFKDGL
FT                   IRMRILEAETALARASAEEQRKATLRDMAGRLEQAVGGIVGMVSSSATELQATAQQMTA
FT                   TAAQTAVQSTTVAAAAEEAASNVNTVAAAAEELGASVREIGRQVDGSTSLAHVAVGEAN
FT                   QSAALVQELSGAVARIGDVVTLISSIASQTNLLALNATIEAARAGEAGRGFAVVAAEVK
FT                   ELASQTARATDEISRQIGHIQGSTEQAVQAIGGISARIREIADVATSIAAAVEEQGAAT
FT                   QEIVRNVAQAAAGTGEVTGNIAGVAGAAEETGAAASQVLGAASELSRQSEQLTEEVDRF
FT                   LTMVRAA"
FT   CDS_pept        335773..336582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phnC"
FT                   /locus_tag="METD_I0353"
FT                   /product="phosphonate transport protein (ABC superfamily,
FT                   atp_bind)"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 1840580, 2155230, 9650256;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0353"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22017"
FT                   /db_xref="GOA:C7C887"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7C887"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22017.1"
FT                   /translation="MLALESLEVTYPGGIKALRPTTLTFREGEFAVLLGPSGAGKSTLL
FT                   RCLNGLVRPTNGRVSAPGVGDIAASRATLRRHRAVTGMVFQHHHLIGRLTALANVLMGR
FT                   LGHQSTLRSLWRPSWSDQRFGLEALERVDLLDRALTRVDLLSGGQQQRVGIARAVAQRP
FT                   RLILADEPVASLDPATATRVLDLLRSICRTDGISAVVSLHQVDLARHFADRVVGVRGGE
FT                   VVFDGPPARLCDGVLSRIYGARPAEVPVDVVEASRARRAAIYASRTA"
FT   CDS_pept        336595..337467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxB"
FT                   /locus_tag="METD_I0354"
FT                   /product="putative phosphonate transport system
FT                   substrate-binding protein"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 9791102; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0354"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22018"
FT                   /db_xref="GOA:C7C888"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="UniProtKB/TrEMBL:C7C888"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22018.1"
FT                   /translation="MISRRTFGAGLALSAVLRAGPSLAQGANPDTLKVALLPDESASTI
FT                   IQNNQGLKSYLEQGLGKRIELVVTTDYSSMIEAMRFKRIDLAYFGPLSYVLAKSRSPEI
FT                   EPFAALVSGGQPTYTSYLIANVAAGIARADDVKGKTVGFGDTASTSSHLIPRALLKNAG
FT                   LEAGQDYSFQHLGTHDAVARAVQAGHVQAGGLSRPIFTALVEKKSIDPAKIKVVAESRP
FT                   IPNYPWTVRGDLAPDLKEKIKAAFLEIRDPVILKPFKAESFASITDADYDVLRETAKLL
FT                   NIDLTKVKG"
FT   CDS_pept        337471..338304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxC"
FT                   /locus_tag="METD_I0355"
FT                   /product="putative phosphate permease component of
FT                   ATP-dependent phosphate uptake system"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 9791102; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0355"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22019"
FT                   /db_xref="GOA:C7C889"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7C889"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22019.1"
FT                   /translation="MARAPSLASAVGAADGYDAILGRARGASVRRLMVALPAAAAILAC
FT                   LWKVGLLDPGRLAEGAPAMAQLLGEMTPPDFTRWRSWAGPIVDTLAMSVAGTVLAVTLS
FT                   LPLGLLAAPNTSPHPFVYGAFRLLLNALRSVPELIMGIFFVAAVGFGALPGVLALGLHS
FT                   TGMVGKFFAEAIEHVDHKPIEAARAAGASPLQVVTHAVLPQVLPQLTDTTLYRWEYNFR
FT                   ASTVLGVVGAGGIGFELIASLRLLQYDQVAAIMLCILAAVTLVDALGGALRRRLK"
FT   CDS_pept        338313..339332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ptxD"
FT                   /locus_tag="METD_I0356"
FT                   /product="Phosphonate dehydrogenase (NAD-dependent
FT                   phosphite dehydrogenase)"
FT                   /EC_number="1.20.1.1"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 11278981, 9791102; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0356"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22020"
FT                   /db_xref="GOA:C7C890"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C890"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22020.1"
FT                   /translation="MRFKVVVTNPVFPETREILEGLCDVDINPGPEPWPAAEVRARCSD
FT                   ADALLAFMTDCVDAGFLEACPRLKVVACALKGWDNFDVEACTRSGIWLTAVPDLLTEPT
FT                   AELAVGLAIGLCRNVVAGDRAVRAGFDGWRPRLYGSGLYGSVVGVAGMGKVGRAITRRL
FT                   KGFGARELLYFDEQALPASAEAELGACRVSWDTLVGRSDVLILALPLTPDTRHMLDAAA
FT                   LAAASPGLRIVNAGRGSVVDEAAVAEALAEGRLGGYAADVFEMEDWALDDRPRRIAPGL
FT                   LTVEDRTLFTPHLGSGVVDTRRRIEAAAAHNLLDALKGLVPADSINHPESLRGFDGAN"
FT   CDS_pept        339358..340218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0357"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 15640200; Product type
FT                   r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0357"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22021"
FT                   /db_xref="GOA:C7C891"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C891"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22021.1"
FT                   /translation="MLNLQYVETLLAVLATGSFHAAGRYLNLSQPTVSQHVRKLETALR
FT                   ATLVERDPAGCRPTPQGRALLPHAEALIRISRRAEEAVAGSRLAIGASGNIGTFLMPEI
FT                   LRRYEETHAATADAEIANNPHLIARLEAGEIDVALLEWWESRTGLDAHVWRREPLVVIV
FT                   DPDHRWAGRAHLTPQDLTGASLLGGEPGSGTGRVLREALGAVGAGFRLDRQLGSTEAVK
FT                   RAVRARLGISIVMACSVQDEVRNGVLAALPVEGIELSKNLFAAYRDPLPETARASSFLT
FT                   VLTAH"
FT   CDS_pept        340552..340674
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0359"
FT                   /note="Evidence 5 : Unknown function; Product type e :
FT                   enzyme;putative diguanylate cyclase (GGDEF domain)
FT                   (fragment)"
FT                   /db_xref="PSEUDO:CAX22022.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        340687..340824
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0360"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme;putative
FT                   diguanylate cyclase (GGDEF domain) (fragment)"
FT                   /db_xref="PSEUDO:CAX22023.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        340834..341001
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0361"
FT                   /note="Evidence 5 : Unknown function; Product type e :
FT                   enzyme;putative diguanylate cyclase (GGDEF domain)
FT                   (fragment)"
FT                   /db_xref="PSEUDO:CAX22024.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(341136..341948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0362"
FT                   /product="putative cytochrome c"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 7619830; Product type c
FT                   : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0362"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22025"
FT                   /db_xref="GOA:C7C895"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C895"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22025.1"
FT                   /translation="MSDERLLSPKNPWFIGSVGITAGLLAATALGGFVLLPYAQPDLKL
FT                   AGIWDAICSAAGVPKAPSAAEPVRPDGKLTQVVVTSALPSAADPDAVGRGATLAQQCAI
FT                   CHGPTGVSRADSPNLAGQYAPAVYKQLADFKAGVRVNATMTPFAVDLSDRDMADLAAYY
FT                   AYLPRLPGFHPASDKPPPRIVINGAPLRNIAPCGSCHGVLDNKTGSPWLEGQPAAYVKA
FT                   QLQAFASGARRNDISQQMRNVARRMTPEEIDQAAEWYASQPSTNVHTK"
FT   CDS_pept        complement(341945..343567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0363"
FT                   /product="putative Cytochrome c oxidase, subunit I"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 10775261; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0363"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22026"
FT                   /db_xref="GOA:C7C896"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:C7C896"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22026.1"
FT                   /translation="MLSSRRLVLAHFWLAFAVFGLSLLLGAWQMFIRSPLHTWISNPEW
FT                   YYRSLTAHGTVMGYVFPTLVAMGFGYAISEISLKQRLIGLRWAWAGYWLVVVGAVMAMV
FT                   PVSLGRASVLYTFYPPLIGSPFYYLGVVLVVVGSWIWVALMSVNLRAWKKANPGTPVPL
FT                   PMFANVAGSYLWAWTAVGAALELILQILPVAFGLRSTIDAGLSRVFFSWTLHAIVYFWL
FT                   MPTYIAYYTIVPRAIGGKIYSDTMARISFILFLVVAMPIGMHHTFADPQVGAGFKFIHS
FT                   AFTALVALPTLLTVFTICASVEIAARLRGGRGPFGWIKVLPWSNPMMLAVAFSFVMLGF
FT                   GGAGGLINMSYQLDASIHNTQWITGHFHLIFGGAIVIMYFAIAYDLWPHLTGRALGDLR
FT                   LMRTQLWLWFAGMIVTTFPWHWVGILGMPRRMAYFDYGDPAVATQAFSVTLSAIGGFIL
FT                   VASGALFILVLVRGHRAPREDAGSYRFAQALHPPLTVPALNGYALWVALMVGLTVTNYG
FT                   FPIAQLALRDDTSVPAVYVGANP"
FT   CDS_pept        complement(343557..344120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0364"
FT                   /product="putative cytochrome c oxidase, subunit II (cbaB)"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 10775261; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0364"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22027"
FT                   /db_xref="GOA:C7C897"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:C7C897"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22027.1"
FT                   /translation="MTTHDHVDEGARVAERVERRWAILSIGIIVLLAGLAAFAGIHRAT
FT                   MPQARVETVRPQTIHLAGEFVESNLGSAVEPDGSVTVRAVGQQYSFTPQCMVVPTDTPV
FT                   VFRATSPDVIHGFLIQKTNVNTMLVPGYVSEIPARFSKPGEYLMPCQEYCGVGHEGMWA
FT                   KVKVVDKPEFLSMVSASRRVTCVE"
FT   CDS_pept        complement(344133..344309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0365"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0365"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22028"
FT                   /db_xref="GOA:C7C898"
FT                   /db_xref="UniProtKB/TrEMBL:C7C898"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22028.1"
FT                   /translation="MLNAPPLQHRDEEAERRDVAAAVRAGPSGAVTVAAIATAIVVACW
FT                   FAFYLFVFLPRGS"
FT   CDS_pept        complement(344314..345570)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0366"
FT                   /product="putative cytochrome c, putative exported protein"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.11 : Sugars"
FT                   /EC_number="1.1.99.3"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 9352901; Product type c
FT                   : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0366"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22029"
FT                   /db_xref="GOA:C7C899"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR014353"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C899"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22029.1"
FT                   /translation="MSDLARRTIPALLAALLGAAAEAQTAPAVRPDAGVLAKGEYLARA
FT                   GDCIACHTAPEGKPFAGGRSMATPFGTLFTSNITPDPETGIGKWTADQFYQMMHTGRSP
FT                   DGGLLYPAMPFGSYTKVTRADSDAIYAYLMSVPPVGQANRPHDLRFPYNNRQLILGWRT
FT                   LFFREGEFKPDPKQSEEWNRGAYLVEGLGHCGMCHTPINALGGNSESQAFQGGLIPMQN
FT                   WYAPSLTSNREAGVGDWTIEEISDLLRTGVSRRGAVYGPMAEVTYNSLQHLTPEDTRAM
FT                   AVYLKSLGQEVPPPVTSRVPTAESSLLLSLGKTVYDGQCASCHGAQGQGKPPHYPPLAG
FT                   NQSIQMSSAVNAIRMVLNGGYPPGTQGNPRPYGMPPFAQSLSDNEVAAVVTYIRTTWGN
FT                   HGAAVTAQEANQLRSAPLD"
FT   CDS_pept        complement(345582..346181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0367"
FT                   /product="putative cytochrome c"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.9.3.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0367"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22030"
FT                   /db_xref="GOA:C7C8A0"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C7C8A0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22030.1"
FT                   /translation="MLACAPCHGAQGEGTRDPYFPRLAGKPAGYLFNQLVAFRNGRRHY
FT                   PPMNYLLAYLPEAYLKDMAEYLASLNPPLPPPAVPSAGEEVLATGRRLVTQGDASRNIP
FT                   ACTSCHGADLTGMEPGIPGLLGLRPNYISAQLGAWRYGTRTALSPDCMQVVAGHLTDAD
FT                   VTAVTAWLSSRPAPEERRSVPQGTYALPFACGSQPQ"
FT   CDS_pept        346671..347360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0368"
FT                   /product="putative transcriptional regulator, Crp/Fnr
FT                   family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 11882718, 8759861;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0368"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22031"
FT                   /db_xref="GOA:C7C965"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C965"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22031.1"
FT                   /translation="MDQAPRRIRAAAGGLLSGLDQEAADALLETATDRQIAEGSALFHQ
FT                   GDAPSHLFQVATGLVKLSRVDPHGEQTTLRFMGPGELVGCVAVFQQFPFPATATASKPT
FT                   SVLCWGAAQVLDLIRRYPAVSANALKTAGDRAREMVERVTELSAMSVEARIASVLLRLA
FT                   AQVGRTCSVGVEVASPVTRHDLAEMTGLTYFTVSRVLSAWQKRGIVRLGRERITVVEPG
FT                   RLAEIAN"
FT   CDS_pept        347567..347797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0369"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0369"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22032"
FT                   /db_xref="UniProtKB/TrEMBL:C7C966"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22032.1"
FT                   /translation="MFFFDVCDRGRLETDETGLELASAEATYLEACAAIPGLTAELLRA
FT                   GDQAVGYSFVVTNEAGRVLFEIPFHEILGRP"
FT   CDS_pept        complement(347733..348056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0370"
FT                   /product="protein of unknown function; putative domain
FT                   coil"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0370"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22033"
FT                   /db_xref="UniProtKB/TrEMBL:C7C967"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22033.1"
FT                   /translation="MAGSVRCRIVDMPDGRFAVMALLASGKVFRRKALATLAEAEEAVE
FT                   CLRDVMAACGAPVIVEVSAWCGARSGYRIGQAAGGERGLDVSKACLGSRGTGSRTRPVL
FT                   PRS"
FT   CDS_pept        complement(348081..348326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0371"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0371"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22034"
FT                   /db_xref="UniProtKB/TrEMBL:C7C968"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22034.1"
FT                   /translation="MCNPFCAAFLLAVEAQRVIELRLVRLAWGGAEAQAEMVSMVGEKV
FT                   VAAMEAANTLMTGGSHDQVIARYRELVADNTRRLTA"
FT   CDS_pept        348595..348990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0372"
FT                   /product="Putative Response regulator; CheY-like protein"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0372"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22035"
FT                   /db_xref="GOA:C7C969"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7C969"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22035.1"
FT                   /translation="MQDADRALCVLVVEDNLDVGRFCTPLLEDLGHATVWAHNAEAALA
FT                   GMERVPFRFDAVFSDVVMPGIGGVELASRLRADHPKLPVVLTTGYSDVLARDEAHGFEL
FT                   VRKPYSAEQVARALRGAVTKRGRQPPA"
FT   CDS_pept        349296..349742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0373"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0373"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22036"
FT                   /db_xref="UniProtKB/TrEMBL:C7C970"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22036.1"
FT                   /translation="MRSTSARILKGLHEGFVLQVFVDQGGRDPDIYCLMTWQVDEVEGK
FT                   PYLRTERVAEGYRKGFSNAAADDLGMDGLIAWLPNTGTNALHALTPAGLAEAQALYGPI
FT                   AAKVLVKREAGAELVSPNPDGAAAVPAGTINVPDLTEDDVAPTP"
FT   CDS_pept        349865..350194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0374"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0374"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22037"
FT                   /db_xref="UniProtKB/TrEMBL:C7C971"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22037.1"
FT                   /translation="MTVEDYARRPVVSPVAGSKALPGSAVARLRAATDEHPEAGHEVAG
FT                   GLTDSLYKVIGGGGRKRLASPPRTRCRPRLRDLPTYIWPSAAADRPTTVPARNAPAHDY
FT                   WAPTC"
FT   CDS_pept        complement(350423..350635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0375"
FT                   /product="protein of unknown function precursor,
FT                   FAD/NAD(P)-binding domain"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0375"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22038"
FT                   /db_xref="UniProtKB/TrEMBL:C7C972"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22038.1"
FT                   /translation="MKKLVVIVGSLLAGLMSALALALASSEVTTVGRSEDAGGADARRK
FT                   TAQTGAALRAHLRSAAARDPRIAIP"
FT   CDS_pept        complement(350656..350970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0376"
FT                   /product="conserved protein of unknown function; Putative
FT                   domains: Antibiotic biosynthesis monooxygenase and Dimeric
FT                   alpha+beta barrel"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0376"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22039"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C7C973"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22039.1"
FT                   /translation="MTTAKSEERHIIATVIAKAGHRDEVKELVLDLVGAARDEPGCLYY
FT                   DVYQDQSAPDTFRIVDGWASDQAVLDHVAHPNVAHITKQLAPLVVSSTYVTSLRVSDPR
FT                   "
FT   CDS_pept        complement(351013..351750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0377"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0377"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22040"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C974"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22040.1"
FT                   /translation="MTGGSTGIGFGSAKRLIEEGAVVYITGRRKEQLEDAAARLGRAAV
FT                   AVQADATSKADMLRVADTIMAGHGQLDILFANAGSGRPTPFEELTEEQIDRELAVNLKG
FT                   VILTVQGMLSVLVDGASVVLNASITADMGLPGFGVYAATKAAVRSLARSWTSDLRSRGI
FT                   RVNTISPGTIPTEAYATEQGMSQEEVEAYARRAAKEIPAGHFGTPDAIGNALVFLSSDA
FT                   GKWIRGIDLVIDGGMTRIYQGRG"
FT   CDS_pept        complement(351847..352830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0378"
FT                   /product="putative oxidoreductase, aldo/keto reductase
FT                   family"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0378"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22041"
FT                   /db_xref="GOA:C7C975"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C7C975"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22041.1"
FT                   /translation="MKKRTLGNGNLEVSAIGYGTMGLTFGYGSATEKGEAIKLLQAAHD
FT                   LDVTFFDTAEAYGAASEELLGEAVKSFRDDVVLATKFGWKDGEAKTGKLDSRPERIRLV
FT                   AEQSLTRLRTDCIDLFYQHRVDPSVPIEEVAGTVKDLIAEGKVKHFGLCEAGVQTIRRA
FT                   HAVQPVTALQSEYSMFTRDPEAEILPVLDELGIGLVPFSPLGKGFLTGKIDGATKFEEG
FT                   DIRKTLPRFQGEAREANLRIAKLVGEMAERKGVTPAQIALAWLLAQKPWIVPIPGTSKL
FT                   HRLQENVGGAEVTLSADDQAELSELLAKTPVQGERYTEAGMAMLNR"
FT   CDS_pept        352999..353895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0379"
FT                   /product="putative transcriptional regulator"
FT                   /function="9.3 : Transcription factors"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0379"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22042"
FT                   /db_xref="GOA:C7C976"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C976"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22042.1"
FT                   /translation="MLRENASDLAAFLTVARERSFTRAAAKLGISQSALSQTVRNLEER
FT                   LKVRLLTRTTRSVSPTEAGERLLRTVGPHLDAVETELAALGETLDQPAGNFRITAIEHA
FT                   AETILLPGIAKVVGEHPDIHVEVVVDYGLTDIVSHRFDAGVRAGEDIAKDMIAVRVGPD
FT                   MRMVVVGAPSYIAMRGTPRIPQELVGHSCISLRLQTSGGLYAWEFEKDGRPVNVRVEGG
FT                   LVFNTPRLILNAARMGLGLAFVPSDQAGPLIESGELVQILDDWCPSFPGYHLYYPSRRQ
FT                   ASPAFRLLVEGLRYKGR"
FT   CDS_pept        354410..354616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0380"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0380"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22043"
FT                   /db_xref="UniProtKB/TrEMBL:C7C977"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22043.1"
FT                   /translation="MRDATVHPSTSAPHRRLRHWSVPQAYGIETPSHALQSERAYAWQP
FT                   LHGSWHGHTLRGHAPRSSQRTCS"
FT   CDS_pept        354761..354979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0381"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0381"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22044"
FT                   /db_xref="UniProtKB/TrEMBL:C7C978"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22044.1"
FT                   /translation="MSDPRGNVGSIPSPSREVARALFEGNSESFLEPIIGKWALTREPT
FT                   MYNRRQQLLASDLAKGSRKWRLPSLAE"
FT   CDS_pept        complement(355367..356248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0382"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0382"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22045"
FT                   /db_xref="UniProtKB/TrEMBL:C7C979"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22045.1"
FT                   /translation="MYIGRALARKGGGDLDEYQLWSSLALELLGKAALARKHPSLVVDP
FT                   NHWQSMFVAAGINVTTDVKTITAKTLFERLVHLVPRFDKAVQKFCQDIAERRNAELHSA
FT                   DLPFKTMKLDAWEARYWHACDTILQQMGSSLEQWVGAADAAAPRQLLDEAAKALKAAVE
FT                   LRVQAAREQFDALKRAERERLAAEAELRLPRHQTSLFRGTYDEIWPVDCPACGCRSFMA
FT                   GEQIGEDISEEHDEGTIWEIVNRDFAGEEFKCPSCELSLSGSDEIEAAGLDYIHEDLQE
FT                   REMDYEPEYGND"
FT   CDS_pept        complement(356298..356849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0383"
FT                   /product="conserved protein of unknown function, putative
FT                   siderophore biosynthesis-associated protein, putative
FT                   clavaminate synthase, putative iron-binding oxidoreductase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms; PubMedId : 10383985, 1472501, 7876185, 8704959"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0383"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22046"
FT                   /db_xref="GOA:C7C980"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:C7C980"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22046.1"
FT                   /translation="MLGARIAGRAGAIEETIRPQASDDAHPRSLSAQFGLNALPFHAEL
FT                   SHRPRPCRYLLLGCLNPGSSGAATMLLDWRTLDFTADELRLLESAPVLVRTGRRSFYST
FT                   LLSPDHAFLRYDPGCLEAVDARGRCALDLVRRRLGSGLSEVHHWRRGDILVIDNWRTLH
FT                   GRAPSRPSSGRRLARMLIDA"
FT   CDS_pept        complement(357055..357273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0384"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0384"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22047"
FT                   /db_xref="UniProtKB/TrEMBL:C7C981"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22047.1"
FT                   /translation="MCWSRPDPAGRRAPVKMSECSEIPPPVTLLAPDGVNAVYRRFSPR
FT                   TEVYFIDQSWRPLNEAVNATRARPGPG"
FT   CDS_pept        complement(357400..358680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0385"
FT                   /product="putative transport protein, SulP family"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 14727089, 3009477,
FT                   7984428, 8140616; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0385"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22048"
FT                   /db_xref="GOA:C7C982"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="UniProtKB/TrEMBL:C7C982"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22048.1"
FT                   /translation="MPNGAATAHLYKPKLVTVLAEGYGVAVLRRDVMAGLTVAIVALPL
FT                   SMAIAVASGVSPDRGLYTAIVGGFVVSALGGSRFQIGGPAGAFIVLVSATVARFGVDGT
FT                   LLAVLLSGLLLTLVGAFRLGSLIRHIPHAVTVGFTAGIACTILASQLKELGGLKLDGAE
FT                   PGPVIPKLVVIGHALPTLNPTALALGCGVVLAVVALRQWKPSFPGMLVSVAAASALAWL
FT                   GGLDVATVGNSFGSLPHGLPMPQLPSMTPQLLRDVFPTALTFTLLGGIESLLSAKVADS
FT                   MTDRVHRSNMELVAQGIANVASALFGGISVTGTIARTATNVRAGAASPISGILHSAFLL
FT                   LFMLVAAPLAGFVPLAALAGVLLVVSWNMAEKSEFVRLLKNRCTAAVLIATFGLTLLED
FT                   LTAGIIAGCVLAAVLAVTHRGVPEEGA"
FT   CDS_pept        359408..360433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0386"
FT                   /product="histone deacetylase family protein"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0386"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22049"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C7C983"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22049.1"
FT                   /translation="MTTLHLTHGSALAHLGPAWHPERADRIRVVERCLEQERFAGLVRE
FT                   QALVVSEAALARVHEEAYVEATIAGLQNGIIAPVDEDTHVSAGTLEAVLRSAGAAVQAV
FT                   DEVMTGTVRNAFSAMRPPGHHAGRARTAGFCYFNNIAVAARHAQAAHGAGRVAILDWDA
FT                   HHGDGTQEIFWSDPTVLFCSTHQWPFYPGTGAASECGEHGTIVNVPLPAGADGAMFGEA
FT                   LRTMVLPRIAAFRPDLILISAGFDAHWRDPMSDLALTEADYRWATERLADIADRECDGR
FT                   IVSLLEGGYDLVGLARSVEAHVTALLEPASCRIQGVIGSTPECYTAACNPRTSGQSPAV
FT                   I"
FT   CDS_pept        complement(361106..361333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0389"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0389"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22050"
FT                   /db_xref="UniProtKB/TrEMBL:C7C984"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22050.1"
FT                   /translation="MPRQQSHKRRATADGRIRLALMEALAPVVSRLTTEQFWTRMGSDA
FT                   GTASQRRHDLGDIEARRVAAVGLRRLLLIY"
FT   CDS_pept        361463..365764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0390"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0390"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22051"
FT                   /db_xref="UniProtKB/TrEMBL:C7C985"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22051.1"
FT                   /translation="MAASIAWKNPAPRGSGCGILSIQVSLAKPAIGPCGGHAPALSCVQ
FT                   TGLHAPDSFPGAPTQPSSSSYSPREKTTVPDTPALPLSLAADPVARAVLARFPGAQIVN
FT                   DKAAPAGALPVVGGMHQINARCFSVLGPELVTRGWSVFPQTRDHRRGPGLVDNAALKWG
FT                   EYKDRLPTLGEIDWWSRFCPSHNVACILGAASGGTWALDIDVSDAELSNAIVKLADDHL
FT                   GYTPFSRVGRVPRIVLVYRQAPVSEVGADQVIRVSPHRFAARPGEDSPGQIEVLGHGKP
FT                   VTFFGLHHGTGKYFIWVDRSPHVLGPEHAPLVTRQQYDAFLDAVHALHPFAKPAVHEAP
FT                   DAAWTFDPAAGLHRPTALGEPDWQVSEGKVVDGRNRFLIRLTSNTVRANEAAARDAGAG
FT                   RAQLCALVEQEFLARAEMSGTWTPLKVKTEIRSMVTSSCEWHIREERFTRIRRGAPVAV
FT                   DGEGDVQHAPSRTDDLAPADDMPELAHLRSDFARLLARTGRKGYKLKAGAHPVRALKRA
FT                   LLTDELLRTEAAQAATAAVRDHQDRWIDGLYERAAERRSRELRKDKSPLDAGLISILRG
FT                   DAGVGKTSTFWRALARAVDKRGRLGFPVGFAMPTHANIEDSLGSASKAQLAWEQSVSEA
FT                   VEAGEKAGLKVVVFRGKLRTNCAFKEQLRSLNAASIQAERLCKSRVNVNEKVPGAEPEW
FT                   EERLCPMFEACEYQRSLAAVADADVVLFASAYLSAKAPAALTKALIALVVDERPYNGLL
FT                   GTNSRCPMPVSVLELPRPAPRLLDEEIQPLLEQANPRQAIEDRREGYLADRHAAVQIVL
FT                   PHLRKRDAGAAVVALHRTRNGNQRTGLEFARSAYAVCSRGSNLAKDVQPGMTEEAAAAL
FT                   AGAPRGEGIWDERRFWSLVIERLEALAHDEENPGTPRKAKGASDARLQVVSGETGPAIR
FT                   MSWRGTPGFPGIPLLMLDASAAPAIVTKIWVEREVEVLDVQAPCHLRTVLVTGSTFSDF
FT                   SMLPGRSRKARTILAAAKRVNLHRDVVTRLAGVHGYGKFLVGGNMGPMAVLRAGWQPPA
FT                   NVDFVHNGAMRGLDQFKNHAAALLLGRLELPPRAIDAFVAALTYDDDLPELPVDSNGDG
FT                   LDEEGKALKPLIGEKLIAMRDGRDIAVDDATYEGAWARLIQGQFREEEVRQFVARLRPV
FT                   HRLGRAPVAYVACSAIPEGLIVDDVVDIRDLLTPGPDNGQRPFEVARATGGVLDARYGG
FT                   QDREDLVGPNRTIESHLSGARLERPGFPESQGTSRIRWRLPGGEWTTSSVLTWPENPVA
FT                   PLARAIATEQGLTVEEVEEALEFEILWEGTTRAASGTKGPDKIDRANLGLPADAPLTHE
FT                   DARRAYADQEAAERADMIARVKAELSGLPIGAPDEAIEAALRRRRIAQIDWSKLAPYAG
FT                   ADRKTEAVSLAELVIARRYGLDDAEIEEDED"
FT   CDS_pept        complement(365722..366657)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0391"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0391"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22052"
FT                   /db_xref="UniProtKB/TrEMBL:C7C986"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22052.1"
FT                   /translation="MSASWGRGTVSDSPRSPMSNAVVIPLSRYFAAGLCLRGGSLTSLD
FT                   LCLWLAAVSGTLALVDEPDESGLTLRDHWITARGDAAPVWIAGPVLLQATGQRGYALLE
FT                   RSFERLAEARVSIGLHGPADAHRLWHGWEATPVSKEDPIDRGVVSGLMLTQAMIEGDPH
FT                   PVAVNLSAMAAFRSRFSALIYLRALGWMAGAGTPKSWSRTRPGPRVSVTVPIGDLHRAL
FT                   GTDSLAMVGDWNAKAFGPGGRGGPVHEDLATAGIRLKTEWRMGAAGYGTRQVPTGLRIT
FT                   VSTIAGAERRPLPRRPRQSSSSSISASSRP"
FT   CDS_pept        367017..367376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0392"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0392"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22053"
FT                   /db_xref="UniProtKB/TrEMBL:C7C987"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22053.1"
FT                   /translation="MPQPAETSPATRKARRKEGARRRAQRWRDSRAAERAALQAAAAEA
FT                   EALRTRLAVDGALVDALVERHRQLRDENGQRAPALPLGDVIRLARRALSPALPDAEAAI
FT                   RDRLGAALQAASPAA"
FT   CDS_pept        367547..368476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0393"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0393"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22054"
FT                   /db_xref="UniProtKB/TrEMBL:C7C988"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22054.1"
FT                   /translation="MRVSGLGVRIDVAGAVRDAAAEFERFAIDRFPRAVQFALTGVVID
FT                   AANAFRRDIPNIWDVPNRATRGALRYVVDRELLNRVTMVGEAQASVFVQDLPSIWLKYS
FT                   FGNGPQTRTGGDVGVEAYFQDQMSVEVPVSSNLKHTGLGSPSAAGKVSSRDARNIGRLA
FT                   AAGYTRNTGTAGATRGSARWGVFEIKPGEASRQGGYFMGPGIYARPPRVVAAVGWKKIA
FT                   KAIKAGTRSAPMTRFTRASGQTVTVPKVVNADVPRLLFLSTPQAQLQPKATPSWARAME
FT                   AAAATMPDRLARELTDHLEHAARKGRRR"
FT   CDS_pept        368481..368801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0394"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0394"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22055"
FT                   /db_xref="UniProtKB/TrEMBL:C7C989"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22055.1"
FT                   /translation="MRTTHSRILNAFGGGSSVVEHVYLDDVIEAWDAAMTRAGIDPTLP
FT                   ASVAALRDLLDKAGILTLSTWGMVYKAEHARADLANALAAFGVDPPAESPIEAPPEDRI
FT                   LH"
FT   CDS_pept        complement(368954..370117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0395"
FT                   /product="conserved protein of unknown function, putative
FT                   ATP-binding and metalloprotease domains"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0395"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22056"
FT                   /db_xref="GOA:C7C990"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="UniProtKB/TrEMBL:C7C990"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22056.1"
FT                   /translation="MARREALGEPAREVRSARGPPGTGKTSFCVSLAKSLKLPLNITSA
FT                   SAWFSANGGYLGDVIAAINSAFTNASATGPAVLFIDELDAVLNRDTLDSRHRSFWTPAV
FT                   TALLLALDSAVSSSANLVVVGATNYPDRLDPALVRPGRLNRVLNIRMPDADAIVGILRQ
FT                   HLGDALPEADLTPFGILGGGASGADIAGWARAAKAAARSAGRTVAMDDVVRQVCPPETR
FT                   PPETVRAIARHEASHAVLGVVTATGELEVVTVVERGSFAGCTNVRLQNPAMMTSAQVDA
FT                   LAVTQLAGRAADEIWGEPTSGARGERWSDLAVATELLATKAASWGLSGSILYRGDRAEA
FT                   QALIRADGKFREGVEHDLNRLYARALRLVRENTRVLPVFSRGAKQTV"
FT   CDS_pept        complement(370027..370917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0396"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0396"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22057"
FT                   /db_xref="UniProtKB/TrEMBL:C7C991"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22057.1"
FT                   /translation="MDARGGPMPEAAMNSKKTPAYTLHDLARRTARAADEKGYLDLGAA
FT                   PFEPASPEEAHAAFLDENTVPRMLATAMLVEALSMREQAAIGIRNGLAVVVEVAHPEMV
FT                   APVANPLRTAGTFSEILQRSGSNRSQDRPDHGCDKVANLLGAGANVAGVSPSPTRYLPS
FT                   TLTAAADMHLTLGAPTTRAVRSIIGLVTGRRPRKLPPLAGLTFLDVCAAIRRNSSAAAC
FT                   TKRLSVMASAKLAVVATNDAPPLEQMHGLGEAKEWGLALAAAVEEWRAGRPWESLPEKS
FT                   VVLGDPRGPARPASA"
FT   CDS_pept        complement(371059..371400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0397"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0397"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22058"
FT                   /db_xref="UniProtKB/TrEMBL:C7C992"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22058.1"
FT                   /translation="MTDVIPDHADARSASGRTPSQSFTAPPPDTEDPARQVGEIFRRLS
FT                   GCHATYGETGFARVVAAVLVALGRAAMEESERQARRLRERTAPAGPGVRVSATARRVDF
FT                   DSWDPGERD"
FT   CDS_pept        complement(371672..372160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0398"
FT                   /product="conserved protein of unknown function; putative
FT                   phosphohydrolase/phosphoesterase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0398"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22059"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7C993"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22059.1"
FT                   /translation="MQNPRPFASIEKHDETLIANWNAAVGPEDTVWHLGDFCYRCSEDY
FT                   ARSVFGRLRGRRRFLVRGNHDKIGARLPWDDVVDVARVVVQQPDGATQGVWLSHYAHRV
FT                   WPRMHYGDLHLYGHSHGTLPGTAASTDVGVDCFGFRPVTIDEIRTRLAENAQAASGVA"
FT   CDS_pept        372598..373371
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0399"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="GOA:A0A2P9HAM1"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01961.1"
FT                   /translation="MPPPLIRRRKTGEPYVRTAQVAAAIDRATMLDHATVVAEARLDDR
FT                   ADPNFMQPECLLHLIRSTRLDNSDDRFTQLFDTLITRVERSLKGAIRPSPLYDAEELRQ
FT                   DVLDRFVDLLAADRNQADDKLDYFEVRFAGALAALRIDVMRASARKAGKEDYIEEMHDE
FT                   EGQPLPVLARQMREGFASEGSEQEKEHFRNELLRAIDRLPDREKAAVTLVLEGHPVEGE
FT                   HAETIAKLCGVGDRAIRYRLQKAYGKLRRELGERR"
FT   CDS_pept        373374..374003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0400"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01962.1"
FT                   /translation="MTSESPNARDVLMTFATEGDPTPKRLEAFVKEHPDLRRELTDLAV
FT                   ELVLEPARVLPPADASTKRAVSSARARFQAATRSAQEASPVPQAVTHLPNVFAGFSGAA
FT                   FPQLAARLGLTPVFLIKVRDGLIHASGFPVALMKRIAEAVGHDVATIRAILERPGSVPQ
FT                   GMMAKADGKPEAGAKQTFAEAVETSGLSAEQRRELLGMAEAERGSD"
FT   CDS_pept        373990..377409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0401"
FT                   /product="putative ATP-dependent DNA helicase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 12620739; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0401"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22062"
FT                   /db_xref="GOA:C7C996"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C7C996"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22062.1"
FT                   /translation="MDPIEAARKKAERIHREAVDGGADPWQPFDIAVRAIQAHGLWHQP
FT                   VQAGDVSLHGCRARLDPDTFGIMYGETGSPGGDALLIGHELGHVAMHGCTVPILTYETD
FT                   PSRSAESGTGVEKLVDYGRGERREIQADLFARELVLPRYVARHLNLNGWTATEIAAKLG
FT                   IPLEVVTQQLLDALLLPPVPAPVPLPGGPLTPDPSQDAAVAHRGSPYLLQAGPGTGKTR
FT                   TLIRRVTSLIDEGIDPNSILVLTFSNKAAGELMDRLALSHPEAAASVWIGTFHAFGLDI
FT                   VRRFHDRLGLPPGPRLVDKATAITMLEEVVPTLDLDHYRDLWDPEENLSEILAAISRAK
FT                   DELVGPVRYAELAEDMKLKASDETSMLRARRAGEEALVYAAYERLLADNDAVDFGDLIL
FT                   KPVRLMAEHPEVAKALALRHRHILVDEYQDVNFATVRMIAALAADRGERLWVVGDARQS
FT                   IYRFRGATSASMTAFKEDYPKAADGALTVNYRSRGEIIDTFTAFATSVAGFKPLGDLSL
FT                   KPDRGTSGRRPAIYEAGTPDDEVALVAASVAEAEAAGVAYRNQAILCTANDRLAEFAEG
FT                   LAARGVPVLYLGPLFERPEIKDLLCLLALFHDPRAATLVRVAILPEIGMGLDDVAVVAA
FT                   SLRHAATEPLAWLDDAVSLEALSAGGRAALGRLRNACAGFERRAHPWTIASALVLDRLG
FT                   IARRIGEATTLGDRMAGVAVWQFLNFLRSLPSEGEFPTYEASRQIRRLIRLKEDRSLRQ
FT                   FPDAALELDAVRLMTLHGSKGLEFELVHAPGLITTGLPRKAKPPDCPPPDGLIAGSEGM
FT                   TGIEACTVGHDEQEACLFFVLLSRARDDLRLYRSTLLKGGKKRSPSDYLKHIAGTLGPA
FT                   PVLDRLPELAGEPASAPVSVAWDVPVELDHRHIDSYERCGLRFLYTYVLGLGGRRDENP
FT                   YMRMHNAVGEMVDWLDRNFDAGKAEPEGFAEAFEDAWGTHGPADHGHAEAYRRIAEEML
FT                   RFLVGMRDEAGRQPPLALRWPAGGGHVLTRAHDVVRTPDGRLVVRRVATRKALASLDKE
FT                   IEYTILDASAEQALGEPVTVEAVHLTGATRRLVTPGKKAERMAAVAGHMADIGAGRFAP
FT                   KPGRGCPRCPHLFACPGLPDGAAFVRRRLARH"
FT   CDS_pept        377446..378249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0402"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0402"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22063"
FT                   /db_xref="InterPro:IPR025701"
FT                   /db_xref="InterPro:IPR027802"
FT                   /db_xref="UniProtKB/TrEMBL:C7C997"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22063.1"
FT                   /translation="MKKVRVERFRLNRRHSINLSTALAAPHPSRGKDMGNDGHNHHDRD
FT                   NEGQDGTRKIKVYRFRIDKTEYESPLPDLTGRDLLVIAGKQHPERYKLLQKIGGAMKPV
FT                   GLDEVVHVSDNGQERFITLPLDQTEGEQALPTRRDFTLPEGDRETLDATGLRWETVQEM
FT                   GVARVVIRGYPVRPGYAPGRTDLMLRLLPGYPSSQIDMWYFHPPLARTDGAPIRALVSD
FT                   VFEGKTWQGWSRHRTGLNPWRPDIDDIGTHLAVVEHNLAKEVGAA"
FT   CDS_pept        378249..379643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0403"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0403"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22064"
FT                   /db_xref="GOA:C7C998"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C7C998"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22064.1"
FT                   /translation="MRISLALTGAQHAAIHAHLFPGDGREAVALLLCGRASSPGRAKLV
FT                   VHEVVPIPHEACRRTDRRVTWPTSFLEPLLAKAASRGMAVAKIHSHPGGNLAFSAVDDE
FT                   ADATLFGSVHAWVEDGGPHLSAIMVPDGAVLARAHDADGTCDELHHVCLVGDDIRFWKP
FT                   RHDTEGEVPEFARRHAQAFGRGTFAAMRGLRIGVIGCSGTGGPLVDQVARLGIGELVLV
FT                   DPDTVEEKNLNRIVNTTRADIGRPKVEVLADFVGRLGLGTHVEAFAHDLSHPAALRAVS
FT                   TCDVVFGCMDGVEGRDLLNRLATFYSLAYFDVGVMLDADGHGGIEQICGSVHYLQPGRS
FT                   SLRGRGLYTDGMLEAESLRRQDPAAYADRLARGYIRGVPEDRPAVGALNGLFSSLAVME
FT                   FLLRLHPSRIDPNGGFATQTFSITAGYLEHLADEGTDEALARYVGRGDMVPFLNRPHLD
FT                   MLARAA"
FT   CDS_pept        379640..379981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0404"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0404"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22065"
FT                   /db_xref="UniProtKB/TrEMBL:C7C999"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22065.1"
FT                   /translation="MTGFSLLSKLRAALTWVARRRGRHAAVSVGEEPDVLASRTVYVVG
FT                   EDGHQWYAAFDCPCGCGETIKLSLIPGDRPGWKLRQHWDGTASLAPSVWRKVGCESHFW
FT                   LRKGKVDWC"
FT   CDS_pept        complement(380060..380779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0405"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0405"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22066"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9A0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22066.1"
FT                   /translation="MALDPSTLDVSGASGGPSAREEAEFNRLTRLQLSCSDFSQAMSAA
FT                   AFLLQELEDEVPYSLADWRRFRCYETTMVVAYARPFSQSKGKVPRLGWKALGIEPTPDE
FT                   LALHDRLIEYRNTLYGHSDADVVELRTLYLHEVFRHNGVEMNLFVPRFEERTRFDLDEI
FT                   LRVREFTSKLHHHAFLGCQALGARFRERFVRLPMSLSEPDAKTGSEGPIAPAPHSVDKP
FT                   ECAVQRSDTSSKSGTPS"
FT   CDS_pept        381098..381463
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0406"
FT                   /EC_number="2.7.4.9"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 11259647; Product
FT                   type e : enzyme;thymidylate kinase (fragment)"
FT                   /db_xref="PSEUDO:CAX22067.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   mobile_element  complement(381413..382468)
FT                   /mobile_element_type="insertion sequence:ISMdi20"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Insertion Sequence ISMdi20, IS630 family; Evidence 3
FT                   : Putative function from multiple computational evidences"
FT   CDS_pept        complement(381426..382001)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0407"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e :
FT                   enzyme;transposase of ISMdi20, IS630 family (ORF 2)"
FT                   /db_xref="PSEUDO:CAX22068.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(381998..382396)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0408"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme;transposase of
FT                   ISMdi20, IS630 family (ORF 1)"
FT                   /db_xref="PSEUDO:CAX22069.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   CDS_pept        complement(382848..383009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0410"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0410"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22070"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9A4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22070.1"
FT                   /translation="MAHSRTNGVRTPDPLQNFDITLVKVCFKFRNGRDADCDITSMLAC
FT                   DLRLNVPL"
FT   CDS_pept        383292..383573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0411"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0411"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22071"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9A5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22071.1"
FT                   /translation="MVYGGQLRFGFEGAVAFCDAAPAAEARFGVYLDAIAVGEIVFAAG
FT                   SKNGSFYMFPNAKLNWASGARFRVLSPSVQDEQLRGLEFAIPYTYYAA"
FT   CDS_pept        383991..384380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0412"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function; PubMedId : 11055911"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0412"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22072"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9A6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22072.1"
FT                   /translation="MTRDSRSILLGLHRDRRHPMGLATDLSLDACSRLALVGGFAHAGL
FT                   QRAMADIRHEQRREASAVGEVVARLREARLGQVAATRRAVAAEARAAQTEEEARGAQAE
FT                   IRLLREALRAERSLTAGLKEICGVA"
FT   CDS_pept        complement(384455..385291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0414"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0414"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22073"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9A7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22073.1"
FT                   /translation="MSFLARILAAISHAMRGVWTFIGDTFDEVFEPITKRVPWMRSRAR
FT                   AAGRAIDRGVSVAADAALDVAAVTADVALRAPGVIGRELGSIVASAFPAPAVTGRALAE
FT                   AGVVGDEEIQRMVEAAGPGAEFERQRPWVGHGHFLQHAVEAYRDGGEKALAPHVRWISE
FT                   PAAEWIRTLSHTQMETALAMAPEALKRHTTPERASDVSPLLPVGPAPKVDPLFVTEEMK
FT                   ADILARAKRSMAGERAGVAEMMQRGTATPARPEPRFDATADEMLRYGRGYRPRGAY"
FT   CDS_pept        complement(385356..385889)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0415"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0415"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22074"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9A8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22074.1"
FT                   /translation="MRVVLPAGSTVRQVDVWSGTRTSLHARLVTVRPFASQQHFLNPER
FT                   TRWKAGFDLPLGEVVTTCRVREPGQGQLFLVTEDGLEPLTYAQAWDRVDPTGAEEGLAE
FT                   MEHDARAAKAGLPRELTRFVGPHGLQNGVHPIGNSHYYAERCTARQAFSRRATRAEIEA
FT                   LGEGGVRTHMVPCM"
FT   CDS_pept        386043..386375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0416"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0416"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22075"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9A9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22075.1"
FT                   /translation="MVMRRDEFRVPAAVLRQHLAAGEGYAEISRRYDVGENAVRYRCRR
FT                   LGLRELVNGRAPSEAALRMALSHSDIPLKAIARAFGVEASTLTRAARLYGLPTDEIGRE
FT                   QLRDAR"
FT   CDS_pept        386372..386596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0417"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0417"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22076"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22076.1"
FT                   /translation="MMARRPLHDEDVRRCLAAAVDLAGGQSAWAARHGLTQSYVAKLVL
FT                   GRREISPRVLSALGLRALPRAYEPTEPRP"
FT   CDS_pept        386593..387198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0418"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0418"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22077"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22077.1"
FT                   /translation="MSSVDRSIHAFPTPEAVARLWASHGAEAVIGRYWYLNNSERSRLN
FT                   RLGRATLGLESRVVSRPRATTPEQEAAAIEAAFAVGSMHGIEVAAGIRKNGVRDYCAAR
FT                   GLSDTPRISSELQGRLTRDSKDAARGDAAAAARIAARRRHAEQVYAVCLAALALVPDQP
FT                   AAGRPRLPEPSPELAAALAGFDASAVAAVFPSLTERTA"
FT   CDS_pept        387198..387485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0419"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms; PubMedId : 12767982"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0419"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22078"
FT                   /db_xref="GOA:C7C9B2"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22078.1"
FT                   /translation="MLRRLLSTALDNVRADPGWRECIRLVVGLPILRANAALFIAAFLL
FT                   PLFRVPPSWPHESPAMWAIAWLPAFLGLTLLADWLGVDGMRDPDDDLDVR"
FT   CDS_pept        387559..387984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0420"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0420"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22079"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22079.1"
FT                   /translation="MEFHEEAHRCGQDYEPTAEELRLVMIEALPEAGGVHYWSQRLGCT
FT                   PEDLQAVLDGEIEPAGDMLDILSMEPIPSRGVYADPLMDREARAIQRQRWSKGPTAATY
FT                   VRGTPRRIERSAPIPEHVKNMFAIGVAAPTAKPKLEK"
FT   CDS_pept        388077..388292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0421"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0421"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22080"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22080.1"
FT                   /translation="MTQPQTSPAPAETLDLSFDLAAFFPEEPADLGPSPEGWDALMRQM
FT                   ADAEIHDLPLPECLLPLHDEPLDLSF"
FT   CDS_pept        388421..388846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0422"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0422"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22081"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22081.1"
FT                   /translation="MFTLLTPKARDTALDLARGDYQLSLLRGSASWAGSDLKGAAARSG
FT                   RSYADSRESLLARLAEAGLYVERTKGERGRTVVVIMTAAERRRSKDRPAAEAAASVIEK
FT                   AKKAKAAAERKAAREKARAERDLAADLPALEVIAHAR"
FT   CDS_pept        388958..389491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0423"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0423"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22082"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22082.1"
FT                   /translation="MFFRTPLKNQSHAGILACCILTPLDDEMHDLLNGHVAVPTKPEPT
FT                   YLQLTAVEKARGWLQQAEQLLVDAKSNGGTTEKIAESQRLVERLRLRVRHAEAVEALGP
FT                   LEYGRTLEFHCGDTDLYAIADKDTGFLFHVPWNMAPDDIRRTIAIYDGAFYAGLMQGRK
FT                   EVRRPILSALGLLD"
FT   CDS_pept        389586..390119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0424"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0424"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22083"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22083.1"
FT                   /translation="MGTREFTDAEERARRVALVQAVGERVYGGSWQTPLAEALSAATGR
FT                   PLGRARVAQWMLADGAKPVPAWALDALPAIARDGAARLRRHADELDALFAEGGAGAPPA
FT                   QSEPDAAEEPPFESGPAAAADDDDFDVDAFVEANAHLRPARPAPEPAPEPERPAGWRSA
FT                   FAEAHAARWAPRNV"
FT   CDS_pept        complement(390116..390700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0425"
FT                   /product="Putative phosphohydrolase/phosphoesterase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0425"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22084"
FT                   /db_xref="GOA:C7C9B8"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22084.1"
FT                   /translation="MPRTRTFFTADTHFGHEGIIGMCRRPFASVRDMNRTLVELWNARV
FT                   GRDDVVWHLGDFALGATPAEAAAIFRALNGKLRLVKGNHDSADTLALPWAGPVEHLVET
FT                   SIDGTRLVMCHYPMRAWRGSFGKTIQLFGHTHDLLSPSTLSCDVGVDSWAYAPVTIAEI
FT                   RSKLAGLTEEPEERRMARLKRVEAGPVEDEG"
FT   CDS_pept        complement(390794..392215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0426"
FT                   /product="putative phage integrase, putative
FT                   integrase/resolvase/recombinase protein, putative DNA
FT                   integration/recombination/inversion protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0426"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22085"
FT                   /db_xref="GOA:C7C9B9"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9B9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22085.1"
FT                   /translation="MPRKPDKDKAYLTVHDGVWRVSMGVPRELRDQLGTRLVRSTGTKA
FT                   LGEAKLARDLIVPQFKKRIEDAWSARGGKRNSLLALTLETRRLMETADENLADFMIQGA
FT                   EERYEEILNEGATWVNEHTPDGIIPRRIPKPEAAKLVSEIRRVAAGDTPIAHYHQAFVD
FT                   GLKIKPRSKLDEPRALSILLDWMESQDIEPFIENINKRNAIRFLDWLDADTNLSWASKA
FT                   KYFGRIKFYWSWLARREYAKENPFHDLNIDKPETKREDDEREYTDEEVQKLLMGEPMEG
FT                   RRMLDVMMVAALTGARLDAVIDLKVGNLSDGYFTFKAQKKERGSRDIPVHPDLDEIVAR
FT                   RIANKAPEDDLFPEWPGPPSTSVKPRSSYFSKRYTKYTSDIGVRDEEKGRRRSKINFHS
FT                   WRRWFITKMERARVREPLIAAIVGHARKGLTLRVYSGGPEFLEAQDAIALVKLPPLDGS
FT                   PVVEERSLTPRRRKP"
FT   CDS_pept        392837..394297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0427"
FT                   /product="putative transcriptional regulator, LuxR family"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0427"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22086"
FT                   /db_xref="GOA:C7C9C0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22086.1"
FT                   /translation="MTADVDRHELRQIIVGLSEGVILVEPDQTIAYANEAALAMHGVET
FT                   LDGLGATVDAYRERFVLRYRNNRAPEQYPIERVVAGERFHDVVVEVRRPDAPDVYFVHS
FT                   LRSLVATDRDGKPSCLALILKDVSDQFEAEERFEKTFNANPAPAIITRLSDLRHVKVNA
FT                   GFLEMTGYVRDAVIGRSVYEVDVLAGARNRDLAVSRLNEGGTIPQMEACLNLPDGGSRF
FT                   VIVAGQPIEMGEEPCMLFTFADLELRRKAETALRQSEERFATAFRLTPVPTLLARLDGF
FT                   TVTSINDAFTRVFGYGEDSVVGRSPSETGLWVADAARERFEEAVGRTGFVPGQEVCLRH
FT                   QDGSELDCLASAERVEIGEETFALLVLQDITERKRGERELFEAIEAVMADTSWFSRGLI
FT                   EKLANLRQPGGHDGDGASPILTVRERQILNLICTGLDDDAIAKRLNLSRNTVRNHGAAL
FT                   YRKLGVHKRAEAVIWGRENGFPLHPAGT"
FT   CDS_pept        394393..394548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0428"
FT                   /product="conserved protein of unknown function; putative
FT                   CsbD-like general stress response protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms; PubMedId : 10376822, 11988534"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0428"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22087"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22087.1"
FT                   /translation="MTDRVKSTSTTEAKGSVKEAIGKLTGDARVEAEGKAQKRQVQRSK
FT                   AAPRSK"
FT   CDS_pept        394607..394948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0429"
FT                   /product="conserved protein of unknown function, DUF883;
FT                   putative CsbD-like general stress response protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0429"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22088"
FT                   /db_xref="GOA:C7C9C2"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22088.1"
FT                   /translation="MVDTDRITGAAKEFGGKVQGAVGDLTGSNNDSVEGRFREAQGTAE
FT                   NLYGQAKDAVRHAADEVSDYAEDAYDRSRRTLREGSRDVGGYVSEAPGTSLLIAAAVGF
FT                   GLGLLVSRL"
FT   CDS_pept        394992..395903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0430"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0430"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22089"
FT                   /db_xref="GOA:C7C9C3"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22089.1"
FT                   /translation="MTTTTSLSPVAAGDTRAVLLNEVSWGAIFAGAVTALVTQVVLNLV
FT                   GVGVGLASVGTNAADNPDASTFSLGAGLWFVVSGIVASLAGGVIAGRLSGKPLPGVAAL
FT                   HGLVAWAVTTLVVLYLITSAASGLVGGTLGTVSGALGGAGNIVGSTVQTAAQAAAPSLS
FT                   KIANPLDGIERTVREQAAGQDPQAARDAAVAAVRAVLSGDPAQKEQAKSRAADALAKAQ
FT                   GIAPDQAKAQIDGYEKQYEQAVATAKQKAEAAAVAAKSAATQGAFYAALALILGALAAF
FT                   FGGRLGAPKPATLVGTYDARRV"
FT   CDS_pept        395994..396197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0431"
FT                   /product="conserved protein of unknown function; putative
FT                   CsbD-like general stress response protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0431"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22090"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22090.1"
FT                   /translation="MSSTTDKIKGLANEAAGNVKQGIGNVTGNDKLVAEGKAQELKGEA
FT                   QKTVGDVKDGAKNLADKVTGKH"
FT   CDS_pept        396272..396655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0432"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0432"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22091"
FT                   /db_xref="GOA:C7C9C5"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22091.1"
FT                   /translation="MNRDQFRGASRHIKGRAQTALGGVTGDPVRQVRGAANQVAGGAQY
FT                   AYGSARERIEDLARDGEHLAHSARERADDLLQDGRRYAGEARRRGRDYGRRAVRYADSN
FT                   RTSTLLGIAAAAFTLGWLARPSR"
FT   CDS_pept        complement(396876..397796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0433"
FT                   /product="putative membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0433"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22092"
FT                   /db_xref="GOA:C7C9C6"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22092.1"
FT                   /translation="MIVRPRPGLLTILFAMRGSILPKVAPQVIVIAALSFLVVAIEQRH
FT                   AAWFPVTAGIGPFTLVGLALSIFLSFRNGACYDRWWEARRAWGSLIVELRGLARLLPAL
FT                   LPEPEHEALRHRCLRRGAGFAHALHARLRGLDETEALAPWLPSEEVATLGQRPSGADAA
FT                   LTGLTRDLAGAAKAGALSDVLFVSLEHKIASLSAIQATCERIHGTPLPFAYTLLLYRTA
FT                   WLYCLLLPFGLAGSLGWSTPIIAALVAYAFFGLDALGDELEEPFGTDANDLPLDTLLHT
FT                   ADAAILDALGETGREAPKADRFMLR"
FT   CDS_pept        complement(397807..398982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="METD_I0434"
FT                   /product="Acetylornithine deacetylase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="3.5.1.16"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 10684608; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0434"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22093"
FT                   /db_xref="GOA:C7C9C7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010169"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22093.1"
FT                   /translation="MTAPVGGTRLTPLELLERLVAFDTESSKSNLALIDFVAEYLDSWG
FT                   VPSIRVPNAEGNKAALFATLGPMTDGGVVLSGHTDVVPVTGQAWTSDPFRLRVADGRAY
FT                   GRGAVDMKGFDALALAMVPAALEAGLTRPIHILLSYDEETTCLGVADTIARFGADLPRP
FT                   GAVIVGEPTEMQVADAHKSVVTYNTTVHGHAAHSAKPGLGANAVMAAADLIAELNRIAD
FT                   AMVARGDASGRFDPQNTTVHVGVIEGGTARNILPKLCTFLWEFRGLPDLDMAEIPALFA
FT                   AACERVTRERLNRYGEFGHIATVEEVSVPGLGPDPGSEAERLALRLAGRNATITVPYAT
FT                   EAGRFQRAGIPTVVCGPGSIDQAHQPDEFITLDELARGEAFMRRLVAAFAG"
FT   CDS_pept        complement(398979..399371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apaG"
FT                   /locus_tag="METD_I0435"
FT                   /product="ApaG domain protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0435"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22094"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR023065"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22094.1"
FT                   /translation="MYKAETRGIMVTVEPRFVEEESSPGESRYFFAYTVEIVNNGSEQV
FT                   QLRSRHWRIIDGRGACQEVRGAGVVGKQPVLEPGESFSYTSGCPLTTPDGLMAGSYTMS
FT                   TIGGESFEAEIPAFSLDSPHLRRVVH"
FT   CDS_pept        399539..399988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0436"
FT                   /product="protein of unknown function; putative membrane
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0436"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22095"
FT                   /db_xref="GOA:C7C9C9"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9C9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22095.1"
FT                   /translation="MATRPDRPPLAAGPALGSVLTLALALAFAWWDPAQNRWPALALVL
FT                   ALGLDTAARIAARAVRQRTGVETEIRGLPSPMLALGKAMGIGALVVAGVSYLRPDLFPL
FT                   LASALAGLVAMGACARLALARMVVAIEAAERAEAEAKRKGEGTGR"
FT   CDS_pept        399985..401103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="METD_I0437"
FT                   /product="2'-deoxycytidine 5'-triphosphate deaminase"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="3.5.4.13"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0437"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22096"
FT                   /db_xref="GOA:C7C9D0"
FT                   /db_xref="InterPro:IPR010550"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22096.1"
FT                   /translation="MSGDVPAASGILPAQAITALTQAGAIRPATSYAADQIQPASLDLR
FT                   LGRRAYRVRTSFLPGSGRSVATCVEAFALHEIDLTQGAVLETGCVYIAELQETLALPPD
FT                   LSASANPKSSTGRIDVFTRVITDRASAFDQIEAGYAGQLYAEISPRTFPVRVRTGSRLS
FT                   QIRFRQGDPRLRETELAALHASDPLIDAATPSLQGGVPVSVDLAGFDGLIGYRAKRHTG
FT                   LIDMDRPRGHRTRDFWEPLPADGSRTLILDPGQFYILASKEAVRVPADYAAEMVPFDPL
FT                   VGEFRVHYAGFFDPGFGLSEAGGAGARAVLEVRSRDVPFLLEDGQIVGRLVYERMLERP
FT                   ATLYGAGAGSNYQAQGLKLSKHFASEPEPPAT"
FT   CDS_pept        complement(401150..402070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0438"
FT                   /product="putative transport protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0438"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22097"
FT                   /db_xref="GOA:C7C9D1"
FT                   /db_xref="InterPro:IPR000292"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22097.1"
FT                   /translation="MGCDETTAEGRMSQESRTHGDPDDQGEAKTHGAHTREKDNAQVEK
FT                   AHRPDALILHEIIRREGEEEMRRTWLALSLSGFAAGLTMGFSLIVPGVLKGHLPHAPWA
FT                   ELVTSAGYSIGFLIVVLGRQQLFTENTVTPILPLLTERTFGALLRVVRLWGIVLVANIL
FT                   ATIAIASVLAHTDAFKPEVREAFAEISRHTIEDPFWTTVIKAVFAGWLIALMVWILPAS
FT                   GSAAPFIIILMTWLVSMCGLAHIVAGSVDAYYLVAIGEIDFSKYLTGFFVPTLLGNIVG
FT                   GVTLVSVLNFGQVAPEIEDHNRVGA"
FT   CDS_pept        complement(402149..402886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0439"
FT                   /product="putative Molybdopterin binding, CinA-related"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 16926146; Product type
FT                   f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0439"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22098"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22098.1"
FT                   /translation="MSQSSDVTAAILVIGDEILSGRTKDKNIGTIAEVLTEIGVDLREV
FT                   RIVPDVKDEIVAAVNALRARYTYVFTSGGIGPTHDDITADSVAEAFGVGIDVDPRARAM
FT                   LLERHRPEDLNAARLRMARIPDGADLIANPVSKAPGFRLGNVFVMAGVPQIMAAMLDEI
FT                   RPTLTGNAPVISETIEAGAIPEGNFAGGLSDIAAAHGDVSIGSYPSMTPEGFRNRIVVR
FT                   GRDADAVAAARAAVEALLAGLRP"
FT   CDS_pept        402970..403716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sfsA"
FT                   /locus_tag="METD_I0440"
FT                   /product="sugar fermentation stimulation protein"
FT                   /function="12 : Regulatory functions"
FT                   /function="6.11 : Sugars"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 11259647; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0440"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22099"
FT                   /db_xref="GOA:C7C9D3"
FT                   /db_xref="InterPro:IPR005224"
FT                   /db_xref="InterPro:IPR040452"
FT                   /db_xref="InterPro:IPR041465"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22099.1"
FT                   /translation="MRFPTPLIEGRLVRRYKRFLADVTLADGTMVTAHCANPGAMLGLN
FT                   TDGFRVLLSPSTNPSRKLGYSWELVEAELPGGPQWVGINTARPNALVAEAFRENKLAPL
FT                   IGYETLRPEVAYGKASRVDFLASGGGRPPCHVEVKNCHLMRQAGLAEFPDCKAARSARH
FT                   MEELAGVVTAGGRAMLIVVIQMRAGAFDVARDIDPVFDRALRMALEVGVEAYAYTCAVG
FT                   PEGVEIADPVPILTPGATVQPARTSG"
FT   CDS_pept        complement(403673..404518)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0441"
FT                   /product="putative S-adenosyl-L-methionine-dependent
FT                   methyltransferase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="GOA:A0A2P9HAR2"
FT                   /db_xref="InterPro:IPR006342"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01963.1"
FT                   /translation="MTDTSPYGTYAPTGLVARIAERTQKLPEHSWRARRMAMFLRRLAI
FT                   SMMRGRPLDVERYGARMRLHPYNNNCEKKVLFTPQFFDPQERAFLKERLRDDAVFLDIG
FT                   ANIGAYALFVAGFTGRRARILAVEPQPDVFDRLTFNIGQNPFGTVKAIACAVADKSGEL
FT                   TLFIDPRNRGESSVKIVGTHKNATVRVPAVTLVELCRSEGIERIDAIKLDVEGAEDLIL
FT                   EPFLRDAPASLLPSVLVIENGADQWQIDLPNLLNKYGYRQIARTRLNLMFERVEPSRPA
FT                   "
FT   CDS_pept        404658..405434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0442"
FT                   /product="putative alpha/beta hydrolase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 16926146; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0442"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22101"
FT                   /db_xref="GOA:C7C9D5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22101.1"
FT                   /translation="MQSFDSDGVQIAYIDVPPKEGASGGSGDPILLIHGFASNHAVNWV
FT                   NTLWVRTLTEAGYRVIAHDNRGHGQSEKLYDPASYTSDQMAGDAVRLLRHLGIERADVM
FT                   GYSMGARIAAHMALDYPAEVRSLLIGGLGFNLVDGRGLPQGIAEALEAPAGAPAPNPTA
FT                   ASFRTFAEQTKSDLRALAACIRASRQTLSRAELSAIETPTLVSVGTLDTVAGSGPELVK
FT                   LLPNARALDLPNRDHSTAVGDRLHRKGVLEFLEQRP"
FT   CDS_pept        405573..406037
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0443"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0443"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22102"
FT                   /db_xref="GOA:C7C9D6"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22102.1"
FT                   /translation="MPGRTSQTAADGVLRSVVADALASALIVLAILLLVFGGTALARPK
FT                   LTYAADKVVGLSNLSTDEGCLPANLAGRVVKRAFGRDGLSLESVIVEEKTGQRSFINVE
FT                   DGYRNLDAATNGAVKHSLETLLNVGKSVSLRVLGCGAAARTLTLDAVRPL"
FT   CDS_pept        complement(406061..406840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0444"
FT                   /product="putative ABC transporter, permease"
FT                   /function="14 : Cell envelope"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0444"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22103"
FT                   /db_xref="GOA:C7C9D7"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22103.1"
FT                   /translation="MMGVSMLNVPAVLAIYRFEMARFWRTALQSIVAPVISTSLYFVVF
FT                   GAAIGSRMQTVDGVPYGAFIVPGLIMLSLLTQSVSNAAFGIYFPRFAGTIYELLSAPIS
FT                   PFEVVLGYVGAAATKSIIIGLIILATASLFVPLHIEHPFWMVFFLLLTALTFSLFGFVI
FT                   GLWADGFEKLQLVPLLIVTPLTFLGGSFYSIDMLPPFWRAVTLFNPVVYLVSGFRWAFF
FT                   GKGDVAVGVSIAATLAFLALCLGLVTYIFRTGYRLKS"
FT   CDS_pept        complement(406837..407763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0445"
FT                   /product="putative ABC transporter, ATPase"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 16738553, 8202364,
FT                   9278503; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0445"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22104"
FT                   /db_xref="GOA:C7C9D8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22104.1"
FT                   /translation="MPPIVSIANLSKVYASGLHALRDVNLDIAKGEIFALLGPNGAGKS
FT                   TLINIVCGIVTPSTGEIRVGGHDILSEYRAARRMIGLVPQELTTDAFEKVWDTVSFSRG
FT                   LFGLPKNPAHIERVLKDLSLYDKRESRIMQLSGGMKRRVLIAKALAHEPQVLFLDEPTA
FT                   GVDVELRQDMWRLVRRLREQGVTVILTTHYIEEAEEMADRVGVIRKGEIILVEDKVELM
FT                   RKLGKKQLILHLRAPVTTLPENLARHDLHLGEDGRSLVYTYDTRRERTGITGLLRELAD
FT                   AGIAFTDLDTSQSSLEDIFVDLVRERA"
FT   CDS_pept        complement(408084..410081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0446"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0446"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22105"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9D9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22105.1"
FT                   /translation="MPLDVAALEKGCDTRVRTADQLCGRELDRYREALATGSPVTVSCT
FT                   LQAPLFEEIAAEMEAEERVTFAKIRETAGWSSQAERAGPKMAALLAAAAEAVPVAGTVP
FT                   LESRGVALIYGRDEAAIEAGRRLAEHLDVTVLLSRPGEVAPLHRNEFPVIRGTVRGATG
FT                   HLGAFDLRIDDYALPAPSSRTHLVFGSGRDGAVSTCDLILDLTGGTPLFPAHELRSGYL
FT                   RADPRDPAAVERAVMAASHLVGEFDKTRFIDFRGELCAHSRSRITGCTRCLDVCPTGAI
FT                   SPAGDTVAIDPYVCAGCGSCAAVCPTGAANYALPPADALMRRLRSLMRAYRAAGGADAV
FT                   VLFHDGDHGEPLIDALGRYGEGLPAHVLPVRVNEVTQFGPEVLAALFAYGAAGARVLVR
FT                   ERPKHDLDSLHRTVALGRTLADALGYGTGTEAPTVALIETDDPDALGAALRSDVPGRAT
FT                   TAPAGFVPVGGKREMLRLAFREMHAAAPTPVAAVPLAAGAPFGGLQFRTEDCTLCLSCV
FT                   GACPTHALSDSTDRPLLAFEESLCVQCGLCAATCPEDVISLKPQIDFEAWGEPRRIVKE
FT                   EEPFCCITCAKPFGTRATIERVIGKLRERHWMFSGEAGEQRIRSLMMCDDCRVEAALTQ
FT                   GFDPHAVPPAKTRTTEDYLREREAAGRLPG"
FT   CDS_pept        410264..411022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0447"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0447"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22106"
FT                   /db_xref="GOA:C7C9E0"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22106.1"
FT                   /translation="MTLPLDIGSPGLRLAPLVLPPAFTGLVAAGSAAGLACRMAESGEA
FT                   DAATLLMEERDDVIAFAVVLAPTEPLATARRAVFIGMQALADAVGAFGPPEIPVTFHWP
FT                   DTLNFNGARLGGGALHWPEGCDETETPDWLVFSAMLLASKRDAGDPGLTPDSTSLEEEG
FT                   FPNDLREALVESFARHLTKAFEIWDEDGAARSTGRYLTRLALPPGVRATIDPSGNAQLV
FT                   HADGRRETLLLRPAVSAPSWRDPATGTVRL"
FT   CDS_pept        411019..411585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0448"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0448"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22107"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22107.1"
FT                   /translation="MSAGKLPRTLRLDPSDTFVFARAAEAGEWAVTGSFLFFDADLSAL
FT                   AGKERAAFRSGFVGVRSLGFSTLVVVSEASEAEREAAIEDLARHIHERFGAPDREAARA
FT                   AAREEIEVAASLCNLPVGSVVAMHRSAQDGEIAEEFRTLHQRAPGADPMHGRAFHFVET
FT                   DEDGPDEQADLVGLLSDASAGAERA"
FT   CDS_pept        411582..412592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0449"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0449"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22108"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22108.1"
FT                   /translation="MTEFWVSSGHHLTQRTEGGGLAVTDELILAYLARPELVPPEEACA
FT                   AERALHASLLSDPRRPVSSGELQQIADADARENWEVMLAFRERLLTARSVEAAYLALVR
FT                   GGLQGVPGLFLTQLVHLILRNALDGCEDPFVLRAAELFFRSQRASLHEGAVLLADAEVI
FT                   EAREGGAPLSPLVTMLGKEAASELDVLNEENAWTYWSRSDAFTMALNLGSSGRSRDGLA
FT                   RAIEAFVRHLLNAEVTVKPLDRLEDPDWRWFVGLDAEGTRIGNALWRGEALDDAARERV
FT                   IAVFSLTFADPARVDPRVGERPVYLLLAMSPDKTVQLKPQNLVVGLPLASDRAAA"
FT   CDS_pept        412601..413119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0450"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0450"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22109"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22109.1"
FT                   /translation="MTPEQIPEDRFEVGIIVARRRLKGPWASHAWLPIEALPAAPETAP
FT                   WTQLSETEEEATFYAGAHEVTLHIGETAHYRDNLVSGRPSLWVTLHATSEDTYTVASVT
FT                   ADPYEGESMAEGIGEIVEAVPMPPEVQAKLLAFFEAFHIERKFEKRKRDRADPEALARR
FT                   APGTQGKPE"
FT   CDS_pept        413116..413826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0451"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0451"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22110"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22110.1"
FT                   /translation="MSDSFLSRWARRKEAVRTTERTVAPTVSDEVEAKAALDAEAHTGD
FT                   GSPTPQPVALTGDEPEAGTDDLLARLPSLDALTPETDLTAFLQSGVPTALRNAALRRMW
FT                   SLDPAIRDFVSEAREYAYDWNTPGGVPGMGPLLPTDDVKAMLKRIIDGVPVAAEEDPDT
FT                   HLQDAPTAASEEAAQIADAAPPASDTDPETDGVPLPMPDLHAPVAVAAVESSQVVQSTL
FT                   PRPRLRRHGGAMPS"
FT   CDS_pept        413914..414549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0452"
FT                   /product="Cytoplasmic chaperone TorD"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0452"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22111"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22111.1"
FT                   /translation="MSSVASVMALPGDEVSGVVGVPDEIDLLRAQQYDLLAALLGRAPG
FT                   SSLLAALAAVKEGDGVLGRQVAALRRAAAETDTEAVEREFFALFIGVGRGELLPYASYY
FT                   LTGFLNERPLARVREDFAALGIERDESMSEPEDHLAILLEVMAGLAAGRFEAEPGMQAH
FT                   FFARHIEPWADRFFADLEKAKAGRFYRAVGGLGRAFIEIEAEAFAMEG"
FT   CDS_pept        414623..414871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0453"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein; formate dehydrogenase region TAT target"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes)"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0453"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22112"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22112.1"
FT                   /translation="MMRQDPKTLGRRQFFRALGGSTVAAAAAVASPMGATEAQAYDPGN
FT                   DETKARYWESDHVKAFYRTNGYETLKKNTDPASTGPK"
FT   CDS_pept        414879..417821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdh3A"
FT                   /locus_tag="METD_I0454"
FT                   /product="formate dehydrogenase alpha subunit precursor
FT                   (tat pathway signal)"
FT                   /EC_number="1.2.2.1"
FT                   /note="Evidence 1c : Function from experimental evidences
FT                   in the studied genus; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0454"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22113"
FT                   /db_xref="GOA:C7C9E7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22113.1"
FT                   /translation="MLIKRKSGDAARTKHQAVAAGLAAGVLDRRAFLRKSGLTAGALAA
FT                   AGTIQLGSVRKAQAAGSSAVGPDTVIKKNVCTHCSVGCTVTAEVVNGVWVGQEPSYASP
FT                   INRGTHCAKGAAIRELVSSDRRLKYPMKLEGGQWKRISWDQAYEEIGDKLVQIREKNGA
FT                   DSVYWLGSAKFTNEASYLMRKFAALWGTNSIDHQARICHSTTVAGVANTWGYGAQTNSY
FT                   NDIRNAKTMIILGGNPAEAHPISMQHVLSGKEINRANMIVIDPRFTRTAAHATEYVRIR
FT                   SGTDIPVVWGILWHIFQNGWEDKEFIAQRVYAMDDVRKEVAKWTPDEVERVSGVPGEQL
FT                   KRVAEKFAKEKPATLIWCMGATQHTVGTANVRALCILCLATGNVGKPGTGANIFRGHTN
FT                   VQGATDLGLDVTSLPLYYGLVEGGWRHWARVWDVEYDWLQSRFDEVPAKGGRKARTRKE
FT                   NMEAPGITSTRWFDAVNLPPEQIDQRSPIKAFMVFGHGGNTVTRMPEAIDGMNKLELLV
FT                   VADPHPTTFAALDARQDNTYLLPICTSLEMDGSRTASNRSIQWGEQIVKPAFESKSDYE
FT                   VLYRLAQKLGFADKLCKNIKIVDGAPEAEDILREINRGGWSTGYCGQSPERLKAHMRNQ
FT                   HKFDLVTLRAPKDDPEVGGDYYGLPWPCWGKPELRHPGSAILYNTSLHVKDGGGGFRAR
FT                   FGTERNGQTLLAENSFSKGSDLTDGYPEFTFGVFKKLGWDKDLTPDELATILKIGGEKP
FT                   DTVSWATDLSGGIQRVCLDHGVSPFGNGKARANAWNLPDPVPVHREPVYSPRPELVAKY
FT                   PTRPDERQLRMPNIGFSVQKSVVDRGVAKDFPIILTSGRLVEYEGGGEETRSNPWLAEL
FT                   QQDMFVEINTGDAAARGIKDGQWVWVSGPENGAKTKVKALVTDRVGMGVAFMPFHFSGW
FT                   YQGKDMRDFYPKGTDPVVLGESVNTVTTYGFDPVTGMQETKCTLCQIAAA"
FT   CDS_pept        417839..418435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdh3B"
FT                   /locus_tag="METD_I0455"
FT                   /product="Formate dehydrogenase iron-sulfur (beta) subunit"
FT                   /EC_number="1.2.2.1"
FT                   /note="Evidence 1c : Function from experimental evidences
FT                   in the studied genus; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0455"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22114"
FT                   /db_xref="GOA:C7C9E8"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22114.1"
FT                   /translation="MARMKFLCDADRCIECNACVTACKNEHEVPWGINRRRVVTLNDGK
FT                   PGERSVSMACMHCTDAPCAAVCPVNCFYTTADAVVLHSKDICIGCGYCFYACPFGAPQY
FT                   PRVGNFGSRGKMDKCTYCSGGPEPDFSTAEYEKYGSNRLAEGKLPLCAEMCSTKALLAG
FT                   DGEMIAEIYKQRVIKRGYGSGAWGWKTAYRETVAI"
FT   CDS_pept        418504..419541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fdh3C"
FT                   /locus_tag="METD_I0456"
FT                   /product="Formate dehydrogenase gamma (cytochrome) subunit"
FT                   /EC_number="1.2.2.1"
FT                   /note="Evidence 1c : Function from experimental evidences
FT                   in the studied genus; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0456"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22115"
FT                   /db_xref="GOA:C7C9E9"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9E9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22115.1"
FT                   /translation="MRRATTFLSTLLLAVMLLAVPGALSPAQAQNPIQADGQNPMGARP
FT                   TADSVNEEFLFKQESKIRGRVSIPDGKSANLIQPQGREYQNFRERWLPWIGALTILGML
FT                   AALGAFFLFRGRIMMEHSQESGKKILRFNAFERFTHWMTAVCFIILSLSGLNYIFGKRL
FT                   LMPLIGPEAFGAIAQWAKYSHVYLAWPFMLGVAFMFVLWIRDNIPNKVDWAWIKAGGGF
FT                   IGKGHPHAARFNAGQKGVFWMVAGFGAAMGVTGLMMLFPFALTDINGMQVMQVIHSVIG
FT                   IIFIAGILAHIYIGTLGMEGAYDAMGSGKVDLAWARAHHDLWVEQEQARTASGPQLKGH
FT                   PAPAE"
FT   CDS_pept        419636..419875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0457"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0457"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22116"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22116.1"
FT                   /translation="MKAFLAAVIAAIALGVLAMFALTSNQKFAYQAFATSGARVSEPGT
FT                   NLVGPRWNGDPKPDEYNGEPHGKAEGEASHPKRS"
FT   CDS_pept        419920..420537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0458"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0458"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22117"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22117.1"
FT                   /translation="MKPSPIIRHLAGGLAACALLAGTALAQDASPSAPATLQTSGKPAN
FT                   LCQELVAFVKQPEPANKAAATPPQQATAVSNPSGKTEGGKPADGGEPQKTSGLSGAVSE
FT                   TGNGPAPGAATNNSKPEAAAGNPADNPNAKANALAKNPPPPAPPAPAPKPDVATIEKIE
FT                   AAAGANDLAACREAARSMRVAGVVMPPPLLALAALDLKFFQQ"
FT   CDS_pept        complement(420575..421168)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0459"
FT                   /product="protein of unknown function; putative membrane
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0459"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22118"
FT                   /db_xref="GOA:C7C9F2"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22118.1"
FT                   /translation="MSPADLAPLAWNAAREHLDLFGGLGLCLGFAGGMMPRRSLILFTS
FT                   AACSACFALHFLRLGAQTGTAMCLVSVMQSVVAARWIGPESRAAWVAPLFLASSLVALG
FT                   LTLATWNGWPSACAGLGSLLATTARLQGNSQAMRRFFLGASSCWALHNTLVGSVFGLTC
FT                   DLLTLTALVIALVRGGAEKPTPVANPVAPLQGAA"
FT   CDS_pept        421488..421802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0460"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0460"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22119"
FT                   /db_xref="GOA:C7C9F3"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22119.1"
FT                   /translation="MSMIVGERASFPHAVGLGADLTTAQEGFSPARLFKAVCTPANLLV
FT                   CAVVAFGWFALLGWTGAGPDGWQARLCADLDLQPRSCAAVQLLSEPGRTAATDTVGTTS
FT                   "
FT   CDS_pept        421799..422434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0461"
FT                   /product="putative TetR family transcriptional regulatory
FT                   protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0461"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22120"
FT                   /db_xref="GOA:C7C9F4"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22120.1"
FT                   /translation="MSAAAGAVIDARSGQAARREHILDAAESCFVRNGFHRTTMQDLAR
FT                   EASMSPGNIYRYFDSKEAVVLGLAERDRERGAVLVEAMERAGDKRAVLMGVLARFFLEI
FT                   SREAAVLRLDLWVEATRNPAIADLVERGDEEGRVWLTEMFDALKTSPDCDPAALFDAIA
FT                   PLMKGMIVSRALSPGYDARPAVAQLQSLIEAGLSGALALPPADKEAGR"
FT   CDS_pept        422431..423672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0462"
FT                   /product="RND efflux transporter, MFP subunit"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0462"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22121"
FT                   /db_xref="GOA:C7C9F5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22121.1"
FT                   /translation="MIRARTLAVPALVLTALSFGPAWAETAQALAKTAPAATVSVVEAE
FT                   RREIVESVVVTGTLVPRDEILVTPEIDGYRLVELLTEEGMRVEKGQVLARLNRDLIDRQ
FT                   LSQQNALIDKVSAAVLQAQSNIEQAEAAELEARLAHDRAKQLIQTGITTAAVMENRTAA
FT                   LRQAEGKLAFARNGLAMAKAELAQAKAVRDELELRLARTEIRAPEAGIVSRRTARVGMA
FT                   TSASAEPLFRLIARGEIELEAEVIETKLPLLREGAPAFIEIGEGERVTGSVRAVYPEVD
FT                   KASRLGKVRVRLDPDPRLRIGTFARGAVELARTRGVTVPQASVLYGGGKRSSVLVVAED
FT                   KVESREVRTGLSDDDDIEIRSGLAEGERVVARAGSFLRDGDRVRPVSLARQGQTPAAVS
FT                   AAPSPQATADAGSR"
FT   CDS_pept        423721..426816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0463"
FT                   /product="RND efflux transporter, translocase subunit"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0463"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22122"
FT                   /db_xref="GOA:C7C9F6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22122.1"
FT                   /translation="MRLNISAWAIRNPIAPLVLFLVLVVLGLVSFRGLAVTRMPNVDVP
FT                   IVSVTITQGGAAPSELQTQVTKWVEDSIAGVRGVKHITSAITEGASVTTVEFRLEVNTD
FT                   RAVNDVKDAVSKIRINLPRTIDEPVIQRVEITGLPILIYGVTSPAMTPADLSWFVEDKV
FT                   ARTLQGVKGVGGVERVGGVAREIRITPLPDRLLALGITAADVNKQVRVTSADLAGGRGE
FT                   VGGREQSIRTLAASRTIRDLKATSIVLPGGRKVRLDDLATVEDSIEEPRTFARFNGESV
FT                   VAFSVSRGSGASDAEVAAGVEKKIAEFAQGYPDIQFQEIDSSVAATRGSYASAMHTLME
FT                   GAALAVIVVFLFLRDWRATLIAAVALPLSVLPTFWAMDALGFTLNGISLLAITLVTGIL
FT                   VDDAIVEIENVVRHMRMGKSPYRASIEGADEIGLAVIAITATLIAVFAPVSFMGGIAGR
FT                   YFIQFGLTIAVSVFMSLLVARLITPLLAAYFLRDHGHAEEREGPVMRAYTRLVGWSVRH
FT                   KWITLMVGLALFAGSIVSTKLLPSGFIPKQDNARTLFMIELAPGARLPDTIAVADRVVE
FT                   RIRALPEVTSVFVDGGRQAGGKKETRLATLIVNLSPKSERVKRQWTIESEIAGLLAQEP
FT                   DIRSWTLRDSGQRDLALVVSGPDVDVVTEVAARLQRDMAAIPHLVSVMSTAPLNRTEVR
FT                   IRPKPGAAADLGVATDVIAETVRVGTIGDIGINLAKFNAADRQVPIRVQLPESARGAIA
FT                   RLENLKVPAKNGTAVPLAAVADIELDQGPGAIERYDRAVRVAVEANMEGSDALGSLIEQ
FT                   ALATPTAKSLPPGVTIRQTGDAEIMQEVFSGFLMAMGAGIMMVYAVLVLLFGSFLQPLT
FT                   ILFSLPLSIGGAILGLLICHMPISMPVVIGLLMLMGLVTKNAIMLVDFAVEEMARGVDR
FT                   VTAIVDAGRKRARPIVMTTIAMAAGMVPSAMALGIGGEFRAPMAVAVIAGLIVSTLLSL
FT                   VFVPAVFLLMDSLGGLIGRGLGRFVGPRDEAEDAPAPAGHHG"
FT   CDS_pept        complement(427069..427347)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0464"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0464"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22123"
FT                   /db_xref="GOA:C7C9F7"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22123.1"
FT                   /translation="MPTVVNRTMSPFEWAMLFGLSVLWGGSFFFAGVALSALPPLTLVV
FT                   LHVGLAALILNAARPLAGLRLPRGREVWVAFFGMGLLNNVVPFCLIV"
FT   CDS_pept        complement(427476..428579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hrcA"
FT                   /locus_tag="METD_I0465"
FT                   /product="Heat-inducible transcription repressor HrcA"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 14704707; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0465"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22124"
FT                   /db_xref="GOA:C7C9F8"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22124.1"
FT                   /translation="MLISLIEAVQPIVNPQPQALAALNERSREIFRQIVESYVTTGEPV
FT                   GSRNLARILPMSLSPASIRNVMADLEHSGLIFAPHTSSGRLPTELGLRFFVDAMMEIGD
FT                   VDLAEKARIEAQMQAAASRHTFDSALAEASSLLSGISRGAGVVLTTKVDAGLKHVEFVR
FT                   LDPERALVVLVSIDGTVENRLVDLPPGLPAGALQEASNFLNARLRGRTLDTLRADIENG
FT                   RKEMKRELDALTERLVDAGLATTVGPSEARQLIVRGQANLLDDLRAAEDLERIRLLFND
FT                   LETQKDVIELLARAEQGDGVRIFIGSENKLFSLSGSSMIAAPFRDSAQKIVGVVGVIGP
FT                   TRLNYSRIVPMVDYTARVVSGLLDRSR"
FT   CDS_pept        428845..429108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0466"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0466"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22125"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9F9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22125.1"
FT                   /translation="MVKVAALAIAVTGLSLASAPRAAQAAPLPIQTEATAPAGDMIEQA
FT                   QYRGHRRHYRGHMRHRGHWHRHHRFGGPRHHHHRRHWNHRRW"
FT   CDS_pept        429026..429232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0467"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0467"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22126"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22126.1"
FT                   /translation="MAIGTAITASADRAITITAVTGTTAAGDRSAGYLKGRRRETAAFF
FT                   MPEAGLPRKAAHLAAVAAGAGSA"
FT   CDS_pept        429273..429986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="METD_I0468"
FT                   /product="ribonuclease PH (tRNA nucleotidyltransferase)"
FT                   /function="9.1 : Degradation of RNA"
FT                   /EC_number="2.7.7.56"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 1512252, 1512253, 1885537,
FT                   1925027, 6207018, 8501045; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0468"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22127"
FT                   /db_xref="GOA:C7C9G1"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22127.1"
FT                   /translation="MRPSKRAADAMRDVTLERAVARYAEGSCLVTFGNTRVLCTASLEE
FT                   RGPPWLRGSGKGWVTAEYAMLPRATHERTRREVNSGKPSGRTQEIQRLIGRSLRAVTNL
FT                   PALGERQITVDCDVIQADGGTRTASITGAWVALHDCFAWMRARSIISVDPLKDHVAAVS
FT                   CGIYKGQPVLDLDYAEDSAADTDANFVVTGKGGIVEVQGTAEMEPFTDEQFLELLRLAK
FT                   GGVAGLVELQRKAIA"
FT   CDS_pept        429983..430618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0469"
FT                   /product="nucleoside-triphosphatase"
FT                   /EC_number="3.6.1.15"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 12597275; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0469"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22128"
FT                   /db_xref="GOA:C7C9G2"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22128.1"
FT                   /translation="MSAHRILSGKVVIATHNAGKLVEMRELLAPFGVEAVSAGELGLPE
FT                   PDETGTMFAENAAIKAHAAAKASGLPAFADDSGLCVDALDGAPGLFSARWAGPDKDFSG
FT                   AMARIAAELDKRGATDRRAHFVSALVLAWPDGHTELFEGRVFGDLVAPRGSLGFGYDPM
FT                   FRPEGMDRTFGEISSEEKHGVDWQSGNALSHRARAFVLLAQACLRRPG"
FT   CDS_pept        430868..432046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0470"
FT                   /product="putative oxidoreductase; putative
FT                   coproporphyrinogen III oxidase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0470"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22129"
FT                   /db_xref="GOA:C7C9G3"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22129.1"
FT                   /translation="MPAATPPDHPTRDAGFGIYLHWPFCAAKCPYCDFNSHVRHAGVDQ
FT                   PRFLAAFRREIAHAAALAPGRTVTSIFLGGGTPSLMAPNTVAGLLDAVAGAWSVAPDAE
FT                   VTLEANPTSVEATRFRGYRAAGVNRVSLGVQALDDGDLKRLGRLHSVAEALDAVRTASA
FT                   HFERFSFDLIYARPEQTPEAWAAELRRAIDYAAEHLSLYQLTIEPGTPFFGLAQAGRLV
FT                   PPDDDASRALYDVTQEICGLAGLPAYEISNHARPGAQSRHNQLYWRYGEYAGIGPGAHG
FT                   RLVLPQGRTGTLTEKAPEDWLARVERDGHGIVETETLSAEDQGDEFLMMGLRLTEGIDP
FT                   ARYATLKGRPLHAGRLDALVRDGLVARRPDGRIAATARGAPVLNAVVAELAG"
FT   CDS_pept        432102..432335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0471"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0471"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22130"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22130.1"
FT                   /translation="MVDILDRAVEALRRMPVGDRECLAQAILTVAENEIPLDIDSEHLP
FT                   AVLEGLAQIERGAYIEGEPEDLVAAAFRRRVP"
FT   CDS_pept        432332..432619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0472"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0472"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22131"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22131.1"
FT                   /translation="MRLRLSARAAEDLESIAAYLEARDPQAARRVEQQLTAALRRLLDH
FT                   PKAGRPVGRNLRRFAVPRLPYLIFYRVDEADNVVGVATIRHTARRPIGQM"
FT   CDS_pept        complement(432641..433852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0473"
FT                   /product="putative extracellular ligand-binding receptor
FT                   precursor"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0473"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22132"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22132.1"
FT                   /translation="MARRGGRWTARAGAALLSLGLTIGLAGCLGVPDAPRPAARAVPEG
FT                   EPNPTVTASNVIGAGTVKVALIVPLSGQGAAVGAALRNAAELAYDDFQKPNLQILVKDD
FT                   RGTPEGAREATQAAFTEGAEMVLGPLFAANVQAAGGVARGAGKPVIAFSTDAAVAARGV
FT                   YLISFLPQSEVDRIVDEASAGGRRSFAALIPETTYGNAVEAQFREAVARRGARLVGIER
FT                   YPAGNPGPAVDRLRGVVAGAGAQADALFVPDTAEGLMAVAPALTKIGFSPARVRPLGLA
FT                   LWNDPRVLSQAAFQGGRFAAPDAAGFAGFAQRYQTRFGTMPPRTASLGYDAVSLTAALV
FT                   RQYGSQRFADATLTNPAGFSGLDGTFRFLPEGVSERTLAVYEIRNNAANVVSPAPKVLA
FT                   PSGI"
FT   CDS_pept        433973..434923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rmsL"
FT                   /locus_tag="METD_I0474"
FT                   /product="ribosomal RNA small subunit methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 19965768; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0474"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22133"
FT                   /db_xref="GOA:C7C9G7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22133.1"
FT                   /translation="MTQRLDKRPEGAPRSPATFTAFGLAAEAESLAPGLYVVATPIGNL
FT                   RDVSFRALATLAAADAVLAEDTRVTRTLLMHYGITTPLLSYHEHSNEAVRERMVMRLKA
FT                   GETLALVSDAGTPLVSDPGFKLVQAAIAAGIPVTPIPGPSAVMTAIVAAGLPTDRFFFE
FT                   GFLPQKSGARRNRLEALATIPGTLVVFESPHRLPEMLADAAATLGPERPAAVARELTKL
FT                   FETIRRDSLGALAEAFAQEGPPKGEVVVVIGTAPEDAAPREADTGLDARIETALARHSI
FT                   KDAAALVADETGQPKRVVYARALVLARRADDETSG"
FT   CDS_pept        434907..435293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0475"
FT                   /product="conserved protein of unknown function, UPF0235
FT                   protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0475"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22134"
FT                   /db_xref="GOA:C7C9G8"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22134.1"
FT                   /translation="MRPPADPGARRRATHGRGLSAEGLALLVLMLKGYRPLARRFAAAG
FT                   GEIDLIVRRGRTIAFVEVKARATLDAAATAIDARKRARVSRAARAWLARHPLAAGATLR
FT                   ADAVFVAPRRWPRHLPNAFEIEGL"
FT   CDS_pept        complement(435323..435712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0476"
FT                   /product="putative response regulator receiver"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0476"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22135"
FT                   /db_xref="GOA:C7C9G9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9G9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22135.1"
FT                   /translation="MSVDSNEDRLSGARVLVVEDEAAISMLLEDMLLDFGCEIVGPAAR
FT                   LATALEMARSESFTVAILDVNVAGEPIYPVAEAIAERNLPIVFSTGYGGAGIREPFRDR
FT                   LVVQKPFSQADLKRTLAAAIAAAEG"
FT   CDS_pept        436005..436916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0477"
FT                   /product="ABC transporter, glycine/betaine type,
FT                   periplasmic protein"
FT                   /function="16.1 : Circulate"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 15251200; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0477"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22136"
FT                   /db_xref="GOA:C7C9H0"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22136.1"
FT                   /translation="MSRRGLLAAAAAAMLPIRARAEPGRPIVIGSKSDTEGALLGNLIS
FT                   LVIEDLGLRVERRLGLGPTLIVRSALLAGEIDLYPEYTGNVAFFSGTETDPAWKNSAGA
FT                   YGLALRLDAAHGLVWLGRAPANNTWLIAVQGRLARERGLATMADFAGAVRDGAIRLAAS
FT                   TEFVESPAALPSFESAYGFSLPLSRIVSLPGGDTAVTARAAAEGISGINAGMVYGTDGA
FT                   LAALDLTVMSDPKGAQIVYEPAPVIRAATLECHPRIREALDPIFARLDADTLRRLNAAI
FT                   TVEGRTGEAVAKAWLAEAASRP"
FT   CDS_pept        436913..438055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0478"
FT                   /product="ABC transporter, glycine/betaine type, permease"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0478"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22137"
FT                   /db_xref="GOA:C7C9H1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22137.1"
FT                   /translation="MTARLLTGLATAALLPAVFAGLPLLHLAPNRLVTGAPIAASDALG
FT                   TGLWPIAVLAAGGLGLLAAGRGRMAAGLAGLACLGALALLLVGLGAGAADLTAGQPFAT
FT                   RARLASGAWTGVVVLVFALAFAARRARLPGGGLIAAPAVLALIGGLWRAGRLDALSLVV
FT                   EGRARSDALGAAIRDHLVLALGALVLATGLTGGLALWRRGRGAVDLTVSGLQVVPAVAL
FT                   LGGLVAGLSALLTAAPALRGYGISALGIGPALIGVAAYLLLPLWRGLQAARRATGPDSI
FT                   AAARALGLTSGQILTTLRLPLGAPALIGGLRVATVQALGLATLGALVGAGGLGTLVFDG
FT                   MAQFAPDLILLGALPIIALSLAAEGALGRLEAALRRRWPR"
FT   CDS_pept        438052..438780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0479"
FT                   /product="ABC transporter, glycine/betaine type, permease"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0479"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22138"
FT                   /db_xref="GOA:C7C9H2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22138.1"
FT                   /translation="MNRVSEAFGPLALGLALAGASHPAFAGLIGASGQPLTVGHMAELA
FT                   LNHLTLAATGLTLVAALGIGLGLIATRARFAGFRGSIDTLAAFAQAVPPVVVVALALPV
FT                   LGFGGPPTLLALTAYGIMPTLRGTVGALDAVTAEARESAQAIGLTPAQILIHIELPLAA
FT                   AGLVDTLRTALILAVSVTAVGALAGASTLGTPIVAGLQNQNIAAMLQGALSTAALAFLG
FT                   DALLLAFGARLRPPERRTAG"
FT   CDS_pept        complement(438787..439881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0480"
FT                   /product="putative L,D-transpeptidase catalytic domain
FT                   (YkuD)"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 16647082, 18456808,
FT                   17369299; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0480"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22139"
FT                   /db_xref="GOA:C7C9H3"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22139.1"
FT                   /translation="MRGALAALSVWSAAAQAAESGAPDLTREAIENAAFRESPEEAKPD
FT                   KASKPGKKSKKEAEAKKEAEAKKDAEKKPDPLLVKVQVLLDRARFSPGAIDGRDGENLR
FT                   GALKAFAAAQGLPEGDRLTREIFDRLQATGKEPVVTQYTITEEDVKGPFVEKMPPKMEE
FT                   QAEVGPMRYTNAREMLAERFHMQRDLFSALNPNVPLDKAGGTLVVAAVPPLGEGKVEGA
FT                   PVAPKVTRIEVDKRTKRVRAFAEDGKLTADYPASIGSSEKPAPDGSAKVKAVAFDPWYT
FT                   YNPKYQFKGVKATKKFSIHPGPNSPVGVVWIDLSIPSYGIHGTPEPEKVGKTESHGCIR
FT                   LTNWDAHDLASHTKKGAKVEFLDK"
FT   CDS_pept        complement(440003..440920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0481"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0481"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22140"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22140.1"
FT                   /translation="MKPSTLASLLACLLAAGLALPPDPAWSDPAKPPPATVPLPPPQPP
FT                   ARPDDLVPPAPQVTPLPPERPPELATGPDKGAVAKPDEPPKETKTTNDTKDAPAAQPEA
FT                   PLPPARPPELSGESALALKVSAPDDTACLRRLERLGARFEAASPLGNGQCSAPHPLTVT
FT                   ALADGVTLEPAATLNCRAAEALARWTTEVQVAAQKEFGESLKSLALGGTYVCRGQNHDT
FT                   DAKLSEHSFANAIDVMAYGFTKRASLKVTAAPDSTPEAAFLASARTSACTFFRTVLGPG
FT                   SDAAHGNHLHLDLRERNAGHRLCQ"
FT   CDS_pept        441118..443217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcp"
FT                   /locus_tag="METD_I0482"
FT                   /product="Peptidyl-dipeptidase"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.15.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0482"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22141"
FT                   /db_xref="GOA:C7C9H5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22141.1"
FT                   /translation="MTADTARDLPEGTEPGRGGVQANPFDASDWATPFGLPDFEAIRPE
FT                   HYVPAFAHALKAHEAEIAAIAGNEAAPTFANTVAAMERAGAALDRVANVFFNLTGSNTS
FT                   PELQAIERAVAPQLARHSSAITLNPELWARLSAIDAEAEGLGAEERRVLDRYRSRFHRA
FT                   GAGLAAEAKTRIAEIAVRLAELGTQFSQNVLADERDFVLPLNGEADLAGLPPFLRDAAA
FT                   EAAKERGGGQSHVITLSRSLIEPFLVFSTRRDLRALAYAAWTRRGENGGETDNRAIIAE
FT                   IVRLRAERARLLGFDSFAHLKLDDTMAGSPDAAMELLRNVWKPALQRAATEREGLQALV
FT                   RAEGHDFDLEAHDWRHYSEKLRRAEHDLDESEIKPYLPLEGMIRAAFDTASRLFGLTFE
FT                   ELRGVPRYHPDVRTWLVRDADGSEVGLFLGDYFARPSKRSGAWMSAFRSQERLNGDIRP
FT                   IIVNVMNFARAPRGEPTLLSFDDARTLFHEFGHALHGLLSDVTYPLLSGTAVSRDFVEL
FT                   PSQLYEHWLQQPEVLRAHARHVTTGEPMPDALLERLLAAANFNQGFATIEYAASAIVDM
FT                   TLHLSAAGEDGLDVVAFEADALRRIAMPAEIAARHRAPHFAHIFSGDGYAAGYYSYLWS
FT                   EVLDADAFDAFREAGDIFHPETAQRLRRMIYGAGNLRDAREAYTAFRGRLPSIEPLLKK
FT                   RGLAA"
FT   CDS_pept        complement(443332..445005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftfL"
FT                   /locus_tag="METD_I0483"
FT                   /product="formate-tetrahydrofolate ligase
FT                   (formyltetrahydrofolate synthetase)"
FT                   /EC_number="6.3.4.3"
FT                   /note="Evidence 1c : Function from experimental evidences
FT                   in the studied genus; PubMedId : 14645277; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0483"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22142"
FT                   /db_xref="GOA:C7C9H6"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22142.1"
FT                   /translation="MPSDIEIARAATLKPIAQVAEKLGIPDEALHNYGKHIAKIDHDFI
FT                   ASLEGKPEGKLVLVTAISPTPAGEGKTTTTVGLGDALNRIGKRAVMCLREPSLGPCFGM
FT                   KGGAAGGGKAQVVPMEQINLHFTGDFHAITSAHSLAAALIDNHIYWANELNIDVRRIHW
FT                   RRVVDMNDRALRAINQSLGGVANGFPREDGFDITVASEVMAVFCLAKNLADLEERLGRI
FT                   VIAETRDRKPVTLADVKATGAMTVLLKDALQPNLVQTLEGNPALIHGGPFANIAHGCNS
FT                   VIATRTGLRLADYTVTEAGFGADLGAEKFIDIKCRQTGLKPSAVVIVATIRALKMHGGV
FT                   NKKDLQAENLDALEKGFANLERHVHNVRSFGLPVVVGVNHFFQDTDAEHVRLKELCRDR
FT                   LQVEAITCKHWAEGGAGAEALAQAVVKLAEGEQKPLTFAYETETKITDKIKAIATKLYG
FT                   AADIQIESKAATKLAGFEKDGYGKLPVCMAKTQYSFSTDPTLMGAPSGHLVSVRDVRLS
FT                   AGAGFVVVICGEIMTMPGLPKVPAADTIRLDANGQIDGLF"
FT   CDS_pept        complement(445244..445465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0484"
FT                   /product="putative metal-binding protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 12644235; Product type
FT                   c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0484"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22143"
FT                   /db_xref="GOA:C7C9H7"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22143.1"
FT                   /translation="MDQSPIELTMRVDGMTCEGCAEAVRRTIRRLDPQADVSVDVGLGR
FT                   VSATTVAQSLDVAQALTQAGYTATAMTG"
FT   CDS_pept        445752..447233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0485"
FT                   /product="conserved protein of unknown function; EAL
FT                   domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0485"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22144"
FT                   /db_xref="GOA:C7C9H8"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22144.1"
FT                   /translation="MKTPKARTIRPRGTPWILGLIGVLVLVPLALILPLAAVAAVSGLA
FT                   IVGGALLWRRLSAFAVAQEVVSKEIGVLSQRLVKLEAVTAALIQSRMQDSATAADGSAR
FT                   PPDEAVKALDARFNAGIEEVTAEIGILSGIVRELAAVVASQDGDIARLRVQAQAPQPKP
FT                   VPQAAPEPIRPRPAPAAPPPPETEPMAPPMRLVPRTTLPAARPSDHFAADADAALLIEA
FT                   FDGEGLEVFLQPVVTLPQRKVVAYEALARLKVGDAVYAPETFLPVLERHGRTTALDRRM
FT                   LQRVATIARHLQGRGSPASVSYSLTPHSLFEPGFLRSLGRLVSEGPELAGRVVIALPQS
FT                   SWRSLDAEQAALLAGLRGRIGFVMDRPIDLRFDPTALAERGITQVKVAAALLLRPLDRE
FT                   ARPDIALEDLVTSLARAGIRLVATGVEAETEVPDLIDLDVPLAQGGVFAAPRAVRSEVL
FT                   SASPEAAPPPPPSPDPPPSPPPQRRPFRDFLRRAG"
FT   CDS_pept        complement(447268..447495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0486"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0486"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22145"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9H9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22145.1"
FT                   /translation="MANFDQLPDRASGDALDRARAQGQMHHSIATTLLVIAAARAERAA
FT                   PPVHAARQRLAKIYGASRLRKRMERDAARG"
FT   CDS_pept        complement(447666..448202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0487"
FT                   /product="conserved protein of unknown function; putative
FT                   CheZ-like phosphatase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0487"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22146"
FT                   /db_xref="GOA:C7C9I0"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22146.1"
FT                   /translation="MKMMATARDGRSQNSHPSAMVKELLDIADYIASLRDAIAILRANE
FT                   LTRDRLPMVHEELSEVVAATAGATNSIMSTAEAVLALRDGPGYRDAVEAKIYDIFEACT
FT                   FQDITGQRIAKVAEAMSQLEGRLARFTAAVKARDAAGIDETEADRRKRNESLLLNGPQM
FT                   GGPATAQDAIDALFA"
FT   CDS_pept        complement(448386..448769)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0489"
FT                   /product="putative response regulator receiver,
FT                   two-component response regulator"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0489"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22148"
FT                   /db_xref="GOA:C7C9I2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22148.1"
FT                   /translation="MALDLSMPILVVDDYQTMVRIIRNLLKQLGFEDVDDASDGTAALA
FT                   RLKGRKYGLVISDWNMEPMTGYELLRHVRADEGLRTTPFIMVTAESKTENVIAAKKAGV
FT                   NNYIVKPFNAATLKSKIEAVCGA"
FT   CDS_pept        449076..450089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="METD_I0490"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /EC_number="2.7.7.2"
FT                   /EC_number="2.7.1.26"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 2985604, 9743119,
FT                   10518757; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0490"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22149"
FT                   /db_xref="GOA:C7C9I3"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22149.1"
FT                   /translation="MPSGDENAVPPAGTGLRPSSRPFTVCREDDPVPPALAGAVAALGN
FT                   FDGVHRGHRTLIEAVRAEAGSHPAAVLTFEPHPRAFFSPDQPMFRLTGPSAKEIVFARL
FT                   GLDGLIVRRFDERLAGTSARDFVEGWLRDGLGLSGVVIGHDFHFGRGREGSPGTLAELC
FT                   AEAGLSCRIVPAVSADPGDAPISSSAIRAALASGDVARANDLLGYRWFVLAQVRHGDKR
FT                   GRTLGYPTANLALESCGLAHGIYAVRVRLADGSLHDGVASYGRRPTFDDGAPLLEVHLF
FT                   DFKGDLYGQEVAVELLGYLRGEEKFSSAEALIAQMDVDSARAKAAIRTDRVPSMLG"
FT   CDS_pept        complement(450280..451284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0491"
FT                   /product="glyoxylate reductase"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 11532010; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0491"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22150"
FT                   /db_xref="GOA:C7C9I4"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22150.1"
FT                   /translation="MSSLKRKPLVVVTRRLPDAVETRMRELFDTRLNHDDAPLSQEALS
FT                   AAIREADVLVPTVTDEIGAGLLAQAGPNLRLIANFGNGVDHIDVAGALERGITVTNTPG
FT                   VLTEDTADMTMALILAVARRLAEGARIIPDDDWTTGWSPTWMLGRRITGKRLGIVGMGR
FT                   IGQALARRAKAFGLSIHYHNRRRVPSHIEESLDATYWESLDQMLARVDIVSVNCPHTPA
FT                   TYHLLSARRLKLLKPEAIVVNTARGEVIDENALARLIEGGEISAAGLDVFEQEPAVSPR
FT                   LVRLARTGKVVLLPHMGSATHESRTDMGEKVIINIKTFMDGHRPPDRILPSML"
FT   CDS_pept        451610..452203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0492"
FT                   /product="conserved protein of unknown function; SH3
FT                   domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0492"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22151"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22151.1"
FT                   /translation="MRPPELPPMNPARLALLAALFALFIPLTAEAAPAPAPEVGKGPVT
FT                   KLPLPRYASLKTNRVNLREGPSKDHRTLWVFQREGLPVEIVAEFETWRRIRDSEGTEGW
FT                   VLHSLLSGRRTAVVIPPSGERADSAKATVPLTARADEQSGEQARLQPGVIGSVKGCTGS
FT                   WCRLVVPLPDKRGDVDGYIRQSRLWGVYPDERVE"
FT   CDS_pept        complement(452308..452808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0493"
FT                   /product="Ferric uptake regulator family, Irr-like protein"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0493"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22152"
FT                   /db_xref="GOA:C7C9I6"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22152.1"
FT                   /translation="MSDLMPLQAVLNARSASPGDASGRRGCPLSDLRDRLRRAGLRPTR
FT                   QRLSLGWLLFGRGDRHLTAEMLYDEAMRAKVPVSLATVYNTLHQFTEAGLLRQLALDGS
FT                   KAYFDTNPTEHHHFFFEEEGEVLDMPECGISVDSLPDAPEGMEIAGVEVIVRLRRRKVS
FT                   GRA"
FT   CDS_pept        453085..453624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabA"
FT                   /locus_tag="METD_I0494"
FT                   /product="beta-hydroxydecanoyl thioester dehydrase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="4.2.1.59"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 8808925, 8910376; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0494"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22153"
FT                   /db_xref="GOA:C7C9I7"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22153.1"
FT                   /translation="MASLDQQSDGASPQRASSFSYEDLLACGRGELFGAGNAQLPLPPM
FT                   LMFDRITSIGTEGGAHGKGHVLAEFDIRPDLWFFPCHFKEDPVMPGCLGLDALWQLVGF
FT                   HLGWLGALGRGRALGVGEVKFTDQVLPTVKQVVYGIDIKRVRQGKLVLGIADGWLEADG
FT                   RRIYEANDLRVALFRA"
FT   CDS_pept        453785..455011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabB"
FT                   /locus_tag="METD_I0495"
FT                   /product="3-oxoacyl synthase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="2.3.1.41"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10571059, 3076376, 3076377;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0495"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22154"
FT                   /db_xref="GOA:C7C9I8"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9I8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22154.1"
FT                   /translation="MRRVVISGMGIVSSIGNNTGEVLDSLREARSGIARSEAQAAHGFR
FT                   SQVAGAPTIDPEGVVDRRAMRFHGGGTAWNHIAMDQAIRDAGLEEREISNDRTGIIMGS
FT                   GGPSTRTIVESAAIAREKGPKRVGPFAVPKAMSSTASATLATWFKIRGVNYSISSACAT
FT                   SNHCIGNAAEIIRGGRQDIIFAGGCEELDWTLSVLFDAMGAMSSRYNETPSRASRAYDV
FT                   NRDGFVIAGGAGVLVLEEYEHAKARGARIYGEVAGYGATSDGHDMVAPSGEGAVRCMRQ
FT                   AMEDLKGVKIDYINPHATSTPVGDDKEIEAIRTVFGAGDACPPISATKSLTGHSLGATG
FT                   VQEAIYSLLMMNNGFICESAHIEELDPAFADMPILRQRRDGAQLGHVMSNSFGFGGTNA
FT                   TLVLKHPDA"
FT   CDS_pept        455485..456315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabI"
FT                   /locus_tag="METD_I0497"
FT                   /product="NADH-dependent enoyl-[acyl-carrier-protein]
FT                   reductase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="1.3.1.9"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10398587, 2687243; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0497"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22156"
FT                   /db_xref="GOA:C7C9J0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22156.1"
FT                   /translation="MTGLMAGKRGLIMGVANDHSIAWGIAKTLHRHGAELAFTYQGEAL
FT                   GRRVTPLAASVGSDIVLPCDVEDLATVDAAFATLDERFPDGIDFIVHAIGFSDKAQLKG
FT                   RYVDVTTRANFSRTMTISCFSFTEIAQRAAARMPRGGALLTLTYAGSTRVMPNYNVMGV
FT                   AKAALEASVRYLASDLGPDGIRVNALSAGPMRTLAGAGIADARLMYNHQKAHAPLRRTV
FT                   TLDDVGNSALYLLSDLSGGVTGEIHFVDSGYNIISMPRPAVLQAQDEAGVVGDL"
FT   CDS_pept        456383..457144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="METD_I0498"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0498"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22157"
FT                   /db_xref="GOA:C7C9J1"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22157.1"
FT                   /translation="MTPSPRRPVPRSLPLTLLLAALLLAAGSGAAWAQSVTLDLGAGGT
FT                   TERALQLVALITVLALAPSVLVMATSFTRIVVVLSILRSALGTQTAPPNTVMVSLALFL
FT                   TAFVMAPTAREAYRTGVEPLMAGQISQSQAFERASAPFKTFMLRNVREKDLKLFLDMAR
FT                   QPAPAGPEAIGLEIVTPAFMISELRRAFEIGFLLFIPFLIIDLVVASVLMAMGMMMLPP
FT                   ATVALPFKLIFFVLVDGWTLVAGSLIQSYGS"
FT   CDS_pept        457201..457602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0499"
FT                   /product="conserved protein of unknown function, putative
FT                   inner membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0499"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22158"
FT                   /db_xref="GOA:C7C9J2"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22158.1"
FT                   /translation="MDLTTTTTHWAPRMLSILRIVSALIFMAHGTQKILGFPASSMNPP
FT                   LLSLPGIAGLLELVGGALLVVGLFSRPVAFILSGQMAFAYFIAHAPKSFFPALNGGDAA
FT                   ILFCFVFLYIAFAGPGPWSIDAQRGRGRV"
FT   CDS_pept        complement(457606..460956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0500"
FT                   /product="conserved protein of unknown function, putative
FT                   exported protein, tetratricopeptide TPR_4 domain"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0500"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22159"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22159.1"
FT                   /translation="MGGRAGQAKRRPGRALLRAGFAVGLCAAASATEAARLVSAKGAQP
FT                   PEGFGRIVLTFDEPVSVKARLSGAILVLNFGEAVGSGPERIAAGMPDYVTVVRRDPDGS
FT                   ALRLALQRPYRVNVQDAGEQVFIDLLPESWNGFLPPLPTEVVADLARRAAAAEASLKAR
FT                   NPAPVPRPLTLELARTDARTRLSLRLPAGAEAAFAPDGTGTRLTLPGAWRLDDHALRGR
FT                   LDPNLGRVTVETDTGEARIVASPAEGVTLSTLRDEDVVAIDFVTKPKSPENATSPVPPA
FT                   EASATVAKGGATEAARPAASNADASPRPTAPPVLSRKAGSGLVFPFAKRVPAALFERGG
FT                   IVTLVFATTEPVAVPPPGATGLVALAPPQRSGGFTILRFTAPAGRLVDLLPITEPAGWE
FT                   LATGDGLSPSESLTAQRAPTAQGRLGVSVRLPQAGPAGWLDLDGERIAVVATDGSRPAG
FT                   VVKAQRFVEFELIPSRLGLAVLANADDLIVRPDLDGVTIGREGAREGAREGRDGGLSVS
FT                   GISRPADPPVGAVMELAVDRDAWEKAQRGDVRATLREGLAAAVDAHRRDRGGARLGLAR
FT                   AMMANDLDVEALGALTSAAAEDVVIDGDRQTALMRGILLARIGRAEEARKLLSDERLAT
FT                   NPEARLWRGYADALVGRWNEAAVALRAGESVLERYPEPLASLFHAAAAEAAVETGDWEA
FT                   VTRESIAATRAATDYTRDRLTLLRAKMDEATGRGAAALAAYETLRNQAPWPLAAEATLR
FT                   AAALGHTLGKKPLPEAIDQLEVLALTWHGGPTEIGTLGALGGLYEEAGRWRKIFTTARR
FT                   ANALSPEAPIARALHERALAVFEDLFLGARGERLGGVEALALYFDFKDFAPAGRRADEI
FT                   VRRLADRLVALDLLESADELLQYQIDHRLEGAARSSVSARLATIRLMEGKPLQALQTLD
FT                   ATHLPELPEDVRRARAMLRARALSDLSRTDLALETVEGETGADAERLRADILWAARRWR
FT                   EAGEAHEMILGPAWRSGKPLDDTARADVIRAGIAYGLAGESLGLERLKAKFAGPMAESA
FT                   DARTFAMLTRPDAPRSAAFRDAALRATKAETLAAFLSEYRKRYPDSAVPEPGSAATGNR
FT                   AEAPSPPPG"
FT   CDS_pept        complement(461072..461503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0501"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0501"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22160"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22160.1"
FT                   /translation="MKHLAIAAAILFAWPLSAGAESPAAPDTVKTSPEAASPAPDAAPK
FT                   APQTAQERQEANAAKLAGLVRFVGESCKEAQPDYERFKAVVSAMGVDLDAISKGELLMR
FT                   SMGYTEAYRKNVDESCRKAQEMFGEKGKAIPGLVLRKAS"
FT   CDS_pept        complement(461657..463804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0502"
FT                   /product="Peptidase S9, prolyl oligopeptidase"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.83"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0502"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22161"
FT                   /db_xref="GOA:C7C9J5"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22161.1"
FT                   /translation="MTFEPPPFALPPEAPVAETRPHVFELFGRRVEDPFAWLKAENWRA
FT                   VLKDPSALAPDIRAYLEAENAYAEAALSGSADLRKTLVAEMRGRIREDDASVPEPDGPF
FT                   AYYSRHREGGQHPLICRRPRTVHRIAEEPEDGEIGEQILLDGDREGEGLAFFEIAGAAH
FT                   SDDHRLLAWGVDTKGSELHTIRVRDLDTGEDRPEQVESTAGEAVWNAAGTAFFYVALDE
FT                   NHRPARVMRHRLGTDQAQDTTVYEEPDPGFFVNIGRTQSGTYLTVTASDHETAEVHLLD
FT                   RADDEGALACVAPREERLIYSVEHWGSYLVILTNADGAVDFKIVTCPLDATARENWQDA
FT                   VPYRPGVMIRHLHVLGNHLVRLELENALPRIVVRDMKGEEHTVSFAEEAYSLGLLPGYE
FT                   FETARIRFSYSSMTTPAETYDYDCVTRARILRKRQSVPSGHEPADYVTRRLFATAPDGE
FT                   SVPISLLHRRGLALDGSAPLLLYGYGSYGTLMPAGFRTNLLSLVDRGFVYAIAHVRGGT
FT                   EKGWNWYLEGKREKKPNTFTDFVACGRALIEAGYTAQGRIVAHGGSAGGMLMGAAANLA
FT                   PELFAGIVADVPFVDVLNTMLDADLPLTPPEWPEWGNPAESEEAFKTILAYSPYDNVAA
FT                   KAYPAIFALGGLTDPRVTYWEPAKWVARLRATMTGGGPVLMKINMEAGHGGAAGRFDRL
FT                   EEVGLIYAFALMAAARAAKRV"
FT   CDS_pept        464233..464670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mucR"
FT                   /locus_tag="METD_I0503"
FT                   /product="Transcriptional regulatory protein mucR"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 10656595, 11481430,
FT                   7756693; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0503"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22162"
FT                   /db_xref="GOA:C7C9J6"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22162.1"
FT                   /translation="MNETETPVDYVALTADIVAAYVSNNPVPAAELAGLIGNIHGALIQ
FT                   VGTGRAATPQPVAQEALQPAVPIKKSIQPDYLVCLEDGRTFKSLKRHLRAKYNLSPEQY
FT                   RAKWGLSPDYPMVAPNYAKARSDLAKAIGLGQVRPGYDAAA"
FT   CDS_pept        464821..465015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0504"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0504"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22163"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22163.1"
FT                   /translation="MSDDSPSEQLAKTNEALAEWAARSACDSDRLIDRFEQMGYAVRGK
FT                   SEDEIAEILKKPPTKPFQA"
FT   CDS_pept        465152..465976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0505"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0505"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22164"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22164.1"
FT                   /translation="MNKTGGLGREAERLLAALAPEGAYAFPDPSAPETLIVRSGGRGVS
FT                   LGAGRFPVRAGEALVAADLASRDDGRRNRLVIGAAGRARLRRAEIGGPDSFRLQHLAVV
FT                   REGTGDGERVRDTAESPLAWMARRRGRDGEPMIDAAAFAAGERLRHDLASAQMMPQLST
FT                   DWTAPRVDGGGPRDPSSGSDRVIAARQRVDLALAAVGSDLSGLLIDLCGFLKGLERIEA
FT                   ERRWPARSAKVVARIALGRLAEHYGLAREATGPERARTRAWRLKTDQPPASS"
FT   CDS_pept        complement(466014..466442)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0506"
FT                   /product="putative sulfur acceptor protein sufE"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0506"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22165"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9J9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22165.1"
FT                   /translation="MLPDLDTIIENFEILDDPMDRYEYVIELGKLMPKMPEAAKVEDNR
FT                   VSGCESQVWIDVSLKKDAGHPALKLEGDSDSHIVKGFVALMVALYEGKTPDEAIKADGF
FT                   DLLKRLDFGSHITSKRSNGVRAMVDRIRKDAGRLQTLN"
FT   CDS_pept        complement(466531..467610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0507"
FT                   /product="protein of unknown function; putative sensor
FT                   protein; sensory_box: PAS domain S-box domain"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0507"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22166"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9K0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22166.1"
FT                   /translation="MGADTPQGGLSGNHGADTPFDLGDGFRRFADHVPLMMWRTDESGR
FT                   STYHNECWLQFTGRPLAEEIADGWRGGVHPDDFKRHAEIVEKAVESRLPFTVEFRLRRH
FT                   DGAYRWLLDTGRPLEENGVFHGYLGSCFDITDRKNAEEHAEHALVEKETLLAEIYHRVR
FT                   NNLQVMVSLIGLYGRAAPEACRGSFDALGQRVRAIALVQQHLHEAPHIASIDLRDYLHR
FT                   LASGLGQLRRAGRIGVTVEGDGTSLVEPRTANALGMIVAEVVAECLDATTETVTCGISI
FT                   RIDAAAGAPVRLSVISGAGEAAAAGREGVPKLGPRLIAAYAAQAEIAVCGTATEADPLH
FT                   LQLPEVRADVAPTISPSLS"
FT   CDS_pept        complement(467763..471431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0508"
FT                   /product="putative sensor hybrid histidine kinase with
FT                   multiple PAS/PAC, GAF and response regulator receiver
FT                   domains"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0508"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22167"
FT                   /db_xref="GOA:C7C9K1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7C9K1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22167.1"
FT                   /translation="MRNGEGVPASLRFLEEGGQTGREILAYPWSDTPLGPLEDWPVSLR
FT                   TTLATMLACPAAMFLAWGPEGISFFNDAYRPVFGDRLPRALGARFREIWADLWEDIGPL
FT                   VDAALRGESVAQRNLPLLMDRYGVPEESWWSFTYSPVRDDAGRINGMICVTAETTAEVL
FT                   AERARRRSDERLEMALSAGGSIGIWDWDVSADRVTADPRFAALYGVDPEMAAAGAPIAA
FT                   FFSGVHPDDLPSLKASIGAVFGTGGQFDAEYRLVQGDGSIRWVAARGRCTLGEDGTPRH
FT                   FPGVSFDITERKRIEQALRDSQDRFRGIINSVDQMIWSTRPDGYHDFYNERWYAFTGVP
FT                   AGTTDGEAWNGMFHPDDRERAWAAWQHALATGENYQIEYRLRHRSGLYRWVLGRAQPVR
FT                   DADGRIVRWFGTCTDIHDRKLAEERQAFLLGLNDRLREADEPQAVTLAAAATLGAHIGV
FT                   ARAGYGEIDETGEIVRVERDWTRDPSVPSLAGASRILDGFGPAVIAELRAGLTLVVEDC
FT                   YADPRAGHDYAATWDSIGCRSLVVVPLIREGRLRAILYLHEPKPRVWRAEEIGLVEDVA
FT                   QRVGHAAERARAEQAERANARELRLIADSLPVLIALFDADGVCRFANAASADWFGVAPA
FT                   ESVGQTLAALIGPADFAEARPRFESARAGRDVRAERAWPRRDGSPRIADIRYLPRPMPD
FT                   GSTDGAYLFVTDISDAKRIEAMLEREVGERTRERDRLWQTTNDLMGTAGLDGHLRSVNP
FT                   AWGRLLGWSEQELLERPFLDFIDPEDHAGTGAVLARLAGSDQITDFVDRILSKDGRRRT
FT                   VMWTAVPESGCFHIVGRDITDQRLAEEQLRQAQKMEAVGQLTGGIAHDFNNLLTGIIGS
FT                   LDLMQTRIAQGRIDTLERYAGAALTSAHRAASLTHRLLAFARRQPLEQKPVDVNALLAD
FT                   MEEMLRRALPEQVHLDIVATEGVWPTLCDPHQLENAVLNLAINARDAMPEGGRLLVETS
FT                   NAHLGPADLRLHSGAREGAYVCIRVTDTGHGMPPEVAARAFEPFFTTKPLGMGTGLGLS
FT                   MIYGFARQSEGHARIVSEPGRGTTVTICLPRYRGALSSERASALPPEPARSERNETVLV
FT                   VEDELVVRDLVVEVLRELGYRAIEAPDGPSGLEIVRSSARIDLLVTDVGLPGLNGRQLA
FT                   DHARTLRPELRVLFMTGYAENATFGGGPLDPDMQMITKPFPVERLAARIREMMELS"
FT   CDS_pept        472118..472627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0509"
FT                   /product="protein of unknown function; putative PYP-like
FT                   sensor domain (PAS domain)"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0509"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22168"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22168.1"
FT                   /translation="MNTDDFAYDFDAPDSDWNYEPSRADLFRQIDAPLYTTDSNGWLTY
FT                   YNEAAAQLWGFRPVIGKARWCGAWRLFEADGAPLPHDLSPMALTLKGARAVRGVQIGLE
FT                   RPDGSRMAFLPYPTALRDGTGAVVGGCNILLAVERSSLRVPLRGALQGRPTLRAAQLAS
FT                   MHRCSA"
FT   CDS_pept        472743..472907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0510"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0510"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22169"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22169.1"
FT                   /translation="MSVDTNWSLDAVQSLRSMAREGIPLSVISLRLKRPVDAVCAKLAE
FT                   LGITPKLEL"
FT   CDS_pept        complement(472954..473376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0511"
FT                   /product="lactoylglutathione lyase (gloA-like)"
FT                   /EC_number="4.4.1.5"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 10882093; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0511"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22170"
FT                   /db_xref="GOA:C7CAE5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22170.1"
FT                   /translation="MVRVADLDRALAFYVDAFGLKEVRRVENEKGRFTLVFLAAPGDVE
FT                   RAEATKSPLIELTYNWDPETYSGGRNFGHLAYQVDDIYAFCQRLKDAGVTINRPPRDGY
FT                   MAFVRSPDGISIEILQKGGAKPPQEPWASMENTGTW"
FT   CDS_pept        473817..474725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0512"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0512"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22171"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22171.1"
FT                   /translation="MMAGSIIRGVGEVEHATPEQILAHPDFAAARRVFVSEHAKVYEAG
FT                   VFPAQFGADAGRVTTLAIIVCQHANYDPADRATWPTLSLLKETVARFGFASPRLIDSFV
FT                   ARLVQTNYLELRQQPGDSRVRLLFPTERLLAWDREWKAAHYAPLDILYPDPGFEPARRR
FT                   DLDFQAAHARSAVAAFDAIIAMMWSNLEIIVFLSSTSALIILLTLSEMGGSGPDSRIRG
FT                   SDLVHLAPRFAVSLSHVRNILAVAQERNFLVRSGPRNAYIHLTPHWVAAFDRFIAGSLA
FT                   QSDLTYRLALRHQAKQAVSTA"
FT   CDS_pept        474804..477440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepN"
FT                   /locus_tag="METD_I0513"
FT                   /product="aminopeptidase N, a cysteinylglycinase,
FT                   (alpha-aminoacylpeptide hydrolase)"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.11.2"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0513"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22172"
FT                   /db_xref="GOA:C7CAE7"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR012779"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024601"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035414"
FT                   /db_xref="InterPro:IPR037144"
FT                   /db_xref="InterPro:IPR038438"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22172.1"
FT                   /translation="MRTETPPTVRLEDYRPSDHLIDRVELDVRLDPHDTRVTATLALRP
FT                   NPAGRAGAPLVLDGDDLTLLALELDGQAPASDAVRADASGLTLHRPPQRPFTLRIETRL
FT                   DPTANTQLMGLYRSNGVYCTQCEADGFRRITYFLDRPDVLSVYTTRIEAEREAAPVLLG
FT                   NGNPVEAGTVPGTDRHYAVWHDPLPKPAYLFALVGGRLDRVAKPFTTMEGRTVEIAVYV
FT                   EPGKADRAAYALDAVERSMAWDETAFARAYDLDLFNVVAVSDFNMGAMENKGLNIFNDK
FT                   YVLASPETATDGDYAAIEAIIAHEYFHNWSGNRVTCRDWFQLCLKEGLTVFRDQEFSSD
FT                   MRSRAVHRIAEVRNLRARQFPEDAGPLAHPVRPKQYAEINNFYTATVYEKGAEIVRMLR
FT                   TLVGETAFRAGMDRYFADNDGTAATVEDFLKAFEAVTGRDLSRFAEWYERPGTPRVAVS
FT                   SSYDPAARTYRLAFRQTRPGAGADAPPLVIPIGLGLVGPDGPLDSPHAERVEDGVFVLE
FT                   TAEDAVTFENVTVEPVPSLFRAFSAPVRVESPLDDAARLTLLRHDPDSFNRWEAAQRIA
FT                   LGLMTAQVRGETAGDAGADDFVVALGAFLDAEALRDPAFAAQVLALPSEGDLADEIGTE
FT                   IDPDAIFAARRDLRRRLGTGLRERLLSLREALAEPEGTPFSPDAAAAGRRALRNAALDL
FT                   IAAADSEAGTALAQAQIAQATNMTDRLAGLAALALLPGEAREAALSAFAERYANEPLVL
FT                   DKWFAIQAMIPEDGTVARIRRLQGHPAFANTNPNRVRSLVGSFSLANPTQFNRADGAGY
FT                   ALVAETVLALDGTNPQVAARLMTAFGPWRRLEPVRRAAAESALRRIAATPGLSRDVTDI
FT                   GTRSLAG"
FT   CDS_pept        477626..479986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0514"
FT                   /product="putative PAS sensor signal transduction histidine
FT                   kinase"
FT                   /function="13 : Signal transduction"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0514"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22173"
FT                   /db_xref="GOA:C7CAE8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22173.1"
FT                   /translation="MSGAVSASLSARARADTILGIQRTTGTAQARLIRAETWLRYALPA
FT                   LLVVFMLTLLGVAALQMRGRHDEAMRVATREVEAFARLAALALSNASSAAETRLERVLP
FT                   VHLLPAGREVLVIGPGGRIRAAYPAPAPAETFAGYLADGEPIAILGESAGAMTVNLQAG
FT                   GQAVVAARRLSDGMGEVAVVQRFEPLADNWWRMFGHHAVSLSAIALVLAGMATAYILQT
FT                   QRAQAADEVCDLVKQRLDTALGRGRCGLWDWDIARGTIFWSDSMYALLGYTPEKDLLSF
FT                   GDVNALLHAEDGDLYSLARHLAASHATVDHEFRIRDASGEWIWLRTRAEIVEDAVDGSR
FT                   HLVGIAMDVTEQRRLAEFTATADMRLRDAVEAVSEAFVLWDASNRLVLCNSKFRDLHAL
FT                   ASEDAVPGRRYDEIMGRGALPPVRRGIPGSERGPSRTFEVELTDGRWLQVSERRTKDGG
FT                   YVSVGTDITSLKRHQEQLVTSERELIETVKDLKRSRRTLETQTQQLADLAERHLDQKAR
FT                   AEIANQAKSEFLANMSHELRTPLNAIMGFAELMESEVYGSLGSPRYADYCRDIQQSGTY
FT                   LLSVIDDILHMSRIEAKRVKLVRRDIDLGTALNSALTLVSKEAASKSVSIDLELAGTLH
FT                   VLADERALQQILLNIIQNAVKFTPEQGRVALRGRSCNGFVHLFIGDTGIGIPKTAISKL
FT                   GRPFEQVETNLTRSYKGSGLGLAIARSTAELHGGSLRIRSEEGIGTLVLVRLPMPTPER
FT                   LAEVAREAERDTLQAIGEMTGVARTEGDRIAAL"
FT   CDS_pept        480393..481319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rocF"
FT                   /locus_tag="METD_I0516"
FT                   /product="arginase (arginine amidinase)"
FT                   /EC_number="3.5.3.1"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 2806247, 7540694, 9375792;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0516"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22174"
FT                   /db_xref="GOA:C7CAE9"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR014033"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22174.1"
FT                   /translation="MPAPSTIDLIGAPIEIGTSEPGAVMGPAALRTAGLLRVLRDLGFT
FT                   VRDQGDLAPDCTPGQRDLPAIRAWMTEISRAVETALDGGSLPLVAGGDHSLSLGSIDGA
FT                   LRHCGRTGRPVFVLWLDAHADFNTLETSPSGNVHGMPLAALCGEPGFDDLFAGGERPLL
FT                   DPRRIHLFGLRSIDAGERAIVTQRQVNVIDMRTIDEFGVVAPLRRILDRVAAANGHLHV
FT                   SFDVDFLDPAIAPGVGTTVPGGATFREAHLIMEMLCDSGLVGSLDVVELNPFLDERGRS
FT                   ARALVELVASLFGRRIIDRPTEPPLEA"
FT   CDS_pept        complement(481412..482890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="METD_I0517"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase (G6PD)"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /EC_number="1.1.1.49"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 17631881, 9537370; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0517"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22175"
FT                   /db_xref="GOA:C7CAF0"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22175.1"
FT                   /translation="MATIIPVSPFDYVVFGATGDLTQRKLLPALYQRYRDAQIPETSRI
FT                   IGASRSHMSVEEFREHARDALKSFVPPAEIDDARLAGFLDHLFYVAIDALGDEGWDDLK
FT                   RLLDERPDRIRPYYLATSPDLYGAICRNLDRYGLIGENSRVVLEKPIGKDLKSARAIND
FT                   AVGAVFPESQIFRIDHYLGKETVQNLLALRFANTIFERLWNADVIDHVQITVGETVGVE
FT                   GRGGYYDTSGALRDMVQNHILQLLCLTAMESPISLDANSVRDEKLKVLRALKPITAADV
FT                   QSVTVRGQYVAGAVSGRPVESYHTDLGSNAASRTETFVALKLEVRSGRWAGVPFYVRTG
FT                   KRLPKKLSEIVVQFRASPFSIFPNDAFGREPNRLVIRLQPEEGMKLEVMTKDPGPGGMR
FT                   LRPTNLDISFEETFKQRYPDAYERLLMDVVRGNATLFMRRDEVEVAWAWADTLLKAWAD
FT                   RPDPPRPYAAGSWGPTASIALIERDGRTWHEEIG"
FT   CDS_pept        complement(483161..483598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0518"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0518"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22176"
FT                   /db_xref="GOA:C7CAF1"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22176.1"
FT                   /translation="MPDSQPPFADFPFDLTAAETAAQVEAALVARREERTSTNWIALIR
FT                   LFDGTEIPCNVKDISKSGAKLGVPATYELPSAFMIRIIGRDFVLRVNLAWRRGNYAGVR
FT                   IERIAKLPVVEEKKAPAAELASKPTPNYSSIGTRRSRISPD"
FT   CDS_pept        483989..484150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I483989D"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01964.1"
FT                   /translation="MSELIRVKPTQDGTYTVYRGSMALVAGLTRLQAERYEASIAHQQR
FT                   SFSPLVGA"
FT   CDS_pept        complement(484230..484553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="METD_I0519"
FT                   /product="copper binding protein, copper sensitivity"
FT                   /function="6.5 : Electron transport"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 7623666, 7623667;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0519"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22177"
FT                   /db_xref="GOA:C7CAF2"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22177.1"
FT                   /translation="MERPLLVYTTFPDAPTALEIGEALVRARLAACVNVIPGMQSVYAW
FT                   KGAVERGTEVVAILKTREGLADALAAELKRRHPYETPIILHLPVSGADPDTAAWIASET
FT                   GLG"
FT   CDS_pept        484659..485429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppnK"
FT                   /locus_tag="METD_I0520"
FT                   /product="putative inorganic polyphosphate/ATP-NAD kinase"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /EC_number="2.7.1.23"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 11259647; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0520"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22178"
FT                   /db_xref="GOA:C7CAF3"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22178.1"
FT                   /translation="MPRRFSRIAFVASPTADAREAADLLMRRYDHVSPEEADVVVALGG
FT                   DGLMLQVLHRFMDAPKPIYGMNRGTVGFLMNEFREEGLLERLEATKRSTIHPMTMIATD
FT                   TEGNSHTARAINEVYMLRQTHQTAKLRVSVDDHVRLPELIADGILAATPAGSTAYNLSV
FT                   GGPILPLNAHLLALTPISAFRPRRWRGALLPNHARIRIDVIDAEHRPVAAVADHTEFRR
FT                   VCTVETWLDHATDLVLLHDPGHSLEERILREQFG"
FT   CDS_pept        complement(485498..485725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0521"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0521"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22179"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22179.1"
FT                   /translation="MKEIGMTQADAKEKDADSRALSPAAQRALAEAAERRAAIDARAAK
FT                   IAERPETLGRGGLEPVRYEDWEVKGLASDF"
FT   CDS_pept        485815..487179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="METD_I0522"
FT                   /product="16S rRNA m5C967 methyltransferase,
FT                   S-adenosyl-L-methionine-dependent"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 14656444, 8412700,
FT                   8432722, 9086272; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0522"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22180"
FT                   /db_xref="GOA:C7CAF5"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22180.1"
FT                   /translation="MAPTPNRRPPPPFDPSVPGLAARHAAREAVATLLGPARGLALEDA
FT                   LAQAARGAGLDTGEAALARAIATASFRRLGFIKAALAARLRDGLPEDRPHLLALLVTGA
FT                   AQILDLAVADHAAVDLSVRLAKADPQLQHLVPLVNAVLRRIARERDAIRAQESDPLAHN
FT                   TPDWLARRWQAAYGEEAARRIAVAHLEGAAVDLTVPHDPEIWAERLGGIRLDLGSVRLA
FT                   EVRQAVAELPGYAEGAWWVQDAAAALPVRLLAPVSGERVVDLCAAPGGKTAQMAAAGAA
FT                   VTAVDRSAVRLERLGRNLERLGLSAEVVTADALALPEDAPFDAVLLDAPCSATGTIRRH
FT                   PDVVWTKSEADVVRLAGLQRRLLDKAARLTRPGGRLVYCTCSLEPEEGSAQVAAFLARN
FT                   PDFERIAITPDRLSGHAELIDASGDLRTLPSHVVGGIGRAGGLDGFFASLLRRRD"
FT   CDS_pept        complement(487239..487403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0523"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0523"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22181"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22181.1"
FT                   /translation="MIALLSLVSLTCGLALAGQAPRFPGWTARMEMAGGLSLVTGLATV
FT                   GAGLKAYCI"
FT   CDS_pept        487750..488784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0524"
FT                   /product="conserved protein of unknown function precursor;
FT                   putative membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0524"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22182"
FT                   /db_xref="GOA:C7CAF7"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22182.1"
FT                   /translation="MLAGAAGFLIFGTGAASAHVKWFCAFDVAGQPRGLEQVLCADFEL
FT                   LTGLALVCLMFGCLMEGTPLGTALLNALDRVTASARVHSGLIVRAVVGFFLVSLWNLGG
FT                   IILTPELKTDATWIPWLQLAMAAGLLWKRTLPFTAAGIVFLFGFAVWNYGVFHLADYPV
FT                   FLGVAAFLALTALDRDLFGQRPIDVVRIAAAITLMWASVEKWAYPHWTDPLIAAKPAMT
FT                   MGASPELFMQAAGIIEFTLAFALIWTPLVRRASAIILTAVFISAIFEFGKVDAIGHSGI
FT                   IAVLIAIAADDVRVPATRRDVVLAPVYYASALMLFLGVYYFAHEALFGDGYRIGASMAG
FT                   LPVI"
FT   CDS_pept        489158..490351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0525"
FT                   /product="putative 2-amino-3-ketobutyrate coenzyme A ligase
FT                   (AKB ligase) (Glycine acetyltransferase)"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0525"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22183"
FT                   /db_xref="GOA:C7CAF8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22183.1"
FT                   /translation="MRHREQTDATDRDRTDGVHLLPKAASFGDRPLRGLDFASQDCLGL
FT                   STHPEIVATAADTLRRFGVRSVCAAAEAGDPGLSVALERRIADFLQMEEALLCATGRAA
FT                   ARTVIRGLVRSTDHVVIDAAIRSGLRESAEAATAHLHPFRHLDAEHCRARLRAIRARDA
FT                   ENGILVVTESLSPLDSGTPDLAALRTLCDEYGATLLVDVTQDLGCLGEDGRGHLGLQDM
FT                   LGKADLVTGSFTKSFASNGGFVAARTRAVTACLRAAEADAQALSPIQIAVLLKAFTLID
FT                   EADGCERRARLMRNVLNLRTALRERALTVCGEPCTSVSVAIGSGELARLAAPRLIELGL
FT                   LVDLTASGEASRLRMHVTAEHSDADIARAALGVAEALDRARADLAERSRRPNLLVAA"
FT   CDS_pept        complement(490412..490741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0526"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0526"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22184"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22184.1"
FT                   /translation="MFRTMYPQEAVGHAHALIGAYETAHSGLARISHEFRRDLCLALDR
FT                   LGPGAAPYLRVVRSDLEDRTSAARATWPLWIDRLTDPMIDRRLIASRALLDAVESEADA
FT                   RGMIL"
FT   CDS_pept        491087..492019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="METD_I0527"
FT                   /product="malonyl-CoA-[acyl-carrier-protein] transacylase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="2.3.1.39"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 7768883; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0527"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22185"
FT                   /db_xref="GOA:C7CAG0"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22185.1"
FT                   /translation="MTRAFIFPGQGSQAVGMGKALSEAFPAARQVFEEVDAALGQNLSR
FT                   LMFEGPSDELTLTANAQPALMAASLAVLRTLEAERGLDLARDAAFVAGHSLGEYSALAA
FT                   AGTFSISDTARLLRIRGEAMQRAVAPGIGAMAALIGPDLATARDIGGEAAEGLVCDVAN
FT                   DNGGGQVVLSGHREAVERAMALAQSRGVRRAVLLNVSAPFHCALMAPAAEAMRRALAEV
FT                   PMHAPAVPVYANVTAGPLTEPDAIRNALITQVTGTVRWSESVAAMAEAGVDRFFELGAG
FT                   KVLTGLVKRIAPSATASAVGTPDDVAAYA"
FT   CDS_pept        492128..492868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="METD_I0528"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 11669613, 1314802; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0528"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22186"
FT                   /db_xref="GOA:C7CAG1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22186.1"
FT                   /translation="MFDLTGRKALVTGATGGLGGAIARALHAQGAHVALSGTRRAVLDE
FT                   LAAELGGERVAVVEANLADKEAVEALLPAAESALGGLDILINNAGITRDNLFMRMKDEE
FT                   WEAVLNVNLTAAFRLSRAALRGMMKRRHGRIIGIGSVVGATGNPGQGNYAAAKAGLVGM
FT                   TKALAAEVATRGITVNCIAPGFISSAMTDALNEKQRETILTRVPAGRLGTGAEIGAAAV
FT                   YLASEEAGYVTGQTLHVNGGMAMY"
FT   CDS_pept        complement(492843..493034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0529"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01965.1"
FT                   /translation="MFDRAWFGKSRNPLNRQLPCTAEPGVNTGFPLWRVAVQKAFIAVV
FT                   FRLEHLFVDILSTSPCRH"
FT   CDS_pept        493132..493368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acpP"
FT                   /locus_tag="METD_I0530"
FT                   /product="acyl carrier protein"
FT                   /function="3.1 : Biosynthesis"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10784042, 8359454; Product
FT                   type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0530"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22187"
FT                   /db_xref="GOA:C7CAG2"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22187.1"
FT                   /translation="MSDIAERVKKIVVEHLGVEPEKVTEASNFIDDLGADSLDTVELVM
FT                   AFEEEFNVEIPDDAAETIQTVGDAIKFLEKNSA"
FT   CDS_pept        493507..494769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="METD_I0531"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="2.3.1.41"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 9013860, 9482715; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0531"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22188"
FT                   /db_xref="GOA:C7CAG3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22188.2"
FT                   /translation="MRRVVITGLGMVSPLGGSVEHTWSRLIAGDSGASAVTAFQTDDLA
FT                   CRIACTLPFGDGSNGTFNPDLWMEAKEQRKVDPFIVYAMAAAGQALDDADWHPKSDADQ
FT                   EASGVLIGSGIGGIGTIYDASVTLHEKGPRRISPFFIPGRIINLASGQVSIQHGLKGPN
FT                   HAVVTACSTGAHAIGDASRLIALGDADVMVAGGTEAPVNRLSLAGFAACRALSTGFNDQ
FT                   PTKASRPYDRDRDGFVMGEGAGIVVLEEYEHAKARGAKIYAEVIGYGLSGDAYHITSPA
FT                   PDGDGGYRCMKAAVKRAGIDPSEIDYINAHGTSTPLGDELELKAVERLLGDAASKASMS
FT                   STKSAIGHLLGAAGAVEAIFSVLAIRDGVMPPTLNLDNPSVETAIDLIPHEAKRKRVDT
FT                   VLSNSFGFGGTNASLLMRRVA"
FT   CDS_pept        495032..496435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0532"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0532"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22189"
FT                   /db_xref="GOA:C7CAG4"
FT                   /db_xref="InterPro:IPR003770"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22189.1"
FT                   /translation="MFRRRQEPPSPPPASEEPSLPNRPSPRSPSEAIKPTVAPAPPEKP
FT                   ERRRGGLLATISGFLTLGVVLALGALIGLTLLNRQTSEPGPLSADKVVVIPSRSGTSEI
FT                   ASILAREGVIDHPSLFEMSARFGGKGPLKHGEYMFKAHSSVKDTIETLTNGRQVQHAIT
FT                   FPEGLTSEQIVARLGDNDILSGEISETPPEGSLLPDTYKFERGATRQQILNLMRSKQRE
FT                   VLNQIWQRRSPEVPVKTPAEMVTLASIVEKETGRADERPRVAGVFVNRLQKRMKLQSDP
FT                   TIVYGLVGGRGTLGRGIMRSEIERATPYNTYVIEGLPPGPIANPGRAALEAVANPSRTK
FT                   DLFFVADGTGGHAFADTLEGHQRNVTRWRQVERSRQQSQPADPGAVDKVDPNTAEPNAG
FT                   QPGAAPGRASAYAPGSNSAFAIDGASDGGAGGPRPKAFDASEGTRLDPLRNKTYDLGSP
FT                   KTVPALRNP"
FT   CDS_pept        complement(496465..497181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0533"
FT                   /product="putative haloacid dehalogenase-like hydrolase"
FT                   /function="6.11 : Sugars"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0533"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22190"
FT                   /db_xref="GOA:C7CAG5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22190.1"
FT                   /translation="MLTAVIFDVDGVLVDSPHEQAWREALAGFADPAGFTTAFYQAHVA
FT                   GKPRLEGARAALERLGDAEAAAHAAAFAERKQAVIDRLIAEDRFVAFPDAIRLAVALRD
FT                   AGLRIVLASSSKNADAVLARMVLPDGRTLRSLFDADVSGRDVPRGKPDPTLFLLAAKVV
FT                   NVPPAECLVVEDAPAGIRAAQAGGMASLGIARLGDEALLRAAGADLVVTSLDQLDIAAL
FT                   GSGSLRTRSVEAAHEP"
FT   CDS_pept        complement(497195..499582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0534"
FT                   /product="putative glycoside hydrolase or sugar
FT                   phosphorilase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0534"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22191"
FT                   /db_xref="GOA:C7CAG6"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22191.1"
FT                   /translation="MLRPRLIPPTDMFPPNPWAVEAVRYDGRMARELTGQAETMFALSN
FT                   GYLGMRGVTDEGMPVREPGTYLNGFYEYRPIVYGERAYGFPTVGQSILNCPDGTVLKLS
FT                   VDDEPFTLPEAEILSYRRVLDFRAGTLSRDVSWVTPAGKRLNLRTLRLVSFAHRHLAAI
FT                   TYELTAENAEVAVVIASELRNDQPLATDTSDPRLAEGFVGRVLHPTGTQSEALRSILSY
FT                   RTGSSGLVLGCGMDHVVTADCPLAVRAACDDDLATVVLRGVLAPGGVIRIQKYLSYHYS
FT                   GSAAPEQIRSQVAWTLDHAVESGISSIVARQRRDMDRFWERADVTVESASPRIQQAIRW
FT                   NLFQLMQASERAEGHGIAARGLTGRTYEGHYFWDTEVYVLPFLIYTNPPMARSLLKVRY
FT                   DMLDCARDRARELGQRGATFPWRTINGREASAYYAAGTAQYHINADIAYALRKYVEVSG
FT                   DVDFLCRYGAEILVETARLWCDLGFFSERMGGRFCIHGVTGPDEYTALVNNNCFTNLMA
FT                   RENMRYAAQTVRMLERDHPGSFDALVRRTGLDPDEPDAWDQAAELMYLPYDEALKVHPQ
FT                   DDTFLELEKWDFAGTPEDHYPLLLHYHPLNLYRAQVIKQADMVMAMFLLSEQFTPEAKQ
FT                   RNFAYYDPLTTHDSSLSVCIQSIVANEIGLREKAFHYFNFAVAMDISDIGGNMMHGAHI
FT                   AAMGGTWLALVYGFAGMRDTGGRITFNPCLPDAWTRLSFTLTVRGQTIRVSLSHASATY
FT                   SLLAGDGLTLWHVEEGVRLSGAEPSVTKAIRRPAGEDHAAEP"
FT   CDS_pept        500447..501649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0535"
FT                   /product="putative acetate kinase (ackA)"
FT                   /EC_number="2.7.2.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0535"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22192"
FT                   /db_xref="GOA:C7CAG7"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22192.1"
FT                   /translation="MRDSILVVNAGSSSIKFKLYRIEGADLAPSLSGGMSGIGGTPSLK
FT                   VTDGSGALLEDRRLEAGEVPDASAAQHHLADWLVHHLGDTTVVAVGHRVVHGGADFTEP
FT                   VLIDDAVLRRLETFIPLAPLHQLGNLDPIRVLRERRPDLPQVACFDTSFHRGHPELSDR
FT                   FALPRFLHDEGVRRYGFHGLSYEYVARRLREIAPEVANGRVVIAHLGSGASLCALKEGR
FT                   SQETTMSFTALDGVPMGTRCGALDPGVVLHLIEHRGMTPAEVGHMLYYESGLLGLSGLS
FT                   NDVRTLLASERPEADLAVTYFCRRVAQAAAALAVTLGGLDAFVFTAGIGENAPEIRRRI
FT                   IADLSWAGLILSNDANGSGVARLDASGSRAQIWVIPTDEELMIAKHTMRLLDRIASGAR
FT                   A"
FT   CDS_pept        501646..502677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0536"
FT                   /product="putative membrane protein, component of efflux
FT                   system"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0536"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22193"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22193.1"
FT                   /translation="MRRTRPGPRARGALLAILLATGFAVAAPPPSFAQSRLKQLIDRLR
FT                   GQKMPEGIAKSNGRIEATQVDVAAKYAGRISKLLVKEGDEVSAGQVVATISSPETEAQL
FT                   RGAQSQVLRAKKSLAEAVALIAQRNSDLTFADADYSRGKELVGKGYMAKQIFDQRKAKA
FT                   EAAKAALDAAKAQEDQAKFAVQSAEADVQRLEAMLVDLVLRAPRDGRVQYRLAREGEVV
FT                   GAGTRILTLLDLSDVYMTIYLPASQAGPLALNDEARIILDPVPQYVVPATISFVAADAQ
FT                   FTPKSVETEEEREKLTFRIKLQIDPQVLKTYRKRVKTGVRGIGFVRIKGNVAWPPDLAV
FT                   KLP"
FT   CDS_pept        502685..505423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0537"
FT                   /product="putative ABC transporter, fused tandem ATPase and
FT                   permease domains"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0537"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22194"
FT                   /db_xref="GOA:C7CAG9"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22194.1"
FT                   /translation="MTDAAEIARLDHVSHRYGRTVALDDVSLGLPAGRMVGVIGPDGVG
FT                   KSTLLALIAGVRRIQTGQVLALGGDMAERRHRAAQGARIAYMPQGLGRNLYPTLSVFEN
FT                   IDFHGRLFGQGQRERRTRITDLLTATGLEPFEARPAGKLSGGMKQKLSLCCALIHDPDL
FT                   LILDEPTTGVDPLSRGQFWDLIGSIRARRPGMSVVVATAYMDEASRFEWLVAMDDGKVI
FT                   ASGSPAELLERTAKPDMEAAFIALLPPEKQAQHKAVVLRPRPPGLDAEPAIEAEHLTRR
FT                   FGSFTAVDDVSFRIGRGEIFGFLGSNGCGKSTTMKMLTGLLPATEGTARLFGRPVGSND
FT                   METRRNVGYMSQAFSLYSELTVLQNLELHAQLYHLPPHDRPVRIRELLDRYELEPVKDA
FT                   RPDSLPLGIKQRLQLAVAVLHRPAMLILDEPTSGVDPIARDAFWRTLIDLSRDEGVTIF
FT                   LSTHFMNEAERCDRISLMHAGRVLAVGTPADLVRERGSTSLEDCFIGYLAEAAGIDREE
FT                   PAGPPADLPAASTRPAPHRHLFDPRRLWAYARRETMELLRDPIRIAFAFIGPMLLLVAF
FT                   GYGISFDVENLRFSAFDQDNSPESRQLTEAFTSSRYFSEQAPIRSATELDERFRSGTVQ
FT                   IALEIPPRFGLDLQAGRVPEVAVWLDGAMPFRAETSRGYVTSLASQYAQQLVIERTGAA
FT                   ASGKTVSVETRFRYNQAFRSVNAMVPSVMMLLLILIPAIMSAIAVVREKETGSIANFRS
FT                   TPVTKFEFLVGKQLPYIGIAMISFLLLVLVALIVFDVPVKGSFIALALGTLFYVSATTG
FT                   FGQFISTFMKTQVAAVFATALLSIIPAVNFSGLLVPISSLSGSARIIGLSLPPAWYQPV
FT                   TAGAFTKGLPFIELAPNIAVLAGFAFLFLVLSQLLLRKQEA"
FT   CDS_pept        505425..506624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0538"
FT                   /product="putative ABC-2 transporter, permease"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0538"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22195"
FT                   /db_xref="GOA:C7CAH0"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22195.1"
FT                   /translation="MAAPAQAPAQIPARAQVPAPAPLGFGTHVANVFRLIVKELRSIRA
FT                   DPVMLFLVVYAFSFAIVSVASGASTEVRNVSIGVVDEDHSDLSRQIVSAFNPPLFKDVV
FT                   SIGPEEVDPAMDTGRLVFVIDLPPRLQRDVLSGHPTSIELDVDATAMTQAGNGSVYIQT
FT                   IITQEIAAFAARSELNDTAPVRVVTRAKFNPNLQTSWFTSVMQVINNITLLTVILTGAA
FT                   LIREREQGTVEHLLVMPLVPVEIMLAKVIANGMVILVAAGFSLLIVVEWWLGVPIAGSI
FT                   ALFLFGAGLYALAVAALGILLGTIATSMGQFGLLVIPVLLLMQLLSGSSTPMESMPVWL
FT                   QYLVQTVSPTPHFVALAQAVLYRGADLSIVWPQLLALAALGSVYFAFALARFRRVIFGD
FT                   "
FT   CDS_pept        506704..509139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xfp"
FT                   /locus_tag="METD_I0539"
FT                   /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase"
FT                   /EC_number="4.1.2.22"
FT                   /EC_number="4.1.2.9"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 11292814, 11823225; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0539"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22196"
FT                   /db_xref="GOA:C7CAH1"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22196.1"
FT                   /translation="MTEPTNTQGRTAPSSATLGGEELALIDRYWQAANYLSVGQIYLLD
FT                   NPLLREPLQPQHIKSRLLGHWGTTPGLNFIYVHLNRLIKARDLDAIYICGPGHGGPGIV
FT                   ANTYLEGTYSEVYPDIAQDTEGMRRLFRQFSFPGGIPSHVAPETPGSIHEGGELGYAIV
FT                   HAFGAVFDNPDLIAACVIGDGEAETGPLAASWQSNKFLGPVTDGAVLPILHLNGYKIAN
FT                   PTVLGRMRDDELESLFTGFGYEPLFVEGDQPEPMHRAMAEALDRAVARIKDIQAEARGG
FT                   GMGFRRPRWPMIVLRSPKGWTGPKTVDGKRVEGFWRAHQVPVGNARTDDRHRQILEDWM
FT                   RSYRPETLFDETGRLRPELAALAPEGNRRMSANPHANGGLLRRELRVPRWQDFALTVSK
FT                   PGAEIGEATRTLGRYLRDVIRLNAEARNFRIMGPDETASNRLDAVFEATDRVWIENIEP
FT                   YDVSLAHEGRVMEVLSEHLCQGWLEGYLLTGRHGLFSCYEAFIHIVDSMFNQHAKWLKV
FT                   SRELGWRRPISSLNYLLTSHVWRQDHNGFSHQDPGFIDLVANKKSDIVRVYLPPDANTL
FT                   LWVADHCLQTYDRINVIVAGKQPQPQWLSAHEAGLHCEAGIGIWSWAGTDETGLEPDVV
FT                   MACAGDVPTLETLAAVDLLKQAVPGLRIRVVNVVDLMTLQSNRDHPHGLTDAAFDSLFT
FT                   RDKPVIFAYHGYPYLIHRLTYSRANHANMHVRGFIEEGTTTTPFDMVVLNELDRFHLAI
FT                   EAIDRVPGLVTRAAGAKQAFRDRLTAHKLYIREHGEDMPEIQGWKWPYETRQETGTPH"
FT   CDS_pept        509263..510393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0540"
FT                   /product="Salicylate hydroxylase (Salicylate
FT                   1-monooxygenase)"
FT                   /EC_number="1.14.13.1"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 11756688; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0540"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22197"
FT                   /db_xref="GOA:C7CAH2"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22197.1"
FT                   /translation="MDTQQAGRVLVAGGGIAGLAVRRALHQQGIPSLTLERRGVQADAG
FT                   LAINLPGNAMHALSRFGLLDALRAVGAPVRRREYRTERGRLLFAVDETAFWGTETGPHC
FT                   LRRADLLRLLQGDLPPGDIRRGVEIAAVRQRPQGVTAELADGSTESGGLLVGADGVHSA
FT                   VRRSLFGEQALGSAMLASQSWRFMTPNPGVEAWTLWAGAGALFLLIPVDRGEAYGWASV
FT                   SAGRERGSDPAAIRDAFAPFPRLVRDTLDAVLSQPDAIYHSPLEEVRIPAWTRDRVVLL
FT                   GDAAHATAPVWAQGAALALEDAQVLARLLAERADWNRVGPDYERLRRPRVAHVQIMTDR
FT                   LSRTARMPDWARNVLLPVVGPRSYRATYGPLRTPTG"
FT   tRNA            complement(510472..510545)
FT                   /gene="trnG"
FT                   /locus_tag="METD_MTRNA55"
FT                   /product="tRNA-Gly"
FT                   /note="Gly-tRNA (tRNA6); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   CDS_pept        510804..511862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="METD_I0541"
FT                   /product="putative sulfate/thiosulfate transporter subunit;
FT                   ATP-binding component of ABC superfamily"
FT                   /EC_number="3.6.3.25"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 2188958, 7665461;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0541"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22198"
FT                   /db_xref="GOA:C7CAH3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22198.1"
FT                   /translation="MSAASSSVRLDICGVSRRYGRMLALDDVSLSLSAGEILAVLGDSG
FT                   CGKSTLLRLVAGLDEPDAGEIHIDGRRIAGRGGGEPPETRGVGLMFQDYALFPHLTVLA
FT                   NVRFGLSHLPGARARTVARERLAEVGLAGRETSYPATLSGGEAQRVALARALAPRPRVL
FT                   LLDEPFSNLDAGTRERVRADTLAVLRQDGISAILVTHDAAEAVEFADRIALMRKGQLIQ
FT                   CDTAEALYRAPVSPFAARALGDVVTVAGLASGGRLATPLGTVALPSSRPDGAVQVCLRP
FT                   EAIRIVPRGEGVPGRVLRRNFAGGSTRIDVEIPGLDEPLRLTAAQEDHVDDRIELGLVE
FT                   GRILVFTECESA"
FT   CDS_pept        511965..512990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbpA"
FT                   /locus_tag="METD_I0542"
FT                   /product="ABC transporter, periplasmic protein precursor,
FT                   putative iron transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 16926146; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0542"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22199"
FT                   /db_xref="GOA:C7CAH4"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22199.1"
FT                   /translation="MLRLRRFGCFVGFSLAFALAGQAESAEVNLYTTREPGLIRPLLDA
FT                   YTAKSGVTVNTVFVEKGLAERVAAEGARGNADVVMTVDIGNLIELVDRDLAQPVRSAVL
FT                   EAAVPAPLRDGDGRWYALSMRARVLYADKALSDLNAATYESLADPKWRGKICLRSGQHP
FT                   YNTALIAAFLVRHGAEKTEEWLRGVKANLARKAAGGDRDVARDIAADLCEIGLANSYYV
FT                   GLMRSGRGGPDQQKWGEAIKVVLPTFEGGGTHVNVSGAVVAKHAPHREEAVKLLEYLVS
FT                   DEAQALYAKADFEYPVKAGVAADPMLQALGPLSFDTTPLVEIARNRKAASLLADKVGFD
FT                   N"
FT   CDS_pept        513067..514719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fpbB"
FT                   /locus_tag="METD_I0543"
FT                   /product="ABC transporter, permease precursor, putative
FT                   iron transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 9884235; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0543"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22200"
FT                   /db_xref="GOA:C7CAH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22200.1"
FT                   /translation="MTPARGFLYAAAALLAAVLLAPVASLAVAAADGSGELWPHLAAYV
FT                   LPQAIRETGLLLAGVGILVIGLGTGTAWLVSAFAFPGRRLLDAALLLPLAVPTYVVAYA
FT                   YLDLMHPLGPVQSGLRGLLGLSSPRDLSFPDLRSLPGCILLLGFVLYPYVYLPTRALFL
FT                   MRAGTLLEAARMLGAGPARTFFRVALPLARPAIALGTGLALMEALNDVGAAEFLGVRTL
FT                   TVQVYATWVNRSDLPGAAQIALVMLAGVVGLVALERLARGGRGYAGSGHRDRPTARRPL
FT                   SGWRAGLALGLGLTPVLLGFGLPAGYLAWAVWQRLNGMGLPDTLAAQALNTVLYAGAAT
FT                   LVTVAVGLLVAASPHLLGRRSGLALIRAAGLGYAMPGTVLAVGLLAPLALLDAGLTNLA
FT                   DAGLGWAPAVGLGTGAALVIAYTLRFLTISVGATEAGLARIPSTLPDAARMLGRGRFGT
FT                   LLAVQLPLAWPAVLSGALLTFVDMAKELPVTLLLRPLNVETLSTHLYGEAARGTYEDGA
FT                   ASALLIVMTGLIPVALLLRLNRDAGLRPSRSDA"
FT   CDS_pept        complement(514727..514828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0544"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0544"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22201"
FT                   /db_xref="GOA:C7CAH6"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22201.1"
FT                   /translation="MQLKPVSYAMIAVFACGLVMTFVGSMNVLLGGM"
FT   CDS_pept        complement(515142..515396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0545"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0545"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22202"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22202.1"
FT                   /translation="MKTRLAAVVAAVIIGVTAPASSVMAFDRNARPAATSDVEVTGSLG
FT                   VHDSPAHTACPMSSAAEGNANQQNFPVKQYGQTSGGTRC"
FT   CDS_pept        complement(515680..516378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0546"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0546"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22203"
FT                   /db_xref="GOA:C7CAH8"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22203.1"
FT                   /translation="MRQVFSPALRGILFKSLALTIGLLVVVWFGLTRLIQAFQASHHIS
FT                   ADYPFLDTLAFFLAGAGLFVALAYIMPAVSILVAGFFLDDVAEVVEHSDFPADTPGRAL
FT                   PWGQALGSAFRFAGLALLVNFVALILVFVPGVNLVAFFGANAYLLGREYFELAAGRFRS
FT                   LPEARAMREHYGFTVIAAGCLLAGLMIVPIVNLVTPLFGVALMVHLHKGLERRALPGPA
FT                   ETNPRLPNRR"
FT   CDS_pept        516565..517530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0547"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0547"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22204"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22204.1"
FT                   /translation="MARPALSRLVLLGSLLATVPATLPAAAHEVGAWAGASSAPAERSE
FT                   VAVAALDGKAYVIGDYNGATELLIYDLATDRWSKGAPFPYPVHHTMAAEQGGRVYVFGG
FT                   YVNGWEATDKVWAYDPKANAWEARAPMPTPRAAGGAAPLGDKIHVVGGSGSGRGNVRSH
FT                   EVYDPANDTWRTAADLPTPRDHLAVQMVEGRIVASGGRIDGDSSKNLAANQVYDPARDA
FT                   WSEAAPLPTARSGVASAVLGREVFVIGGESNRRTYDEVEAFDLPGNLWRALARLPTARH
FT                   GFGAVTYKGRVFTLTGSPRPGGDRSGTVEVLDPNGAAPAR"
FT   CDS_pept        517618..518946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0548"
FT                   /product="putative flavin containing amine oxidase"
FT                   /EC_number="1.4.3.-"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0548"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22205"
FT                   /db_xref="GOA:C7CAI0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22205.1"
FT                   /translation="MRPAPEHARFRPTVAPRVSPVPATPDVIVIGAGAAGIASARRLIA
FT                   RGLSVAVLEARERVGGRAVTTQLRGHAIDLGAHWMHAGPINPLVALARSRGEPLRRAAQ
FT                   HEHLWIGRRPARADEEAAFSRAFDVADHAITGAASRSQDGPAAGALPRHLGPWRERIAG
FT                   VHALVSGRPLEEVSLHDWPSMEYGDNFFIAGGYGAYLARLALGLPIRLGCPVAGLDWSG
FT                   PGVRVELADGGRLAARAVIVTVPMPVLQAAFRFDPPLPERTRAAIDGFLSGIYEHVVLH
FT                   WPSAPFHGRDRLASVVGGRHKPPGMLTRIDGTPFHYFELDTALTRALDAAGAGPDGARR
FT                   LARAVLAEHFGRAALADLAIPAVTAWRRDPWSRGSWAVVPPGHAAARATLQEPVGERIW
FT                   FAGEANSRAQWGTAGGAYEEGQRAADRVADTLTDDRAPLRASA"
FT   CDS_pept        519055..519690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0549"
FT                   /product="putative cyclic nucleotide-binding domain"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0549"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22206"
FT                   /db_xref="GOA:C7CAI1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22206.1"
FT                   /translation="MNWVEAIGYLGTALTVASSAMGTMIPLRIVALCASCAVITYGYLI
FT                   GSVPVMLTEAIQIPFNAWRLYEMVRLVRETERAASGDLSLDWLKSFGTSRRFRAGEVLF
FT                   LKGDPAHEMYLIESGRFRIAEHGLDVRPGQIVGELGMLSPGNRRTGSLACVEAGSARCL
FT                   SYSEVKQLYYQNPEFGFYFLKLTSERLFQSAAEAAGAQHTVPAGSDVL"
FT   CDS_pept        complement(519694..520113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0550"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0550"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22207"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22207.1"
FT                   /translation="MDEPGSAGHAVFDVAESVRRLPETAATMVADHRFTDDETASARVF
FT                   RVYRPTPPHYHTTCDEYLYALSGRCRMQFGDAAPVEVGPGMLVFFKRGVVHSVPEILEE
FT                   PVVFLSVDTPRRGPRDIQFVEAGTGTPDSFMRQPD"
FT   CDS_pept        520318..520524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0551"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0551"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22208"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22208.1"
FT                   /translation="MMRGYEGNAQVMADVATVIEQAQREGRDLATALRIARVTLAYVSG
FT                   PEPEPDQARALEALDRQLRALSD"
FT   CDS_pept        complement(520684..520797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0552"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /note="Evidence 5 : Unknown function; Product type n : RNA"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0552"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22209"
FT                   /db_xref="GOA:C7CAI4"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22209.1"
FT                   /translation="MENHELRESRAALILMGVAVLAVLLFGAVTLIVQAAG"
FT   CDS_pept        complement(520951..521241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0553"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0553"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22210"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22210.1"
FT                   /translation="MSLPNPAKNASDHDVQTILFGLLADGSGEARFAGAPIEPAGPSSE
FT                   AARFSPSRDWYGRWAVQPLHGILKQDATRMDRVVCPEDIVILGPRRHARRF"
FT   CDS_pept        521894..522943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysP"
FT                   /locus_tag="METD_I0554"
FT                   /product="ABC transporter, periplasmic protein, putative
FT                   sulfate/thiosulfate transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 15188393, 16926146; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0554"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22211"
FT                   /db_xref="GOA:C7CAI6"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22211.1"
FT                   /translation="MFDGYPIKPGATPYRRAVLLGLAMTVCLASAGSAQAQSEILNVSY
FT                   DPTRELYREVNAAFAEEWKAKTGETITVRAAHGGSGAQARTVIDGIPADVVTLGIPSDI
FT                   DAIAKISKKIPADWRTKLPNEGLPYTSTVVFLVRKGNPKGVKDWDDLAKPDVKVITPNP
FT                   KTSAGGRWNFLAAWGYAYEREGRDKEKANAFLGALYKNVPVLDTGARGSTVTFAQRGLG
FT                   DVLPTWENEAFLVLEEFGKDKFDIVVPPTSIYAEPPVALVDANVDKKGTRKQAEAYLQF
FT                   LYGDKAQAIFAKHHYRPIKREAAKPEDLAQLPEIKLFKIEDLQGSWDEIQKANFDNGGL
FT                   FDQLSKAGR"
FT   CDS_pept        522948..523802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysU"
FT                   /locus_tag="METD_I0555"
FT                   /product="ABC transporter, permease, putative
FT                   sulfate/thiosulfate transporter"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 2188958; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0555"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22212"
FT                   /db_xref="GOA:C7CAI7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011865"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22212.1"
FT                   /translation="MGEPVKPRRRFRQRSVIPGFGLTLGYTLTCLSLIVLLPLATLVVK
FT                   ASGLGLSGIWDVATDPRVASALRVSFGVSLLAALTASVFGGTVAWVLTRYDFPGRKLAD
FT                   AVVDLPFALPTAVAGIALASLYAPNGLVGEQLARVGIEAAYTPVGIFIAMVFIGLPFAV
FT                   RTVQPLIAEIDKEVEEASAILGASRITTLTRVVLPPLIPAVLTGFALAFARGVGEYGSI
FT                   IFIAGNLPYVSEIAPLLIVIKLSEFDYAGASAIAVIMLAISFVTLLAINLIQAWSRRRF
FT                   GYV"
FT   CDS_pept        523807..524697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysW"
FT                   /locus_tag="METD_I0556"
FT                   /product="ABC transporter, permease, putative
FT                   sulfate/thiosulfate transporter"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 2188958; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0556"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22213"
FT                   /db_xref="GOA:C7CAI8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005667"
FT                   /db_xref="InterPro:IPR011866"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22213.1"
FT                   /translation="MAQSPGSPPRHEALRLPASVVTERRVVRWLLIAVALTFLGLFLVL
FT                   PLLTVFAQALAKGWGAYLAAFSEPDAHSAIRLTLIVAAIAVPFNLVFGVAASWAVAKFE
FT                   FTGKNLLVTLIDLPFSVSPVVSGLIYVLVFGSRGLFGPFLVEHDIQIIFAVPGIVLATI
FT                   FVTFPFVARQLIPLMQEQGTAEEEAALTLGASGWHAFRTVTLPNIRWGLLYSVLLCNAR
FT                   AMGEFGAVSVVSGHIRGLTNTLPLHVEILYNEYNFVAAFAVASLLAGLALVTLAVKSVL
FT                   EWRYADDIAAGARRH"
FT   CDS_pept        524564..525745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysA"
FT                   /locus_tag="METD_I0557"
FT                   /product="ABC transporter, ATPase; putative
FT                   sulfate/thiosulfate transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.25"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 2188958; Product type e :
FT                   enzyme"
FT                   /db_xref="GOA:A0A2P9HAQ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005666"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A2P9HAQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="SPK01966.1"
FT                   /translation="MSTTSLPRSPSPLSLPGSLLSPSPSNPSSNGATPTISRRGHAATD
FT                   LVGTATAIRIEDVSKTFETAAVLHDFTLDVRAGELLALLGPSGSGKTTLLRIIAGLDFP
FT                   DRGRIIFGGDDATQVPVQRRAVGFVFQHYALFKHMTVAQNIAYGLNARKRSERPDKAEI
FT                   KRRVGNLLDLIKLSGFADRYPSQLSGGQRQRIALARALAVEPRVLLLDEPFGALDAQVR
FT                   KDLRRWLREIHDRTGQTTIFVTHDQDEALELSDRVAVLDRGRLEQVGTPDEVQENPVSP
FT                   TVLKFLGDTIEVEAIAQNGQVLVNGRPTPLTAPNGLVGPVKLYARPWQLQFAEPDTAHL
FT                   TGTVRSSYRTQGRQRIEIDRPGAKVVVVEAADTARLAAGREVGLRIVGGHVFP"
FT   tRNA            complement(526161..526237)
FT                   /gene="trnM"
FT                   /locus_tag="METD_MTRNA54"
FT                   /product="tRNA-Met"
FT                   /note="Met-tRNA (tRNA7); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            complement(526303..526407)
FT                   /gene="rrf"
FT                   /locus_tag="METD_I_5S_1"
FT                   /product="ribosomal RNA 5S (rRNA operon 1)"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type n : RNA"
FT   rRNA            complement(526571..529411)
FT                   /gene="rrl"
FT                   /locus_tag="METD_I_23S_1"
FT                   /product="ribosomal RNA 23S (rRNA operon 1)"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type n : RNA"
FT   tRNA            complement(529703..529778)
FT                   /gene="trnA"
FT                   /locus_tag="METD_MTRNA53"
FT                   /product="tRNA-Ala"
FT                   /note="Ala-tRNA (tRNA8); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   tRNA            complement(529785..529861)
FT                   /gene="trnI"
FT                   /locus_tag="METD_MTRNA52"
FT                   /product="tRNA-Ile"
FT                   /note="Ile-tRNA (tRNA9); Evidence 2a : Function from
FT                   experimental evidences in other organisms; Product type n :
FT                   RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   rRNA            complement(530015..531491)
FT                   /gene="rrs"
FT                   /locus_tag="METD_I_16S_1"
FT                   /product="ribosomal 16S RNA (rRNA operon 1)"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type n : RNA"
FT   CDS_pept        complement(532146..532616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0563"
FT                   /product="conserved protein of unknown function, putative
FT                   integral membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0563"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22215"
FT                   /db_xref="GOA:C7CAJ0"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22215.1"
FT                   /translation="MDRPVYSAVIRPHQSLSQDGFRIVMGLCCLVSLVTSIACWRAGFW
FT                   PIAGFFGLDMLALYVALKVSFRRGRSFEEVAISPLEVFLARIDPRGVRREWHFNPLWTK
FT                   LSRIDDDEFGLRTLTLTSRREHVVVARDASPDERAIVADGLTRALAQVKRGF"
FT   CDS_pept        532799..533500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nth"
FT                   /locus_tag="METD_I0564"
FT                   /product="endonuclease III; DNA glycosylase/apyrimidinic
FT                   lyase"
FT                   /EC_number="4.2.99.18"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 2669955; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0564"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22216"
FT                   /db_xref="GOA:C7CAJ1"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22216.1"
FT                   /translation="MPALAAGVETSPEPVDDATLVEIFSRLRAADPEPRSELEYLNPYT
FT                   LLVAVVLSAQATDKSVNLATAPLFAIADTPQKMLDLGEEQVRHFIRTIGLFNTKAKNVI
FT                   ALSRILLERHDGAVPCEAEALEVLPGVGTKTASVVLNVAFGVPRIAVDTHNFRVSNRIP
FT                   LFSGATTDKVQAGLEARVPEPFRLNAHHWLILHGRYICKARRPECPRCSIADLCRYPSK
FT                   TTALTPISTGD"
FT   CDS_pept        533694..534488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="METD_I0565"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthetase (SAICAR synthetase)"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="6.3.2.6"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 1534690; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0565"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22217"
FT                   /db_xref="GOA:C7CAJ2"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="InterPro:IPR033934"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22217.1"
FT                   /translation="MDFLKPRYTPMNRRRRIYEGKAKVLYEGPEPGTLIQHFKDDATAF
FT                   NAKKHEVIDGKGVLNNRISEFVFQHLNDIGVPTHFIRRLNMREQLIREVEIIPLEVVVR
FT                   NVAAGSLATRLGLEEGTQLPRSIIEFYYKNDQLNDPMVSEEHITAFGWATPQEIDDIMA
FT                   LAIRVNDFLSGLFLGVGIRLVDFKMETGRLWEGDLMRIVVADEISPDSCRLWDIKSSDK
FT                   LDKDRFRKDLGGLIEAYTEVAKRLGIMSENEKVQAGGPRLVQ"
FT   CDS_pept        complement(534496..536151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0566"
FT                   /product="conserved protein of unknown function, putative
FT                   glycosyl transferase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0566"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22218"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22218.1"
FT                   /translation="MSDDGLPPAWPDALLFAAEPVPGHLARLARVLRHPKRALPILSAR
FT                   LSGRRLRAAQAFVALVGAHHHWDRPRIVPPPSEPHAALAAAGIERVVTDATGAIRITAD
FT                   GPRIVLLTSDGQHIAAGAAAAIAAAFADPDRHAIYGDALFSHAAHGPWLPLLRPAFDRD
FT                   YLRTVDYLGPVIALRRASVIGLDAVPGAAALDLTLAIAHRFGPGAVRHLPRLLSFGRFD
FT                   ETGEGRTARRDAVRRDLERAGEGGTPVLVGQDGVIRLDRPLPEPRPLVSLIVPTRDRLD
FT                   LLRPCIESLRHRSDWPAKEILICDNDSRDPETLAYFRTLEAEGAARVVACPGPFDFAAI
FT                   NNRVAAQARGRLLAFINNDVEAEAPDWLERMIREALRPEIGAVGARLVDGEGRIQHGGI
FT                   VLGTGGLVTHGHRHFAGDAAGYLGALRATRSVSAVTAACLVIEADKFSRVGGFDASTFA
FT                   IDFNDVDLCLRLNAVGLRTLYVGGARLHHRESASRRPSPAAAARHRAEVEALKKRWGPL
FT                   LAQDPHYHPGFDPDLSTHLRLRRGWTGLEPAEPR"
FT   CDS_pept        complement(536148..538202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0567"
FT                   /product="putative glycosyl transferase"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 8626291; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0567"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22219"
FT                   /db_xref="GOA:C7CAJ4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22219.1"
FT                   /translation="MAKPDARRGDGWDLWRGRETSFSLVPTDDPLFDRRLVLSPPDRRP
FT                   WQDRWIVLTYTLPVRARPQRPLLRLLRSAGRRDSFVLPGVALCAARWLGYLPGDCQGIE
FT                   IAAEPGFVLERVGLRSSASVFAEALLKRPERAAAALRAGLARDERRWRDSLRGACAVSP
FT                   HTRYPAWKASRLFRAASTDPRSGAQIRLVLPAPFAQADAVARSVASLRAQTHQDWSLLI
FT                   AWTDGAAPTNPAIDGRVLSTSWNPAAALHELAGGADLFGLLRPGDILAPEALHLLAKSR
FT                   EAEAAEMVYADEETSGRTLRPRLKPDWSPDLALATGYVGAPALIAGDFLAGLPAEPVDS
FT                   PDALALTLDLAASSATRVAHIPRILCRREPVTADPAARAPHLDRHLRSTGSSARAALRD
FT                   GRLDLQWPLPDPAPLVSIIIPSRDRLDLIARVTEDVLEKTPYPALEMVIVDNGSKEPAV
FT                   LDLYERLRLDPRVRIEPYPHPFNFSALVNAGARKARGDVLVLLNNDVAVLRPDWLDVLV
FT                   GQAVRPEVGAVGAKLLYEDGRLQHVGVVVGLGGEAGHILRRRPADTPGHLDRLSVAHEV
FT                   SGVTAACLAVTRDKYQAVGGFDEETFAVDFNDIDFCLRLGARGWKTVWTPHAVLSHLES
FT                   VSRGRPVGAARARFEREAAAFTERWRNVIWHDPFYHPALSLTTFGEELE"
FT   CDS_pept        complement(538261..538851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0568"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0568"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22220"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22220.1"
FT                   /translation="MPGTARAEPGSFFKNMFGGREGDAPAVTTPRAQDPDDVYCPPVFV
FT                   PDGGAAVQAFAGAAGDNRRLRHQIVLGRLSRECKARPDGSVAVRVGVELRALLGPAGAS
FT                   GRFEVPVSIGVKYNEQPVMMRSHRVAVAVPAGAAQGEATVIENDLTVPADKAMGYDIEV
FT                   TLAGASARPKPAVRRRKPAPAAAAEQGEAPVAQ"
FT   CDS_pept        complement(538954..539496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0569"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein; putative invasion protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0569"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22221"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22221.1"
FT                   /translation="MSLFAGVVRALRPGTGRRLALVAATAATVLAAGGAAQAQGTVRKT
FT                   FDDWQLRCETPAGAKAEQCALVQYVAAEDRPNLNLVVIVLKIADNRGYLLRVQAPLGIL
FT                   LTSGLGLKIDQTDIGRASFVRCLTMGCVAEVVMDDGLIKSMRNGSQSTFIVFQTPEEGV
FT                   GIPVSMKGFGPGFDALK"
FT   CDS_pept        539733..540152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0570"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0570"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22222"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22222.1"
FT                   /translation="MRRLASPLALATLLVAVGSGGASALSLPFEESDYLPPEATTTYVE
FT                   RSLNHQAPLTIEHPPVERNPRGRRRGDAAAIAGFCRDGGTVMRRDAMGRPTYLRQREVC
FT                   DNVAPRTLWPGHVNPRPTWPAEAAPARSRAVVTKY"
FT   CDS_pept        complement(540239..540964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0571"
FT                   /product="putative metal-dependent hydrolase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0571"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22223"
FT                   /db_xref="GOA:C7CAJ8"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22223.1"
FT                   /translation="MTRALLRRPDPDHIEIAHDGQTFRIAILRRPTARRLTLRVSSATG
FT                   TVVLTLPTRSSLATAQKFAQSHGGWIATRLAKLPERVPFAEDSVIPLRGVPHRIVAREG
FT                   RGMAEADPASATLAVPGDPAHMPRRVREFLMREARRDLSQSVAVYATRLGQRPARVTLR
FT                   DTRSRWGSCTARGELNFSWRLILAPPVVLDYLVAHEMAHLREMNHSPRFWALTNELCPH
FT                   VDEAERWLKRHGSELHRYG"
FT   CDS_pept        complement(541060..542304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="depA"
FT                   /locus_tag="METD_I0572"
FT                   /product="intracellular PHB depolymerase"
FT                   /note="Evidence 1c : Function from experimental evidences
FT                   in the studied genus; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0572"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22224"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22224.1"
FT                   /translation="MDLAYIWYETARAMLTPARLAADAARHSLANPGNPFAYGPYARSA
FT                   AAALEMFERVTRRYGKPAFGLPTTVIDGQVVPVSERVVWERPFGRVIAFDRALPAGLSE
FT                   PQPKLLIVAPMSGHYATLLRGTVEAMLPNHRVFITDWSDARMVPLLDGRFDLGTYIDYL
FT                   QAMFRDLGPDLHVMAVCQPAVPVFAAVALMEAADSAHVPVSMTLMGGPIDTRRSPTAVN
FT                   CLAQERGMAWFEKNCITVVPPLYPGAMRRVYPGFLQLSGFMAMNLDRHVTAHTDMFHHL
FT                   VTGDGDSAEKHRDFYDEYLAVMDLTAEFYLQTVQTVFVDHALPRGRMRHDGRLVDLSAI
FT                   RRCAILAVEGENDDISGVGQTKAALDLTPNLPDARKAYHMQEKVGHYGVFNGSRFRSVI
FT                   APRIARFVREMEGSA"
FT   CDS_pept        542450..543844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regS"
FT                   /locus_tag="METD_I0573"
FT                   /product="two component sensor histidine kinase, RegS"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 9683482; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0573"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22225"
FT                   /db_xref="GOA:C7CAK0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22225.1"
FT                   /translation="MMEAAHKTLTPTGRHLRLDTFVRLRWLALTGQSAAVVGAQFGLGL
FT                   NLPFGWCFLVIATSCWLNLALRIRFPASYRLSDDSAALLLAFDIVQLAGLLFLTGGLQN
FT                   PFSLLFLAPVLISATALPPERTLALGLLAVGLATLLALVHRPLPWFADGRIELPFLYVS
FT                   GVWTAILLGTAFTGVYAWRVAEETRQLARALAATELVLAREQHLSQLDGLAAAAAHELG
FT                   TPLGTIMLVAKELDRQLGPTASPAIAEDLSLLRDQVDRCRGILSKLTSMGEENEEGETF
FT                   LQTVTFGHLVEELVAPQRALGIAVEVVRQGDGPEPVCRRNPGVMFGLANILDNAVDFAE
FT                   SRVVLEAGWDAERVTLTVCDDGPGFPSEVLLRAGEPYVTTRNRDRSQNPDEVGGGLGLG
FT                   LFIAKTLIERSGAQLLLSNITEVGQHGALVRVTWARHIFEREVIVPHRVAHNSLRPLTE
FT                   RDAAPI"
FT   CDS_pept        543881..544483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="regR"
FT                   /locus_tag="METD_I0574"
FT                   /product="two-component transcriptional regulator RegR, Fis
FT                   family"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 9683482; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0574"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22226"
FT                   /db_xref="GOA:C7CAK1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22226.1"
FT                   /translation="MLTQSGTTVPGSDTAFLSDADPLSAFSDRSLLIVDDDKPFSTRLA
FT                   RAMEARGYEVHVAESVSEGVAAVETKAPAFAVIDMRLGDGNGLDVIARLKERRPEARGV
FT                   ILTGYGNIATAVTAVKLGAFDYLAKPADADEIHGTLMAQPGERADPPENPMSADRVRWE
FT                   HIQRVYELCSRNVSETARRLNMHRRTLQRILAKRAPR"
FT   CDS_pept        544665..544889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0575"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0575"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22227"
FT                   /db_xref="GOA:C7CAK2"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22227.1"
FT                   /translation="MRNLITILGLMVLVGTEVFAAAIAAGWALAGLLDLGDQVGHVLMA
FT                   LFSLVAAWIMVQLWRRATEAEPIGSTRRR"
FT   CDS_pept        545081..545320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yexA"
FT                   /locus_tag="METD_I0576"
FT                   /product="Phosphoribosylformylglycinamidine synthetase
FT                   PurS"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 10784038; Product
FT                   type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0576"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22228"
FT                   /db_xref="GOA:C7CAK3"
FT                   /db_xref="InterPro:IPR003850"
FT                   /db_xref="InterPro:IPR036604"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22228.1"
FT                   /translation="MKARIVVTLKTGVLDPQGKAIEAALKSFGINEVSGVRQGKVFDLE
FT                   VASENREQAEATLKAACEKLLANTVVENYTVEIA"
FT   CDS_pept        545320..546000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="METD_I0577"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="6.3.5.3"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10071207; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0577"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22229"
FT                   /db_xref="GOA:C7CAK4"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22229.1"
FT                   /translation="MRAAVVVFPGSNRDGDVARALRRSGAEVVSVWHADTELPAGTDLA
FT                   VVPGGFSYGDYLRCGAIAGRAAAMDAVRAHAARGGLVLGICNGFQILCESGLLPGVLMR
FT                   NVNRRFICHRQFLRVERADTRFTSAYTEGQVIDVCVAHGEGNYFADSETIGRLEGEGRI
FT                   AFRYCDASGALTEDANRNGSLNSIAGIYSEQRNVLGMMPHPENFVDGLVGGTDGKGLFD
FT                   SLAA"
FT   CDS_pept        complement(546126..546671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="apt"
FT                   /locus_tag="METD_I0578"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.7"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0578"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22230"
FT                   /db_xref="GOA:C7CAK5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22230.1"
FT                   /translation="MEARRHSALKDSVRSIPDYPKPGIIFRDITTLLSDPRSFRRAVDS
FT                   LVHPYAGGRIDQVAGIEARGFILGGAVAHQLSSGFVPIRKKGKLPHKTVSTAYALEYGT
FT                   DEIEIHVDAIKPGDRVILVDDLIATGGTATAAVNLLRQLGAEVVAACFVIDLPEIGGAQ
FT                   RLRDLGVTVRTLMEFEGH"
FT   CDS_pept        complement(546754..547548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="METD_I0579"
FT                   /product="inositol monophosphatase; putative 30S ribosome
FT                   biogenesis factor"
FT                   /function="9 : Transcription"
FT                   /function="12.3 : Protein interactions"
FT                   /EC_number="3.1.3.25"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 26980831; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0579"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22231"
FT                   /db_xref="GOA:C7CAK6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22231.1"
FT                   /translation="MINSPLMTVMVDAVRKAARGLKRDFGEIENLQVSRKGPGNFVSAA
FT                   DRKAEEVLRDALMKARPGYGLIMEESGTIEGTDRSHTWHVDPLDGTTNFLHGIPHFAIS
FT                   VGLERDGQIVAGVIYDPAKDELFIAERGKGAFLNNRRLRVSGRQDFADALVAYGTPYLG
FT                   RGSHGRLLKEVAAVMAVSGGTRRLGSAALDLAYVACGRTDLYWERDLQTWDIAAGIILV
FT                   REAGGFVSSADGGAEPLAARSVACGNEVLHRELIGLLRKAAA"
FT   CDS_pept        complement(547832..548449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="METD_I0581"
FT                   /product="thiamine phosphate synthase"
FT                   /EC_number="2.5.1.3"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0581"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22232"
FT                   /db_xref="GOA:C7CAK7"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22232.1"
FT                   /translation="MTLPPLLIVTDRHGAARPLTETVRAAVAGGARFVWLRDRDLDRDA
FT                   RRDLAHDLIALLQPAGGRLVVGGDAELAAETGAQGVHLSGSAGIDGIRAARTSLGAAAL
FT                   IGFSAHSVAEVAAAAAAGADYATLSPIFPTPSKPGYGPALGLASLRAAAAHGVPVFALG
FT                   GIDGGNARACREAGAAGVAVMGGVMRGSDPRDATGRFVAALT"
FT   CDS_pept        complement(548456..549277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="METD_I0582"
FT                   /product="thiazole synthase"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0582"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22233"
FT                   /db_xref="GOA:C7CAK8"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22233.1"
FT                   /translation="MNHHDTTLAQTSAAGDAPGDDALEIAGIRLASRLFIGTAGYPSQE
FT                   IMAQSVRASGAEVVTASIRRVSLQGHGSDTFQKLKGARFLPNTAGCETARDAIMTAELA
FT                   REALGTSWIKVEVIGDRETLYPDVTELLEACRHLVDDGFTVLPYCNDDPVICERLADLG
FT                   CAAVMPMGSLIGSGMGISNPANIELICRRAKVPVIVDAGIGTASDAVIAMELGAAACLV
FT                   NTAVAKADDPVRMAGAMRHAVEAGRLAHLAGRIPRRGRAESSSPQLGLVGS"
FT   CDS_pept        complement(549280..549492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="METD_I0583"
FT                   /product="thiamin biosynthesis proteinsulfur carrier ThiS"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0583"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22234"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22234.1"
FT                   /translation="MRLTVNGETCEREAADLAALFATEAEERGIESAQGIAIAVNGRVV
FT                   RKSAWAETTLNEGDRIEIVRAMQGG"
FT   CDS_pept        complement(549489..550724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiO"
FT                   /locus_tag="METD_I0584"
FT                   /product="glycine oxidase"
FT                   /EC_number="1.4.3.19"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0584"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22235"
FT                   /db_xref="GOA:C7CAL0"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22235.1"
FT                   /translation="MSDLLTSPIGQRRSLAIRPRAAELPQRADVAVVGAGLIGLSIAWR
FT                   LAQAGRSVAVVERGSVGSGASLAATGMLAPAAEHEPGSDLLLPLALESLRRWPAFRDAL
FT                   QAASGREIDYRTDGTLVIAIGRDEVERLRFRHDLQRRSGVAAEWLSGPEVRAREPLLRP
FT                   NVTAGILCPLDAQVDPRLVMEALLRACEAAGVVISEGVAVEGLERRGGRVTGLHAAGRT
FT                   LAADTVILAAGAWSGDASLLPSDLDVPDLSVPVRPLKGQSLALRTTKRTGTLSRMVWTD
FT                   AVHMAPKGDGHLIVGATVEDCGFTSGVTAGGMFALLEGARRVLPGIEEMEIDAVWSGFR
FT                   PTSDDDAPIIEEAAPGLVLATGHHRNGYLLAPATADAVATLLTEGALPDFARGFGRARF
FT                   SSSHQTGGRAVA"
FT   gene            complement(550821..550925)
FT                   /locus_tag="METD_IMISC_RNA_64"
FT   misc_RNA        complement(550821..550925)
FT                   /locus_tag="METD_IMISC_RNA_64"
FT                   /product="TPP riboswitch (THI element)"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 12376536; Product
FT                   type f : factor"
FT                   /inference="profile:Rfam:8.1"
FT   CDS_pept        complement(551048..552322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0585"
FT                   /product="putative Adenylate/Guanylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0585"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22236"
FT                   /db_xref="GOA:C7CAL1"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22236.1"
FT                   /translation="MRDADAPKPTPTALADGSEAEDVPFGALQRCVGIRDWLLGEGARL
FT                   PRADDLLAGLAERLNAIGVPIDRASTAIDTLHSEYSGVGRVWTRGAGSTVRLFPHGEVS
FT                   AKAYQVSPFSTVHETGEWLSLDLAETAEDAYAIIPELKADGYTHYLVAPLIFTNGNKNG
FT                   ITFATRAKDGFRDEDIAILRFVMPALAAVMEMRILNKQLDTVLRIYVGDEPHRAILSGD
FT                   IRRGQVRRIRSAILFADMRDYTRLSANRTPEGAVDLLNAFFDCLVPPIEREGGEVLKYL
FT                   GDGLLAIFRESGDDLGGAAKSALTAAEAALAALAEANAVGRFGQGERVVDAGIALHHGE
FT                   AAYGNVGSGTRLDFTVIGRDVNLASRLARLNRTLQEPLLMSKPFVDFLWGDPEPLGSHV
FT                   LDGFDEPMAVYRPGRRRAAEAAAAE"
FT   CDS_pept        552619..552987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0586"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0586"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22237"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22237.1"
FT                   /translation="MLRTAFSLTLLATAALAPNLALAQGKQDFTLVNRTGYQIDEVYVG
FT                   PVNQSHWGQDVMGKDAIANGDTADITFNGGSNACKWDIKVVYNDGDESEFRGVNLCNVS
FT                   KVTLFWNRNAGETRFVVE"
FT   CDS_pept        553279..554283
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0587"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0587"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22238"
FT                   /db_xref="GOA:C7CAL3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035418"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22238.1"
FT                   /translation="MSNQSFTFTSEADGFEGYHALYSVGTDVAATDGPFRARVEAHRFG
FT                   PINVFERTLSGVRHWRDGARVRRDDFDHFVIQYLRSGTYYGGSIDAERRLAPGDIILFD
FT                   MSRPQRSRVETASTVTVSLSRKLVEAAAPEASRYHGHILPEAVSGLLGDLMGSLARRAA
FT                   ATEPSTAESTARALTELLAGALGQVRPDDEASSALIADLRRRRAEAFIEARLNDPSLDV
FT                   SMVARGAGLSRSALYRLFEPTGGVAYHILTRRLERLSAALRNPVEARSITTLTFDHGFA
FT                   SESHCSRAFRGTFGLPPGRYRAEMRHPRAGTLGQPLPGESAANLMSAWSRALA"
FT   CDS_pept        554292..555635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0588"
FT                   /product="major facilitator superfamily (MFS_1) transporter
FT                   (Putative tartrate transporter, ttuB)"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 7592429; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0588"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22239"
FT                   /db_xref="GOA:C7CAL4"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22239.1"
FT                   /translation="MSFPTAHPQPGTAVARAGLAGWPLVALLAMIQFAAFSDRFLLTLV
FT                   ATPLKQALALSDTQLGLLQGSAFALPYALTLPLLGIVADRGRQRGLLLAGLSLWSVATF
FT                   ASGLASGFGALLAARVALGVGQAGFGPAALSLMTRHLRRDRLGRGISALTAGATLGRSF
FT                   ALLAGGAVLAWLTTRGGLTLPGLKPLAPWQALLVLAALPNLVLVILVLRIRPPPRAAAS
FT                   AQASRGLPGVSLRSALAWIGRRRTAYLPHVAAATAAVLLTQTLTAWAPTFYVRSFGLTP
FT                   AESGLRLGLLVLIAAPLGHFAGGLVLDRLRGAGRADAAPLLLALGLILAVPMTAFASLS
FT                   PDLSFSLLGFAGLVALLGFTGPPGLAGIQILTPQRLRGRVNALFLATVNLAGFGLGPLL
FT                   VGLLSDHLFGEAGLGLALLAVYAPVGAVGTLAALLARRAWQPVPRRRA"
FT   CDS_pept        complement(555680..557680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="METD_I0589"
FT                   /product="sigma D (sigma 70) factor of RNA polymerase"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 8491721; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0589"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22240"
FT                   /db_xref="GOA:C7CAL5"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR007631"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22240.1"
FT                   /translation="MATKATERDDADAAQDQPTDGPLLDLTDAAVKRMVKLAKKRGYVT
FT                   YEEINEVLPDGQVDGDQIEDVLAQLDDMGIRVVEAEESEEAAPEAKANGEASEEEESTE
FT                   GGEVAETSGTRAVAVATPTTREPTDRTDDPVRMYLREMGSVELLSREGEIAIAKRIEAG
FT                   REAMIAGLCESPLTFQAIIIWRDELVDGKVLLRDIIDLEATYAGPDARGAPQEAEAEGE
FT                   ESEEAEGAVPPEGGDDEDDMENNVSLAAMEAEIKPRVLETFDNIASNYRKLRKLQNEET
FT                   ELKTGGGTVTSAQTKKQAELKDIVVTDVKSLSLNANRIEALVEQLYDINKRLISHEGRL
FT                   MRAAEHHGVARDEFLRHYQGYELDPNWMDRVATLGGKGWKNFVERGGRQVADLREQILT
FT                   LASETGLQIGEYRKIVAMVQKGEREARQAKKEMIEANLRLVISIAKKYTNRGLQFLDLI
FT                   QEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKIV
FT                   RTSRQMLHEIGREPTPEELAEKLAMPLEKVRKVLKIAKEPISLETPIGDEEDSHLGDFI
FT                   EDKNVVLPIDAAIQSNLRETTTRVLASLTPREERVLRMRFGIGMNTDHTLEEVGQQFSV
FT                   TRERIRQIEAKALRKLKHPSRSRKLRSFLDN"
FT   CDS_pept        complement(557882..559807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="METD_I0590"
FT                   /product="DNA primase"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0590"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22241"
FT                   /db_xref="GOA:C7CAL6"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22241.1"
FT                   /translation="MRYPPHILEEIRARVPTSEVVGRRVRLKKAGREWRGLSPFNSEKT
FT                   PSFYVNDQKQFYHCFSSGKHGDIFKFVMETEGLSFPEAVERLAGEAGVTLPKMTVENEQ
FT                   AEERRKGALEVMELAAVYFEEQLRGQAGGEARAYLDRRALGEATRKTFRLGYSLPGRYA
FT                   LRDFLAGKGVDRDLMLELGLLTAPEGVNVPYDKFRDRIMFPILDIRGRVVAFGGRAMQA
FT                   EAKAKYMNSPETPLFHKGRMLYNLHAARKSAHDRSRIVAVEGYVDVIAMTLAGYPETVA
FT                   PLGTALTEDQLALLWRHADEPILCFDGDGAGQRAAFRALDVALPMLEPGKSLRIAMLPQ
FT                   GQDPDDLMRSGGPSAIEAVLSAARPLVEMLWAREAEAATLETPERRAGLARTLREAVAG
FT                   IRDETVRRFYRDDIEGRLRGLSGGPASFSGGRSERAAGGRPASPRGAPFQRRPRPGDPP
FT                   PSPRITTGFNPLLKTAAPVPAAGGRAAKREAMIVMSLLAHPELLGIEEEALAALELVNP
FT                   DARALRTLLLDRAAEAGTPEAELMEARLRRAGLEEAHARLLALVSSGDRWTLDPNADPQ
FT                   RLEQTLHQAVILHRQTGALHSELHQAERALAEDGSEANFAWLCDVQQQLAVIAAAEAEA
FT                   EVSHEE"
FT   CDS_pept        559942..560928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gnl"
FT                   /locus_tag="METD_I0591"
FT                   /product="Gluconolactonase (D-glucono-delta-lactone
FT                   lactonohydrolase)"
FT                   /function="6.11 : Sugars"
FT                   /EC_number="3.1.1.17"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0591"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22242"
FT                   /db_xref="GOA:C7CAL7"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22242.1"
FT                   /translation="MTESRSPPRRGIARRPLLGLALLGALTPRARAADDLSAVLDPAAK
FT                   AETLYDEGEWCEGPVWAPSLGGLIFSDVRRNRMMLIREGSRAEVFREPSNNSNGNTVDT
FT                   QGRLVTCEHRTSRVVRRETDGAITVLADRYDGGRLNAPNDVVVARDGAIWFSDPTYGID
FT                   QAEEGLPRPSEQKGRFVFRLALDGTLAVATDRFVQPNGLAFSPDERVLYICESGTREGA
FT                   TGEIRAFDVADGQLSNERVFATVPKGVPDGVKVDTDGRVYAGTGDGVRIWSADGRPVGH
FT                   IPTEGPCANLAFGGPDGRRLFLCAGKRVLAIETKVRGAAIESGGSRP"
FT   CDS_pept        560925..562091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0592"
FT                   /product="conserved exported protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0592"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22243"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR017996"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22243.1"
FT                   /translation="MTVRLARRTLLAGTAALATARTMATRPAQAEAATAPVGALERVVA
FT                   AQAPTTPTGLTLSADGRMFLFMPRFDEQTVFTAGEVFPDGRVVPYPSEAANRPDPARPA
FT                   ETLFHVPNGVFDAKNRLWLLDAGLMASSGEPVQGAAKLVCIDPATNAILRTIPLQSVVT
FT                   KTSSLNDLRVDVRPGREAAYITDQGQTGAGAVIAVDLASGRAVRRLADHASTQSVPGIL
FT                   KIVEGRVLLKREADGTTSPIKGGANGIALSPDGARLYYTPLMSRRLYAVETAALLDAGK
FT                   DDAAVAETVTDLGEKGLTGGLVADSRDRIYLSLQEFNGIGRRDPDGRIEVIATDPRLIW
FT                   PDTFWITSDGWLYLSSAQANRRPEHNGGIDRQEPPYAIFRMRIDAGPA"
FT   CDS_pept        complement(562280..562738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="METD_I0593"
FT                   /product="Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase
FT                   subunit B (Asp/Glu-ADT subunit B)"
FT                   /function="1.2 : Aspartate family"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number="6.3.5.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0593"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22244"
FT                   /db_xref="GOA:C7CAL9"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22244.1"
FT                   /translation="MLRERITAEMKAAMKAGEKQKLSTVRMIQAALKDRDIAARGEGKG
FT                   ETGEDEILALLQKMIKQRQEAAGVYEQGGRPELAESERAEAEIIQTFLPQQLDEAEMRT
FT                   AIADAIAETGAESPKDMGKVIGALKGKYTGRMDFGRASALVKDALAGK"
FT   CDS_pept        562928..564178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="METD_I0594"
FT                   /product="carbamoyl phosphate synthetase, glutamine
FT                   amidotransferase small subunit"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="6.3.5.5"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0594"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22245"
FT                   /db_xref="GOA:C7CAM0"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22245.1"
FT                   /translation="MLQDEPATLRADPARTNPAPKAPEPWSEPLVTALLVLADGTVLEG
FT                   FGIGQTGAADGEVCFNTAMTGYQEILTDPSYAGQIVTFTFPHIGNVGTNDEDLESLDQA
FT                   PASGVRGAVIASAVTKPSNWRSSSHLDGWLKARGIVGITGIDTRALTALIRDRGMPNAV
FT                   IANDPEGKFDREALKARAAALAPMEGLDLVPPVTSRETTAWTETVWAVKGGYGSRAPGQ
FT                   GLKVVAIDYGVKRNILRLLAEAGCDVTVVPATTTAEDIMALKPDGVFLSNGPGDPAATG
FT                   EYAVPVIRKLLDERVPTFGICLGHQLMGLALGGRTVKMGQGHHGANHPVKDHTTGKVEI
FT                   VSMNHGFAVDPTSLPETAVETHVSLFDGSNCGLSLTDRPAFSVQHHPEASPGPRDSHYL
FT                   FERFVKLMRENRPETAA"
FT   CDS_pept        564318..564692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0595"
FT                   /product="protein of unknown function; putative membrane
FT                   protein"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0595"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22246"
FT                   /db_xref="GOA:C7CAM1"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22246.1"
FT                   /translation="MTLDDARDDFSRLHRLFTFHLGVAVGLAWLTTLYAAVSAPWVRNI
FT                   RALIDPTDPMRIESTLSYLFVMPAVLTLAWASAYFGRETMRRFQTLPNQTLEFAAAAMV
FT                   AFGVFYLSIDRAVAVIGAGF"
FT   CDS_pept        complement(564733..567393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0596"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0596"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22247"
FT                   /db_xref="GOA:C7CAM2"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22247.1"
FT                   /translation="MDQIDEQAAAAVSDGEGAAPLLPAASRYAGGAGPGGREGLHRIAP
FT                   NNRFARVGLSFSDLTPGTWACLRFGLAFDADEAAALAVDAVAAGFDFLAADGASLDLDH
FT                   VPGLARSLLDPHVAWIPGPALLGAEPFRIAFRVPDQARGVSVTLRSWRNTGDVAVADPV
FT                   LRLGAPDPAPAPRRRPLSGEGLRFDYALAEDVALVLRGQIYAARADEHAARVRLVYRDA
FT                   AGAEIAPPYANAVSVPGLGAVINLSAQPQARRFTLTLRPPPGAAAVALDFGAWEDAQTA
FT                   SESELIGQPELALEDDFRLESLCDDDVLDAPAFLARLADRLGLPEGVPASWRAGSATGA
FT                   APILARARDLRTGPDRSARIEGESVLLALAGLPDWTLPQAPDWREDPFRSVAWRLAYQS
FT                   LTWLLPLAAHPDGAARARTIAAAWSRANPWSQPADGLSLHPAALAPRGDVLASLLTGGD
FT                   EPTRVEIAAEAARQGFALAEIVGQNTLARALHGIQAAAALLAVARALPGFAFAPYWDSL
FT                   SRDSLTHGFDSLLSEAGAFTDAAPVRRLDLLGHGQAIADALGETEPGPTIRRRVEVALP
FT                   GLAGLIDRGGRLPPFGDAPAGLDHSAWIARLSSRGHSQGHDLVAERDAAPVPEGRTAGM
FT                   LALRYDGMEQGWGHFALTHAAQSPHGHRDCTSFTFATGSRRWIVEGGGAEGVEVGPARH
FT                   YLLSPRAHNVAIPDGCEPVAGSGTLSARLTLDGAQALTLSTNVHGPDYTHARLFLVLDD
FT                   LSGMAVIDRFVRVGPSLSFEGLLHLPPDTLVALSSPRRALAQQEGRRLEFFAIPLKGQA
FT                   AGLEVAIGRSDRPHAMQGFCATGSGGLRPAPVLRYAFTGRDTVCGGVVIAADAGAEQRL
FT                   LRLLADDAVRLWVEE"
FT   CDS_pept        567551..567940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="METD_I0597"
FT                   /product="Flagellar basal-body rod protein flgB"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0597"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22248"
FT                   /db_xref="GOA:C7CAM3"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR006300"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22248.1"
FT                   /translation="MTTGVYLFDLASQHARFLATRQATIAGNVANANTPGYKARDVMPF
FT                   AQVLARTGLDMASTATSHLGTQGTGIPVREAKPTETWEVLQSSSAVSLEQEMLKAGDVS
FT                   RQHNLDTAVVKSFHRMLMAAVKGGA"
FT   CDS_pept        567937..568353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="METD_I0598"
FT                   /product="flagellar biosynthesis; cell-proximal portion of
FT                   basal-body rod"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0598"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22249"
FT                   /db_xref="GOA:C7CAM4"
FT                   /db_xref="InterPro:IPR006299"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22249.1"
FT                   /translation="MIDPLLSASRLASAGLEAQSLRMRVVSENLANAQSTGATPGADPY
FT                   ARKTVTFRAELDRAAGVASVRLREIGTDNAPFRTEHDPANAAADANGNVKLPNVNMLVE
FT                   MADMREANRSYEANLQVIKQARAMVASVIDLLKS"
FT   CDS_pept        568367..568720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="METD_I0599"
FT                   /product="Flagellar hook-basal body complex protein FliE"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0599"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22250"
FT                   /db_xref="GOA:C7CAM5"
FT                   /db_xref="InterPro:IPR001624"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22250.1"
FT                   /translation="MIEALNSLAAFDKVAGTSFAGAAPTQKAMFSPAALSGIAGTAPTA
FT                   PTDFGEVMAQVASSARDALRTGEATAISGIQGKATAQQVVEAVMSAEQSLQTVLAIRDK
FT                   VVAAYLELSRMPI"
FT   CDS_pept        568813..569601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="METD_I0600"
FT                   /product="flagellar biosynthesis; cell-distal portion of
FT                   basal-body rod"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0600"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22251"
FT                   /db_xref="GOA:C7CAM6"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012834"
FT                   /db_xref="InterPro:IPR019776"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22251.1"
FT                   /translation="MRALAIAATGMSAQQLNLEVIANNIANLNTTGFKGARAEFTDLLY
FT                   QAERQQGVPNQAGQEAVPEGAMLGLGVRAAAIRNLHRQGSLANTGNQLDLAVNGRGYFQ
FT                   ITSPAGEIQYTRAGSFNKNNAGQLVTMEGYAVDPAILIPQNTTQVTINESGQVFAKIDG
FT                   QVALQNVGQLTLANFANDSGLEPLGNGLYRETPASGAPVVGNPGDVSYGKLQQGYLEGS
FT                   NVDPVKEITSLITAQRAFEMNSKVIQAADEMAGTVSKGIR"
FT   CDS_pept        569667..570161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="METD_I0601"
FT                   /product="Flagella basal body p ring formation protein
FT                   FlgA"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0601"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22252"
FT                   /db_xref="GOA:C7CAM7"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR017585"
FT                   /db_xref="InterPro:IPR039246"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22252.1"
FT                   /translation="MPRKTFVRGLVLAALAAGSAQPIAPAQAVEGMANAELMLPVPTVT
FT                   IYPGDTIKESMLRMQAYPATYRARTAVIDASAAIAGRVARRMLLPGEPVPVNAVDDPRL
FT                   VSRGAPTQMIFEENGLVITAVGAPLQNGGLGETIRVRNTDTNRIILGTVMADGRIRIGA
FT                   Q"
FT   CDS_pept        570158..571285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="METD_I0602"
FT                   /product="flagella basal body P-ring protein"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0602"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22253"
FT                   /db_xref="GOA:C7CAM8"
FT                   /db_xref="InterPro:IPR001782"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22253.1"
FT                   /translation="MIRRLLLAVLLGLLTGLGFAVMTGPVFAAGTRIKDIATLKGVRDN
FT                   QLFGYGLVTGLQGTGDTLRNAQFTEQSLQSLLDRLGINVRDARLRTRNIAAVMVTADLP
FT                   PYTGTGSRIDVTVTSMGDATSLRGGTLLMTSLTGGDGLVYAAAQGPLAVSGFSVQGQAE
FT                   QLTQGVPTAGRIPNGAMIEREVPGTFRDLPELVFELKNPDFKTATQISDAINAWSLGAF
FT                   GRRIASARDQRAVVVMRGRQMAQTRLVAQIGDLTIQPDTPARVVVDQRTGTVVIGRNVT
FT                   ISTVAVTHGNLTVRVTEAPEVSQPEPFSNGQTVVVPRTEVSAREERGKLAILGGSDLQT
FT                   LVRGLNQVGLKPTDIIAILQAVKTAGALQAELVVQ"
FT   CDS_pept        571285..571869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0603"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0603"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22254"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22254.1"
FT                   /translation="MNVTLGIALCWLALGGAALAAGGDHADPAKDAAMRALATRDAPKE
FT                   ISAQDFVAKEPAKTGYCANIADAAADARFAWQKEQLAVMERQVEERIKLLEEKRAEYEA
FT                   WLKRRNEFLAKADESVVAVYAKMRPDAAALQLANMPDEAAAALLTKLNARTASAILSEM
FT                   EAARAAGLARAMSESGRKDATAPAVKKNQRS"
FT   CDS_pept        571869..572576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="METD_I0604"
FT                   /product="flagellar L-ring protein FlgH"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0604"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22255"
FT                   /db_xref="GOA:C7CAN0"
FT                   /db_xref="InterPro:IPR000527"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22255.1"
FT                   /translation="MRPSSAAVAVLALSLGACQSDLDRLGRPPLLTPIGTGLNAPREPL
FT                   PTSFGALGPRHSYHSTWSPASAALYQDPRARDVGDVITVSIAINDKAQFDNASERGRSQ
FT                   KSSLGFDFGYGISGLKDTATADTGIRSGTETKGQGSIDRKESLSLSVAAVVTEVLPNGN
FT                   VLISGSQEVRVNNEVRVLEVAGIVRPRDISRKNTIDYDKIAEARISYGGRGRITDVQGP
FT                   SLGQRVFETVAPF"
FT   CDS_pept        572657..573139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="METD_I0605"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0605"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22256"
FT                   /db_xref="GOA:C7CAN1"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22256.1"
FT                   /translation="MADAKDSKKGGKGWIGALALVTLIAVGTGGGLGVYLLGTVEKSVD
FT                   LKQREEAGKAVKVLNYTGDLSLRSVGSVVANLAEPTDSWVRIESSVVFNTGALPNPDVT
FT                   LAEIRADALAYLRTLSMAQIEGANGLQHLREDLNERVATRTKGAVRELIVESLVVQ"
FT   CDS_pept        573136..573918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="METD_I0606"
FT                   /product="flagellar biosynthesis protein FliP"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0606"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22257"
FT                   /db_xref="GOA:C7CAN2"
FT                   /db_xref="InterPro:IPR005837"
FT                   /db_xref="InterPro:IPR005838"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22257.1"
FT                   /translation="MKRARAILVTAGLAVAAGLTASAALAQGAAPGGVTGVPGLDALLP
FT                   PGNGAASGRIIQLVALLTVLSLAPGLLVMVTSFTRFAVALSFLRSGLGLQSTPANLFLV
FT                   SLALFMTFYVMAPTFDRAWNEGVKPLQENRISEEEAFGKIVDPFREFMTQHVRPKDLQT
FT                   FTDLASRTFPKAEAGEKIDLRILIPAFMISELRRGFEIGFLIVLPFLVIDIIVSTIVMS
FT                   MGMMMLPPTVISLPFKVLFFILIDGWNLLVSGLVRSFF"
FT   CDS_pept        574424..576103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="METD_I0608"
FT                   /product="Flagellar M-ring protein FliF"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0608"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22258"
FT                   /db_xref="GOA:C7CAN3"
FT                   /db_xref="InterPro:IPR000067"
FT                   /db_xref="InterPro:IPR006182"
FT                   /db_xref="InterPro:IPR013556"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22258.1"
FT                   /translation="MFGREQAERLWSNIVDLGARRLIALGLVGLLVFLGVGVGAYYLSR
FT                   PAQEMLYTGLSREDVSRIGGVLKDNGIPFDVSSDGAAVLVSFGHTAQARMLLAEKGLPQ
FT                   SSKSGYELFNDLGSLGMTSFMQEVTRVRALEGEIARTIQGMKGVRAARVHLVLPDRGSF
FT                   RRDQQPASASVVVRTEPADDTSGAQAIRQLVASAIPGMKPDRVTVIGSEGTVLLAGDDA
FT                   GTAPTGKMATLEKSVSREMQDNIRRTLAPYLGVGNFEISVATQLNTDKTSTNETIFNPD
FT                   QRVERSVRSVRESENAQNRNSQRPTSAQENLPDQRTRSDGNDQSSNESSKKEDLTNYEI
FT                   SQKTVQTVSDGYAIRRLSVAVLVNRSRLTALAGPDDKASLDKQIAEIEELVGSAAGFSK
FT                   ERGDTIKVAAVGFVNDGQPMEPVPPLSLTDVMMKQSGTLINAATILVVAGLLIWFGLRP
FT                   ALRAILATPETAQSEVAALAGLEGAPVLAADGTMALAAPGAALPGSSEAAKLPAPGVAG
FT                   LLEELEDKMARSPQKRLEQLIDIDEEQVAAVLKRWLMREEAA"
FT   CDS_pept        576103..576828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0609"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0609"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22259"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22259.1"
FT                   /translation="MDAVLARYLPDFSAPPPPPAALSGEPDFSGAWFRAPAAEPAAPAP
FT                   IEIQAELEPFLPRAAAATLRPAEDREALIAAAEARGREQGRTEAMEEWSAQAALERAAQ
FT                   QALFEEGVAQARRDWTEAQGEILAQGFVAAMQALDATLSDRVARLIAPVLGQALQRQAL
FT                   DELGAALKRILAEPQRAAVQVRGPDDLIAALAARLGGSTGIAFETAEGPEVTVRAGETV
FT                   IETELAAWSRLITAAIAEA"
FT   CDS_pept        576830..578254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motB"
FT                   /locus_tag="METD_I0610"
FT                   /product="Chemotaxis protein MotB"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0610"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22260"
FT                   /db_xref="GOA:C7CAN5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22260.1"
FT                   /translation="MSDRAHEIIIIKRHGDHEEGHHGGAWKIALADFMTAMMALFLVMW
FT                   LINSTSKEQKQTIAEYFNPVKLAEVTHDRKGVNDPQDTPNDPAPSGKGKGDGGNAEGKG
FT                   DAAGAPGSRARESALFQDPYAVLAKLAAEAEAAGPEAASADASALEAGQPGVAGGETGR
FT                   DPFDPLYWQVAALPRRRTDNPGALDSAAAAPADSRLDARAQTAGSKPREPQKESAKDIA
FT                   RQSLSDAMRQAGVKLASAEPMPLTVPSAEPAKPSAEAAPLASPAEAKPAPPEPTLLAKA
FT                   EAPPAKDFAPAKDLAPAKDLAPAKELAAPADQAAKAAETAALSALKAEIARAVPSLPNG
FT                   APAPQVEVRRTGEGVLISITDEINYSMFGIGSAEPTPKVVKALERIAKILNSRPGRVVV
FT                   RGHTDGRPFRSETYDNWRLSSARAQMASYMLVRGGLDEARIDRIEGYADRQPRIANNPK
FT                   AAENRRIEILLRGLPE"
FT   CDS_pept        578254..579633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motC"
FT                   /locus_tag="METD_I0611"
FT                   /product="chemotaxis protein MotC"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0611"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22261"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22261.1"
FT                   /translation="MLRTLPRRPLARFSRRAVIASRPAKPSRYVTAMEGASRTALTALA
FT                   VALCLVIAPAKAAEHGDTHAPPAEAHAADDHGGHGAAAKPIEPLPVKAHGLPVELTRTL
FT                   QLLQDRIARGSTQAHLAQRQLLGHIEQRLIALDPETWAEAENVRAAVTFALAGGGPGAL
FT                   RVILRSGKVPEAEQPLALGALAYLEGREREARAKLAGIDPRTMPAGLAGQLALTQSALM
FT                   VRDAPVKSLELLDLARLLAPGTLVEEGALRRQIFVVAQGGDARRFEALAIQYLRRFRRS
FT                   VYAGNFRQRFAGALTRLDFDSDRTRIASLERMLDEIEPEGRRDLYLLVARAGLEQGRRE
FT                   TALFSAERAMGLAAPDSQPSAQARLYRGAALIVADGRFEEGYEALRGLDRTDFVPTDAE
FT                   LLDAALSTARQIRTPSAIAEAAATPPPSSSRPIPESGSLLRAQEALARAERAMDAPART
FT                   P"
FT   CDS_pept        579673..581526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0612"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0612"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22262"
FT                   /db_xref="InterPro:IPR021136"
FT                   /db_xref="InterPro:IPR038610"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22262.1"
FT                   /translation="MRSLDTLPLLRPKSEAGRAPVGEDARAGVPPDFEAMLGAFENGAA
FT                   ERGTAESGIARAGEAATEQAEAGTDTPPTLPAEASPATTLDVGGSALQALMALTGPAAP
FT                   AIAVPPDASLEAMVQRAAARAGSGPGPAPAEPALQMSMVGLETHFAPVRPHGAAAPVET
FT                   AMTPGQIEPSAPQTLPTPGSIGAAPIAPVSAGKAPIPGTPQTAPAPDATVPSALPAGGP
FT                   DGPLAPGSVALQPPASRSDAREPPVPSDRPASGAPANALTAPAATTSARPAAPVPGPDR
FT                   PAESTAASPGPAPDEAVRQAAGAPPAQAAGAEAPRSPAPRGRAATRSDQAEPASAADNA
FT                   ALLDQPESTSLPEPVAVTQPGTPGQTRRDPESRQDRPAAIARPDTMPEHAAVAVPRPQA
FT                   EGGARAERAGSDAVTIEAPRPDMPLAPSGPQETAGMPTPAPASPLRQIVDAVAAQLPAA
FT                   PAAMATPSARPVPASAEAGPLKILTLQLHPADLGSVLVRMRLQDGRLEMSLRTSREETA
FT                   ERLRREGDLLSGLLREAGYEPEAVTIQSGGPGAGESGPRGQGFASFAGSQGGQHDRQPD
FT                   AATPDQSGRRPSPRADAAATPTEEQDHETDSRGRDRGSLYL"
FT   CDS_pept        581480..582148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0613"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0613"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22263"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22263.1"
FT                   /translation="MRRILAGAIAAACISSAVVPNAAAAHSTAAEGAAEAASAQTGALG
FT                   GDARGGSKRPLMAGASRVCERQMAQAAAKHGVPLGMLYAVGLTESGNRGSLQPYAMNIG
FT                   GKAYFGSGAADVMQRLAQAQQEGVRLVDLGCMQINHHYHRAKFASLEAMIDPAQNVEYA
FT                   TRFLKELKEREGSWTLAVARYHAGPNNNPAQKVYVCRVITNMVATGFGNWTPGAKSFCQ
FT                   "
FT   CDS_pept        complement(582156..582857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0615"
FT                   /product="Two-component response regulator"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0615"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22264"
FT                   /db_xref="GOA:C7CAN9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22264.1"
FT                   /translation="MYFLVDPRDTVNAGYKASFEREGISSFALMPDEFLSWLRAASPAD
FT                   LEAIQGFLLGDFAERAKCAGVIRKQSRAPIIALADLRSLEQTVELLEAGIDDVLPKPVH
FT                   VREILARSEAIWRRVNGAVQPSEAEGETEGEARGPDRLKVFHDGRDPEIDGVPLSLPRR
FT                   ERHILEYLVRNRGRRLTKTQVFNVVYGVYSNGVEESVIEGHVSKLRKKLAERLGYDPIE
FT                   AKRYMGYTYVG"
FT   CDS_pept        complement(583079..583525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0616"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0616"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22265"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22265.1"
FT                   /translation="MTPQVQRFAPGPSAVPHSHAAAEQIFAEALRDFIAELCLLDGGVL
FT                   IGWIRGERHGNIADIVSSSAELFFKESVLTYADAADVCLDWGRSMQVVLDLEFAAESVT
FT                   VFFKLVLDEVFAGVAIQRIVAEETAALSLENFAHALRQARVGHA"
FT   CDS_pept        complement(583522..584583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flhB"
FT                   /locus_tag="METD_I0617"
FT                   /product="Flagellar biosynthetic protein flhB"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0617"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22266"
FT                   /db_xref="GOA:C7CAP1"
FT                   /db_xref="InterPro:IPR006135"
FT                   /db_xref="InterPro:IPR006136"
FT                   /db_xref="InterPro:IPR029025"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22266.1"
FT                   /translation="MADDDKESKTEAATERRVRDAIEKGDIPFSREAPVFASTLGLLIA
FT                   LALFARGQAAQLAGDFAPLLDDPRGFSLESSGDAMLLLSRVALAAGRFLLPILLILAVC
FT                   SLSASLLQNLPRFVLDRITPKWSRVSPMAGFARIFGTSGQVEFLKSLVKFLSVSVVALL
FT                   LLRSERTRAVNAMFVDPSQLPELILTVAIRLVSAVAIATIVIVAGDLVWARLRWQRSLR
FT                   MSHQDIKDEHKQTEGDPSVKARLRSLAQDRARNRMLANVDRATVVIANPTHFAVALRYE
FT                   PSENPAPLVIAKGQDLIALRIRAIAEEKGIAVIEDKPLARSLYDAVQVDQTIPAEFYRA
FT                   VAQILFFLFARAR"
FT   CDS_pept        complement(584627..585706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="METD_I0618"
FT                   /product="flagellar motor switch protein FliG"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0618"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22267"
FT                   /db_xref="GOA:C7CAP2"
FT                   /db_xref="InterPro:IPR000090"
FT                   /db_xref="InterPro:IPR011002"
FT                   /db_xref="InterPro:IPR023087"
FT                   /db_xref="InterPro:IPR028263"
FT                   /db_xref="InterPro:IPR032779"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22267.1"
FT                   /translation="MSSSPLASSPVPSDAVSSGAVAPRAVATRRLEPVDQVAALLLAMG
FT                   KPAAGRLIKYFEPDELKRITRSASNLGAVSPEQLDTVVEHFSAEFSAGNSLIGTASEVE
FT                   KLLSGLLPADQIADILADVRGSATRSVWDRLGTVQESVLASYLVKEHPQTAALILSKVK
FT                   PATAAKVMGHLPAPVRNTVMRRMLSFKPIVDDVLHAIEKTLHEDFMINGARNSGADTHA
FT                   KMADIINKMERQQMDDVLSSLGESRPKSVEILKGLLFTFDDIVKLAPRARTTLFDAVPN
FT                   DRLVLALKGTEADFRTTVLSALSARVRRMVEHELNGGEPAAQRDVLEARRTITDLAMEM
FT                   AGRGEIEINPGGEDEALIR"
FT   CDS_pept        complement(585729..586055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="METD_I0619"
FT                   /product="flagellar motor switch protein fliN"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0619"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22268"
FT                   /db_xref="GOA:C7CAP3"
FT                   /db_xref="InterPro:IPR001172"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR012826"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22268.1"
FT                   /translation="MSSSPFPDTDLAGTEPRVGDGRNLDSILRIPVLMQVVLGSATMPV
FT                   ADLMKLGRGAVVPLDHRVGEPVDVMVNGRVIARGEIVIVEEDNSRFGVSLTEVVGPSAT
FT                   DQNT"
FT   CDS_pept        586256..586528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0620"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0620"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22269"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22269.1"
FT                   /translation="MNTLKTLAAATLATGLLAASAHADTPGKDWMPIDQVLTKLAEAGY
FT                   GTVHSIEADDGVWKAKAVRDGRSVKVQLDPQTGAIVEKTKKQSDD"
FT   CDS_pept        complement(586542..586838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0621"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0621"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22270"
FT                   /db_xref="GOA:C7CAP5"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22270.1"
FT                   /translation="MGSLVDGVLLVALVATSACVLPMYLKLKRLDRTQAEYGAAVAASG
FT                   VALTQAGEAVRSFKEEGREVLDALSLKIEEARATLDTLEASRAALVAARSEKP"
FT   CDS_pept        complement(586822..587844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="METD_I0622"
FT                   /product="Flagellar motor switch protein FliM"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0622"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22271"
FT                   /db_xref="GOA:C7CAP6"
FT                   /db_xref="InterPro:IPR001543"
FT                   /db_xref="InterPro:IPR001689"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR036429"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22271.1"
FT                   /translation="MDETETPEAALDTAPAGAPEAAPERRPELPPFVTAAKPATDIRTR
FT                   IQEAGGLSLDRLPMLSVVFDRLATACSDAAKHLAASTTFYSLSGVESGRFGEFLDAYDA
FT                   NAVVGIFQAPEWDGHVLVGLDRDFLYTMVEVLFGSDGAEPPVEDERTFSAIELRIAQMV
FT                   FEQVGKALESSFGLVSQTAFRLERMETRMEFAVIGRRSNKAVQAKFLLQALNRGGEMFL
FT                   IIPQTVLNPLRPALGKVLTGESAARDPRWAEQIAAEVQKTTVRLRAVLEERHLTLGEIA
FT                   GLKVGQVLTLDATPATRIKLEGNDRPLFWCRAGQSQGSYVLRVEESINPEKEGGHGLLG
FT                   "
FT   CDS_pept        complement(587859..588734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="motA"
FT                   /locus_tag="METD_I0623"
FT                   /product="Chemotaxis protein MotA (Motility protein A)"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0623"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22272"
FT                   /db_xref="GOA:C7CAP7"
FT                   /db_xref="InterPro:IPR000540"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR022522"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22272.1"
FT                   /translation="MGILVGLVIAIGCMLGGFVAMGGHLIVIWQPWEFVIIFGMAAGTF
FT                   VIANPMKTVVDSGKATMEAFTNKGPKRQDFLSLLGLLHALMRDLKTKPRNEVETHFDDP
FT                   ANSEIFKNYPEVTKDQDLVLFICDYCRLILIGNARSHEIEALMEEEIGTHKKYKLKPYA
FT                   AINTVAEALPALGIVAAVLGIVKAMGALDQSPQILGGLIGAALVGTFIGVFASYGMLAP
FT                   LAVKIKGVREKQCSVYTIVKQSLIAYMNGALPQVAIEHGRKGIAGADRPTIDEVESATV
FT                   PGARAEPAAA"
FT   CDS_pept        588933..589493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="METD_I0624"
FT                   /product="ATP-dependent protease"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="12.3 : Protein interactions"
FT                   /function="15.1 : Cell division"
FT                   /EC_number="3.4.25.-"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10368140, 10693812, 8244018,
FT                   9003766, 9013898, 9177170, 9257689; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0624"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22273"
FT                   /db_xref="GOA:C7CAP8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22273.1"
FT                   /translation="MAQTDDRLPQMHATTILMVRKGGRVVIGGDGQVSLGQTIVKGNAR
FT                   KVRRLAKGTVIGGFAGATADAFTLFERLEAKLEQYPGQLTRACVELTKDWRTDRYLRRL
FT                   EAMMLVADKEVSLLLSGAGDVLEPETGVMAIGSGGNYALSAARALEDGELDAEAIVRRS
FT                   MKIAAEICVYTNGNLVIETLDAA"
FT   CDS_pept        589605..590918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="METD_I0625"
FT                   /product="ATP-dependent protease, ATP-binding subunit"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 10368140, 10693812,
FT                   20370831, 8244018, 9003766, 972251; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0625"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22274"
FT                   /db_xref="GOA:C7CAP9"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22274.1"
FT                   /translation="MTTFSPREIVSELDRFIVGQKDAKRAVAIALRNRWRRQQLKGPLR
FT                   DEVAPKNILMIGPTGCGKTEIARRLARLAGAPFLKIEATKFTEVGYVGRDVEQIVRDLV
FT                   EVGIGLTREEKRKAVKAKAEAAAESRILDALVGPTASQATRESFRKKLRASELDDKEVE
FT                   IELAPSGSQGMPMFEIPGMPGASMGAINISDMLGKALGGQRGKPRRITVAEAYAPLIAE
FT                   ESDKLVDDDALTREAIREVEDNGIVFLDEIDKICAREGRSGADVSREGVQRDLLPLIEG
FT                   TTVATKHGPVKTDHILFIASGAFHVSKPSDLLPELQGRLPIRVELQPLTVEDFKQILTA
FT                   TEASLIKQTVALMETEGVTLDFTEDAIDALARVAVEVNGSVENIGARRLQTVLERVIDE
FT                   ISFTATDRSGETVPIDAAYVRDRVEDLAANADLSRFIL"
FT   CDS_pept        590921..591811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0626"
FT                   /product="putative membrane protein DUF6 precursor,
FT                   putative threonine and homoserine efflux protein"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 8021175, 8930920;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0626"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22275"
FT                   /db_xref="GOA:C7CAQ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22275.1"
FT                   /translation="MHGRNAAPDIALPILALLAGMVSIQSGAALAKGLFPVVGAAGVTT
FT                   LRVGFSALILLAVWRPWRRSLERGEIGAIALYGAALGLMNLLFYLSLRTIPLGIAVAIE
FT                   FTGPLAVALAGSRRARDFAWIGLAVLGLGLLLPLGETSTLDPTGAALALGAGLCWAAYI
FT                   VFGQRAGRAGGGRAVSLGMAVAALVVAPVGLVEAGTDLFTPATLATGLVIAVLSSALPY
FT                   SLEMFALTRLPRPAFGVLMSLEPAVASVAALALLGERLTPVQGGAIACIVAASAGITLA
FT                   NRRSGGRRQEPNDVG"
FT   CDS_pept        complement(591845..592906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0627"
FT                   /product="Beta-lactamase-like"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0627"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22276"
FT                   /db_xref="GOA:C7CAQ1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22276.1"
FT                   /translation="MKKRGLLTVASAATVMTLGGVGYAAHRRNKNPYYRGPESAHFDGL
FT                   RFHAPNQPPDKSLSDLARWRRTGKPEAWPASFPSPFPADRPPERFEGLRVVLIGHASYL
FT                   FQVAGRNILVDPVYAKRASPVRFAGPKRVNAPGIAYADLPPIDAVLITHNHYDHLDGAT
FT                   IARLWQDHQPLIVAPLGNDAILRGYDETMHVETHDWGESVDLGAGITVHLTPANHWSAR
FT                   GFNDRRMALWCAFVLTTPRGVHYHVGDTGLGDGALFREIRARFGPPRLATLPIGAYEPR
FT                   WFMQPQHMNPADAVEALGLLGADQALGHHWGTFKLTDEGIERPVEALGEALTAAALPPE
FT                   RFLALRPGQVWEG"
FT   CDS_pept        complement(592956..594041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0628"
FT                   /product="putative rieske 2Fe-2S family protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0628"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22277"
FT                   /db_xref="GOA:C7CAQ2"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22277.1"
FT                   /translation="MSSATAPRISTDDALDPRAMREPLSNAWYCAGRASAVAGGKMRAV
FT                   ALNGEQVVLGRAKDGSLFALRDRCPHRGMALSKGKFDGDTLMCPFHGWRFGTDGRCRDV
FT                   PTLSAHDASDFSRIAVQRFPIVESAGFLWVNPHLGPSDPGAVPAVPSLDFEPAGCLVLE
FT                   LEVEASFDLTTLSLVDPGHVAFVHDTWWFRPSKELREKVKTFQPVPHGFVMTSHATTTS
FT                   SPVYRLLGGAPEVEIEFRLPGVRLERIKAGTKRVANYTFATPMGPNRTMLTNALYWSMP
FT                   ALNLLKPIARPLMRQFLTQDQQVLQHAQAGLDRKPTMVLLGQGDLPSQWYFRLKREALE
FT                   AARESRPFANPLTRQELRWRS"
FT   CDS_pept        complement(594406..594912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0629"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0629"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22278"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22278.1"
FT                   /translation="MLVNAPLEVPEDFPMSEPARQAPSPEPGLRTPAATAPLRDWLATM
FT                   RTAMSDTPAVETRSAEPAPAEPDAEARNSGWSPRLVSVAAKSAEAADEDVAEIMAENMM
FT                   LKARLRLESERRDELQVILAQEIRELRAHIAEEVGKMDDLRTERDLWRARCEALAAPLF
FT                   QVQHR"
FT   CDS_pept        595451..597013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ffh"
FT                   /locus_tag="METD_I0632"
FT                   /product="signal recognition particle protein, GTPase"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 6357787; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0632"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22279"
FT                   /db_xref="GOA:C7CAQ4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22279.1"
FT                   /translation="MFEGLSDRLSGILSGLTRRGALTEADVTAAMREVRRALLEADVAL
FT                   EVVRSFTDKVREKAVGAVVLKSVTPGQMVVKIVNDELIAMLGTDASVVDLNAPAPVAIL
FT                   MVGLQGSGKTTTTAKIARRLNQRDKRRVLLASLDTRRPAAMEQLAVLAKQVEVESLPIV
FT                   AGQSAVQIAKRAMEAARLGGFDVVMLDTAGRTTVDEGLMNEAAEVKAATKPHEVLLVAD
FT                   ALTGQDAVNTARAFDERLGVTGIVLTRMDGDSRGGAALSMRAVTGKPIKLVGVGEKVDA
FT                   LEEFHPHRVANRILGMGDIVSLVEKAAETIDHEQALRTAEKMRKGKFDLEDLSMQLAQM
FT                   EKMGGIGGLMGMLPGMGQMKKQVEGANLDEKMFKRQRAIISSMTAGERKNPDLLKNSRK
FT                   KRIAAGAGVKVEEINKLLKMHRTMADMMKAMGSGKRGGIGQALGNMFGLGGGMPGGLPG
FT                   GMKLPPGMPEPTPEQIAEIEKQFGGKLPPMPAGLGGGKMPGLPGLGGPKMPGLGGFLPG
FT                   KKK"
FT   CDS_pept        597010..597357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0633"
FT                   /product="putative chorismate mutase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="5.4.99.5"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 12581215; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0633"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22280"
FT                   /db_xref="GOA:C7CAQ5"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR010951"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22280.1"
FT                   /translation="MTILSAQGIDPELASLRESIDNFDAALIHLLAERFRCTQRVGELK
FT                   ARKGLPPSDPDREARQVKRLRNLAVEAKLDPDFAEKFLAFVVKEVIRHHRTIAESVDQN
FT                   TTAKPDTERND"
FT   CDS_pept        597357..597719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="METD_I0634"
FT                   /product="30S ribosomal protein S16"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0634"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22281"
FT                   /db_xref="GOA:C7CAQ6"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR020592"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22281.1"
FT                   /translation="MSLKIRLTRGGAKKRPYYRIVIADARAPRDGRFIDKVGAYDPMKA
FT                   KDDPARIVLDNEKIQSWLAKGAQPTDRVLRFLDAAGLAKRPTRNNPQKAEPGEKAKERA
FT                   AKRAEKAAAPAEDAAA"
FT   CDS_pept        597844..598515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0635"
FT                   /product="putative 16S rRNA processing protein"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 11214968, 6357787,
FT                   9226267, 9422595; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0635"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22282"
FT                   /db_xref="GOA:C7CAQ7"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22282.1"
FT                   /translation="MARRPGSSSRGPARSDRLPAEAVTSARKPHAAAPTSPASPDPGLV
FT                   LLGEFGRPHGLHGEVRLKSHTSEPLAIAGYGPLHASDGRTLELANVRPAAGSSPDLLIV
FT                   RVKGVDDRTGAEALNRVTLAIARERLGEVEDEDEFFLTDLIGLTVEDGAGTVIGTIVAV
FT                   PNFGGGDLLEICPAAGGPTALLPFTKAFVPSLDIAGGKVVADPPDDLFAPPGPKPADDP
FT                   G"
FT   CDS_pept        complement(598523..599317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0636"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0636"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22283"
FT                   /db_xref="GOA:C7CAQ8"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22283.1"
FT                   /translation="MILDLWLDQPVWLMFTLLSGVFLALCLMLSLLSNLPWTRSGMRLL
FT                   AGGIVPPYIGVIAVLLSLLTGFVANDAWERQRQASRVVQAERSHALAVYDLSIASAPDM
FT                   SGLRTSLFAYLDAVVKEEWPSMAADGASAPAVGQALGRLLQTAADPRTAAEAGEATYAA
FT                   LLEAVMQLRSARSERLALSAARSDESKWLTLLVLAILTLTSIALVHCERPFAQATTLAL
FT                   FSAAMVTTLSVIAMHERPFDGPLALSSEPIRLARVAMEAGTR"
FT   CDS_pept        complement(599386..600117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0637"
FT                   /product="conserved protein of unknown function; putative
FT                   exported protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0637"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22284"
FT                   /db_xref="InterPro:IPR026669"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22284.1"
FT                   /translation="MTRFAAALVLLSLPALAAEPLAPPGAPSERFPRPDRPVAEIVAPQ
FT                   WAQERERDKADEVGQVAHLMRIAPGETVADIGAGNGYYVFRLSPRVGPQGRILAQDITP
FT                   DYLADLERRLAESGLSNVTVVRGEAHDPRLPPGSVDAAVLVHMYHEIAQPFGLLWNLAA
FT                   AMKPGGRVGIVDADAIPSRHGTPPKLLRCELASVGYRELSMTRLKGGVGYLAVFEAPAP
FT                   DRRPAPETIRPCRDEATRERR"
FT   CDS_pept        600227..600544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0638"
FT                   /product="protein of unknown function; putative exported
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0638"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22285"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22285.1"
FT                   /translation="MHNPMLRPPFLRHAILAASAALALTLLPASLAQAQGMPGATVGLP
FT                   MGSPDPFGLSTVNRPSGYSAEPYAEPGMGPAERRIRPRSQRRLKSHRNSAPKRRAPMAR
FT                   R"
FT   CDS_pept        600654..601376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="METD_I0639"
FT                   /product="tRNA (guanine)-methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0639"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22286"
FT                   /db_xref="GOA:C7CAR1"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22286.1"
FT                   /translation="MSEPIPPGTAAPWRATVLTLYPEMFPGPLGHSLSGDALGRGTWSL
FT                   EPRQIREHGLGRHRNVDDTPAGGGAGMVLRCDVLGAAIDAAAPADDPRPRLLMSPRGRP
FT                   LTQDRVRALAEGPGAIIVCGRFEGVDERVIEARALEEVSIGDYVLSGGEIAAVVLIDAC
FT                   VRLLPGVMGKHASGVEESFEGGLLEYPHYTRPREWEGRTIPDVLMGGNHAAIARWRAEQ
FT                   SRALTRARRPDLLEQDEF"
FT   CDS_pept        601550..602725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serC1"
FT                   /locus_tag="METD_I0640"
FT                   /product="phosphoserine aminotransferase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /EC_number="2.6.1.52"
FT                   /note="Evidence 2a : Function from experimental evidences
FT                   in other organisms; PubMedId : 8824630; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0640"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22287"
FT                   /db_xref="GOA:C7CAR2"
FT                   /db_xref="InterPro:IPR006271"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022278"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22287.1"
FT                   /translation="MTAQMPAARPRVPYFSSGPTTKRPGWSLDALSGAALGRSHRSAVG
FT                   KAKLAEAIELTRKVLRIPADYRIGIVPGSDTGAVEMAMWSMLGPKPVEVMAWDSFGAEW
FT                   VTDALKELRIDPKVHIGEHGILPKLDAIDTKNNDVVFTWNGTTAGVKVPHADWIADDRE
FT                   GVTICDATSAAFAMPLPWDKLDVVTYSWQKVMGGEAAHGMLILSPRAVARLESHTPAWP
FT                   IPKVFRLTKGGKLIEGIFKGETINTPSMLAVEDYIDTLNWAQSIGGLDALHARADANAR
FT                   VIHDWVARTPWIGHLAVDPATYSNTGVCLVITDSDVLAKGDAAVKAFAAALVTRLEKEG
FT                   VAFDFGAYRDAPAGLRIWCGATVEASDLAALTPWLDWAFAQEKAALAAAAA"
FT   CDS_pept        602883..604490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="serA2"
FT                   /locus_tag="METD_I0641"
FT                   /product="phosphoglycerate dehydrogenase"
FT                   /EC_number="1.1.1.95"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0641"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22288"
FT                   /db_xref="GOA:C7CAR3"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR006236"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22288.1"
FT                   /translation="MPKLTQTKPKVLITDALSDAAVQIFRDRGIEVDFQPGLGKDKEAL
FT                   AAIISQYDGLAIRSATKVTDKLLAQATRLKVIGRAGIGVDTIDVPAATARGVIVMNTPF
FT                   GNSITTAEHAIALIFALARQIPAADASTQAGKWEKNRFMGVELTAKTLGVVGCGNIGAV
FT                   VADRAIGLKLKVIAYDPFLTPERAFEMGVEKVELDELLGRADIITLHVPLTDKTRNLLS
FT                   EENLAKTKRGVRIVNCARGGLVDEIALRAALDSGHVAGAALDVFVTEPAIENPLFGHPN
FT                   VICTPHLGAATSEAQENVALQIAEQMADYLLSGAITNAINFPSISAEEAPRLKPFVALC
FT                   EKLGLFLGQLTEAPIKGIRITYEGAVAGMNTRALTSAAVTGVLRPILQEVNMVSAPVIA
FT                   RDRGIVIDEIKREGGASDYESVVRITVDAEDMPRDAAGTVFNDGKPRVIEIRGINIDAP
FT                   FAPLMLYVRNHDRPGFVGSFGTVLGEAGVNLATFAMGREAEGGNAIAFVAVDAEVSPEV
FT                   LKAIEAIPQVKRVRPVRF"
FT   CDS_pept        604468..604818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0642"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0642"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22289"
FT                   /db_xref="InterPro:IPR015066"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22289.1"
FT                   /translation="MSAPYASEAGKPPAEASKPPADDPDRPLHSDGTALPAPSPLPPDQ
FT                   EDRAMARKFTFRCAWDEAAGVFFVHDSPVPGLATEAPTMPALLCKLPGMIRDLLGLDDG
FT                   AYLDIYVERVKR"
FT   CDS_pept        604961..606058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0643"
FT                   /product="putative translation initiation factor, aIF-2B
FT                   alpha subunit (eIF-2B)"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0643"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22290"
FT                   /db_xref="GOA:C7CAR5"
FT                   /db_xref="InterPro:IPR000649"
FT                   /db_xref="InterPro:IPR005251"
FT                   /db_xref="InterPro:IPR011559"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR042529"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22290.1"
FT                   /translation="MKIDGRPYRTIFPEADGDAVMVIDQTRLPFAFELKRLANLDDAAV
FT                   AIRTMVVRGAPLIGVTAAYGMALAMRQDASEAGIEQASATLAATRPTAINLRWALDRMA
FT                   AVLRRAPQSAREALAFTEAAAIADEDVASCRAIGEHGAKILSAIAAKKDGPVNVLTHCN
FT                   AGWLATVDWGTALAPIYVAHDAGVPVHVFVDETRPRNQGAALTAFELNAHGVPHTVIAD
FT                   NAGGHLMQHGQVDVCIVGSDRTTASGDVCNKIGTYLKALAATDNRIPFYAALPFSTIDW
FT                   TLSDGVRDIPIEERDAREVTHLTGRTDDGAFATVAVVSPGSPVANPAFDVTPARLVTGI
FT                   ITERGVCDASEEGLAGLYPERRRAA"
FT   CDS_pept        complement(606070..606417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0644"
FT                   /product="putative DNA-binding protein"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0644"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22291"
FT                   /db_xref="GOA:C7CAR6"
FT                   /db_xref="InterPro:IPR021487"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22291.1"
FT                   /translation="MAEKDDHETIWKDFKGAVNMTASALEKFLETDESQSVGQKKDGGE
FT                   ATGHKEGRRIVEILHKKKADLSDDDYAHMKKVVGYVNRHLKQGGPEDKSKTEDSPWRLS
FT                   LMNWGHDPLKA"
FT   CDS_pept        complement(606483..607901)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0645"
FT                   /product="putative multidrug efflux system transporter
FT                   mdtK"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0645"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22292"
FT                   /db_xref="GOA:C7CAR7"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22292.1"
FT                   /translation="MTSSPSLAAGALGRPPASPWLDELRATLKLSAPLVLINLAQHGLV
FT                   ASNAVLLGRLGAEPIAAGALATSLYLLLFIGGIGLTSAVAPLVAEAVGRAAGAGADEVR
FT                   RTVRAGLWVGFLVTLALMPGLWFTEGLLLALHQEPAVAREAGAYMRVLQWWMFPALAFM
FT                   VLKGALAALQRPGPPLAVSLAALPLNIALGAFFAFGPPDLGIVGVALGTVVTEFLAIAA
FT                   LVAVIRLDAGLRRHRMFARLWRFDTERLARVVRVGLPMGVAGIAEAGLFEAATVAMGTF
FT                   GTLPLAAHAITLQIAATCFMVPNGIGQAATVRVGRAYGAADRAGLRRAGAVALWLGFGF
FT                   MVACALAQLFAPHTLINLFLDAEAPGAAQVYPVAAGFLIFSALFAISDGVQSVALGALR
FT                   GLQDTKVPMLIALFGYWGIGVPLGAALAWGTGMGGRGIWAGFCAGLLVVSVALVIRWRR
FT                   LSAGRPRVPSAQPA"
FT   CDS_pept        complement(607926..609782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0646"
FT                   /product="ABC transporter, fused ATPase and permease
FT                   domains"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0646"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22293"
FT                   /db_xref="GOA:C7CAR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22293.1"
FT                   /translation="MFLDWLERRIDPFAPFDDRRVPPKTVLGFAGFYLRPIRFALLALF
FT                   VIAVVAGGIEASLYLLMRWFIDLMNAADRTTVLSDNAVPLTLAALLLLVVRPLAAFLHE
FT                   LASNQLIVPQSTNQIRWRTHLYTLGHSLSYFQADFAGRLANRTVQVGPAVRELAVVFID
FT                   TLLYVAIYAVTAIGLFSSISGWLALPVVLWVVAYAGLTAWFVPRARKRSHLTAETRSTL
FT                   IGRVVDSYTNILTVKLFARDREERATVRDAVDTHTRAYLHQFRLTTLTTSLLAGLNSLL
FT                   LFATAAVCFALWQRGALTTGEASAGLALILRLMAMSGWVMQTVRGVFENVGVIQESMQT
FT                   IARPHGLTDAPDAKTLQVTGGEIRFENVDFHYGRGDASIIEDLSFQIRPGEKVGLVGVS
FT                   GAGKSTITALLLRLHDVEGGRILIDGQDIAGVTQDSLRQAIAMVSQDTSLLHRSIRDNI
FT                   GYGRPDATDAEIEQAARLAHAHEFILDLVDHKGRRGYDAHVGERGVKLSGGQRQRIAIA
FT                   RVILKDAPILILDEATSALDSQVEAAIQEALDTLMGDKTVLAIAHRLSTIAALDRLIVI
FT                   DSGRIVEEGTHAELIRRGGLYADLWRRQSGGFLGDRAPAPAS"
FT   CDS_pept        609923..610372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0647"
FT                   /product="putative rRNA methylase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0647"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22294"
FT                   /db_xref="GOA:C7CAR9"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22294.1"
FT                   /translation="MLRLALYQPDIPQNTGTMLRMSACLGIAVEIIEPAGFDVSDRHLR
FT                   RSGLDYLDHVAITRHRSWDAFEAWRRETGIRLVLATTTGSVPYTQHAFRDGDCLLMGRE
FT                   SAGVPEAVHAAADARVVVPIRPGLRSLNVAVCAAMMLGEAIRQVG"
FT   CDS_pept        610666..612300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0648"
FT                   /product="putative methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0648"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22295"
FT                   /db_xref="GOA:C7CAS0"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:C7CAS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22295.1"
FT                   /translation="MISAGLIVYARDVMRGLSEQTARIVDVQAVRLDALLHMRGGITEA
FT                   AVMDRNMLLESDPQNKARFRTRQQAGMTEAREGAERLLALADTPERRTANEAVRRDIES
FT                   FFATLDRVYDLGLRQQGDEAFRIARDVGIPARLKLNEWMQNRSTLLASELAAAKVKATE
FT                   DADRGTAMLISFAVVGLLGAMALAGSIVVLSITRPLGSLVGVLQRMARGEIEAEIKEAA
FT                   RGDEIGAVGRAVEGIKAMVARKAAEEAEVRRRADEAAAAERKRTMVELADGFEAAVGGI
FT                   VGMVSASATELQATAQQMTATATETASQSTTVAAAAEEAASNVGTVAAAAEELGVSVQE
FT                   IGRQVQGSSGLAQAAVGEADQTTHLVQALRTTSARIGDMVGLISNIASQTNLLALNATI
FT                   EAARAGEAGRGFAVVATEVKELASQTARATEEISGQIGEIQGVTDQAVAAIGVITSRIR
FT                   EINNVAAGIAAAVEQQGAATQEIVRNVAQASSGTAEVTRNISGVAQASEETGIAASQVL
FT                   TSSAELSRQSEHLSAEVQRFLATVRAA"
FT   CDS_pept        612563..613702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0649"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0649"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22296"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22296.1"
FT                   /translation="MTRSGTLPSRLTYRLLPEPADLAEVFALLAAYRRMLVLLEEIRRE
FT                   HGLRANVVALIEHGYQRVRDETGLPARLVTLGIRDFAQRAAGFDPETVTSMPLDDKLFS
FT                   VKGASEIALTTMNGRRTMPYRVEGYDGPWRELSSARLTIAGDALTIQVGVSVTAPQEET
FT                   RMTENILTRVGRIIGGLSNAALEAVEDRNGLAVAEQALREIDAVIHEARLDLGKIKAEE
FT                   HRLSARRGQLDGELRALPEKLSLALSNGREDLARAGISRQLDLESQIEAIDSSLADVAE
FT                   RHRAATKAMQAATAARRDAEHRIALLRKPPAKAADPLDGYGSEEATRTRQLEQSLRAID
FT                   RVTGTASSVADPSVEELDRLHRDDAIERRLAALKQGRPS"
FT   CDS_pept        613699..614367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0650"
FT                   /product="conserved protein of unknown function; putative
FT                   membrane protein"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0650"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22297"
FT                   /db_xref="GOA:C7CBC7"
FT                   /db_xref="InterPro:IPR010840"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22297.1"
FT                   /translation="MTSLVGPLAGPALFPFTLAAVVMAGLVAVEALSLLLGQSLSGLVD
FT                   GALGHEAGGGGDLTSAADADAAFSPAAVMSWVNLGRVPFLILLILALAVFALAGFVVQG
FT                   LAAAVIAPLPALLAVPVAGAATLPALRVSTKAIARLIPRDESYVVSADDLIGATAEVTL
FT                   GPLDQGLPGQVRALDRHGNTHFLRTRAAPGAPAMEAGARVLIVDRADAVYVAVPAAPDL
FT                   "
FT   CDS_pept        614404..616110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0651"
FT                   /product="putative inner membrane protein (yqiK-like)"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0651"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22298"
FT                   /db_xref="GOA:C7CBC8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR027705"
FT                   /db_xref="InterPro:IPR031905"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22298.1"
FT                   /translation="MDLISPGIINLLVIAGIIVVALLGIGFVFSRLYRRTTRDTAFVRT
FT                   GLGGRKVVVDGGAVLLPVFHSIAMVNLNTLRLEVKRSGNESLITKDRLRADITVEFYVR
FT                   VEPKEESIALAAQTLGDRTNDAMLLRELIEAKFVDALRSVAAGMTLPDLQEKRAAFVKG
FT                   VQEAVSGDLRHNGLELESASLTRLDQTSIEHFNPDNSFDAEGLARLKEITEQRRKERNA
FT                   TERDAEVAVAEKDRETALKQLEIKRTTREAELAQERDIANKTAETRAETAQAEQRAQQS
FT                   EETARIEREQVVRLREAEARKNSEGARIEADLAIAQRNAEAERERQLILQDNAIKIAER
FT                   SEKESQARAAAKAAEALAVAAEERVATAKAKEIAEREREVTVIAAKQEAEREATGVTVT
FT                   AEAERRAAEDRANAIITLAEAEATAAASRAEAIAKLGQAEAERERVMNEARNALSAEAR
FT                   AFETNLKRLGIIPDALRESMRAVEKIDSIRIFDAGGMMGGGNGAGGVSANFGDSLSGHL
FT                   LRYQYNSPILGAILNEAGFAEGKGSLDTLVGGLRNGTAVEPAANGHAAAAE"
FT   CDS_pept        616302..618488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0652"
FT                   /product="putative TonB-dependent siderophore receptor"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0652"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22299"
FT                   /db_xref="GOA:C7CBC9"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR010916"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22299.1"
FT                   /translation="MSSALRDRLRYGLAAFLAGTAALGSSGAAWAQEAVTLETLSVEGS
FT                   GRGGSGPGGAGTESAFGPVPGYVAQRSATGTKTDTALKETPQSISVVGEQQVREQAATS
FT                   VQEALRYTAGVAAEAYGPSTRGDYPRIRGSDAAIFLDGLRLKDPDVFNEPRPDPYTLSR
FT                   FEVLRGPASTLYGSSPVGGLINLVSKRPLDVPYTEAGVRFGNYGWKEAFTDSTGRLTED
FT                   GQFLYRFVGIGRLADAQTDFVANDRYVINPSVTWRPSADTSWTLIGLHQKDAFGASDAF
FT                   LPREGSLYAGPNGFIPLSRFTGDPNFNRYETETSSITSLFEHRFDDSLILRQNLRYSHI
FT                   DGTYQSAYGNVYTLTPSADLPNAPFLDPARRTVDRFTYRVSSVKDRITTDTNLQGRFDT
FT                   GPISHTVLGGVDFRQQWDSTRTGFGTDTRPFDLYAPVYVGVTPPDLGVPTALSQSQTGL
FT                   YLQDQIKFGQWIVLATMRHDWVNSATRGAESVAGEATTGRIGLMYAFENGLTPYVSYAT
FT                   SFTPIFGANVCAGGACRPIEGEQIEGGFKYNPTPWFAVNAAIYDTVERNRLTPDPSGLP
FT                   ISIQTGKVKIQGGDIEAIATINNDTNIIASYAYTDARYAAGDNAGARVETQPLHLASLW
FT                   VTHRFTLAEVPGSFLVGGGVRHIGESFDGSLNSFNTPAVTLADALVGWEDAHWRAQLNV
FT                   SNIADTRYLSTCLARGDCFVGTRRTILGSLTYKF"
FT   CDS_pept        618532..619455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="METD_I0653"
FT                   /product="Coproporphyrinogen III oxidase, aerobic
FT                   (Coproporphyrinogenase) (Coprogen oxidase)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="1.3.3.3"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); PubMedId : 12975365, 4567136,
FT                   8300522; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0653"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22300"
FT                   /db_xref="GOA:C7CBD0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22300.1"
FT                   /translation="MSDATASPLPSPDDLAALKSEAGAWFSTLRDRIVAALETLEAEAT
FT                   GPFHPDAPKEAGTFEKTPWQRTDHSGAPGGGGVMAMLKGRVFEKAGVHISTVHGEFAPE
FT                   FRAQMPGAAEDPRFFATGISLIVHPWNPNVPTVHMNTRFVVTTKAWFGGGADLTPVLDR
FT                   RRTQQDPDTQFFHACLREACEKHAPAADYEKYKAWCDEYFHLKHRNEPRGIGGIFYDYH
FT                   WTGDPQADLAYTRDVGGAFLKAYPEIVRRNLAQAWTEADREQQQVRRGRYVEFNLLYDR
FT                   GTIFGLKTGGNVASILSSLPPTVRWP"
FT   CDS_pept        619503..620624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0654"
FT                   /product="Exodeoxyribonuclease V"
FT                   /function="8.3 : Degradation of DNA"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0654"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22301"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22301.1"
FT                   /translation="MAESSLPTRFAPQQDEALKAIARWRKEGGSQVFRLFGYAGTGKTT
FT                   LARRIADDIDGPVVYGAFTGKAASVMRQKGCDDAATIHSLIYRTKEGDEGGPTFSLNRS
FT                   GPAAKADLIVIDECSMVDSDLGHDLLSFDKPVLVLGDPAQLPPVRGGGFFTEAEPDVML
FT                   TDVHRQAADDPIVRMAMTIREGGRLEVGEYGQSRVVRRRDIDPAQVLDCDQVLVGLNRT
FT                   RRLYNNRLRELAGHTDPMPSVGEKLVCLRNDRTKGLLNGSTWTVQALRAPPRPDTVRLD
FT                   VVPEDDPAARRRAVDIKVLRQVIEGSEEEIPLFLRRETDEFTYGYALTVHKAQGSQWDK
FT                   VVLFDESYAFREHRARWLYTGLTRAAQAITVVV"
FT   CDS_pept        complement(620788..622065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0655"
FT                   /product="conserved protein of unknown function; putative
FT                   aminotransferase"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0655"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22302"
FT                   /db_xref="GOA:C7CBD2"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR024551"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22302.1"
FT                   /translation="MPSLSTLSPEALSELRSSLRGEYEALKAQGLKLDMTRGKPASDQL
FT                   DLAAEMLALPGNRDTTAEDGTDARNYGNLQGLPETRTLFAPVLGAPPEQIVIANNSSLA
FT                   LMHDVLVYALLKCVPGGTGPWSKQEPITILCPVPGYDRHFALCEGFGIRMIPIPMTGEG
FT                   PDMAAVEREAVDPSVKGIWCVPQYSNPSGETYSDETVRRLASLKAAAPDFRILWDNAYA
FT                   VHHLTEARPALVNILEACAEAGNPDRPIVFASTSKVTLAGAGLAMLAASPANVKWYLAQ
FT                   AGRRSIGPDKLNQLRHVRFLRDAAGIAAHMERHRALIAPKFAAVEAAFAARLDGWEVAQ
FT                   WSRPLGGYFITLDVADGTASRVVQLAGEAGIALTPAGATHPYGKDPHDRTLRIAPTFPG
FT                   LDAVRKAAEAVALCTLLGAVEARAAA"
FT   CDS_pept        622450..623130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0656"
FT                   /product="Two-component response regulator"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0656"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22303"
FT                   /db_xref="GOA:C7CBD3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22303.1"
FT                   /translation="MYIVVDERQSVTDHYVAGFGAEGVEAQGLAIGSMKDWLDAAPRID
FT                   VEAIDGFLIGDCADRASCTVAIRSLSRAPIIALNETRSLEQTLALFTVGIDDVVRKPVH
FT                   VREIIARATAIRRRTGRGVEPAPAPDRAGRLKVYTDGRDPEIDGACLILPRRERHILEY
FT                   LSKNRGRQVTKGQIFTAVYGDLDTSVEESVVEGHISKLRKKLRMRLGYDPIEAKRMAGY
FT                   TFVG"
FT   CDS_pept        complement(623238..624635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0657"
FT                   /product="putative flagellin protein FlaA"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 3 : Putative function from multiple
FT                   computational evidences; PubMedId : 11514517, 2921241;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0657"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22304"
FT                   /db_xref="GOA:C7CBD4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22304.1"
FT                   /translation="MTSLLTNTAAMTALTTLKGINQQLDMTSNRVSTGQRVSSAADNAA
FT                   YWSIATTVRTDNASLSAVKDSLGLGASAVDTAYNGLTSVLGDLQNLRTKLQTALTPGVD
FT                   RSKVQVEIAALQNKMKSTADSSISSGQNWLSVDSSASNTAFQGTQNVVAGFSRNTAGTV
FT                   TFSTIGIDVNAIKLYDLNSSTISTPATAGQIVGTTALTGTTVFAGGTANFSAANEVNFA
FT                   LTLGNGDTANIVINKTTMASAAADLTKVTTQEFIDAINNQIAADTATTPLVGDVKASLD
FT                   SSGRLTFTTTATGAAAQITIQNNTASTGGTPAFALVDVGFGTGTTAADARVGKGSAAGT
FT                   TAGRGILDTVDGSTSYAISTIDISTLSGTAGDTTLKNIITQVEKALAKVTDAGTKLGAS
FT                   KTQIDGQKSFIDTLMKANDRTIGTLVDADIEEESTKLKALQTQQQLAVQTLSIANSATQ
FT                   TVLSLFR"
FT   CDS_pept        complement(625158..625457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0659"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Unknown function but conserved in other
FT                   organisms"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0659"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22305"
FT                   /db_xref="GOA:C7CBD5"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22305.1"
FT                   /translation="MADPRESVSPESAAPVERAGKRHRVVQQGRIVLGPERLIACTVRD
FT                   LSLRGAKIRVAPEHDLPETFSLVIAAHDLRTMTARLCWRRGDFAGVVFESEPVV"
FT   CDS_pept        625660..626229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0660"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0660"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22306"
FT                   /db_xref="GOA:C7CBD6"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22306.1"
FT                   /translation="MTSDSARRSSLGTASRAANLPARPVAGSIAARRAREAAGERTVLA
FT                   GLVLLALTASGFAGYAIATGTHEYAVQAVLPAGTAPFTWKKTVAQGRLADPDFDPVTTG
FT                   SLPDRPVAAAAGLQGPAESPVLPPAGAYALRGVTDGIATLENQEGQRTAALGSVLPGAG
FT                   RVLSIRRTGAGWVVITTETIIGPVAP"
FT   CDS_pept        626402..627655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="METD_I0661"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : Unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0661"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22307"
FT                   /db_xref="InterPro:IPR010626"
FT                   /db_xref="InterPro:IPR023157"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22307.1"
FT                   /translation="MTDTLTSYRLIAKDLPASLSRKAAEPMVARETAYYEAHIGQVKTV
FT                   DDLLGDQRLYAYAMKAYGLEEMTYAKAFMRKVLEEGAASAASFANRLADDRYTAFAKAF
FT                   SFGQGVTATGADPARFGEQARAASLSAPKLLADSYDFSGRAEASFLVESRLDATTTQSV
FT                   TIRLNAQTLAGRVANPAKVTPAEIAAAVAAQIEASALKGKVQAGLAADGSLFFETTALT
FT                   DLGADGAYGGTGLYADTLVNAGGSNRTLTIRNAALSANRTAVDVGFGTDLGPDSMAQTV
FT                   TQAYLRQSLESEAGDADTGVRLALYFARKASTLTSAYDILGDAALSQVANTVIGLPATS
FT                   GAATSEALAKRAQLIAGKIDIASFRDPAKLDAFVRRFAAIWDAQNNTASAPILALFTGT
FT                   GGLDAETLQSVQSARIGA"
FT   CDS_pept        627661..628389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="METD_I0662"
FT                   /product="Flagellar basal-body rod protein flgF"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0662"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22308"
FT                   /db_xref="GOA:C7CBD8"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR012836"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22308.1"
FT                   /translation="MQSSLYVALSSQIALEKRLTTTANNVANMATVGFRAEEVSFSELL
FT                   ARSNRGEVAFVGPGKTTISRAAGPTTKTDSALDVAVQGDAWLGVKGPKGDTLYTRDGRL
FT                   TMDANGQLRTVGGMPVVDPGGGPLLLDPQAGPPVIGRDGSIHQGVNQVGALGVFSIDPK
FT                   ATLTRSGENAVAASLPGRPVQDFTRIGLVQGYVEGANVNPIMEMTRLIAIQRAFESAAT
FT                   MTSEADTTLTGAVKTLGPQG"
FT   CDS_pept        628394..629722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="METD_I0663"
FT                   /product="flagellum-specific ATP synthase"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0663"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22309"
FT                   /db_xref="GOA:C7CBD9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005714"
FT                   /db_xref="InterPro:IPR022426"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032463"
FT                   /db_xref="InterPro:IPR040627"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22309.1"
FT                   /translation="MTRNAIERLEQAMEAGRRDLPLVRIAGPVREVTASAARVAGVSAF
FT                   VRLGDRMGFSADGRTQVGEVVRIDAAGATVKPFESRIEAGIGSLAHRIGPAQLRPDPRW
FT                   KGRVIDALGRPVDGLGPLAEGPASVPLDADPPAAMTRARVKTPLPTGVRAIDLFTPLCA
FT                   GQRIGIFAGSGVGKSTLLAMLAGAQGFDSVVVALVGERGREVREFLEGPIAAARDRAVI
FT                   VVSTGDESPMMRRQAPKVALAVAESFRDRGESVLLIVDSVTRYAHAARDVALAAGEPAV
FT                   ARGYPPSVFSDLPRLLERAGPGAEGTGTITGIFSVLVDGDDHNDPVADSIRGTLDGHVV
FT                   LDRAIAEQGRYPAIELLGSISRLAGEVWTGDQRELVRKLKSMMARFEETRDLRLMGGYR
FT                   AGSDPDLDQAVSLVPRIYEALRQEPGQPPSRDAFLELAQSLRG"
FT   CDS_pept        629805..631016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="METD_I0664"
FT                   /product="flagellar hook protein FlgE"
FT                   /note="Evidence 2b : Function from indirect experimental
FT                   evidences (e.g. phenotypes); Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:METDI0664"
FT                   /db_xref="EnsemblGenomes-Tr:CAX22310"
FT                   /db_xref="GOA:C7CBE0"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR011491"
FT                   /db_xref="InterPro:IPR020013"
FT                   /db_xref="InterPro:IPR037058"
FT                   /db_xref="InterPro:IPR037925"
FT                   /db_xref="UniProtKB/TrEMBL:C7CBE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CAX22310.1"
FT                   /translation="MSLIGVLRTGVSGMNAQSNRISTVAENIQNASTTGYKRTSAEFSS
FT                   LLLDSGDVGNYNSGAVETTLRRSVSEGGPIASTNSDKDLAIQGNGFFVVSDAAGAPFMT
FT                   RAGNFVVDGKTGNLVNAGGFTLMGYSLANGTPNPVLNGVADLKPVNVSVMGQEARPSTA
FT                   ATVSGNLSFETPVYDPTATGAIGYSKKNSLKVYDNVGRPVTLDVQMTKTAANTWSVEFF
FT                   DPAAPTTSLGTTNVTFDGNGKVNNGGSALVDVPNGRRITVDLGGLTQLSGDHNLSGTAN
FT                   GSSPTSVSGTAFGEDGTVYAVYTDGTRKAAFKVPLADVASPDNLAPRAGNVFTTSAESG
FT                   DIQVGFAGQGGRGILKAGALEQSNVDVSTELTTMIESQTVYTANSKVFMTGNELLETLM
FT