(data stored in SCRATCH3701 zone)

EMBL: FP565176

ID   FP565176; SV 1; circular; genomic DNA; STD; PRO; 3768695 BP.
XX
AC   FP565176;
XX
PR   Project:PRJEA16687;
XX
DT   07-JAN-2010 (Rel. 103, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 5)
XX
DE   Xanthomonas albilineans GPE PC73 complete genome
XX
KW   .
XX
OS   Xanthomonas albilineans GPE PC73
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Xanthomonadales;
OC   Xanthomonadaceae; Xanthomonas.
XX
RN   [1]
RP   1-3768695
RA   Genoscope - CEA;
RT   ;
RL   Submitted (20-MAY-2009) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-10-616.
RX   PUBMED; 20017926.
RA   Pieretti I., Royer M., Barbe V., Carrere S., Koebnik R., Cociancich S.,
RA   Couloux A., Darrasse A., Gouzy J., Jacques M.A., Lauber E., Manceau C.,
RA   Mangenot S., Poussier S., Segurens B., Szurek B., Verdier V., Arlat M.,
RA   Rott P.;
RT   "The complete genome sequence of Xanthomonas albilineans provides new
RT   insights into the reductive genome evolution of the xylem-limited
RT   Xanthomonadaceae";
RL   BMC Genomics 10:616-616(2009).
XX
DR   MD5; 2e4259534878e2e5093d18fc5b402419.
DR   BioSample; SAMEA3138291.
DR   EnsemblGenomes-Gn; EBG00000622864.
DR   EnsemblGenomes-Gn; EBG00000622865.
DR   EnsemblGenomes-Gn; EBG00000622866.
DR   EnsemblGenomes-Gn; EBG00000622867.
DR   EnsemblGenomes-Gn; EBG00000622868.
DR   EnsemblGenomes-Gn; EBG00000622869.
DR   EnsemblGenomes-Gn; EBG00000622870.
DR   EnsemblGenomes-Gn; EBG00000622871.
DR   EnsemblGenomes-Gn; EBG00000622872.
DR   EnsemblGenomes-Gn; EBG00000622873.
DR   EnsemblGenomes-Gn; EBG00000622874.
DR   EnsemblGenomes-Gn; EBG00000622875.
DR   EnsemblGenomes-Gn; EBG00000622876.
DR   EnsemblGenomes-Gn; EBG00000622877.
DR   EnsemblGenomes-Gn; EBG00000622878.
DR   EnsemblGenomes-Gn; EBG00000622879.
DR   EnsemblGenomes-Gn; EBG00000622880.
DR   EnsemblGenomes-Gn; EBG00000622881.
DR   EnsemblGenomes-Gn; EBG00000622882.
DR   EnsemblGenomes-Gn; EBG00000622883.
DR   EnsemblGenomes-Gn; EBG00000622884.
DR   EnsemblGenomes-Gn; EBG00000622885.
DR   EnsemblGenomes-Gn; EBG00000622886.
DR   EnsemblGenomes-Gn; EBG00000622887.
DR   EnsemblGenomes-Gn; EBG00000622888.
DR   EnsemblGenomes-Gn; EBG00000622889.
DR   EnsemblGenomes-Gn; EBG00000622890.
DR   EnsemblGenomes-Gn; EBG00000622891.
DR   EnsemblGenomes-Gn; EBG00000622892.
DR   EnsemblGenomes-Gn; EBG00000622893.
DR   EnsemblGenomes-Gn; EBG00000622894.
DR   EnsemblGenomes-Gn; EBG00000622895.
DR   EnsemblGenomes-Gn; EBG00000622896.
DR   EnsemblGenomes-Gn; EBG00000622897.
DR   EnsemblGenomes-Gn; EBG00000622898.
DR   EnsemblGenomes-Gn; EBG00000622899.
DR   EnsemblGenomes-Gn; EBG00000622900.
DR   EnsemblGenomes-Gn; EBG00000622901.
DR   EnsemblGenomes-Gn; EBG00000622902.
DR   EnsemblGenomes-Gn; EBG00000622903.
DR   EnsemblGenomes-Gn; EBG00000622904.
DR   EnsemblGenomes-Gn; EBG00000622905.
DR   EnsemblGenomes-Gn; EBG00000622906.
DR   EnsemblGenomes-Gn; EBG00000622907.
DR   EnsemblGenomes-Gn; EBG00000622908.
DR   EnsemblGenomes-Gn; EBG00000622909.
DR   EnsemblGenomes-Gn; EBG00000622910.
DR   EnsemblGenomes-Gn; EBG00000622911.
DR   EnsemblGenomes-Gn; EBG00000622912.
DR   EnsemblGenomes-Gn; EBG00000622913.
DR   EnsemblGenomes-Gn; EBG00000622914.
DR   EnsemblGenomes-Gn; EBG00000622915.
DR   EnsemblGenomes-Gn; EBG00000622916.
DR   EnsemblGenomes-Gn; EBG00000622917.
DR   EnsemblGenomes-Gn; EBG00000622918.
DR   EnsemblGenomes-Gn; EBG00000622919.
DR   EnsemblGenomes-Gn; EBG00000622920.
DR   EnsemblGenomes-Gn; EBG00001230979.
DR   EnsemblGenomes-Gn; EBG00001230980.
DR   EnsemblGenomes-Gn; EBG00001230981.
DR   EnsemblGenomes-Gn; EBG00001230982.
DR   EnsemblGenomes-Gn; EBG00001230983.
DR   EnsemblGenomes-Gn; EBG00001230984.
DR   EnsemblGenomes-Gn; EBG00001230985.
DR   EnsemblGenomes-Gn; EBG00001230986.
DR   EnsemblGenomes-Gn; EBG00001230987.
DR   EnsemblGenomes-Gn; EBG00001230988.
DR   EnsemblGenomes-Gn; EBG00001230989.
DR   EnsemblGenomes-Gn; EBG00001230990.
DR   EnsemblGenomes-Gn; EBG00001230991.
DR   EnsemblGenomes-Gn; EBG00001230992.
DR   EnsemblGenomes-Gn; EBG00001230993.
DR   EnsemblGenomes-Gn; EBG00001230994.
DR   EnsemblGenomes-Gn; EBG00001230995.
DR   EnsemblGenomes-Gn; EBG00001230996.
DR   EnsemblGenomes-Gn; EBG00001230997.
DR   EnsemblGenomes-Gn; EBG00001230998.
DR   EnsemblGenomes-Gn; EBG00001230999.
DR   EnsemblGenomes-Gn; EBG00001231000.
DR   EnsemblGenomes-Gn; EBG00001231001.
DR   EnsemblGenomes-Gn; EBG00001231002.
DR   EnsemblGenomes-Gn; EBG00001231003.
DR   EnsemblGenomes-Gn; EBG00001231004.
DR   EnsemblGenomes-Gn; EBG00001231005.
DR   EnsemblGenomes-Gn; EBG00001231006.
DR   EnsemblGenomes-Gn; EBG00001231007.
DR   EnsemblGenomes-Gn; EBG00001231008.
DR   EnsemblGenomes-Gn; EBG00001231009.
DR   EnsemblGenomes-Gn; EBG00001231010.
DR   EnsemblGenomes-Gn; EBG00001231011.
DR   EnsemblGenomes-Gn; EBG00001231012.
DR   EnsemblGenomes-Gn; EBG00001231013.
DR   EnsemblGenomes-Gn; EBG00001231014.
DR   EnsemblGenomes-Gn; EBG00001231015.
DR   EnsemblGenomes-Gn; EBG00001231016.
DR   EnsemblGenomes-Gn; EBG00001231017.
DR   EnsemblGenomes-Gn; EBG00001231018.
DR   EnsemblGenomes-Gn; EBG00001231019.
DR   EnsemblGenomes-Gn; EBG00001231020.
DR   EnsemblGenomes-Gn; EBG00001231021.
DR   EnsemblGenomes-Gn; EBG00001231022.
DR   EnsemblGenomes-Gn; EBG00001231023.
DR   EnsemblGenomes-Gn; EBG00001231024.
DR   EnsemblGenomes-Gn; EBG00001231025.
DR   EnsemblGenomes-Gn; EBG00001231026.
DR   EnsemblGenomes-Gn; EBG00001231027.
DR   EnsemblGenomes-Gn; EBG00001231028.
DR   EnsemblGenomes-Gn; EBG00001231029.
DR   EnsemblGenomes-Gn; EBG00001231030.
DR   EnsemblGenomes-Gn; EBG00001231031.
DR   EnsemblGenomes-Gn; EBG00001231032.
DR   EnsemblGenomes-Gn; EBG00001231033.
DR   EnsemblGenomes-Gn; EBG00001231034.
DR   EnsemblGenomes-Gn; EBG00001231035.
DR   EnsemblGenomes-Gn; EBG00001231036.
DR   EnsemblGenomes-Gn; EBG00001231037.
DR   EnsemblGenomes-Gn; EBG00001231038.
DR   EnsemblGenomes-Gn; EBG00001231039.
DR   EnsemblGenomes-Gn; EBG00001231040.
DR   EnsemblGenomes-Gn; EBG00001231041.
DR   EnsemblGenomes-Gn; EBG00001231042.
DR   EnsemblGenomes-Gn; EBG00001231043.
DR   EnsemblGenomes-Gn; EBG00001231044.
DR   EnsemblGenomes-Gn; EBG00001231045.
DR   EnsemblGenomes-Gn; EBG00001231046.
DR   EnsemblGenomes-Gn; EBG00001231047.
DR   EnsemblGenomes-Gn; EBG00001231048.
DR   EnsemblGenomes-Gn; EBG00001231049.
DR   EnsemblGenomes-Gn; EBG00001231050.
DR   EnsemblGenomes-Gn; EBG00001231051.
DR   EnsemblGenomes-Gn; EBG00001231052.
DR   EnsemblGenomes-Gn; EBG00001231053.
DR   EnsemblGenomes-Gn; EBG00001231054.
DR   EnsemblGenomes-Gn; EBG00001231055.
DR   EnsemblGenomes-Gn; EBG00001231056.
DR   EnsemblGenomes-Gn; EBG00001231057.
DR   EnsemblGenomes-Gn; EBG00001231058.
DR   EnsemblGenomes-Gn; EBG00001231059.
DR   EnsemblGenomes-Gn; EBG00001231060.
DR   EnsemblGenomes-Gn; EBG00001231061.
DR   EnsemblGenomes-Gn; EBG00001231062.
DR   EnsemblGenomes-Gn; EBG00001231063.
DR   EnsemblGenomes-Gn; EBG00001231064.
DR   EnsemblGenomes-Gn; EBG00001231065.
DR   EnsemblGenomes-Gn; EBG00001231066.
DR   EnsemblGenomes-Gn; EBG00001231067.
DR   EnsemblGenomes-Gn; EBG00001231068.
DR   EnsemblGenomes-Gn; EBG00001231069.
DR   EnsemblGenomes-Gn; EBG00001231070.
DR   EnsemblGenomes-Gn; EBG00001231071.
DR   EnsemblGenomes-Gn; EBG00001231072.
DR   EnsemblGenomes-Gn; EBG00001231073.
DR   EnsemblGenomes-Gn; EBG00001231074.
DR   EnsemblGenomes-Gn; EBG00001231075.
DR   EnsemblGenomes-Gn; EBG00001231076.
DR   EnsemblGenomes-Gn; EBG00001231077.
DR   EnsemblGenomes-Gn; EBG00001231078.
DR   EnsemblGenomes-Gn; EBG00001231079.
DR   EnsemblGenomes-Gn; EBG00001231080.
DR   EnsemblGenomes-Gn; EBG00001231081.
DR   EnsemblGenomes-Gn; EBG00001231082.
DR   EnsemblGenomes-Gn; EBG00001231083.
DR   EnsemblGenomes-Gn; EBG00001231084.
DR   EnsemblGenomes-Gn; EBG00001231085.
DR   EnsemblGenomes-Gn; EBG00001231086.
DR   EnsemblGenomes-Gn; EBG00001231087.
DR   EnsemblGenomes-Gn; EBG00001231088.
DR   EnsemblGenomes-Gn; EBG00001231089.
DR   EnsemblGenomes-Gn; EBG00001231090.
DR   EnsemblGenomes-Gn; EBG00001231091.
DR   EnsemblGenomes-Gn; EBG00001231092.
DR   EnsemblGenomes-Gn; EBG00001231093.
DR   EnsemblGenomes-Gn; EBG00001231094.
DR   EnsemblGenomes-Gn; EBG00001231095.
DR   EnsemblGenomes-Gn; EBG00001231096.
DR   EnsemblGenomes-Gn; EBG00001231097.
DR   EnsemblGenomes-Gn; EBG00001231098.
DR   EnsemblGenomes-Gn; EBG00001231099.
DR   EnsemblGenomes-Gn; EBG00001231100.
DR   EnsemblGenomes-Gn; EBG00001231101.
DR   EnsemblGenomes-Gn; EBG00001231102.
DR   EnsemblGenomes-Gn; EBG00001231103.
DR   EnsemblGenomes-Gn; EBG00001231104.
DR   EnsemblGenomes-Gn; EBG00001231105.
DR   EnsemblGenomes-Gn; EBG00001231106.
DR   EnsemblGenomes-Gn; EBG00001231107.
DR   EnsemblGenomes-Gn; EBG00001231108.
DR   EnsemblGenomes-Gn; EBG00001231109.
DR   EnsemblGenomes-Tr; EBG00000622864-1.
DR   EnsemblGenomes-Tr; EBG00000622865-1.
DR   EnsemblGenomes-Tr; EBG00000622866-1.
DR   EnsemblGenomes-Tr; EBG00000622867-1.
DR   EnsemblGenomes-Tr; EBG00000622868-1.
DR   EnsemblGenomes-Tr; EBG00000622869-1.
DR   EnsemblGenomes-Tr; EBG00000622870-1.
DR   EnsemblGenomes-Tr; EBG00000622871-1.
DR   EnsemblGenomes-Tr; EBG00000622872-1.
DR   EnsemblGenomes-Tr; EBG00000622873-1.
DR   EnsemblGenomes-Tr; EBG00000622874-1.
DR   EnsemblGenomes-Tr; EBG00000622875-1.
DR   EnsemblGenomes-Tr; EBG00000622876-1.
DR   EnsemblGenomes-Tr; EBG00000622877-1.
DR   EnsemblGenomes-Tr; EBG00000622878-1.
DR   EnsemblGenomes-Tr; EBG00000622879-1.
DR   EnsemblGenomes-Tr; EBG00000622880-1.
DR   EnsemblGenomes-Tr; EBG00000622881-1.
DR   EnsemblGenomes-Tr; EBG00000622882-1.
DR   EnsemblGenomes-Tr; EBG00000622883-1.
DR   EnsemblGenomes-Tr; EBG00000622884-1.
DR   EnsemblGenomes-Tr; EBG00000622885-1.
DR   EnsemblGenomes-Tr; EBG00000622886-1.
DR   EnsemblGenomes-Tr; EBG00000622887-1.
DR   EnsemblGenomes-Tr; EBG00000622888-1.
DR   EnsemblGenomes-Tr; EBG00000622889-1.
DR   EnsemblGenomes-Tr; EBG00000622890-1.
DR   EnsemblGenomes-Tr; EBG00000622891-1.
DR   EnsemblGenomes-Tr; EBG00000622892-1.
DR   EnsemblGenomes-Tr; EBG00000622893-1.
DR   EnsemblGenomes-Tr; EBG00000622894-1.
DR   EnsemblGenomes-Tr; EBG00000622895-1.
DR   EnsemblGenomes-Tr; EBG00000622896-1.
DR   EnsemblGenomes-Tr; EBG00000622897-1.
DR   EnsemblGenomes-Tr; EBG00000622898-1.
DR   EnsemblGenomes-Tr; EBG00000622899-1.
DR   EnsemblGenomes-Tr; EBG00000622900-1.
DR   EnsemblGenomes-Tr; EBG00000622901-1.
DR   EnsemblGenomes-Tr; EBG00000622902-1.
DR   EnsemblGenomes-Tr; EBG00000622903-1.
DR   EnsemblGenomes-Tr; EBG00000622904-1.
DR   EnsemblGenomes-Tr; EBG00000622905-1.
DR   EnsemblGenomes-Tr; EBG00000622906-1.
DR   EnsemblGenomes-Tr; EBG00000622907-1.
DR   EnsemblGenomes-Tr; EBG00000622908-1.
DR   EnsemblGenomes-Tr; EBG00000622909-1.
DR   EnsemblGenomes-Tr; EBG00000622910-1.
DR   EnsemblGenomes-Tr; EBG00000622911-1.
DR   EnsemblGenomes-Tr; EBG00000622912-1.
DR   EnsemblGenomes-Tr; EBG00000622913-1.
DR   EnsemblGenomes-Tr; EBG00000622914-1.
DR   EnsemblGenomes-Tr; EBG00000622915-1.
DR   EnsemblGenomes-Tr; EBG00000622916-1.
DR   EnsemblGenomes-Tr; EBG00000622917-1.
DR   EnsemblGenomes-Tr; EBG00000622918-1.
DR   EnsemblGenomes-Tr; EBG00000622919-1.
DR   EnsemblGenomes-Tr; EBG00000622920-1.
DR   EnsemblGenomes-Tr; EBT00001799752.
DR   EnsemblGenomes-Tr; EBT00001799753.
DR   EnsemblGenomes-Tr; EBT00001799754.
DR   EnsemblGenomes-Tr; EBT00001799755.
DR   EnsemblGenomes-Tr; EBT00001799756.
DR   EnsemblGenomes-Tr; EBT00001799757.
DR   EnsemblGenomes-Tr; EBT00001799758.
DR   EnsemblGenomes-Tr; EBT00001799759.
DR   EnsemblGenomes-Tr; EBT00001799760.
DR   EnsemblGenomes-Tr; EBT00001799761.
DR   EnsemblGenomes-Tr; EBT00001799762.
DR   EnsemblGenomes-Tr; EBT00001799763.
DR   EnsemblGenomes-Tr; EBT00001799764.
DR   EnsemblGenomes-Tr; EBT00001799765.
DR   EnsemblGenomes-Tr; EBT00001799766.
DR   EnsemblGenomes-Tr; EBT00001799767.
DR   EnsemblGenomes-Tr; EBT00001799768.
DR   EnsemblGenomes-Tr; EBT00001799769.
DR   EnsemblGenomes-Tr; EBT00001799770.
DR   EnsemblGenomes-Tr; EBT00001799771.
DR   EnsemblGenomes-Tr; EBT00001799772.
DR   EnsemblGenomes-Tr; EBT00001799773.
DR   EnsemblGenomes-Tr; EBT00001799774.
DR   EnsemblGenomes-Tr; EBT00001799775.
DR   EnsemblGenomes-Tr; EBT00001799776.
DR   EnsemblGenomes-Tr; EBT00001799777.
DR   EnsemblGenomes-Tr; EBT00001799778.
DR   EnsemblGenomes-Tr; EBT00001799779.
DR   EnsemblGenomes-Tr; EBT00001799780.
DR   EnsemblGenomes-Tr; EBT00001799781.
DR   EnsemblGenomes-Tr; EBT00001799782.
DR   EnsemblGenomes-Tr; EBT00001799783.
DR   EnsemblGenomes-Tr; EBT00001799784.
DR   EnsemblGenomes-Tr; EBT00001799785.
DR   EnsemblGenomes-Tr; EBT00001799786.
DR   EnsemblGenomes-Tr; EBT00001799787.
DR   EnsemblGenomes-Tr; EBT00001799788.
DR   EnsemblGenomes-Tr; EBT00001799789.
DR   EnsemblGenomes-Tr; EBT00001799790.
DR   EnsemblGenomes-Tr; EBT00001799791.
DR   EnsemblGenomes-Tr; EBT00001799792.
DR   EnsemblGenomes-Tr; EBT00001799793.
DR   EnsemblGenomes-Tr; EBT00001799794.
DR   EnsemblGenomes-Tr; EBT00001799795.
DR   EnsemblGenomes-Tr; EBT00001799796.
DR   EnsemblGenomes-Tr; EBT00001799797.
DR   EnsemblGenomes-Tr; EBT00001799798.
DR   EnsemblGenomes-Tr; EBT00001799799.
DR   EnsemblGenomes-Tr; EBT00001799800.
DR   EnsemblGenomes-Tr; EBT00001799801.
DR   EnsemblGenomes-Tr; EBT00001799802.
DR   EnsemblGenomes-Tr; EBT00001799803.
DR   EnsemblGenomes-Tr; EBT00001799804.
DR   EnsemblGenomes-Tr; EBT00001799805.
DR   EnsemblGenomes-Tr; EBT00001799806.
DR   EnsemblGenomes-Tr; EBT00001799807.
DR   EnsemblGenomes-Tr; EBT00001799808.
DR   EnsemblGenomes-Tr; EBT00001799809.
DR   EnsemblGenomes-Tr; EBT00001799810.
DR   EnsemblGenomes-Tr; EBT00001799811.
DR   EnsemblGenomes-Tr; EBT00001799812.
DR   EnsemblGenomes-Tr; EBT00001799813.
DR   EnsemblGenomes-Tr; EBT00001799814.
DR   EnsemblGenomes-Tr; EBT00001799815.
DR   EnsemblGenomes-Tr; EBT00001799816.
DR   EnsemblGenomes-Tr; EBT00001799817.
DR   EnsemblGenomes-Tr; EBT00001799818.
DR   EnsemblGenomes-Tr; EBT00001799819.
DR   EnsemblGenomes-Tr; EBT00001799820.
DR   EnsemblGenomes-Tr; EBT00001799821.
DR   EnsemblGenomes-Tr; EBT00001799822.
DR   EnsemblGenomes-Tr; EBT00001799823.
DR   EnsemblGenomes-Tr; EBT00001799824.
DR   EnsemblGenomes-Tr; EBT00001799825.
DR   EnsemblGenomes-Tr; EBT00001799826.
DR   EnsemblGenomes-Tr; EBT00001799827.
DR   EnsemblGenomes-Tr; EBT00001799828.
DR   EnsemblGenomes-Tr; EBT00001799829.
DR   EnsemblGenomes-Tr; EBT00001799830.
DR   EnsemblGenomes-Tr; EBT00001799831.
DR   EnsemblGenomes-Tr; EBT00001799832.
DR   EnsemblGenomes-Tr; EBT00001799833.
DR   EnsemblGenomes-Tr; EBT00001799834.
DR   EnsemblGenomes-Tr; EBT00001799835.
DR   EnsemblGenomes-Tr; EBT00001799836.
DR   EnsemblGenomes-Tr; EBT00001799837.
DR   EnsemblGenomes-Tr; EBT00001799838.
DR   EnsemblGenomes-Tr; EBT00001799839.
DR   EnsemblGenomes-Tr; EBT00001799840.
DR   EnsemblGenomes-Tr; EBT00001799841.
DR   EnsemblGenomes-Tr; EBT00001799842.
DR   EnsemblGenomes-Tr; EBT00001799843.
DR   EnsemblGenomes-Tr; EBT00001799844.
DR   EnsemblGenomes-Tr; EBT00001799845.
DR   EnsemblGenomes-Tr; EBT00001799846.
DR   EnsemblGenomes-Tr; EBT00001799847.
DR   EnsemblGenomes-Tr; EBT00001799848.
DR   EnsemblGenomes-Tr; EBT00001799849.
DR   EnsemblGenomes-Tr; EBT00001799850.
DR   EnsemblGenomes-Tr; EBT00001799851.
DR   EnsemblGenomes-Tr; EBT00001799852.
DR   EnsemblGenomes-Tr; EBT00001799853.
DR   EnsemblGenomes-Tr; EBT00001799854.
DR   EnsemblGenomes-Tr; EBT00001799855.
DR   EnsemblGenomes-Tr; EBT00001799856.
DR   EnsemblGenomes-Tr; EBT00001799857.
DR   EnsemblGenomes-Tr; EBT00001799858.
DR   EnsemblGenomes-Tr; EBT00001799859.
DR   EnsemblGenomes-Tr; EBT00001799860.
DR   EnsemblGenomes-Tr; EBT00001799861.
DR   EnsemblGenomes-Tr; EBT00001799862.
DR   EnsemblGenomes-Tr; EBT00001799863.
DR   EnsemblGenomes-Tr; EBT00001799864.
DR   EnsemblGenomes-Tr; EBT00001799865.
DR   EnsemblGenomes-Tr; EBT00001799866.
DR   EnsemblGenomes-Tr; EBT00001799867.
DR   EnsemblGenomes-Tr; EBT00001799868.
DR   EnsemblGenomes-Tr; EBT00001799869.
DR   EnsemblGenomes-Tr; EBT00001799870.
DR   EnsemblGenomes-Tr; EBT00001799871.
DR   EnsemblGenomes-Tr; EBT00001799872.
DR   EnsemblGenomes-Tr; EBT00001799873.
DR   EnsemblGenomes-Tr; EBT00001799874.
DR   EnsemblGenomes-Tr; EBT00001799875.
DR   EnsemblGenomes-Tr; EBT00001799876.
DR   EnsemblGenomes-Tr; EBT00001799877.
DR   EnsemblGenomes-Tr; EBT00001799878.
DR   EnsemblGenomes-Tr; EBT00001799879.
DR   EnsemblGenomes-Tr; EBT00001799880.
DR   EnsemblGenomes-Tr; EBT00001799881.
DR   EnsemblGenomes-Tr; EBT00001799882.
DR   EuropePMC; PMC2810307; 20017926.
DR   EuropePMC; PMC3019718; 21037298.
DR   EuropePMC; PMC3131649; 21515727.
DR   EuropePMC; PMC3364877; 22404966.
DR   EuropePMC; PMC4235730; 25437615.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01317; CRISPR-DR4.
DR   RFAM; RF01497; ALIL.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01760; traJ-II.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01811; PtaRNA1.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   RFAM; RF02223; sX4.
DR   RFAM; RF02228; sX9.
DR   RFAM; RF02232; sX13.
DR   RFAM; RF02235; asX1.
DR   RFAM; RF02241; Xoo2.
DR   RFAM; RF02242; Xoo5.
DR   RFAM; RF02243; Xoo8.
DR   SILVA-LSU; FP565176.
DR   SILVA-SSU; FP565176.
DR   StrainInfo; 856748; 0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3768695
FT                   /organism="Xanthomonas albilineans GPE PC73"
FT                   /strain="GPE PC73"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:380358"
FT   gene            231..1568
FT                   /gene="dnaA"
FT                   /locus_tag="XALC_0001"
FT   CDS_pept        231..1568
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="XALC_0001"
FT                   /product="probable chromosomal replication initiator
FT                   protein dnaa."
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14547"
FT                   /db_xref="GOA:D2UF61"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF61"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14547.1"
FT                   /translation="MDAWPRCLERLEAEFPAEDVHTWLKPLQAEQRHDNSMVLYAPNAF
FT                   IVEQVHARYLSRIRELLNYFAGSEDVLLQVGSRPRAPEPMAAASDSTTARTPSPQLLEP
FT                   FAGNLDSHYTFANFVEGRSNQLGLAAAVQAAQKPGDRAHNPLLLYGSTGLGKTHLMFAA
FT                   GNAMREQNPNARVMYLRSEQFFSAMIRALQEKTMDQFKRQFQQVDALLIDDIQFFAGKD
FT                   RTQEEFFHTFNALFDGRQQIILTCDRYPREVEGLEPRLKSRLAWGLSVAIDPPDFETRA
FT                   AIVLAKARERGAEIPDEVAFLIAKKMRSNVRDLEGALNTLAARANFTGRAITTEFAQET
FT                   LRDLLRAQQQAIGIPNIQKTVADYYGLQIKDLLSKRRTRSLARPRQMAMALTKELTEHS
FT                   LPEIGDAFAGRDHTTVLHACRQIKHLMETDGKLREDWDKLIRKLSE"
FT   gene            1831..2931
FT                   /gene="dnaN"
FT                   /locus_tag="XALC_0002"
FT   CDS_pept        1831..2931
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="XALC_0002"
FT                   /product="probable dna polymerase III subunit beta protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14548"
FT                   /db_xref="GOA:D2UF62"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF62"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14548.1"
FT                   /translation="MRFTLQREAFLKPLAQVVNVVERRQTLPVLANFLVQVHGGQLSLT
FT                   GTDLEVEMVSRIAVDDAQDGETTIPARKLFEIVRALPDGSKVTVSLSNDKITVQTGRSR
FT                   FTLATLPANDFPSVDEVETTERVVVQEAALKELIERTAFAMAQQDVRYYLNGLLFDLHD
FT                   KTLRCVATDGHRLALCETELENAGGAKRQIIVPRKGVTELQRLLEGGDREVELEVGRSH
FT                   VRVKRNDVTFTSKLIDGRFPDYETVIPIGADREVKLDREILRAALQRAAILSNEKYRGV
FT                   RVEVSPGQLKISAHNPEQEEAQEEVEADTKVSDLAIGFNVNYLLDALSALREEFVVIQL
FT                   RDANSSALVREASSARSRHVVMPLRL"
FT   gene            3205..4305
FT                   /gene="recF"
FT                   /locus_tag="XALC_0003"
FT   CDS_pept        3205..4305
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="XALC_0003"
FT                   /product="probable dna replication and repair protein
FT                   recf."
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14549"
FT                   /db_xref="GOA:D2UF63"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF63"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14549.1"
FT                   /translation="MHLFRLDFHHLRRFPSIELTPAPGMNLITGDNGAGKTTILEAMHL
FT                   MAYGRSFRCRVRDGLIRQGQAGLDVFVEWHEQAADTGQTRRRRAGLQHSGQDWRGRLDG
FT                   QDVPYLGTLCAALAVVTFEPGSHVLVSGGGEARRRFVDWGLFHVEPDFLSLWRRYARAL
FT                   KQRNALLKSGGAGAALDAWDHELAEAGEPLTSRRQHYLDRLLRRLLILAPELAPALGIE
FT                   QLQFSPGWRRHEISLADALLLNRDRDRQLGYTTVGPHRADWSLSFAAIPGRDALSRGQA
FT                   KLTALACLLAQAEDYAEQRGEWPVIALDDLASELDQHHQARVLQRLRAGPAQVFLTATE
FT                   TPQALSDAGLPIARFHVEHGQILSSS"
FT   gene            4419..6881
FT                   /gene="gyrB"
FT                   /locus_tag="XALC_0004"
FT   CDS_pept        4419..6881
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="XALC_0004"
FT                   /product="probable dna topoisomerase II (dna gyrase subunit
FT                   b) protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="5.99.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14550"
FT                   /db_xref="GOA:D2UF64"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF64"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14550.1"
FT                   /translation="MTDEQNTHANNGNYDANSITALEGLEAVRKRPGMYIGDVHDGTGL
FT                   HHMVFEVVDNSIDEALAGHADHVAVTIHADGSVSVSDNGRGIPVGKHAQMSKKLDREVS
FT                   AAEVVMTVLHAGGKFDDNSYKVSGGLHGVGVSVVNALSEKLLLDIFQGGFHYQQEYSHG
FT                   AALAPLKQLETSAKRGTTLRFWPSVKAFNNNVEFHYDILARRLRELSFLNSGVKIVLAD
FT                   ERGEGRRDDFHYEGGIRSFVEHLAHLKTPLHPNVISVSGEHNGITVEVALQWTDSYQET
FT                   MYCFTNNIPQKDGGTHLAGFRGALTRVLNNYIEQNGIAKQAKINLTGDDMREGMIAVLS
FT                   VKVPDPSFSSQTKEKLVSSDVRPAVENAFGARLEEFLQENPNEAKAIAGKIVDAARARE
FT                   AARKARDLTRRKGALDIAGLPGKLADCQEKDPALSELFIVEGDSAGGSAKQGRNRRNQA
FT                   VLPLRGKILNVERARFDRMLASDQVGTLITALGTGIGRDEYNPDKLRYHRIIIMTDADV
FT                   DGAHIRTLLLTFFYRQMPELIERGYVYIGLPPLYRLKQGKQELYLKDDNALNVYLASSA
FT                   VEGAALIPASGEPPITGAALEKLLLLFASANETVVRNAHRYDPALLTALIDLPPLDVAQ
FT                   LEAEGERHPSLDALQMVLNRGNLGSARYTLRFQPANEQRSATLLLVRRHMGEEMTQVVP
FT                   MAVFESGELRALREVALALHGLVREGAQIVRGNKTQAISSFAQAHAWLFEEAKKGRQIQ
FT                   RFKGLGEMNAEQLWETTVNPDTRRLLQVRIEDAVAADQIFSTLMGDVVEPRRDFIEENA
FT                   LKVANLDI"
FT   gene            6966..7808
FT                   /locus_tag="XALC_0005"
FT   CDS_pept        6966..7808
FT                   /transl_table=11
FT                   /locus_tag="XALC_0005"
FT                   /product="hypothetical protease protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14551"
FT                   /db_xref="GOA:D2UF65"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF65"
FT                   /protein_id="CBA14551.1"
FT                   /translation="MTALPSPAVPPLPLPVRPRQRWPVLGFFLDVMLGAVVLVTVSVLS
FT                   GLVWGVWRGFQLAMDLRAQGVASDRLGALVTHRIGQPGALAQMLIALVSTLSAALLLYF
FT                   LRRPASVAERRASWQAARTSSTWGWVVLVVVGVFLGTSAISALATQTAIKAVPSNLSLM
FT                   QGAMAHAPVFLCVFAVLIAPAYEELLFRRVLFGRLWDAGKPRLGMLLSGAAFALSHEVP
FT                   GTSGNGLAATTQLWLVYAGMGIAFAWLYKRTGTLWASIAAHGLNNAIAVASLYWFGIT"
FT   gene            7876..8682
FT                   /locus_tag="XALC_0006"
FT   CDS_pept        7876..8682
FT                   /transl_table=11
FT                   /locus_tag="XALC_0006"
FT                   /product="putative peptidase precursor protein"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14552"
FT                   /db_xref="GOA:D2UF66"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF66"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14552.1"
FT                   /translation="MKQVVLGASIAMLLAACATTTSPTGRTQVVGGISQQQLDQMGVQA
FT                   FAQAKAKETLDADPKHNAYVRCVVNTLVAQLPDHWRNTPWETALFNDKEANAFALPGGK
FT                   VGVNNGIFAVAKNQDQLAAVLGHEIGHVISRHHEERITRQLGAQAGVSVIGALAGARYG
FT                   QGAADTVNQFGGMTAQTLFLLPGSREQETEADVVGQRLMAQAGFDPAQAVDLWKNMMAA
FT                   GSQHPPQWLSTHPDPSARISELQRDVPGLEPVYAQARSSGRTPQCG"
FT   gene            8841..10034
FT                   /locus_tag="XALC_0007"
FT   CDS_pept        8841..10034
FT                   /transl_table=11
FT                   /locus_tag="XALC_0007"
FT                   /product="conserved hypothetical protein."
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14553"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF67"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14553.1"
FT                   /translation="MKSRNRKQALLSLLIAAALGGVMVNDAVAQSDHSEQRSSHRSKND
FT                   KATVMFPNAERKEPAGKPSSKLGSKLQKLIDIYNKGEDYAAVRTQADEILANSAANDYD
FT                   KSLAAQLAAQAAYNLNDTKAAKQYLQQAIQFNGLDNNGHFQSMLMLAQLQLQDEQTAEG
FT                   LATLDKYFAESKSNRPEDLILKGQALYQTQHYQEAIPVLKQAIAASPEPKDSWNQLLMA
FT                   CYAEAGQTGEAIKAAEALAAKSPNDKKAQLNLASMYMQADQMDKAAAVMDKLRAAGQLT
FT                   DEKEYKQLYSIYANTEHKEKDVIAVINEGVQKGILKPDYQTYLALAQSYYYTDQVPKAI
FT                   ENWQKAAPLSKDGETYLNLAKVLHSEGRIAEAKQAAQQALAKGVKKPEEAKKIINLK"
FT   gene            10185..10859
FT                   /locus_tag="XALC_0008"
FT   CDS_pept        10185..10859
FT                   /transl_table=11
FT                   /locus_tag="XALC_0008"
FT                   /product="putative energy transducer tonb protein"
FT                   /function="transport go:0005215 go:0006810; tonb family of
FT                   auxiliary proteins for energization of omr-mediated
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14554"
FT                   /db_xref="GOA:D2UF68"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF68"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14554.1"
FT                   /translation="MTEQLVIHRHYDKDDASGLSWPRIIGIAFVIALHLAALMLLLIPA
FT                   VAPKAPAEKERNIVVTMVDVPPPPPPPPPPPPKQEKPPPPVKNLAPPKPTPVPPPPQAP
FT                   VVDVPEPRPDDIATPPSPPAPPAPPSEISASVDISSKNMNPPKYPPAAFRAGAQGEVIL
FT                   IIDVDASGNVTNVSVEKSSRNRDLDRAAMDAARKWRFNAAVVNGQKSAGRVRVPVNFAL
FT                   NN"
FT   gene            10959..11720
FT                   /gene="exbB"
FT                   /locus_tag="XALC_0009"
FT   CDS_pept        10959..11720
FT                   /transl_table=11
FT                   /gene="exbB"
FT                   /locus_tag="XALC_0009"
FT                   /product="probable biopolymer transport protein"
FT                   /function="transport go:0005215 go:0006810; tonb family of
FT                   auxiliary proteins for energization of omr-mediated
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14555"
FT                   /db_xref="GOA:D2UF69"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF69"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14555.1"
FT                   /translation="MLQEIFIAAAAGGNNASNALSQMGFEHLITEMTSKPGDFAVSWVV
FT                   LVTLITMSASSWYWTVINIFRATRLKSQADRVTSLFWDTPNAQDAIRAMEEQPASEPFS
FT                   KIALDAAQAAAHHQRSEGTGAGLGETLSRSEFVDRALRQAVTRESTKLQSGMTLLATVG
FT                   ACAPFVGLLGTVWGIYGALIKIGATGSASIDAVAGPVGEALIMTAIGLFVAIPAVFAFN
FT                   FFSKVNSSVIAKFDTFAHDLHDFFATGSRVR"
FT   gene            11763..12188
FT                   /gene="exbD1"
FT                   /locus_tag="XALC_0010"
FT   CDS_pept        11763..12188
FT                   /transl_table=11
FT                   /gene="exbD1"
FT                   /locus_tag="XALC_0010"
FT                   /product="probable biopolymer transport exbd transmembrane
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; tonb family of
FT                   auxiliary proteins for energization of omr-mediated
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14556"
FT                   /db_xref="GOA:D2UF70"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF70"
FT                   /protein_id="CBA14556.1"
FT                   /translation="MAFSSGNSGGPMADINVTPLVDVMLVLLIIFIITAPLMSHKVKVE
FT                   LPKANLNQDPDKDDKRPNPITVSVKEDGSLYWNDEPITKEALESHFSTAAQQTPQPPLN
FT                   LRGDRTTKMRTINEITKIAQGQGMLDVGFIATKDKGN"
FT   gene            12192..12605
FT                   /gene="exbD2"
FT                   /locus_tag="XALC_0011"
FT   CDS_pept        12192..12605
FT                   /transl_table=11
FT                   /gene="exbD2"
FT                   /locus_tag="XALC_0011"
FT                   /product="probable biopolymer transport exbd. transmembrane
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; tonb family of
FT                   auxiliary proteins for energization of omr-mediated
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14557"
FT                   /db_xref="GOA:D2UF71"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF71"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14557.1"
FT                   /translation="MAFSSGNSRGPMADINVTPLVDVMLVLLIIFIVTAPIMTYPIDVD
FT                   LPQKVINPPPQLRDPPPPIDLRIDASNQIFWNDGPVAVSALPQMMENEVQRDPTNQPEL
FT                   RIDANPDSEYEVMAKVLAAAKNSGMKKIGFVQQ"
FT   gene            complement(12792..13217)
FT                   /locus_tag="XALC_0012"
FT   CDS_pept        complement(12792..13217)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0012"
FT                   /product="hypothetical two-component system response
FT                   regulator protein"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14558"
FT                   /db_xref="GOA:D2UF72"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF72"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14558.1"
FT                   /translation="MLLSKRHVEPRVLMIEDAEDIKELSRLTLESQACDVVAVETAEAA
FT                   LALLDAGRCFDLLFTDVHLEGLDGIAAANHVRDWQPQLPILVTSGMDEHAVLSRLREGI
FT                   HFLPKPYDMSQLLDAIRLCFHHADDASLVTSPAISMA"
FT   gene            complement(13370..14137)
FT                   /gene="pdxJ"
FT                   /locus_tag="XALC_0013"
FT   CDS_pept        complement(13370..14137)
FT                   /transl_table=11
FT                   /gene="pdxJ"
FT                   /locus_tag="XALC_0013"
FT                   /product="probable pyridoxal phosphate biosynthetic protein
FT                   pdxj (pnp synthase)."
FT                   /function="metabolism go:0008152; pyridoxine (vitamin b6)
FT                   go:0008615"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14559"
FT                   /db_xref="GOA:D2UF73"
FT                   /db_xref="InterPro:IPR004569"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036130"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF73"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14559.1"
FT                   /translation="MTKLSVNVNKIAVLRNSRGGELPSVLDAARACLDAGAHGITVHPR
FT                   PDRRHIHAEDALALAELTQAHGVEFNIEGNPFAPLRPGYPGLIALCAQARPTQATLVPD
FT                   GDSQLTSDHGFDFGRDSDRLRPLIAELKALGCRVSLFVDADNPDLAIAAELGADRIELY
FT                   TGPYAAAFERGDGAAATMAARFAAAARRAQTLGLGVNAGHDLSQANLDMFLAQVPQVLE
FT                   VSIGHALIGEALYAGLDATVKAYLAVLAGRSRR"
FT   gene            complement(14151..14459)
FT                   /locus_tag="XALC_0014"
FT   CDS_pept        complement(14151..14459)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0014"
FT                   /product="hypothetical membrane protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14560"
FT                   /db_xref="GOA:D2UF74"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF74"
FT                   /protein_id="CBA14560.1"
FT                   /translation="MRRYTAAILGEVVMYWLFLPLALGAFVLAFSTPHIWLLVLSLLAA
FT                   LGLMLAWARGWYVTKIGDANQRDAIPMIDPVELRRLREQAEARRAAAAAASNDTSTP"
FT   gene            complement(14545..16014)
FT                   /locus_tag="XALC_0015"
FT   CDS_pept        complement(14545..16014)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0015"
FT                   /product="probable cardiolipin synthetase protein"
FT                   /function="metabolism go:0008152; phospholipid go:0008654"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14561"
FT                   /db_xref="GOA:D2UF75"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027379"
FT                   /db_xref="UniProtKB/TrEMBL:D2UF75"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14561.1"
FT                   /translation="MLVTTLHNAWGRLTGIPHIGAYSTAAYLLYILWLSGWIVLQKREP
FT                   AATLSWVLSLAALPYLGFVIYYLLGPQKVKRQRLRRGRARSGIEYEHRVYPADIHCTEL
FT                   ANMAQATTGLAPSSATAVQWLVDGVATYDTIVRDIGAAQHHVHLEYFIFNPDRTGTRIR
FT                   DALIERAHAGVRVRLLLDAVGSSQVGKRFLRPLLDAGGEVAWFHPNRLLDPFKFKRPWV
FT                   NLRTHRKIVVIDGRIAFTGGINITDEENEALRADAYRDLHLRCEGHVVRSLQLVFMEDW
FT                   LYATEQSRDAFNMARIWPNDMPSRDAGTIQAQLLVSGPDSSWESIHRLQVAAIHEAQRR
FT                   VWLVTPYFVPGEAARMALTSAALGGLDVRLLVPKRSDSRLVTLAARSYFDELLLAGVKV
FT                   YEYGPRMLHTKALIADEDLCLVGSANFDNRSFRLNFEVAMLLRDRSLTEQLAELIGGEI
FT                   AVAVRVREDRKRSLWRHRLPEAIARLTSPLL"
FT   gene            16122..17207
FT                   /locus_tag="XALC_0016"
FT   CDS_pept        16122..17207
FT                   /transl_table=11
FT                   /locus_tag="XALC_0016"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14562"
FT                   /db_xref="GOA:D2U837"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR040086"
FT                   /db_xref="UniProtKB/TrEMBL:D2U837"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14562.1"
FT                   /translation="MNTPIKGRGAGSRLPGRFERTVSQAEDDGWPLDDSVEFAAPRLRT
FT                   RVSEETARSIISRNQSPDVGFAQSVNPYRGCEHGCSYCFARPSHAYLNLSPGLDFETRL
FT                   FAKTNAPELLRRELGKPGYVPSPIALGINTDAYQPIERRLRLTRRLIEVLWEARHPFSL
FT                   ITKNALVERDLDLLVPLARENLVSVYFSVTSLDRRLSARLEPRASAPHARLCAMRTLHE
FT                   AGVPVGVMVAPVIPWINDHALEAVLEAARDAGAESAGYVLLRLPHEVSPLFRDWLQLHY
FT                   PDRAAHVMSSVQQLHGGKDYDSVFGKRMCGEGIYAELLARRFALAHKRLGYAVAPWPKL
FT                   DCSRFVKPSLPCAPSPQGELF"
FT   gene            complement(17339..18046)
FT                   /locus_tag="XALC_0017"
FT   CDS_pept        complement(17339..18046)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0017"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14563"
FT                   /db_xref="GOA:D2U838"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:D2U838"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14563.1"
FT                   /translation="MSDLSADFIEVFDGAMSREDCATILRRLRASTPLRPGEIDGSVFP
FT                   ELKHSQDLRISGLEPWREVEQRLQQVVLAGLLGYLRKYPQTLISPLILQVPGADGQAHW
FT                   LKAEDFALLDDTALSNLARTCLRPGTITLQWYAAGVGGYPYWHCELSPRDPNAETLHRH
FT                   LLWTLYLNDDFQDGETEFLFQRRKIAPRAGSLLIAPTAFTHTHRGNRPRGGDQFVATSW
FT                   ILFQSAQTLYRQE"
FT   gene            complement(18202..19404)
FT                   /gene="tyrB"
FT                   /locus_tag="XALC_0018"
FT   CDS_pept        complement(18202..19404)
FT                   /transl_table=11
FT                   /gene="tyrB"
FT                   /locus_tag="XALC_0018"
FT                   /product="probable aromatic-amino-acid aminotransferase
FT                   protein"
FT                   /function="metabolism go:0008152; phenylalanine go:0009094"
FT                   /EC_number="2.6.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14564"
FT                   /db_xref="GOA:D2U839"
FT                   /db_xref="InterPro:IPR000796"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2U839"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14564.1"
FT                   /translation="MSFFANVEQVPGDPILGLTEAYNADSRPTKVNLGVGIYYDESGRI
FT                   PLLRAVRQIEQQLAQEAKPRGYLPIDGLPAYDLATQKLLFGAESPLLAAGRVATSQTVG
FT                   GSGALRVGADLLKKLLSTSTIAISHPSWENHRAVFTAAGFDVVDYTYFDPATHGLDFDG
FT                   MLADLQKLAPGSVVLLHACCHNPTGADLNHAQWRSVAALLKERGLFPFVDIAYQGFDKG
FT                   IEEDAYAVRLLAEAGIDTYVVASSYSKSFSLYGERVGALSVVSATAAQSKAVQSQVKRI
FT                   IRTIYSSPSTHGAALVAGVLNSPELRAMWEQELTEMRERIHALRAGMVQKLAALGAPEF
FT                   GFIQQQAGMFSYSGLSKTQVDRLREEFGIYAVGTGRICVAALSQSNLDYVTNAVATVAN
FT                   G"
FT   gene            complement(19656..20912)
FT                   /gene="lldD"
FT                   /locus_tag="XALC_0019"
FT   CDS_pept        complement(19656..20912)
FT                   /transl_table=11
FT                   /gene="lldD"
FT                   /locus_tag="XALC_0019"
FT                   /product="probable l-lactate dehydrogenase [cytochrome]
FT                   protein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /EC_number="1.1.2.3"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14565"
FT                   /db_xref="GOA:D2U840"
FT                   /db_xref="InterPro:IPR000262"
FT                   /db_xref="InterPro:IPR008259"
FT                   /db_xref="InterPro:IPR012133"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020920"
FT                   /db_xref="InterPro:IPR037396"
FT                   /db_xref="UniProtKB/TrEMBL:D2U840"
FT                   /protein_id="CBA14565.1"
FT                   /translation="MVLVRPLRGDMRRRRRPMRAPHASLPPADTLPMIISAATDYRAAA
FT                   QRRLPPFLFHYIDGGAYAEHTLRRNVADLADIALRQRVLRDMSALDLHTELFGERLALP
FT                   VALAPVGLTGMYARRGEVQAARAAAAKGVPFTLSTVSVCPIEEVAPAIDRPMWFQLYVL
FT                   KDRGFMRNALERAKAVGVTTLVFTVDMPTPGARYRDAHSGMSGPNAALRRMLQAVAHPR
FT                   WAWDVGVWGKPHDLGNISAYRGHPTGLADYIGWLGANFDPSISWKDLEWIREFWTGPMV
FT                   IKGILDPDDARDAVRFGADGIIVSNHGGRQLDGVLSSTRALPAIADAVKGKLKILADSG
FT                   IRSGLDVVRMLALGADAVLLGRAFVYALAAGGQAGVENLLSLIEKEMRVAMTLTGAKSI
FT                   DAITRDSLAQVADATTGAG"
FT   gene            complement(21041..21622)
FT                   /locus_tag="XALC_0020"
FT   CDS_pept        complement(21041..21622)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0020"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14566"
FT                   /db_xref="GOA:D2U841"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D2U841"
FT                   /protein_id="CBA14566.1"
FT                   /translation="MLTTLQPPDLLFLILGLCWCGCELLLGHRRRAADGGTHDQGTLRL
FT                   LWRVLYAAVTVAVLLSMLNVWRDAPALRAPARWLGCALLIGGLALRLWAIRVLARWFTV
FT                   DLTIQHGQRLVGHGPYRYLRHPSYTGALLAFYGLAVGMGNVLSLLAIVLPVTWVFVHRI
FT                   RIEETMLTEAFPLDYPAYAAHRWRLLPWVW"
FT   gene            21872..23077
FT                   /locus_tag="XALC_0021"
FT   CDS_pept        21872..23077
FT                   /transl_table=11
FT                   /locus_tag="XALC_0021"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14567"
FT                   /db_xref="GOA:D2U842"
FT                   /db_xref="InterPro:IPR010758"
FT                   /db_xref="InterPro:IPR024906"
FT                   /db_xref="InterPro:IPR024910"
FT                   /db_xref="UniProtKB/TrEMBL:D2U842"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14567.1"
FT                   /translation="MIIHPKVRGFICITAHPLGCERNVLEQIEATRARGVRHDGPKNVL
FT                   VIGASTGYGLASRITAAFGFGAATLGVFFEKPSSDKKLGSAGWYNSAAFDKHAKAAGLY
FT                   SKSINGDAFSDATRAQVIERIKTEMGGQIDLVVYSLASPARKLPGTDEVKRSALKPIGK
FT                   TYTATAIDTNRDAIIEASVEPATEQEIEDTVTVMGGQDWELWIQALDAAGVLAPGARTV
FT                   AFSYIGTEITWPIYWHGTLGKAKVDLDQTAQRLHAPLQRHGGTANVAVLKSVVTQASAA
FT                   IPVMPLYISIVYKIMKEKGLHEGTIAQADRLFRERLYRQDGEPAATDTEHRLRLDDWEL
FT                   RDDVQNACKALWPQVTTENLSQLTDYAGYKHEFLKLFGFDRKDIDYDAEVDPNVTFDCI
FT                   EL"
FT   gene            complement(23197..24303)
FT                   /locus_tag="XALC_0022"
FT   CDS_pept        complement(23197..24303)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0022"
FT                   /product="putative 2-dehydro-3-deoxygluconokinase protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="2.7.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14568"
FT                   /db_xref="GOA:D2U843"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D2U843"
FT                   /protein_id="CBA14568.1"
FT                   /translation="MPCHHVLWPSWRFPGMLGIPSTVQDSTTMAISHIVCFGELLLRLA
FT                   APGHERLLQTPRLEVKVGGAEANVGVALAHFGHAVTMVSVLPDNPLGAAAVGELRRHGV
FT                   DTGRIRFAPGRMGLYFLSTGAGHLPSAITYDRAGSTFATVAPETYDWPALLQGAQWLHL
FT                   SGVTPALGERGAAAALAAAQAARAAGMRVSFDGNYRPSLWEAWDGDAPSILRPLMAQAD
FT                   VLFADYRDLEVVLGHRYPQDSAQARVEAGARDAFAAFSQLQLMACTQRVAHSAEWHSLG
FT                   AMLLRRDGSVAQAPAEELTGIVDRIGGGDAFAAGVLHGLCRSWDDTATVRFGLAAGCLK
FT                   HSVPGDMLTLSEAEVQASVGATRFDVKR"
FT   gene            complement(24632..25303)
FT                   /locus_tag="XALC_0023"
FT   CDS_pept        complement(24632..25303)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0023"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14569"
FT                   /db_xref="UniProtKB/TrEMBL:D2U844"
FT                   /protein_id="CBA14569.1"
FT                   /translation="MHMHRRQLSDRKSPGTATQGTSIQDSPSYLFKYFSCTGFAETKSF
FT                   SVRKIANFFSKLRFPRRQDDDSLTNMDFPIPTLHRRKIIMAITDLKLRRFRKTTLCAMF
FT                   ALAIGATTSAHAGYKDVAIFVKNSNYNAKAILLKNGTDGSTVCSGIVMPKYQGGYANGP
FT                   DVNSETWYSVIAMSTPNCLDGTAMAGMFNIFKMGHPSNPQDVRRLEIDVNATNITFQTN
FT                   E"
FT   gene            complement(25368..27311)
FT                   /gene="recD"
FT                   /locus_tag="XALC_0024"
FT   CDS_pept        complement(25368..27311)
FT                   /transl_table=11
FT                   /gene="recD"
FT                   /locus_tag="XALC_0024"
FT                   /product="probable exodeoxyribonuclease v, alpha subunit
FT                   protein"
FT                   /function="metabolism go:0008152; macromolecule degradation
FT                   go:0009057; dna go:0006308"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14570"
FT                   /db_xref="GOA:D2U880"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:D2U880"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14570.1"
FT                   /translation="MNLFDALQRAGTLRTLDLAFAQSLQRLDPTTAPAVLAAAALASLA
FT                   VASGHAGLDPARANALLDSRDSTAPPLPTTDDWMRALAASRWVAQPVAEDAASADCPLV
FT                   LERGLLYLRRYREYERRLALGLRRLAAPSPPQGDLAALAPLFAQLFPRAGRQATLDDSF
FT                   PDRQARAAALALRRALLLVTGGPGTGKTTTIARLLLLRIAQSHTLSMPAPRIALAAPTG
FT                   RAAERMAESLRAAVAHACADGVDPALAEALPASASTLHRLLGVIRESPRFRHDPDNPLP
FT                   FEVIVVDEASMVDLPLMCKLVEAVADGAQLILLGDADQLPSVEAGDVLAAILQAAGPGD
FT                   ALQPADAHALRPLLGHSAVATQSGGLIGHRVQLLRSYRQAQDFTLAPLAEAVRTGEADT
FT                   TMQLLRKGELAGVHFHDGVDDPLVAGGDALFAHWRALGEAANPSEALHAAARLRLLTAV
FT                   RAGPQGAHTLNARIEQRLAGPTSGHRRLGSATPWFHGRLLLIVENSYRHGLFNGDVGIC
FT                   LRDAQGTLVAWFSGAGDGHVRGFHPAALPAHESAFAMTVHKAQGSEFDTVWLQLPSRDA
FT                   RVISRELVYTGLTRARRALHLAASEPLLRAALARRAARISGLAWRLGGEPALSAHPESL
FT                   IETGPPVQRGLF"
FT   gene            complement(27308..30973)
FT                   /gene="recB"
FT                   /locus_tag="XALC_0025"
FT   CDS_pept        complement(27308..30973)
FT                   /transl_table=11
FT                   /gene="recB"
FT                   /locus_tag="XALC_0025"
FT                   /product="probable exodeoxyribonuclease v beta chain
FT                   protein"
FT                   /function="metabolism go:0008152; macromolecule degradation
FT                   go:0009057; dna go:0006308"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14571"
FT                   /db_xref="GOA:D2U881"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:D2U881"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14571.1"
FT                   /translation="MSTASDRDPYLHLPLHGVRLIEASAGTGKTFTLATLFTRLVVERG
FT                   LRLGQILAVTFTEAATQELRRRIRERLTLAATLVPETDAAAWQMPASAESPDVSLTRQL
FT                   LQAHLAAAQETPAALRRRLQQAAEDIDLAAIFTIHGFCARALREYALESGQPFATPQLL
FT                   TDERELLRDVAADLWRAHAVDASVAEDLEALWKGGPHELAADLHALIHIPHLLPLPSAQ
FT                   ASADPSATRAQAAQVLIAAMQTHADDAYAAIIAAFDNKVFNGKLVKRPSFDKAFEQLWQ
FT                   GRADAQWTLDAPGSHLDKLLPARLSTFCREDARDRVPRSPLFDAFDAWQQADAQVRQWQ
FT                   TERRIRFLHTLREAAIARIAAIKRQRRVQTYDDFIDAVAQALRGPHAEALVRGLRAQYA
FT                   VALVDEFQDTDERQWAIFSTLFGTSDLVRAIGVEPGLFLIGDPKQAIYGFRGGDVHTYL
FT                   SAVTNAEQAPPLDHNFRSRPALLAAIDALYAQAGYTQAFFIDGIDFHPVQPGGRRADSD
FT                   LQRDDRCAPALTLWRAPDPPLPAKGKPRPWSAGRARELCTAACVAAIGDWLGAGRAGTA
FT                   LVDGRAVQPADIAVLVRSHSDATRIQQALAAVGIPAVAAGKPSLFASEEALELMALLHS
FT                   LLDPGDDSRLRAALATVLIGEDAAAIAALDHDGERHRRWQQQALDWRERWQRGGPLALI
FT                   EHLGSTNAQRLLALVDGERRLSNYLQLAELLQEAHTHALGPHGLVDWLARRIAASNAND
FT                   DTQLLRLESDARRVQIITLHKSKGLEYPLVFLPYVGIGQKPLTQKPGERVIVHRQGKRC
FT                   LHWPLHVDAVEWEASKRAWEHAQRAEDARLLYVGLTRAEHALWIATGPFFRHDTTALAP
FT                   MLSDIDALQSRISAEILMFDTRPPPHPPRLPPAEALHVPPARTPTRKLVAEWWVYSFTQ
FT                   LANADAGTDPMASTTVASRGGRDEPTAADTVNAAAEVEIIDRRFVGNRFGVAMHEVFER
FT                   CDFAAWRDWRPGQPAPVGQHNAIVEALQRGGYAEDELTDGSALLTSLVGHTLTVPLPES
FT                   ICLAVLPQTQRRNEMEFHFAMRPTRVDALLTLLHRFGVAGERQAFGARQRLEGLMTGLI
FT                   DLTYHHAGRWYVLDYKSNRLPSYDPDALATAMAHSEYTLQALIYTVALHRWLRFRLGAN
FT                   YAYARDFGGVRYLFCRGLDATRDPSPGVHAWRFDPALVEGVDALFAGTDAVENPR"
FT   gene            complement(30970..34533)
FT                   /gene="recC"
FT                   /locus_tag="XALC_0026"
FT   CDS_pept        complement(30970..34533)
FT                   /transl_table=11
FT                   /gene="recC"
FT                   /locus_tag="XALC_0026"
FT                   /product="probable exodeoxyribonuclease v, gamma chain
FT                   protein"
FT                   /function="metabolism go:0008152; macromolecule degradation
FT                   go:0009057; dna go:0006308"
FT                   /EC_number="3.1.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14572"
FT                   /db_xref="GOA:D2U882"
FT                   /db_xref="InterPro:IPR006697"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041500"
FT                   /db_xref="UniProtKB/TrEMBL:D2U882"
FT                   /protein_id="CBA14572.1"
FT                   /translation="MQYCGIAYTRRGAAALYMRQQGSAQLTAMDLSPPLRSHAALPQRI
FT                   RHNAGNMHVTSAPDFRLYPSNALDTLAALLAEELRRPLPEQPLLAPEVVLIPQVAMRRW
FT                   LQSTLAATHGVAANLQFLTPGEFVAHALERNLGAADDDLDMTSLHWRLYAALRSDLGAD
FT                   PTLAPLAAYLADDDPLKPWTLAGELGNVFEKYQAWRRDWLLRWEAGADPDDVQARLWRR
FT                   IASGRAYRARRIGHYLDRYARPDGPLPQGLPPRLFAFAVLNISPDVLRVLATQARVGTL
FT                   HFYLPTPTQGYWGDLQTLWQRRRAGTAVDLFAEQIQENPLLQAWGAAGRDFMALIGDYE
FT                   VVHPLAEIAVYADPLESGQRPLADGGLGDSLLRRMQSDLFQRRAPRSPAALPTVDKHDP
FT                   SLQVHACHTRLRELQVLHDQLRALLDDPRLDPPLQPREIAVLSPNIDPYVPYLDAVFGS
FT                   HGNDDALPYALADASPLASEPLAEVFLALLGLPIARFGLHEILDLIASAPIAEAAGLDT
FT                   AGLDRLRGWLHAAGARWGLDAAHRRQHQAPADDAYTWRFALDRLLLGHASGAEDDIDGV
FT                   APWPQLEGSALAALDTLLRLLRVLDRHQAALAEPMPPAQWRECLLALLDALLPQTPSAP
FT                   RAQRALERLRTLIDQFARDAARAEYTAAVPAEVVRAHFTAVLGESDTRAPLLTGGISFG
FT                   RMVPMRLLPFRAICLLGMNDGDFPRRDPAAGLNRLTAELGTARRRHGDRSTREDDRFLF
FT                   LQLFASAQDVFYLSYLGADARDGSVREPSPLVGELLACAAQYHAEPAAATTLVVRHPLQ
FT                   PFAAAAFGAIGAEAADPRRFSYRRQWRPAVDSLIGQRQPLPPWIPETLPAMADDALPTS
FT                   LSIDELRRFLLDPAEQFLRQRLGLRLPDPAQADSDLEPLVAPTRGLDKYGLQQQVFEAL
FT                   LREETDGLYERLRARALLPSGPLGRHQLDQHLRQLRPYADAFGHWCGATPAPPAARLHV
FT                   HIDGTELHGRLSDWYAAGVGRVKIGALSGRSAIRHGLEWLLLRAAGEGAPFVRFFEHED
FT                   GLGPHPLDPERLSSTQAQQALTDLLRLYRQGQQTPLAFVPYSSWAYYQAARGGDLDKAI
FT                   KNAAAQWQAGFSWREADRPQLRLVCRGRDPFADPQRFAAFASTSQHIFGLLERGDPGAA
FT                   LDPEHLLESWQRWHGTQEDAE"
FT   gene            34599..35390
FT                   /locus_tag="XALC_0027"
FT   CDS_pept        34599..35390
FT                   /transl_table=11
FT                   /locus_tag="XALC_0027"
FT                   /product="probable abc transporter atp-binding protein"
FT                   /function="atp binding component"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14573"
FT                   /db_xref="GOA:D2U883"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D2U883"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14573.1"
FT                   /translation="MASSEPNLVQLSGVRIDRGGRAILRDVSLTVPQGSITAVLGPSGS
FT                   GKSTLLAALTGELVPMAGTLQVFGRPLPRGSRALRETRKSIGVLLQGNGLLSDLSVAEN
FT                   VALPLRAHTRLPEPVLQRLVALKLHAVGLRAAAEAWPRELSGGMARRVALARALALDPP
FT                   LMIYDEPLTGLDPIASGVIMSLIQRLNATLGLTSIIVSHHVHETLPICDQAVAIANGGV
FT                   VFAGTPQALQASADPLLQQFLHGRPDGPIPFDAPQRARSAA"
FT   gene            35390..36139
FT                   /locus_tag="XALC_0028"
FT   CDS_pept        35390..36139
FT                   /transl_table=11
FT                   /locus_tag="XALC_0028"
FT                   /product="putative abc transporter permease abc
FT                   transporter, permease protein"
FT                   /function="membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14574"
FT                   /db_xref="GOA:D2U884"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D2U884"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14574.1"
FT                   /translation="MAMAASIRALGRAGLFFLTVLRGSLPSRDLLAELIREIYKVGARS
FT                   LPIIAVGGAFVGLVLTLQGYRTLTTYGASDALSTLLGLSLYRELAPVLTALLFIGRAGS
FT                   SIAAELGLMRATDQIKALELMAIDPVAKAVAPRFWAAVLTVPLLTGIFCSLAISASYFE
FT                   AIGALGLDRGTFWSALSSSVDFWADFGVAMLKSAVFGGTAALVAAYVGFHAEPTIEGTS
FT                   VATTRAVVNASLLVLMFNFVMSALLFR"
FT   gene            36209..36751
FT                   /locus_tag="XALC_0029"
FT   CDS_pept        36209..36751
FT                   /transl_table=11
FT                   /locus_tag="XALC_0029"
FT                   /product="putative abc transporter substrate-binding
FT                   protein precursor"
FT                   /function="the atp-binding cassette (abc) superfamily +
FT                   abc-type uptake permeases go:0042626"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14575"
FT                   /db_xref="GOA:D2U885"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D2U885"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14575.1"
FT                   /translation="MALRGPRLEFAVGAFLLLGLASLLVLAIASTNRQWGFGGDRYALI
FT                   ARFSQIGQLRAQAPVKIGGVIIGQVAKIDLDPTKFDSVVTLSIDGKYKDLPADTSAAIL
FT                   TSGLLGESYVGLQPGGDPDTLKPGQEIAFTQPAVDLIQLVGKYMFGGGSGGDKTVTPAA
FT                   ASSAAGPVPPSKEPHKP"
FT   gene            36748..37410
FT                   /locus_tag="XALC_0030"
FT   CDS_pept        36748..37410
FT                   /transl_table=11
FT                   /locus_tag="XALC_0030"
FT                   /product="putative periplasmic abc-type transport system
FT                   auxiliary component precursor protein"
FT                   /function="atp binding and membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14576"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="InterPro:IPR042245"
FT                   /db_xref="UniProtKB/TrEMBL:D2U886"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14576.1"
FT                   /translation="MTIKLLPVALATALALAVPTAVLAQTAGATAPSASTASKVVLENS
FT                   TRILSTLEQRRAEFKSNSSALRQFIDSELNKSFDRDYAARLVLGVHGRGASDADVKLFA
FT                   DAMADNLMQRYGSALLTFEGKPQVHVKSEAPLPGGRGVKVSTELVRSSGDPVPVDYLMR
FT                   NTGGTWKIFDVMVEGVSYVQTFRNQFDTPLSNKSIAEVAAELRNGTLQAAPASSSGK"
FT   gene            37400..37714
FT                   /locus_tag="XALC_0031"
FT   CDS_pept        37400..37714
FT                   /transl_table=11
FT                   /locus_tag="XALC_0031"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14577"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D2U887"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14577.1"
FT                   /translation="MASEPQLRRDGDTLALSGVLDRAAATTLWPAALRQLAGVRALDLR
FT                   AVSRVDSAGLALLAELAACIRTQGQAEVAIHGDPAGLTELSAAYRLASTLDFHSPPAAS
FT                   "
FT   gene            37718..38782
FT                   /locus_tag="XALC_0032"
FT   CDS_pept        37718..38782
FT                   /transl_table=11
FT                   /locus_tag="XALC_0032"
FT                   /product="putative lipoprotein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14578"
FT                   /db_xref="GOA:D2U888"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:D2U888"
FT                   /protein_id="CBA14578.1"
FT                   /translation="MNVLRILTSLILTLVVALSAYASTPKPPATPPVAASPDPSTPPMA
FT                   TDSSTAASTMPAAPDSTAAARPGAVASGGVSTGTQRSAPTSAEDDYAALYASDPNNLGA
FT                   DATLPAGVSVPQSYDPWEKFNRKVHAFNNVVDHALARPLARTYVNVVPRPARLGVTNFF
FT                   NNLGSPLTMVNQVLQGHPLQAGQTLSRFVINSTLGIGGVLDPATDAKLPRRTEDFGKTL
FT                   GVWGWRRSRYVELPFFGPRTVRDVLGLAADTSLSPLQQIEDDRVRIGLQGLQLVDIRAQ
FT                   LLPFDSMRDQAPDEYQLTRDAWLQRRNYQIENNLRRGHQGEDKDLPNYLREEDANPTVP
FT                   ADAMPMLQWRGGTR"
FT   gene            complement(39031..39573)
FT                   /locus_tag="XALC_0033"
FT   CDS_pept        complement(39031..39573)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0033"
FT                   /product="probable glutathione peroxidase protein"
FT                   /function="cell processes go:0009987; other stresses
FT                   (mechanical, nutritional, oxidative) go:0009612 go:0007584
FT                   go:0006979"
FT                   /EC_number="1.11.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14579"
FT                   /db_xref="GOA:D2U889"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR029759"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2U889"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14579.1"
FT                   /translation="MSFSLYDIPLIRIDGQPTTLAEHRGKVLLIVNVASKCGLTPQYAG
FT                   LEALYRDKRAAGLEVLGFPANDFKGQEPGDEAQIQQFCQLTYDVTFPMFAKITVTGEAT
FT                   HPLYRALIQAQPQAEGEGPMREKLAGYGIEPNPAPGVLWNFEKFLVGRDGQVCARFAPD
FT                   VTADAPRLGAAIDAALS"
FT   gene            complement(39841..41451)
FT                   /locus_tag="XALC_0034"
FT   CDS_pept        complement(39841..41451)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0034"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14580"
FT                   /db_xref="GOA:D2U890"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D2U890"
FT                   /protein_id="CBA14580.1"
FT                   /translation="MAGYTADMQNDAHFLILAGLLCAAIALLLVVLLRRSTHTGLEATL
FT                   REEQRNGRSELREQLDSLARQQDARSEGFARHLAELSTRTDQRLDLLRETLTEEARRGR
FT                   VEAGEAQQRLAESLNQRLMEMRSQLDGFGQQQDARMQQFGQQQAELIARIDTHLTALRE
FT                   TLIDEARKGRQEGADAQQRFADALGLRLGELVQRNEQRLGEMRGTLEERLKELQADNAL
FT                   KLEQMRGTVDEKLQTTLNTRLDASFKLVSERLEQVQRGLGEMQQLATGVGDLKRVLSNV
FT                   KDRGGWGEVQLDNILEQTLTQEQYARNVRIRPERNEAVDFAVRLPGRGHEDTPVWLPMD
FT                   AKFPREDYERLLDAQERGDAEQAQLMGAQLERAIRVQAKSIGDKYIAPPHTTDFAVMFL
FT                   PTEGLYAETLRRPGLADALQREHRIVIAGPTTVTALLNSLQMGFRTLAIEKRSSEVWGV
FT                   LAAVKSEFGKFAGILEKAEKQINTVGKSLGEASRKTRTIERRLRGVETLSDAQATSLLE
FT                   LSLPLDETDAEEAAPDAPE"
FT   gene            complement(41610..43028)
FT                   /gene="uxaC"
FT                   /locus_tag="XALC_0035"
FT   CDS_pept        complement(41610..43028)
FT                   /transl_table=11
FT                   /gene="uxaC"
FT                   /locus_tag="XALC_0035"
FT                   /product="probable glucuronate isomerase protein"
FT                   /function="metabolism go:0008152; d-glucuronate catabolism
FT                   go:0042840"
FT                   /EC_number="5.3.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14581"
FT                   /db_xref="GOA:D2U891"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2U891"
FT                   /protein_id="CBA14581.1"
FT                   /translation="MPSTTLFLHPNRLFPADPTIQAIARRLYAQIAALPIISPHGHTDP
FT                   AWFAEDAPFANATELLLIPDHYVFRMLYSQGVDLDTLGIPRADGSRAAVNPRSAWRMFA
FT                   EHFHLLRGTPSALWLNHVFHAVFGLRVRLDADSADLYYDCIGEALQTPAFQPRALFERF
FT                   GIEVIATTESPLDPLHHHATIRASGWGGRVITTYRPDPVIDPEHEQFPAALRRFGELTG
FT                   EDVYTWDGYLRAHRQRRAFFAQMGATSTDHGHPSAATANLPAVEAARLFARVVGGTASA
FT                   ADAELFRAHMLTEMAAMSVDDGLVMQLHPGCFRNHNRTLFARYGRDKGADLPLRTDYVH
FT                   ALKPLLDRFGNTPGFTLILFTLDESTYARELAPLAGHYPALLLGPAWWFHDAPEGMWRF
FT                   REQTLSSAGFYNTVGFNDDTRAFLSIPARHDVARRIDCAFLAKLVAEHRLDEDEAVEVG
FT                   IDLAYRLPKRAYRL"
FT   gene            complement(43070..44053)
FT                   /locus_tag="XALC_0036"
FT   CDS_pept        complement(43070..44053)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0036"
FT                   /product="putative xylanase precursor protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="3.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14582"
FT                   /db_xref="GOA:D2U8E8"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8E8"
FT                   /protein_id="CBA14582.1"
FT                   /translation="MKTIASLLFALLLISSTASVDAAPLAAGKKRFLGCAYSAPQMLDF
FT                   GKYWNKLTSENGGKWASVEAVRGQMDWSEFDKAYNFAQDNNIIMFDHVMAWGSQQPEWM
FT                   RTLPPAEQLAAIRHWFAAVAERYPNIAMLEVANETLPNHNQPDNRYSDSGNYMQALGGP
FT                   GVTGVDWVINLFRLARQYFPNTKLMINDYGITASDDATKQYLRTIQLLQRENLIDAIGL
FT                   QEHAFETSSASWWTHFFNLNTLGSTTGLPIYITEFDIDGPTDAQQLDGYKKFFPLFWEN
FT                   QYVKGVTLWGFRPGLWRDQEGAYLVNKDGSERPALKWLRDFVAITP"
FT   gene            complement(44153..45448)
FT                   /locus_tag="XALC_0037"
FT   CDS_pept        complement(44153..45448)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0037"
FT                   /product="putative hexuronate transporter protein"
FT                   /function="porters (uni-, sym- and antiporters) go:0015293
FT                   go:0015297 go:0015292"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14583"
FT                   /db_xref="GOA:D2U8E9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8E9"
FT                   /protein_id="CBA14583.1"
FT                   /translation="MMLPTRTQNTTAIASLGRLRWRICALLLAATTINYVDRQVLGVLA
FT                   PFLQEHIGWNEIEYGYIVTAFQAAYALGLLCSGAVIDRFGTRVGYALAIGVWSLASMGH
FT                   ALTSGVIGFAVARFFLGLGESGNFPAAIKTVAEWFPRRERALATGIFNSGSNIGAIVAP
FT                   LSVPFIANAWGWQWAFIFTGVLGAIWLTVWWLSYRPPEHHPHLSAAELTHIRSDPSESI
FT                   RPLSWTQLLRHRQAWAFVVGKFLTDPVWWFFLFWLPKFLHDKYGLGLLQLGAPLIVIFL
FT                   LADVGSIAGGWLAGRLLARGWSVNRARKVAMLVCALAVMPIVLAARADHLWLAVALIGL
FT                   ATAAHQGWSANLFTLTSDMFPRHAVASLVGIGGFAGAVGGMLIANFIGFLLQSTGSYLP
FT                   VFLLAGSAYVLALGMVHLLTPRLQPAQMQGNA"
FT   gene            45951..48872
FT                   /locus_tag="XALC_0038"
FT   CDS_pept        45951..48872
FT                   /transl_table=11
FT                   /locus_tag="XALC_0038"
FT                   /product="putative tonb-dependent outer membrane receptor
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; the outer
FT                   membrane receptor (omr) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14584"
FT                   /db_xref="GOA:D2U8F0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F0"
FT                   /protein_id="CBA14584.1"
FT                   /translation="MNNGYARTTLAYALALVLSGMSAETVRAQAAPPADAQAALAASGE
FT                   KVKQLDAVNVSGYRHSIQFSTDAKRDAVTFSDTVFAEDIGKFPDMNIAESLNRIPGVQL
FT                   ARDVNGEGLNIAIRGLGSSFTKTTLNGANIATASIGLNAQNQNREVDLNLFPTEFFTQL
FT                   TVNKTPTASMLEGGVSGVVDMRSARPFDHPGTHVTYQLQGDWNSTSKKTTPRGALMGSW
FT                   TNQAGTFGALFGVSSVRSKIGVDGFESIGWTNPGLTYAQCGLTPPAGVPSTNQPVACNA
FT                   NGGGNWRIPDTVPVTAGAGLTPGQSIDAAWLLAHNPGLSTAQITEALIPRLGRRVQMQG
FT                   DRDRDASVLSLEWRPSDSAHFYLDSLFSKAKRTTDRTSMNLIGRNGNMIPLNMQLDANN
FT                   VVTAATFANAQYFLEARPYREQVKFWSVNPGAELLFGQAQDIKLNVQANATRSWMFRES
FT                   PSVLVTSPFTTVDYRNAGGDIPSISSPLDLDNPNLGWSWTGGRLNIANEKRDTETRGAH
FT                   ADLQFGEDRRNIKVGVAYDQAERRIRGFDNSAAWETLVCRGGGNTCTGGPGSLIPQAAL
FT                   ASYLKPGPGGFITVDFNRFLRDSGYYALRDAAPETNAANTGAATGGILEKNWGFYVETN
FT                   AETDVWNRTLRFNAGVRYVTTDQTISGPVTVGGVRRYQVLNSNYSELLPSFNLAWDIAK
FT                   DVVVRLSASRTLTRPDPSAMLPNTNFSDPSAQTATQGNSKLAPYRSTNLDIGGEWYTGG
FT                   EGFVGLTLFGKRIDGFTVNGVRRIPFLDLGVDYATLSATQQAALQQRGGPNVATVDVQT
FT                   QVNADGVLDIRGLEAIWVQPLDRLLDGLGFSLNYTHVAQQSNGGGVPAVAVGVAPNLWN
FT                   GTVYWEKNNTSVRLSYAWNDDMIISGANQNGIPDARLMADARGQLDLSASYTLAHLPSA
FT                   PQITLNITNLTNAPLRTTFEYPNATYDLYKPGRTIMLGIRGTF"
FT   gene            48953..50434
FT                   /locus_tag="XALC_0039"
FT   CDS_pept        48953..50434
FT                   /transl_table=11
FT                   /locus_tag="XALC_0039"
FT                   /product="putative inner membrane symporter protein"
FT                   /function="porters (uni-, sym- and antiporters) go:0015293
FT                   go:0015297 go:0015292"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14585"
FT                   /db_xref="GOA:D2U8F1"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F1"
FT                   /protein_id="CBA14585.1"
FT                   /translation="MTSTHSLSLGEKIGYSLGDLAANLIFQTLVSFLAFFYTDVYRIPA
FT                   GVAATLIFVVGLLGAFVFTPLVGVLADRTRSRWGKFRPWILWTALPFGGFSLLAFSTPM
FT                   LSEQGKIVYAFATYALLMLIYVANNLPYSALSGVLTGSMEQRNSLSAYRFFAVTLAQFV
FT                   IQVLLLPLVLMLGDGDKARGFQTAMGLFAGVGTLCFLIAFATTRERVLPIAAQPSSVRQ
FT                   DLGDLVRNTPWLVMLAVTILVFVNLALKGGMYVYYFKNYLDAQALTGFLDRSGFNTLIA
FT                   ILNRLLASTGLGVLHWPQDAPTSAFSMFSAGGILAMIIGITFSKRLADRYGKRNAFGAA
FT                   LLASTLFLLAFSMYPPQAIGLVFGSYVLHGFFYGMTIPLLWAMIADVADYSEWKNHRRA
FT                   TAIVFSAMLCGLKVGLSIGGALVAGLLAFYGYDAAAPQQSAAVSNGIRLTISVYSAIPF
FT                   LLGVLLLRCYAIDKSLESRIERELDARRLQIASTH"
FT   gene            50462..51475
FT                   /locus_tag="XALC_0040"
FT   CDS_pept        50462..51475
FT                   /transl_table=11
FT                   /locus_tag="XALC_0040"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14586"
FT                   /db_xref="GOA:D2U8F2"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F2"
FT                   /protein_id="CBA14586.1"
FT                   /translation="MSVDSPADLQALACKAISPPLVTHMYTADPSAHVFEEALYIYTSH
FT                   DIETGVAFNDNGDHFGMQDYHVFRMQTPDGPAVDCGLALHLQDIPWAERQLWAPDAACR
FT                   DGRYYLYFPAKRADGLFQIGVAVGERPHGPFVAQPQPIDGAYSIDPAVFADRDGSHYLY
FT                   FGGLWGGQLERYRDNVYAADNGEPADYAPALGPRVARLCTDMLSLAEAPREIAIVDADG
FT                   HPLLAGDHARRYFEAPWLHVHAGRYYLSYSTGDTHLLCYAIGDSPYGPFTYQGPLLSPV
FT                   VGWTTHHSICAFQDRWYLFYHDALLSGGVTHLRSIKVTELHHDAQGHIVQVHPYGD"
FT   gene            51555..51770
FT                   /locus_tag="XALC_0041"
FT   CDS_pept        51555..51770
FT                   /transl_table=11
FT                   /locus_tag="XALC_0041"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14587"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14587.1"
FT                   /translation="MLKHVDTLTPAEISLRIDALRREHRALDEQLQRIPANFEDELEAK
FT                   RLKKRKLQLKDCILHLEQLLIPDEPA"
FT   gene            complement(52039..54687)
FT                   /gene="plsB"
FT                   /locus_tag="XALC_0042"
FT   CDS_pept        complement(52039..54687)
FT                   /transl_table=11
FT                   /gene="plsB"
FT                   /locus_tag="XALC_0042"
FT                   /product="probable glycerol-3-phosphate o-acyltransferase
FT                   (gpat) protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="2.3.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14588"
FT                   /db_xref="GOA:D2U8F4"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR022284"
FT                   /db_xref="InterPro:IPR028354"
FT                   /db_xref="InterPro:IPR041728"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F4"
FT                   /protein_id="CBA14588.1"
FT                   /translation="MAPMPEHNPLPFPEDTAAAGGAFPPGHTPTTAQTSNAGERPASAP
FT                   TTATPSMAHAGARQAKRPLWARLLGRLADPWLGLKIEPDEPGQYDDGRPVVYVLEDYGL
FT                   SNALILDKACRESGLPSPLVPLPGDPLGRKRAYLALSRRSSNHALIPEQRGAKTHSDSL
FT                   AKLLHAHRVRAELDIHLVPVSIFVGRAPDKQSGWFAVLFSENWALVGSFRRLLGVLLNG
FT                   RSTIVRFATPVSIRQTLQEGLPPERTVRKLQRVLRTHFRRIRETVIGPDLSTRRLLVDQ
FT                   VLAVDPVREAIAVQAKRDNSKILDAWRKAHSYAWEIAADYSSPVVRSAGVLLTHVWNRI
FT                   YAGVLVHHLDKLKDAAPGHEVIYVPSHRSHMDYLLLSYVLYERGIVPPHIVAGINLDLP
FT                   VVGTLLRKCGAFFIRRSIKGNALYSAVLSEYVAQLVAGGYSIEYFVEGGRSRTGRLLQP
FT                   KGGMIAMTLRAFLRQPRKPVLFQPVYIGYEKLMEGNSYLDELSGRQKEKESIWALLWGI
FT                   PKVLKQNFGQVVVNFGEPIALSQMLAQRAPEWDGQPLSEDEKPAWLSGTVDALAQQIQV
FT                   HINAAADVNPINLLALALLSTPKHAMGEADLIAQIELCKKLLAELPYSDRVTVTPHSPE
FT                   RIIAHAEDINVLTRIPHPLGDVLSVNGDNAVLLSYFRNNVLHLFTASSWVACCFQNNRR
FT                   MSRAGLLRLGRTVYPFLQSELFLPWSEDQFAERIERTIEVFVREGLLQQIDEDEGSVVL
FT                   ARNTGQTDEVFRLRAIGHSLQQAFERYYIAISVLVKNGPGKLGAGELESLCQQAAQRLS
FT                   LLYAPAAPEFFDKALFRGFIQKLRELKLVWPDDNGKLLFDEHLDVWAKDAKFILGRELR
FT                   HTIERISPEAI"
FT   gene            complement(54687..55622)
FT                   /locus_tag="XALC_0043"
FT   CDS_pept        complement(54687..55622)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0043"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14589"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14589.1"
FT                   /translation="MSSYPTRGFSSRALSSLLLAALALSVSGCKPTPTELPGARAEPPT
FT                   AVRALAHALQRNDLVGYARTAVPPAQYRGLQQAWSKDRSRWPLTELPLAKRLPEVLATL
FT                   AAPDAERQLQHAFDTQFGGQAESLKQAAHSLGLFGVQYLRNENDYTPEQRDHYVQLVQA
FT                   LSAWAARAPLSERNRAHAAIARLCAAARRTGIRSDADLHTLGMDESLGRLGPFLADLKA
FT                   VLADYGLDLGATAGALRTGLVSQQGDLAVVRIQYPLDGEQIDTSAVLVNREGHWYLRNI
FT                   LDQVQTLLAATAGPQAATAAAPHHATPAKR"
FT   gene            56150..57208
FT                   /locus_tag="XALC_0044"
FT   CDS_pept        56150..57208
FT                   /transl_table=11
FT                   /locus_tag="XALC_0044"
FT                   /product="putative transcriptional regulator, laci family
FT                   protein"
FT                   /function="transcriptional level go:0006355"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14590"
FT                   /db_xref="GOA:D2U8F6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14590.1"
FT                   /translation="MRPRFVSAPEQRANITIKDVARLANVSVATVSRTMNGHQHVAEPV
FT                   RARVLEAARSLHYVPHHAARSLSSRRTHTIGVVLPDLHGEFFSEVIRGIDMVAHTRGLH
FT                   LLVSSYRGAQEEQRRAVQRMPGRVDGLLIMAPYLAGVAGDPDEIPLGGLPAVLMNSAER
FT                   LGDAPALNIDNYGGARVMTRHLLGLGHRRIAFIAGPQDNFDASERLRGYRDELQAHCPQ
FT                   VSAQVVQGAFDEASGYRAGEALLQGQRPDVVFAANDMMALGCLFAFTHAGVRVPEDIAL
FT                   AGFDDLPMARYVHPALTTMRVDIVGFGARAMQLLLAALEPHGMPAPTPADAAIVPQLIV
FT                   RASCARGGVAMD"
FT   gene            57304..60360
FT                   /locus_tag="XALC_0045"
FT   CDS_pept        57304..60360
FT                   /transl_table=11
FT                   /locus_tag="XALC_0045"
FT                   /product="putative tonb-dependent outer membrane receptor
FT                   oar-like protein"
FT                   /function="transport go:0005215 go:0006810; the outer
FT                   membrane receptor (omr) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14591"
FT                   /db_xref="GOA:D2U8F7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14591.1"
FT                   /translation="MSKMRSTSTLPARSMLCCALATCLFVALPALAQSSNATLRGQVAA
FT                   AQAGSEVTVTNIATGAVRRAPVAANGNYTVVGLPPGTYKVEANGISRMVTLQVASSSTV
FT                   DLDAGTQPAGAGNAKTLDTINVSAPMLKDVKTSEVGNVVSLHQIEQLPQATRNFLEFAD
FT                   TVPGMVFQVDGNGNTKLRGGASNASAGNLYIDGVGQKSYVKGGGIAGQSDTQGNPFPQL
FT                   AIGEYKVITSNYKAEYGQISGAAITAATKSGTNEFHGETFYRYTDQDLRDKRPDEEANG
FT                   KIDSQTKEYGFALGGPIIQDRMHFFVAYEGKENVVPKSVQADANAQPYIGLLPSTISSQ
FT                   YGAANMPFSEDLYFGKLDFEPTDRDRIELSGQYRNESQVGNVGGTSALDHGTNKINKDK
FT                   RANLRWQHSADNWFNELIVGTENSQNNPNPKSIGNGIVYKYLNYNDPNIGEYTFLETGS
FT                   AGGLNVQRKSQKGWFLQNDLTLTSFQWHGEHTIKMGVSYKDIKLISQDAAALNPQFSYS
FT                   VDANGVAAIPYRVDFIAPYNTPGQKATVESPSKQYGVYLQDDWAATDKLMVNAGVRWDY
FT                   EKSPAYTNFVTSPAFVNALYSDDPANPGQPWANRLLPSGINVADYISNGHNRKNFKDGW
FT                   APRLGFSYDFFGDQSAVLHGGAGRSYDRNLFEQLALETSKAALSPVAVYFKNSATGSCY
FT                   KADRACAVWDPKYLNGVDQLNTIPGVSGSAELFMFNNRLKTPYSDQYSLGISNQVGDWL
FT                   TDVTFQRVLSYDGFAMSLINRYPNGAFFDATGSAPWGEPVPGYQNTILGMNGLEQRSSQ
FT                   VLLSAEKPYTKESGWGLTLSYTHTSARQNRNIDEPYAFDKATIHDYPFVKSDAVAGHRF
FT                   VASGSIDGPWGVTFGAKLVLATPNPVNTIACYGKVDADGAQCQQIGFVPPGSGRFLVGG
FT                   KIWGYRTVDFQATKEFTVYNDVKLSARINLLNAFNFKNYSSYIYGGPNGTGDYFGTGGR
FT                   LDTSYVGLNRTGDINYVPRTVTFEVGAKF"
FT   gene            60476..61993
FT                   /locus_tag="XALC_0046"
FT   CDS_pept        60476..61993
FT                   /transl_table=11
FT                   /locus_tag="XALC_0046"
FT                   /product="putative tryptophan halogenase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14592"
FT                   /db_xref="GOA:D2U8F8"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR033856"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14592.1"
FT                   /translation="MIAAPLRNLVIVGGGTAGWMAAAALARMLGADNRITVIESEQIGT
FT                   VGVGEATVPHIKAFNTLLGINEAEFVRDTQGSFKLGIEFVDWLRPGIAYVHGFGSEIGH
FT                   RLGLLPFQQYWFKQALAGKASPLGDYTLNTVAAKRGKFMTAASDVPPNSPLANIAYAYH
FT                   FDAALYAQFLRRYAEQRGVIRYEGIVEQVLLHPESGDVASVRLVSGEVIAGDLFIDCSG
FT                   FRGLLIEQALHTGYHDFSHCLPCDRALAVPCAKIGPPTPYTRATARAAGWQWRIPLQHR
FT                   TGNGYVYSSAHVSDDEAAATLLANLDGPALAEPRPLRFVTGRRKQAWNRNVIALGLASG
FT                   FMEPLESTSIHLIQSGISKLLELFPREGISPVLVQRYNERIAFEFDRIRDFLVLHYHAS
FT                   ERADSAFWQQCRGMSIPAELQATLDLFRDSGRFYRNGEEMFAEISWVQVMVGQGILPRA
FT                   YHPLVDQVPVADLERFMLSVAQTIGHCADAMPPHQAFIDRYCAAAPG"
FT   gene            complement(62193..62927)
FT                   /gene="pyrF"
FT                   /locus_tag="XALC_0047"
FT   CDS_pept        complement(62193..62927)
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="XALC_0047"
FT                   /product="probable orotidine 5'-phosphate decarboxylase;
FT                   protein"
FT                   /function="metabolism go:0008152; pyrimidine biosynthesis
FT                   go:0006221"
FT                   /EC_number="4.1.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14593"
FT                   /db_xref="GOA:D2U8F9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8F9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14593.1"
FT                   /translation="MSRAPLALEAHERLIFALDVPGRADALAWIERLGDAVTFYKIGME
FT                   LLASGEYFDVLDTLATRGKRVFVDLKFFDIPATVGGVIRRLSQWPVDYCTIHGWHPAMM
FT                   QAAAEANGSDMRLLAVTVLTSMGRADLAAMGIDRAPEDVVVERALAAQAAGIDGVIASG
FT                   QEAASIRRATGPGFSIVCPGIRPGGPVGDDQQRTVGVARAFADGADAIVVGRPIRQAPD
FT                   PRAAAVAIQQEIAATLSGTASK"
FT   gene            complement(62924..63805)
FT                   /locus_tag="XALC_0048"
FT   CDS_pept        complement(62924..63805)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0048"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14594"
FT                   /db_xref="GOA:D2U8P3"
FT                   /db_xref="InterPro:IPR005519"
FT                   /db_xref="InterPro:IPR006423"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8P3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14594.1"
FT                   /translation="MSPITRTALACAVIALSACKPQAPATDASTSATAPGTADDNLNAV
FT                   LWMQRSVEYRAAAEQTYRAATERLDAALQDPTWNALVPEERGNASATLKPAVVMDVDET
FT                   VLDNTPYLARLIRSGKEYGAASWDQWVREKKAKAVPGAVDFAKAATAKGITVLYVTNRG
FT                   VHLNDATLVNLRKAGLPVADNSVLLGLGTVVKDCKQSGSEKHCRRQLVGQQYRVLMQFG
FT                   DQLGDFAQVLANTPENREHLFQQYHTWFGMRWWMLPNPSYGSWEPALFNNDLAQPRAAR
FT                   HQAKLDALEVAQ"
FT   gene            64082..65263
FT                   /locus_tag="XALC_0049"
FT   CDS_pept        64082..65263
FT                   /transl_table=11
FT                   /locus_tag="XALC_0049"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14595"
FT                   /db_xref="GOA:D2U8P4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8P4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14595.1"
FT                   /translation="MQHHDEASFDTPPDAAYAAQLRKGFAALRFDPALERVYHRHSSAT
FT                   LGFAQRLAASLAVLLVLLLLSWEALYFGPSDVGGLIGHTVAVRMASLLLLLWVALSIHC
FT                   ARSHGPARIALLLLIVGTGLVLSSVGYPLQELRYAVVVIALIIMAGFLPLGLTLWQSVG
FT                   VALALCAISAAAGRLLLDGPAQAGYLRLQWLLWAAVLVGVVGGYLREHARREEFLQQRI
FT                   RDDEALRDVLTGLGDRRRFDEHLALALAESTRLQLGLALILVELEGFAEFARRHGPREA
FT                   DRAVLDVAEAMQCLLRPLDVVMRIGADRFGLVLYDANAAHLRQMAPALRDMVDIMASAD
FT                   TGMVSAPLSIRVGALLATPAVTATALMQHAEALLQRARIGGGNQVVLDPETGW"
FT   gene            complement(65460..66608)
FT                   /locus_tag="XALC_0050"
FT   CDS_pept        complement(65460..66608)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0050"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14596"
FT                   /db_xref="GOA:D2U8P5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8P5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14596.1"
FT                   /translation="MLHRFHEQMIESRTKQLAAPCGYNHRTAHSDRSGNLGSHSLCAAL
FT                   LIVIVGFFTVLGPATATERAASETAAEQAARLPLWPGPAPGTSSAPQTLRIVDHSANPA
FT                   LPDRLISGHYQPYMVVYRPKKPNGSALLVAPGGGYVCIALDKEATDLLPIFAEQAGITL
FT                   FVLRYRLPDAEADDNAAVRDQPLADAQRALRLIRAHAADYGVDPHRIGTMGFSAGGHVA
FT                   ASLGTRYAERVYPSGDAIDQVSARPDFLLLIYPVIDMGSGTTAHTGSRLRLLGRHPDAT
FT                   TMAAYSLQNRVNAGMPPTFQVHAQDDPVVPVENSLLFYQALRQAGVPAELHVFAHGGHG
FT                   FGTRSIAGLPLAAWPGLALTWMRTIQDDPRERAPIPPSVGKH"
FT   gene            67820..68494
FT                   /locus_tag="XALC_0051"
FT   CDS_pept        67820..68494
FT                   /transl_table=11
FT                   /locus_tag="XALC_0051"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14597"
FT                   /db_xref="GOA:D2U8P6"
FT                   /db_xref="InterPro:IPR005534"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8P6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14597.1"
FT                   /translation="MKVVVIKGASLVVLGLAITSCATESHQSVAPQTVAAANIPYSGAR
FT                   APIAVGKFDNRSSFMRGLFSDGADRLGSQAKTILITDLQQTNRFRVLDRDNMGEIKQEA
FT                   DIKRQAQQLKGADYVITGDVTEFGRKEIGDTQLFGIMGRGKQQQAYAKVSLNVVDSTTS
FT                   EVVYSVQGGGEYSLSNREIVGFGGTSSYDSTLNGKVLDLAIREAVNRLTAAIDSGAWKP
FT                   VK"
FT   gene            68566..68886
FT                   /locus_tag="XALC_0052"
FT   CDS_pept        68566..68886
FT                   /transl_table=11
FT                   /locus_tag="XALC_0052"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14598"
FT                   /db_xref="InterPro:IPR014508"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8P7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14598.1"
FT                   /translation="MTLVGCAHQSASLYQWGSYQDQVYSHFKGGSPEQQIQALEKDLQV
FT                   MKAANRRPPPGLQAHLGMLYAETGNDAKAQQYLLAEKAQYPESTTYIDLLMKNGHKERT
FT                   AQ"
FT   gene            68883..69548
FT                   /locus_tag="XALC_0053"
FT   CDS_pept        68883..69548
FT                   /transl_table=11
FT                   /locus_tag="XALC_0053"
FT                   /product="hypothetical lipoprotein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14599"
FT                   /db_xref="InterPro:IPR008517"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8P8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14599.1"
FT                   /translation="MKNIAKVACVAVLGLLLSACATQPKSRDYSAYKASKPRSILVLPP
FT                   VSHAPDVDASLSVLSVTTLPLAEAGYYVMPVAPVYETFKQNGITIADDAQAVAPEKLRQ
FT                   IFGADAALYITIDKYGAVYQVVNSVVTVAANAKLVDLRTGTVLWEGKATASSDENKKVS
FT                   VGGGGVLGILVSAAINQVINQATDQSHQVGNMASQRLLSAGYPGGLLYGPYNAKYGTD"
FT   gene            complement(69609..70499)
FT                   /gene="phhA"
FT                   /locus_tag="XALC_0054"
FT   CDS_pept        complement(69609..70499)
FT                   /transl_table=11
FT                   /gene="phhA"
FT                   /locus_tag="XALC_0054"
FT                   /product="probable phenylalanine-4-hydroxylase protein"
FT                   /function="metabolism go:0008152; phenylalanine, tyrosine
FT                   degradation go:0006559 go:0006572"
FT                   /EC_number="1.14.16.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14600"
FT                   /db_xref="GOA:D2U8P9"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8P9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14600.1"
FT                   /translation="MDIAPRRVEHQHTDKGYVPVYTTTVVAQPWDRYDADDHATWGTLY
FT                   RRQRELLVGRACDAFLQAQDTMGMSPQAIPKFDQLNTVLAATTGWTLVGVEGLLPELDF
FT                   FDHLANRRFPVTWWIRRPGQIDYIAEPDLFHDLFGHVPLLMNPRFADYMQAYGRGGVKA
FT                   HAIGPQALQHLTRLYWYTVEFGLIDTPAGLRIYGAGIVSSKGESLYALESDAPNRIGFD
FT                   LQRIMRTRYRIDTYQKTYFVIDSFAQLMQATAPDFTPIYTALADQTHLPAGQVQPDDRV
FT                   LQRGSGKGWGDSDDV"
FT   gene            70625..71107
FT                   /locus_tag="XALC_0055"
FT   CDS_pept        70625..71107
FT                   /transl_table=11
FT                   /locus_tag="XALC_0055"
FT                   /product="putative transcriptional regulator, asnc family
FT                   protein"
FT                   /function="transcriptional level go:0006355"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14601"
FT                   /db_xref="GOA:D2U8Q0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14601.1"
FT                   /translation="MTESAVFDRTDLRLLTLLQRQGRASNAELAAQVNLSPSACLRRVQ
FT                   RLEAEGVVAGYVARLSPSAIGLGLQAFVRVQLEKHGQSGIAHFADSVQGWDEVVACHAL
FT                   TGDMDYLLHVYVRDLAHFSAFLLDKLLNDAAGVADVNSCFVLRTVKEFGGLPLPRV"
FT   gene            71207..71767
FT                   /locus_tag="XALC_0056"
FT   CDS_pept        71207..71767
FT                   /transl_table=11
FT                   /locus_tag="XALC_0056"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14602"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q1"
FT                   /protein_id="CBA14602.1"
FT                   /translation="MWLGVFIGSVCRDRNERHNFFKESVKMKFPRDLKFVPFTLAVLAG
FT                   NVVANAQAEPEKITTTTTRVVEATYLPGSKEVRQIQQWLLLHADPTGKMAGNPRNLGTV
FT                   TVKYTDVIVAQGKAAIDVAAPPPVPLPSTGVPGGTFSVSTCGGGEAQSWTYAWVANSSG
FT                   GSWVPTDYHTYRAPACSSNNSGH"
FT   gene            complement(71991..73532)
FT                   /locus_tag="XALC_0057"
FT   CDS_pept        complement(71991..73532)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0057"
FT                   /product="putative mannitol dehydrogenase protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="1.1.1.57"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14603"
FT                   /db_xref="GOA:D2U8Q2"
FT                   /db_xref="InterPro:IPR000669"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q2"
FT                   /protein_id="CBA14603.1"
FT                   /translation="MLPRLGSATLHTLPLAITRPSYALDRVRIGIVHLGAGAFHRAHQA
FT                   VYLDDLLASEPDWAISAVSLHNPQVRDALCAQDGLYTLALLDAQPELRVIGAIREVLCA
FT                   QDQQAAVLARLTDPAVRLVTLTVTEKGYCLTGEHLDLAHPDIAHDLAAPHAPRSAIGYL
FT                   VAGLRQRWRLRLAPYTVLSCDNLHDNGGKLRRAVLRFAHHIDPALAAWIEAEASFPRSM
FT                   VDSITPASDAALRERIATQLGYDDAWPIQRERYSQWVIEDRFCNGRPAFERVGVTLSED
FT                   IGGFDRAKLRLLNGPHSALAYLGTLLALETVADAMCDTPLATFIETLMREDITPTLPAL
FT                   SGFDPQRYIDAILTRFRNPAIAHKLAQIAWDGSQKLPVRLLGTLADALAAGHRIDRLCL
FT                   PLAAWMHFVRHQAHRDVPLIDPLQETLREIGRAAGSDDVQDVDAFLTLDTVFAPLSKDR
FT                   RFVDALQRAYASLGDGSAAETRETLVLMLNHAVISGCPCSTDLGSGETSPPGLLR"
FT   gene            complement(73578..76322)
FT                   /locus_tag="XALC_0058"
FT   CDS_pept        complement(73578..76322)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0058"
FT                   /product="putative beta-glucosidase protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14604"
FT                   /db_xref="GOA:D2U8Q3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR011658"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="InterPro:IPR037524"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14604.1"
FT                   /translation="MHSNDSHRALRTVLATSVLLALAPAASIAAPPPYLDSQRTFAQRA
FT                   DDLVARMTLEEKVAQMQNAAPAIPRLGVPAYDWWNEGLHGVARAGGATVFPQAIGLAAT
FT                   FDLPLMHEVSTAISDEARAKHHEALRRGEHGRYQGLTFWSPNINIFRDPRWGRGQETYG
FT                   EDPFLTARMGVTFVQGMQGEGADAPKNAQGETYRKLDATAKHFAVHSGPESERHHFDAR
FT                   PSQRDLYETYLPAFEALVKEGKVDAVMGAYNRLFGESASASKFLLRDVLRERWGFHGYV
FT                   VSDCWAIVDIWKNHKIVATREQAAALAVKNGTQLECGQEYATLPAAVQQGLIGETDIDA
FT                   ALRTLMTARMRLGMFDPPGQLRWAQLPISVNQSPEHDALARRTARESLVLLKNDGLLPL
FT                   SRAKHKRIAVIGPTADDTMALLGNYYGTPATPVTILQGIRAAAPDADVLYARGADLVEG
FT                   RSDPAATPLIEAQYLRPSSDSAERGLRGEYFRNPDLSGTPTLVRVDPQIGFRWDRGSPT
FT                   DTLLARGEVGPQQTLPTNHFSIRWTGKLVPPVSGTYHLETAADDGVRLFLDGKRLIDRW
FT                   TPSDRLQSDGVDVQLQAGHVYDLRLEYYEAEHDAAVRLAWRVPGAKPPLQEALDTARRA
FT                   DVVVFVGGLTGDVEGEEMKVNYPGFAGGDRTDLRLPKPQRELLQALSATGKPVVAVLTT
FT                   GSALAIDWAQEHVPAILLAWYPGQRGGSAVADVLFGDTNPGGRLPVTFYKASETLPAFD
FT                   DYAMRGRTYRYFAGTPLYPFGHGLSYTQFAYSDLRLDRRKVAADGQLSATLKVTNTGTR
FT                   AGDEVVQLYLHPLAPTRARAIKELRGFQRIALAPGESRDVHFTISPQTDLRIYDEAQKH
FT                   YVVDPGDYELQVGASSADVRVRERFSVQPASTAASSSHPHPHR"
FT   gene            complement(76325..77980)
FT                   /locus_tag="XALC_0059"
FT   CDS_pept        complement(76325..77980)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0059"
FT                   /product="putative xylan 1,4-beta-xylosidase protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="3.2.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14605"
FT                   /db_xref="GOA:D2U8Q4"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q4"
FT                   /protein_id="CBA14605.1"
FT                   /translation="MLAALSAAATTPTVAFDWFAYRGDDAVFDTPLPPGHYRNPVLAGF
FT                   YPDPSVTRVGAHYYLVNSSFAYFPAIPVFESRDLVHWRQISNVVERPEQLDFDGLDVSR
FT                   GMFAASIAQHRGRFYVVGTAVDSGGNFIATANDPAGPWSPLHWLPDIDGIDPSLFFDED
FT                   GSAYLLNNGPPVGTPRYAGHRAIWMQRFDLTRMQPVGPRQVLVDGGADPASKPIWIEGP
FT                   HLYKHDGWYVLSCAEGGTAAQHSQVALRSRTLWGPYQPAPHNPILTQRDLPAGRAHPVS
FT                   NAGHADLVEGPDGRWWAVFLASRPYAQNRYNTGRETFLLPVTWQDDWPSILPAGQPIAY
FT                   VVPGLAALDDAHAADIAPLSGNFVWRDDFDAPQRNRRWLLLRTPKRAWLDLRTRPGWLT
FT                   LQPDTQGLEGSGNPAFLAYRQQHTRFDASVALQLPTPPSVVAGLAAFQNANAWYVLGVH
FT                   RHGGSIEAFVEKRDGKHSHVLARTTLHAKGVLRLKIAGDGGRYSFAIASEGQDWRWLRR
FT                   NDDAAMLSTALAGGFVGTMLGPYARREPDRPTEH"
FT   gene            complement(78034..79293)
FT                   /gene="rspA"
FT                   /locus_tag="XALC_0060"
FT   CDS_pept        complement(78034..79293)
FT                   /transl_table=11
FT                   /gene="rspA"
FT                   /locus_tag="XALC_0060"
FT                   /product="probable starvation-sensing protein"
FT                   /function="cell processes go:0009987; starvation response
FT                   go:0042594"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14606"
FT                   /db_xref="GOA:D2U909"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D2U909"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14606.1"
FT                   /translation="MTQISARASSPQGSAHDREIVEARVIVTCPGRNFVTLKIVTRSGV
FT                   YGLGDATLNGRELAVASYLQDHVVPNLIGRDAGRIEDLWQFLYRGAYWRRGPVTMTAIA
FT                   AVDVALWDILGKMAGMPLYQLLGGRSREGALVYGHANGRDIAETSEEVGRFRELGFIAI
FT                   RAQCGVPGVKKAYGISSGGKPYEPAESELPAETLWSTPRYLSLVPALFERLRADHGEDV
FT                   QLLHDAHHRLTPIEAARLARDLEPYRLFWLEDATPAENQRAFELIRQHSVTPLAVGEVF
FT                   NSIWDCKHLIEQQLIDYIRTTLVHAGGITHVRRLADFAALHQVRTGFHGATDLSPVCMG
FT                   AALHFDTWVPNFGIQEYMFHSDEANAVFPHDYSFHAGRLHCGETPGHGVDIDEALAARY
FT                   PYAPKQLPIARLEDGAMWDW"
FT   gene            complement(79290..81314)
FT                   /locus_tag="XALC_0061"
FT   CDS_pept        complement(79290..81314)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0061"
FT                   /product="putative hydrolase protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14607"
FT                   /db_xref="GOA:D2U910"
FT                   /db_xref="InterPro:IPR005181"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="InterPro:IPR039329"
FT                   /db_xref="UniProtKB/TrEMBL:D2U910"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14607.1"
FT                   /translation="MTLHRDALQTARCLLLAALCAPAFAQAEKTAQTSQAPLLHALFQD
FT                   HAVLQRDAPIRVWGEATAGETVTVELAQQHVQTRADRQGHWQAQLPALPAGGPYTLQAS
FT                   TAHGRTQRADDVLIGDVWLCSGQSNMELPVQRTLDTRNEIADAKQPTIRMFKVPAQSSA
FT                   VPQAQFGGASAWQPTTPETVGAFSAACYYFARELRKRVDVPMGLINASWGGSQIQAWIG
FT                   DAALRKVDGNAPALDVLARYAKDPQQAAPRWGSLWETWWRAHGIGAPWQPGDTGTDWRD
FT                   APTTLGAWDDWGVPQLVNFIGMVWYRTTVTLSAAQAAQQATLVLGPVDELDQTWVNGQA
FT                   IGSSYGADEPRRYPLPRGVLHAGQNTVVLNVYNSYRRGGLLGGPFAQLLEMGDGSRVAL
FT                   GKQWQYSIVPPRLGTPPRAPWSSAAGLTTLYNGMIVPLGRVGLRGVLWYQGESNTSDAA
FT                   HYPALLDAWQRDWRQRFGAALPLLVVQLANYGAPPVRPGESGWAQLREAQRRFVAGDPH
FT                   AGLAVTIDIGNRYDIHPANKQELGRRLARAARHLIYGETLPPSGPIPRRVQREGQALRI
FT                   DFDDVDGALETYSSDAPIGFELCGAAADSCHYAQAELQAHSVRLPLPAGTVPVRVRYCW
FT                   ADSPVCTLFDHAGLPAGPFELPVPSVASAATALSVSAPR"
FT   gene            complement(81311..83665)
FT                   /locus_tag="XALC_0062"
FT   CDS_pept        complement(81311..83665)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0062"
FT                   /product="putative alpha-glucosidase precursor protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14608"
FT                   /db_xref="GOA:D2U911"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR011395"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:D2U911"
FT                   /protein_id="CBA14608.1"
FT                   /translation="MLCKHWARSGLSWVNPVSWHPVSRDGSGHARCPHGTGKRPTRGCA
FT                   PPPVASAVERARMSGAAAPRRRWYRHWGWLCLALLLPMSTLRAEDGYALWLRYPALAQA
FT                   QAAPWRAYATELIANADTPLQQAARAELQRGLAGMLGAAPPLATTVHRAGALVLGTAAS
FT                   PAIARLRLDTRGLGEEGYLIHSVVIDGRPATVLVGGGERGVLYAAFGFLRLLQTGQAPT
FT                   PLHLRDAPRVQLRMLDHWDNLDGFVERGYAGASLWNWHALPEHVDPRYTDYARANASVG
FT                   INGAVLNNVNANAISLTAPYLDKAAALAAVLRRYGIRLYLSARFSAPIEIGGLTTADPL
FT                   NPAVRRWWRAEADAIYARIPDFGGFLVKANSEGQPGPQDYGRSHADGANMLADALAPHG
FT                   GVVIWRAFVYAHPHAHPGDRAKQAYNEFVPLDGKFRDNVLLQVKNGPIDFQPREPFHPV
FT                   FGAMPRTPLMLEFQITKEYLGFATHLAYLGTLYQETLQADTRRGKRATVARIVEGALDR
FT                   HTRSGIAGVANIGADRNWCGSIFDQANWYAFGRLAWNPQGNARSIAEEWVRMSFGNDPA
FT                   LVAPVVDMMMASREAVVDYMTPLGLHHLMGRGHHYGPAPWDAGSVRADWDPVYYHRADR
FT                   NGIGFDRSATGSDAVAQYAPPLARRFSDVRRVPERYLLWFHHVSWDHRMHSGRSLWEEL
FT                   IAHYDHGVAEVARMRATWAGLAPYVDAQRYRQVADFLVIQQREAQWWRDASIAYWQQVS
FT                   GRALPPGVVPPAHPLAYYQSLSFPNAPGNPK"
FT   gene            83680..84753
FT                   /locus_tag="XALC_0063"
FT   CDS_pept        83680..84753
FT                   /transl_table=11
FT                   /locus_tag="XALC_0063"
FT                   /product="putative transcriptional regulator, laci familiy
FT                   transcription regulator protein"
FT                   /function="transcriptional level go:0006355"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14609"
FT                   /db_xref="GOA:D2U912"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D2U912"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14609.1"
FT                   /translation="MEKVRKAVRRKSHAVTIDEVAALAKVSPMTVSRVINGQGNVRDST
FT                   RTQVMRAVDKLGYTPNLAASALAAAQNTRVALIYSNPSGAYLGDLLVGVLRAASRTSIQ
FT                   LIIDYWEDLGADAERKAVRKLAKGVSGVILPPPLCESEAAVRELLRAKVPMVAIASGRF
FT                   SEAMPSVHIDEFRASQDITAHLIAHGHSRIGYIAGHPNLSASARRFDGFQAALRVAGLR
FT                   LDKALLQQGDFTYRSGLEAAEKLLARRAPPTAIVASNDDMAAAAVSVAHRRGLEVPRDL
FT                   SVVGFDDTSAATTVWPELTTVRQPIAAMADAAIDLLLRRLRSKECESGGHHDHVFAHQL
FT                   VERDSVAAPTTARANKR"
FT   gene            complement(84782..86122)
FT                   /gene="xylA2"
FT                   /locus_tag="XALC_0064"
FT   CDS_pept        complement(84782..86122)
FT                   /transl_table=11
FT                   /gene="xylA2"
FT                   /locus_tag="XALC_0064"
FT                   /product="probable xylose isomerase protein"
FT                   /function="metabolism go:0008152; xylose catabolism
FT                   go:0042843"
FT                   /EC_number="5.3.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14610"
FT                   /db_xref="GOA:D2U913"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D2U913"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14610.1"
FT                   /translation="MSNSVYIGAKEYFPGIGRIPFEGKASDNPLAFKVYDADKQLGGKS
FT                   MAEHLRFAVAYWHSFCGNGADPFGPGTRAYPWDAGSDALARAEAKADAAFEFFTKLGVP
FT                   YYCFHDVDLAPDAEAIGQYEKNLQHMVGIAKQRQADTGIKLLWGTANLFSHPRYMNGAA
FT                   TNPDFDVVARAAVQVKAALEATVALGGENYVFWGGREGYACLHNTQMRREQEHLARFLT
FT                   LARDYGRSIGFKGNFLIEPKPMEPMKHQYDFDSATVVGFLRQHGLDQDFKLNIEANHAT
FT                   LSGHSFEHDLQVASDAGLLGSIDANRGNPQNGWDTDQFPVDLYDTVGAMLVVLRQGGLA
FT                   PGGLNFDAKVRRESSDPQDLFVAHIGGMDAFARGLEVAHALLTSSPLEQWRKARYASFD
FT                   SGAGAAFAAGKSTLAELAAHAGKVGEPTQRSGRQEAYENLINQYLLR"
FT   gene            86572..87435
FT                   /locus_tag="XALC_0065"
FT   CDS_pept        86572..87435
FT                   /transl_table=11
FT                   /locus_tag="XALC_0065"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14611"
FT                   /db_xref="GOA:D2U914"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D2U914"
FT                   /protein_id="CBA14611.1"
FT                   /translation="MSSPLPLPQRLADPASPARSPSSALGKRLCRQVGQAIADFGMIAA
FT                   GDKVMVCLSGGKDSYTLLDILLQLQRKAPVPFELVAVNLDQKQPGFPADVLPDYLRKRG
FT                   VAWDVIEQDTYSVVTRVVPEGKTLCSLCSRLRRGALYRYAAEHGISKIALGHHCDDMVA
FT                   TFFMNLFFHAKLAAMAPLLRSDDGQHVVIRPLAYVREHDIAAYAQARHFPLIPCTLCGS
FT                   QETLQRRQVGLMLQQWDREHPGRVEQIARAMGNVQPSQLADRVLFDFAALGGGAPVTAW
FT                   VDDSPA"
FT   gene            87550..88458
FT                   /gene="rdgC"
FT                   /locus_tag="XALC_0066"
FT   CDS_pept        87550..88458
FT                   /transl_table=11
FT                   /gene="rdgC"
FT                   /locus_tag="XALC_0066"
FT                   /product="probable recombination-associated protein rdgc."
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14612"
FT                   /db_xref="GOA:D2U915"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:D2U915"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14612.1"
FT                   /translation="MFFRNLTLFRFPTTLDLSEIDTRLPEARLKSVGPLEMSSRGFISP
FT                   FGREEQEALSHRIADFLWLTVGGEDKILPGSVVNDLLARKVAEIEEKEGRRPGGRARKR
FT                   LKDDLIHELLPRAFVKSSRTDAMLDLQHGYVAVDTSSRKSGETVMSEIRGLLGSFPALP
FT                   LNAEVAPRAILTGWIAGEPLPEGLSLGEECEMKDPIEGGAVVKCQHQELRCEEIDKHLE
FT                   AGKQVTKLALVLDEHVSFVLGDDLVIRKLKFLDGALDQLEHADQDGVRAELDAHFALMS
FT                   GEVRRLFLLLEDALKLSKAES"
FT   gene            88534..89313
FT                   /locus_tag="XALC_0067"
FT   CDS_pept        88534..89313
FT                   /transl_table=11
FT                   /locus_tag="XALC_0067"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14613"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:D2U916"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14613.1"
FT                   /translation="MPTFLRRLLAPPHAAVERDLVRLRLDEREIEVLRVRDPRARRIKL
FT                   SVDERGARLTLPLRASLVAGERFLLEHRQWLDTQLARYRDEDSTPGLQRGVPGWLPLRG
FT                   ERLPLRWSEGRYARLQVDAQGAELQVPARAGDAVIARTLREFYESQARADLGRWLPIYL
FT                   PSLPRTPARIRLKVMSSQWGSLAPDGTMALDLALVLGRSSAFEYVLVHELCHLLQANHS
FT                   PAFWREVEARFPDWKAERTYFHAHGRCLKAQLRRLLG"
FT   gene            complement(89691..90533)
FT                   /locus_tag="XALC_0068"
FT   CDS_pept        complement(89691..90533)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0068"
FT                   /product="putative hydrolase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14614"
FT                   /db_xref="GOA:D2U917"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2U917"
FT                   /protein_id="CBA14614.1"
FT                   /translation="MSARAITCPSRVGRLAGLRSGDPQGPKVLALHGWLDNAASFVPLS
FT                   AHLPQLDLVMLDLPGHGHSAALPEGGEYLLFSSLHPVLDAADALGWERFVLIGHSMGAA
FT                   IASLLAAAMPQRIDKLVAIEMLGGLAESEANAVQRLRDSVAKGRQPNATPLRVFPDLAA
FT                   PVRARMRANQLSEPAARLLVERGVRAVDGGYVWRSDRRLTQPTPIRQTESQVQALLTGI
FT                   HCPALVVFADPAQAILPEAVRLQRAAQLRDGRVHTLPGTHHLHMEQPAAVAALLHAFL"
FT   gene            complement(90530..91489)
FT                   /gene="hemH"
FT                   /locus_tag="XALC_0069"
FT   CDS_pept        complement(90530..91489)
FT                   /transl_table=11
FT                   /gene="hemH"
FT                   /locus_tag="XALC_0069"
FT                   /product="probable ferrochelatase (protoheme ferro-lyase)
FT                   (hemesynthetase) protein"
FT                   /function="metabolism go:0008152; heme, porphyrin
FT                   go:0006783 go:0006779"
FT                   /EC_number="4.99.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14615"
FT                   /db_xref="GOA:D2U918"
FT                   /db_xref="InterPro:IPR001015"
FT                   /db_xref="InterPro:IPR019772"
FT                   /db_xref="InterPro:IPR033644"
FT                   /db_xref="InterPro:IPR033659"
FT                   /db_xref="UniProtKB/TrEMBL:D2U918"
FT                   /protein_id="CBA14615.1"
FT                   /translation="MSNAPETAVLVVNLGTPEAPTAPAVARYLAEFLGDKRVVAIPRLF
FT                   WWPLLHWVILPRRSPKSAEKYAQVWLPDGSPLAVYTRRLAEGMQRALPDHKVAWAMRYG
FT                   TPALAPTLDALRDAGVRRIVVLPLYPQYSTTTTASIEDVVQVWQARNPQLPVRLIEDYP
FT                   TDPTWVEAVAASVRAHWAQHGRGEMLFFSFHGLPQRVANNGDPYPQRCEASAQAIAAAL
FT                   GLDASQWQLGYQSRFGAERWLRPYAEPRLWELAAQGIQRVDVLCPGFATDCLETLEEVA
FT                   MGFVETCAERGMQVRYIPCLNDSAAHAHALAQLAIRAA"
FT   gene            91660..92577
FT                   /locus_tag="XALC_0070"
FT   CDS_pept        91660..92577
FT                   /transl_table=11
FT                   /locus_tag="XALC_0070"
FT                   /product="putative secreted protein precursor"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14616"
FT                   /db_xref="InterPro:IPR007461"
FT                   /db_xref="UniProtKB/TrEMBL:D2U919"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14616.1"
FT                   /translation="MPRLPRLALLLSTILFAGHAMAGPEEDERARNALRVLSEIQKIPE
FT                   QAIPDRLLDEGRAIVVIPDTLKVGMVFGGRRGHGLMSVKRPDGTWSNPVFVKLTGGSVG
FT                   FQIGVQSSDVVLVFRNDRSLDNIVNGKFTLGADAGVAAGPVGRNASAATDGQLKAEIWS
FT                   WSRARGLFAGVALDGAALQIDDAADLNAYGSNSTPRMIFEGRTASRPSNDIVAFRDKLE
FT                   EVSYAARQTRRNSKDSDDSDTVPASAAPAPTPARQAAVEPAVGLPADNASTAPLQAPSH
FT                   VPQKQGFQPVSDGEVRTEPLNGNH"
FT   gene            92718..92948
FT                   /gene="tatA"
FT                   /locus_tag="XALC_0071"
FT   CDS_pept        92718..92948
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="XALC_0071"
FT                   /product="probable sec-independent protein translocase"
FT                   /function="the type v secretory pathway or twin arginine
FT                   targeting (tat) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14617"
FT                   /db_xref="GOA:D2U920"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D2U920"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14617.1"
FT                   /translation="MGSFSIWHWLVVLVIVLVIFGTKRLTGGIKDLGSAVKEFKKGMRE
FT                   DDDKPAGQLADASRSSEPARQTQAEHDRDAH"
FT   gene            92963..93502
FT                   /gene="tatB"
FT                   /locus_tag="XALC_0072"
FT   CDS_pept        92963..93502
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="XALC_0072"
FT                   /product="probable sec-independent protein translocase"
FT                   /function="the type v secretory pathway or twin arginine
FT                   targeting (tat) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14618"
FT                   /db_xref="GOA:D2U845"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D2U845"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14618.1"
FT                   /translation="MFDIGFSELLVIAVVALVVLGPERLPKAARFAGLWVRRARAQWDS
FT                   VKQELERELEAEELKRSLRDVQASLRQAETQLRDSGQQLQRETDALRREIDPTTPNPDP
FT                   STGIAEPPLHTALAAATVETVETALPVSKSAVEPPPQPAAPVSSGAQGLTAHPKTADTP
FT                   LSPPVQPPSADPTAPR"
FT   gene            93499..94242
FT                   /gene="tatC"
FT                   /locus_tag="XALC_0073"
FT   CDS_pept        93499..94242
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="XALC_0073"
FT                   /product="probable sec-independent periplasmic protein
FT                   translocase"
FT                   /function="the type v secretory pathway or twin arginine
FT                   targeting (tat) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14619"
FT                   /db_xref="GOA:D2U846"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:D2U846"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14619.1"
FT                   /translation="MNPEAESSLIEHLIELRARLMRALIGLGVVVVALLPFSKRIYTWL
FT                   AAPMLAQLPVGQSVIATHPAGAVIAPLKLAFFLGIFIAAPWLLYQAWAFVAPGLYQREK
FT                   RLALPLLASAVLLFYLGCAFAYFLVLPAVFHFLTTFKPDVIQLTPDAGSYLDFVLAIFF
FT                   AFGASFELPVALVILALLGWVTPSQLREGRGYAVVGIFVLAAVLTPPDVVSQLMLAIPM
FT                   CLLYELGIIAASAVTKQPSEMQIRD"
FT   gene            complement(94358..95257)
FT                   /locus_tag="XALC_0074"
FT   CDS_pept        complement(94358..95257)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0074"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14620"
FT                   /db_xref="GOA:D2U847"
FT                   /db_xref="UniProtKB/TrEMBL:D2U847"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14620.1"
FT                   /translation="MIEIRKLPASAGAHWLLSGMSLLRRAPWALGRLGAIWGLALVIAV
FT                   FMGVLNPTLGMLAQLLLGLAGPLLFGGLVWAAREVDQGRRAQPAHLLQGLHAGRAPNLL
FT                   VALLPQLVVVLALGILALVVVGPSGWEQMATVMNKLNELSQSNAQPDPAQVEQLVETLP
FT                   AMRILVWLLLVAVGFVMVMLTLFLFAPQVMFDGRNGLTAMRHSLRACLHNVPAMLVFCV
FT                   LAFIATFALYFVLALVMLLLQVIVGAMVATLVTQVLLMALVMPALAGMVYTAWKQMFGH
FT                   PDHPATAVPQPPSNVFVA"
FT   gene            complement(95333..96064)
FT                   /locus_tag="XALC_0075"
FT   CDS_pept        complement(95333..96064)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0075"
FT                   /product="putative glutamine amidotransferase protein"
FT                   /function="metabolism go:0008152; purine biosynthesis
FT                   go:0006164"
FT                   /EC_number="6.3.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14621"
FT                   /db_xref="GOA:D2U848"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2U848"
FT                   /protein_id="CBA14621.1"
FT                   /translation="MFRMSATPFLILETGEPVPTMRRYGRFPHWIRVAAGLAEREIVVA
FT                   NVAAGAALPDRRDFVGVIITGSAAFITDRADWSERSADWLREAAHAGMPLLGICYGHQL
FT                   LAHALGGEVAYNPAGRESGTVQIALHPPAADDPLFCGLPEHFAAHATHLQTVLRAPAGA
FT                   TVLAHSAQDQCQALRWGKATWGVQFHPEFATHHMRGYVQARADCLRRAGRCARTIAREV
FT                   SAAPLARKLLRRFVQHAHSQY"
FT   gene            96233..97024
FT                   /locus_tag="XALC_0076"
FT   CDS_pept        96233..97024
FT                   /transl_table=11
FT                   /locus_tag="XALC_0076"
FT                   /product="conserved hypothetical protein."
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14622"
FT                   /db_xref="UniProtKB/TrEMBL:D2U849"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14622.1"
FT                   /translation="MMKLLKSLTLAVVLIASGACIAATPVKPTTLTVLSSGGIMGAVRA
FT                   IAPRYEQATGVKLRIEAAPSMGDTPQAIPNRLARHEPADVLLMVGSALDKLVATGQVRK
FT                   ASRVDLGKSYIAMAVKQGAAKPDISSMDAFRKTLLDSTSVAYSDSASGVYLSHELFPQM
FT                   RLGDGFAAKARMIPAEPVGVVVARGQAQLGFQQLSELKPVPGITIVGLIPQQAQKMTLY
FT                   SGAVATSSTQPEAAQALLDYMASKAAAKAIEDSGLTPIVTQ"
FT   gene            complement(97099..98919)
FT                   /gene="gspE"
FT                   /locus_tag="XALC_0077"
FT   CDS_pept        complement(97099..98919)
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="XALC_0077"
FT                   /product="probable general secretory system II, protein e"
FT                   /function="putative uncharacterized transport protein
FT                   go:0005215 go:0006810"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14623"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D2U850"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14623.1"
FT                   /translation="MDSRSAAPPLGLPASSTVSLPPGRLSVERVTTALLADGLVAPEER
FT                   GRMQFSAQSARTVSDVHPLVLLSNLKLPAIHPPGSELSLERLTEWLAQRCGLRYLRIDP
FT                   TRVDVAAVTAVVSHAYARRHRILPLALEPERLLVATSEPLALDWLGDLQHLARRRIEIA
FT                   VVNPLDLHRYTMEFFGVTRSVRGAKDGRGEQGSSLPSFEQLVELGRGGDVNADDHHIVH
FT                   IVDWLLQYAYEQRASDIHLEPRREAGRMRFRIDGVLHKVLEVPPAVMSAIVSRIKVLGR
FT                   MDLAERRRPQDGRIKTRSPGGRETEMRLSTMPTAFGEKCVMRIFDPDAAFKSVDQLGFS
FT                   PQEAAGWNALVERPHGIVLVTGPTGSGKTTTLYSTLKRLATADVNVCSVEDPIEMIATE
FT                   FNQMQVQPNIDLDFASGVRTLLRQDPDIIMIGEIRDLETAQMAVQASLTGHLVLSTLHT
FT                   NDAPSAITRLLDLGVPHYLVASTLNGVLAQRLVRTLCSHCKRPHTLEAPAWDALREPGE
FT                   ALPEQIQTYAPVGCLECRRTGYLGRVGLYELLPIGPRLRSLIRADMDLAGFSRAAQAEG
FT                   VRTLRRAGLEKVAAGLTTLEEVLSVLPPRE"
FT   gene            99000..99908
FT                   /gene="glyQ"
FT                   /locus_tag="XALC_0078"
FT   CDS_pept        99000..99908
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="XALC_0078"
FT                   /product="probable glycyl-trna synthetase alpha chain
FT                   protein"
FT                   /function="information transfer; amino acid-activation
FT                   go:0006418"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14624"
FT                   /db_xref="GOA:D2U851"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:D2U851"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14624.1"
FT                   /translation="MSVSRSVPITFQGLIQTLNQFWAQHGCVLIQPLDLEVGAGTFHPA
FT                   TFLRALGPEPWNAAYVQPSRRPTDGRYGENPNRLQRYYQYQVAMKPNPDNIQQLYLDSL
FT                   RALGIDPLVHDLRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQAGGLECKPVLG
FT                   EITYGLERLCMYLQNCDNVYDLIWTYGPDGTPVTYGDVYHQNEVEQSAYNFEHANVAEL
FT                   FHRFDACEREAQALVEVGLPLPAYEQVTKASHAFNLLDARRAISVTERQRYILRVRALA
FT                   QAVAKAYYAQREKLGFPGVKR"
FT   gene            100064..102214
FT                   /gene="glyS"
FT                   /locus_tag="XALC_0079"
FT   CDS_pept        100064..102214
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="XALC_0079"
FT                   /product="probable glycyl trna synthetase, beta subunit
FT                   protein"
FT                   /function="information transfer; amino acid-activation
FT                   go:0006418"
FT                   /EC_number="6.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14625"
FT                   /db_xref="GOA:D2U852"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:D2U852"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14625.1"
FT                   /translation="MSMHPLLIELGTEELPVKALPGLAQALFDGVIAGLDKRGIAVERG
FT                   DAKPLSTPRRLAVLLPGVAAEQPEQRAEVLGPYLNIALDADGQPTKALEGFAAKAGIAW
FT                   TALERTRDAKGERFVHRAVHPGARTATLLPDILREAIAAMPIPKPMRWGDHDYGFARPV
FT                   QWLVLLLGNEVVPAHLLGVQADRHSRGHRFLHDAPVTLAQPGDYVAALQAAQVLVDPDV
FT                   RRARIVAEVEQAARQAGGRARIAEDNLAQVVNLVEWPSAVLCRFEPAFLAVPQEALIET
FT                   MESNQKFFPVLDADGKLTEHFIGIANIVSRDVAEVAKGYERVIRPRFADAKFFFDEDLK
FT                   QGLEAMGVGLAGVTYQAKLGSLADKVRRVAALAEAIAAQVGADPAQARRAAELSKNDLQ
FT                   SRMVNEFPELQGIAGRYYASAAGEPRDIALAIDEAYQPRFAGDDIALSPLGKVLAIAER
FT                   LDTLAGGFAAGLKPTGNKDPFALRRNALGLARTVIESGFDVDLSEALVAAAKLLPWEQL
FT                   VRKAELPNKLPNEHPTSEIDSIQYAQLAQEVYDFILDRLRGYYADKGVPATHFNAVAEL
FT                   KLASLYDVDRRIDAIGTFAALPEADALAAANKRIRNILRKAEDAIPAQVDAALLREPAE
FT                   RALAEAVEAAIVETDGTLRQRDYVSVLNVLARLRPQVDAFFDGVMVNAEAPALRGNRLA
FT                   LLKRLGERLGSVAAIEHLSSAN"
FT   gene            complement(102366..103028)
FT                   /locus_tag="XALC_0080"
FT   CDS_pept        complement(102366..103028)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0080"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14626"
FT                   /db_xref="GOA:D2U853"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:D2U853"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14626.1"
FT                   /translation="MSNTREQLVLPGGGDRLLLHSCCAPCSGELMEAFVESGIDYTVFF
FT                   YNPNIHPAKEYELRKQENIRFAEQHGVPFIDADYDTDNWFARAKGMENEPERGIRCTMC
FT                   FDMRFERTALYAHEHGFPVITSSLGISRWKNMQQITDSGIRAAAPYDGLTYWDYNWRKH
FT                   GGSARMIEISKRERFYQQEYCGCVYSLRDTNRHRREQGRERIRLGLVFYGDNEAESK"
FT   gene            complement(103317..103859)
FT                   /locus_tag="XALC_0081"
FT   CDS_pept        complement(103317..103859)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0081"
FT                   /product="putative gluconokinase protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="2.7.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14627"
FT                   /db_xref="GOA:D2U854"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D2U854"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14627.1"
FT                   /translation="MDSTSPPPPAAAAIIVMGVAGSGKTSVAQALAAHYRMTFLDADDV
FT                   HSAEAKAQMARGIPLSDAQRAPWVAALATRLRQSNAVGDGIVLAFSGLRRAHRQQLRDS
FT                   GVPMRFVFLHAAMHVIAARLAARSGHFMPPTMLQSQIDALESPIDETDVIAVDVDAPFA
FT                   EVVAEAIARLDSTGVIG"
FT   gene            104008..105387
FT                   /locus_tag="XALC_0082"
FT   CDS_pept        104008..105387
FT                   /transl_table=11
FT                   /locus_tag="XALC_0082"
FT                   /product="putative inner membrane symporter protein"
FT                   /function="porters (uni-, sym- and antiporters) go:0015293
FT                   go:0015297 go:0015292"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14628"
FT                   /db_xref="GOA:D2U855"
FT                   /db_xref="InterPro:IPR001927"
FT                   /db_xref="InterPro:IPR018043"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039672"
FT                   /db_xref="UniProtKB/TrEMBL:D2U855"
FT                   /protein_id="CBA14628.1"
FT                   /translation="MSFSSQRTDAPLRWSETLGYGIGDMGFNLYWANISAFLLIFYTDT
FT                   MGLPAAAVGTMLLVTKLADAVCDPLMGAIADRTRTRWGKFRPYLLFAALPMAGSAVLAY
FT                   TTPELDTGGRLLWAYVTFGLMMLMYTVLSIPYSALSGVMTADSQQRTTLISIRFIAAFV
FT                   GTCLVNYATLDLVRWFGNGDDARGWQCTMLLYGAVAAASFAIVFASTRERLQPLSQSRA
FT                   PVLQDIADLLRNRPWRVLFALALIIMVTIVMRGGAGVYYFKYYVGRPDLAGWFLGGYSV
FT                   ALALGAAATPLLTRWCDKRRLMIWLMTSAGVLSCAMFFVPRKAIWALFAINLLVGLALG
FT                   PKSPLAFSMYADSADYTEWKTGRRATAMTFSAATFSQKLGAALASACIAWMLAAMGYVA
FT                   NQVQSDASQRGIALLLTVIPGAIALLAAWTMRFYPLDDAALRRIQDDLAARKRAAGEVD
FT                   R"
FT   gene            105384..107783
FT                   /locus_tag="XALC_0083"
FT   CDS_pept        105384..107783
FT                   /transl_table=11
FT                   /locus_tag="XALC_0083"
FT                   /product="putative ndvb protein (glycosyltransferase family
FT                   36 )"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14629"
FT                   /db_xref="GOA:D2U892"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037814"
FT                   /db_xref="UniProtKB/TrEMBL:D2U892"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14629.1"
FT                   /translation="MNIAHDPRQDTTSLLAPSADGERYALYSPTALPNAGGFLWNRRMM
FT                   IHVTCRGYATAQFMQPEPTKYAHAPILEAKTFMQPEQPYYAHHPGRFFYLKDEDTGALY
FT                   SVPYEPVRAMPQAFCFSAGQADVVWCVRHADIEVELRLQLPVDDPVELWQCQVRNLDGR
FT                   ARRLALYAYFPVGYMSWMYQSGEYRADLGGIVCRSVTGYQKVEDYFRHRDFKDCTFLLH
FT                   EQTPDAWEARQSAFEGEGGLHAPSAVMQPRLGGSEAHYELPTAALQYRMRLVPQQAQTL
FT                   RFLFGPATDAAEIADLRARYLSAQGFATAAADYRAYLAEAVGCLHIATPDPHLDNLANH
FT                   WLPRQVFYHGDVNRLSTDPQTRNYLQDHMGMSYLCPHTARAALLHALSQQESSGAMPDG
FT                   ILLVEGAELKYINQVPHTDHCVWLPVFLSAYLDETGDSALLRADVTTADGVSRSVAERI
FT                   DAAMRWLLGARDARGLSYIAQGDWCDPMNMVGYRGRGVSGWLSVATAHALQLWARICAQ
FT                   HGRAGSAVQWRAGAAELNAAVNRELWDGDWYARGITDDGVRFGIKDDQEGRIYLNPQSW
FT                   ALLAGTADAAQRQRLLQAIDAQLDTPYGPVMLDPPYTAMREDVGRLTQKYPGSAENGAV
FT                   YNHAAAFYLHALYAIGDADRAWRVLRAMIPGPELADYLQRGQLPVFVPNYYRGAWRSLP
FT                   RTAGRSSQLFNTGTAAWLYRCLIEGLFGLKGDGDALCVRPQLPSHWPQAQVQRRFRGAL
FT                   FAVRMQRAADCLAPQVRVDGRLLEEPRIVEIEAGRHYVVEVRLPPG"
FT   gene            complement(107831..110254)
FT                   /locus_tag="XALC_0084"
FT   CDS_pept        complement(107831..110254)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0084"
FT                   /product="hypothetical atpase of the aaa+ class protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14630"
FT                   /db_xref="GOA:D2U893"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2U893"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14630.1"
FT                   /translation="MSCPPAESRTTHLQQQTLRLQTQLQQAQARQAQADAEVQAQLPAV
FT                   ELAVAAIQRCFATHAARARNAAMQRARRRAWGPALLLRPFLPDIRWRLALLGVLLLILP
FT                   WMSARWFGANQAALEGWRQLGAHGHILPLLECALPSLLLYAVLVVGGAQLLAWHDSYDE
FT                   RLLLRRFARMPLALAQVGDVAQRTPTAAYPVTRAPWPQSNLYGHWQIPATHGDVSGARL
FT                   LALHDAAMEPRLHALIVLPDATHAAALIAFDADLQATASASLHAMAVALATDAAAEAAP
FT                   IGALHACVQAWDAARSQQRAVQQRLQSMDAVQRHWTDVALPDACLDEILKLVDLFVSGR
FT                   APAPKGILLHGPPGTGKTLIARKLAQHAGCHVEALGVADLKAAHVGNTGPKVQAIWQRC
FT                   RDNAPAILFIDECESVFARRGGADSDSFGAELVQTFLAEWDGFHSAPGQVLVIGASNRP
FT                   ALLDEAVMSRFTASIAIGLPDAAARTRILGHELQRAGFALTLDPQVIADSTGLSGRDLH
FT                   TLVARVAAECVDGALDNATLLTQLRALRGKGSTQVAALDWDDIVLPQAALEEFVALGKE
FT                   LRNAEQLAALGVPVPRGILMSGPPGTGKTQVARILANQSGLAFIALTSADLKAGYLGQS
FT                   GQRVQAAFARARAQAPCIVFIDELDILAPARGAESDDALTREIVGQLLQELDGVASHTG
FT                   EVFLLAASNHADAIDPALLSRLDRHIPIALPDRAARTAIVGRLLRGKPLAFDADAAAAW
FT                   VAERSEGHSGRDLHTWISRAMRCAARRALQESDDAASTRLQWDDLVATANTAPM"
FT   gene            110472..113900
FT                   /locus_tag="XALC_0085"
FT   CDS_pept        110472..113900
FT                   /transl_table=11
FT                   /locus_tag="XALC_0085"
FT                   /product="putative two-component system sensor/regulator
FT                   hybrid protein"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14631"
FT                   /db_xref="GOA:D2U894"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2U894"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14631.1"
FT                   /translation="MVSSWILLLVSAGYAALLFAVAWWGDRRPLYPKRPWLRPVVYSLA
FT                   LAVYCSSWTFYGAVGSAVRHGIGYLPIYLGPLLLLLFGWRIIERLALIARSQNTVSIAD
FT                   FISSRYGRSRRLAALVAAIALVGVVPYLALQYKAVAMSLQILSGQSSAGVPFYEDPELY
FT                   VALLMALFATLFGTRQVDATEHRHGMMLAIALESMVKLLAIVAVGVFAYVWLSARDAGQ
FT                   VLHSARTLFQNTPSVGFISQTVLSFLALVCLPRQFHVAVLECSDVGDIRKARWLFGLYL
FT                   VLISAMVVPIAAAGVALFGGSDVADDSIVLALPLAHNRTALALAAYVGGFSAATGMVIV
FT                   SSIAMATMISNDLVMPLLLRRRGHQAVGADVASRVLWIRRMAILLLALISYGYYRTSRN
FT                   DSTLASYGLMAFVAVAQFAPGVIGGLYWRGASRKGVEAGMVLGFATWVYTLLLPALTQS
FT                   GWLGSAWLHDGLFGIAWLRPQQLFGLRGWDPLAHGTFWSLLINLGTLMLVSARWRPGLD
FT                   EQLRTAPFLDPYAQRPAVADDWLGQVHVVDLQTLAERMVGERHARRAFAEQAQLLGCEP
FT                   QPNVVADRAWVQFTERLLAASIGAASARLVLTSLLRGSGMDLGEVVAVLDQAGQELRFN
FT                   REILSTTLDNISAGVSVVDPSMRLVAWNRRYQRLFGYPDSMLYVGRSVADLIRYNAERG
FT                   QLVAGQVEEQISRRIAHMRAGTKHVFERIHHDGTVIEMRGQPLPGGGYITTYNDITDYK
FT                   RAEQALLEANETLEQRVAVRSREAELAQQSKTRFLAAISHDVLQPLNAARLFASALRDA
FT                   AHQSEEQRHLAERVDASLRAAEELLDGLLDVSRLDAGGLRPTIEDVDASALLRELAAQY
FT                   APVAASRGLRLRVYARPCWVRSDRRLLRRVLQNFLANALRYTRQGRIVLGMRGRGTALE
FT                   LQVWDTGPGIPQHHLRQIFEEFQRYQQPFDWGEQGLGLGLSICQRISRLLDHELDVRSH
FT                   VGSGSMFSITVPRVAPPPQQRQHRVVAAVDSLAGLRVLCVDNDQEILDGMRALLGRWQV
FT                   EVICANTVDAALAQAVHAPHVMLVDYHLHDRLDGLDTLDALRAAMSGPVAGALLTADGR
FT                   DELKLQARARGYRLLTKPVKPASLRAFLSAYHDAI"
FT   gene            114029..115885
FT                   /locus_tag="XALC_0086"
FT   CDS_pept        114029..115885
FT                   /transl_table=11
FT                   /locus_tag="XALC_0086"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14632"
FT                   /db_xref="GOA:D2U895"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR026634"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2U895"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14632.1"
FT                   /translation="MTSLDDTAFPPLTDLLQALEAGHAQVLEDGARRYLQHRPDDPVVS
FT                   SLLAMSLQMQGQPAQAAALYRTLTTRQPQDVAHWNNLGTALRECGEHAQARQAYARACA
FT                   LVPQDPMPHHNLGLLAMDSGDYATAREHLLDAHALAPQLPPLRVHAAMACHECGDFQRV
FT                   QALIADWRQWPPLEPDTTMELAWLLSQEGDTESACALLQAFTGGPMPESIRAWSRLVLV
FT                   LERANRLQQAREAAAQLPAPDLIADADVRQDASNALAVLAMRDGRWDDAYALLRGLLSE
FT                   GGAIDTRKQSNLFFALARVCDRLGRPREALAACAQGHAGQVESLAALVPELAVADASPL
FT                   PVAQYRWNPARHAAVRPVIGPGAAASPIFVVGFPRSGTTLLEQMLDAHPQLCAMDERPF
FT                   LQGLADRLEHRGVAWPDGLGELDDADCAALRAEYWQSVAGVVRLAPGQRLVDKNPLNLL
FT                   RLPLIHRLFPEAPVILALRHPCDVLLSCYMQAFRSPAFALLCSSMQRLAQGYAEAMAFW
FT                   LYHAALLRPRALELRYEDLVADSQAQVQRLGEFLQLEQPERLLEFQRHARAKGFISTPS
FT                   YAQVVEGINRKGLDRWRAYRDAFEPVLPTLQPLLQRWNYPVG"
FT   gene            116111..118858
FT                   /locus_tag="XALC_0087"
FT   CDS_pept        116111..118858
FT                   /transl_table=11
FT                   /locus_tag="XALC_0087"
FT                   /product="putative tonb-dependent outer membrane receptor
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; the outer
FT                   membrane receptor (omr) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14633"
FT                   /db_xref="GOA:D2U896"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D2U896"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14633.1"
FT                   /translation="MSLVKNRLAHAVCLTLTALPATLYAQSAAPADNGAPVELDRLTVT
FT                   GSLVRRVDVETASPVAVVDRQQIQQSGKQTLGDLLQALPGIAGDATNPQVNNGGGDGAS
FT                   TVSLRGLGDQRTLLLVDGHRVLNNDVNSIPANMIDHVEVLKVGASAMYGSDAIGGVVNF
FT                   ILRKNFEGGEVALNYGQTSRGDGARDGASFTFGKTWDRGNVVAGVDYNKQKSVSTADRA
FT                   FSKYAMYLSSGSVLKRGSSRTPSGYYKLPAATLAANGCSPRGALTSDGNGGYKCYNGSA
FT                   DSYNYQAQNLLLTPQQRVGGFVLGSFNVTDNVQAYVNAYHNHTMSHYAIAPLPFDAQND
FT                   GITIGANNPYNPFGVEFGPNGYEFRSRFTTLGQRQGFYDTATDQDVLGLKGSFGDSSWI
FT                   WNVNFDYGHYRQRSWNHGYVDYASLQTAIDAGQVNIFDQGNANTVAWMRSHESIPRFET
FT                   TTIMRQWEASANGNLWELPAGSAQLAVGALYRKQSLDYTVSSNALINSDNTCAISSEAC
FT                   SSPLSGSFDVKEAYAQVFVPVLAQSSPVGAVNLTLSDRFSDYSSVRSSNNSASFQVEWR
FT                   PIHDLMLRGTAAQVFRAPAIGDIYLGPTADSPNFTDPCIGYSGSGHANACAGVPAGWAG
FT                   SGLSQANSIKSGSRYVGYQLKPEKGTSFDYGLVYSPEYVPGLSLNLDWWKVKLDDLIQS
FT                   ISAQTVADLCYNDDNSPYCSYIHRYAANTVSAGNINYIQTPVVNIGKLNTQGIDFGANY
FT                   VLPETAFGKFNLALDTTYLHRYDIDTGDSIVHMAGRYSSSYGNYAHWRGRTQVGWKLGN
FT                   WDASWTTRWVGKVQIGSGDPSQNMSADASTAGVVMKYGSQLYHALQVGYDMTDAHLRFD
FT                   LGVDNLTNKQPPVMYQNNVLNANTDVSTYDTLGRYYWMRATYRF"
FT   gene            118955..119542
FT                   /locus_tag="XALC_0088"
FT   CDS_pept        118955..119542
FT                   /transl_table=11
FT                   /locus_tag="XALC_0088"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14634"
FT                   /db_xref="GOA:D2U897"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:D2U897"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14634.1"
FT                   /translation="MRMNQTDLRHYVRVYDAALPHDFCAQLIAQFEHASAQHSRNGTGQ
FT                   RAGLDDSAWTELNITRLADPAFQGFFIEQVRAALECYNADLGLSAAVPWRPRLADLRIK
FT                   RYRADAGERFQPHFDACDAETGRYLVFLWYLNDVEEGGQTRFLDLDLEIAPRAGRLLIF
FT                   PPYWMFLHAGIPPRSGDKYILSTYLEFTAKPA"
FT   gene            complement(119570..120145)
FT                   /locus_tag="XALC_0089"
FT   CDS_pept        complement(119570..120145)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0089"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14635"
FT                   /db_xref="GOA:D2U898"
FT                   /db_xref="InterPro:IPR003810"
FT                   /db_xref="InterPro:IPR022929"
FT                   /db_xref="UniProtKB/TrEMBL:D2U898"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14635.1"
FT                   /translation="MSFFSILLLGIAMSTDAFAAAVGKGAAMQRPCWRDALRAGLIFGC
FT                   IEALTPALGWLLGQAASKYVTAFDHWIAFGLLGALGLHMIVAGLRPQTEAATDPTPKRH
FT                   GFWNLAVTGLATSIDAMAVGVGLAFLNVNIIEVATVIGLCTLTMVTLGIMLGRVLGTLA
FT                   GKRAEIVGGVLLIAIGCTILYEHLHGVG"
FT   gene            complement(120688..121866)
FT                   /locus_tag="XALC_0090"
FT   CDS_pept        complement(120688..121866)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0090"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14636"
FT                   /db_xref="UniProtKB/TrEMBL:D2U899"
FT                   /protein_id="CBA14636.1"
FT                   /translation="MKKRKSTVFLRTLVYAALLFPFMASADNVALVDFYLSKEDNTKID
FT                   MPLTIESDAGDGASVRWSYVFTPYSKGKSGKSTTGYIGLQRNKGMKQVEYGIYNASNAT
FT                   AGSGATTATLDGTGKKISMNFDWKSNNQYVLRIEKDQDKHNDGLQWWKASIIDASSKSS
FT                   IYLGSIGIDENMKNITSYITGTSYSLDDKANCETTPYARVRFDRPQSDDGKGKVETVDP
FT                   WTISFNESPCALMKKSGAINGVNVGVRSDTVENSAVQQIGLSQGPQKWGWFDNEGTVGS
FT                   IFKTDDSKARYFKLLTQTYSDYPSDDSNNEDWKYLGTTEPFYNGPAFHNWSENDRRGKP
FT                   GDLYAYFIRPGTTYYFIRKTPENQQHGYFPTTPSDNDDWHYVGTNINTYTPN"
FT   gene            complement(122479..123144)
FT                   /locus_tag="XALC_0091"
FT   CDS_pept        complement(122479..123144)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0091"
FT                   /product="putative two-component system regulatory protein,
FT                   luxr family"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14637"
FT                   /db_xref="GOA:D2U8A0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14637.1"
FT                   /translation="MPTLLIADDHPLFREALRGAVQRVIPGVQLYEADSVEALYALADR
FT                   HADADLLLMDLNMPGAQGFSALVQIRVLHPQLPVVVVSAREEPTVMRRALDHGAFGFIP
FT                   KSSDSDTIGLALRTVLDGERWAPPEAHDAPPTDRAEREVGQRLRELTPQQIRVLQMLGA
FT                   GRLNKQIAYDLSVSEATIKAHVTAILRKLGVTNRTQAVLLAGKLSIDNDAIVLPQEED"
FT   gene            complement(123249..125192)
FT                   /gene="acsA"
FT                   /locus_tag="XALC_0092"
FT   CDS_pept        complement(123249..125192)
FT                   /transl_table=11
FT                   /gene="acsA"
FT                   /locus_tag="XALC_0092"
FT                   /product="probable acetyl-coenzyme a synthetase protein"
FT                   /function="metabolism go:0008152; propionate degradation
FT                   go:0019543"
FT                   /EC_number="6.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14638"
FT                   /db_xref="GOA:D2U8A1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR011904"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032387"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14638.1"
FT                   /translation="MADLYPVDPHVAARARVDKTQYQALYRQSVEQPEAFWGKVAERLD
FT                   WFKAPTRIKDVNFALDDFRIRWFDDGELNASVNCLDRQLASRGDKTALLFEPDSPDVPS
FT                   YRVSYRELYERVCRLGNALRNLGVQKGDRVTIYLPMIPDAAVAMLACARIGAIHSVVFG
FT                   GFAPNSIADRVIDCGSKLIITADEGLRGGKKIPLKANVDAALKLPDTTSVETVLVVRHT
FT                   GGAVNMQAPRDRWFHDVVDNQPATCEPERMNAEDPLFILYTSGSTGKPKGVLHTTAGYL
FT                   LYAAYTHESVFDLREDDIYWCTADVGWVTGHSYIVYGPLANGATALMFEGVPNYPSVSR
FT                   FWEVIDKHQVTLFYTAPTAIRALMREGDAPVKKTSRKSLRLLGSVGEPINPEAWRWYYD
FT                   VIGDGRCPIVDTWWQTETGGILITPLAGATDLKPGSATLPFFGVQPALVNTDGQILEGA
FT                   TEGNLVLRDSWPGQMRTVYGDHQRFIDTYFRTYPGNYFTGDGCRRDADGYYWITGRVDD
FT                   VINVSGHRIGTAEVESALVAHPKVAEAAVVGFPHDIKGQGIYAYVTLVADERPSDALHK
FT                   ELVAWVRKEIGPIATPDHLQWAPGLPKTRSGKIMRRILRKIAENAPDQLGDTSTLADPS
FT                   VVDSLVNERLTR"
FT   gene            125567..125884
FT                   /locus_tag="XALC_0093"
FT   CDS_pept        125567..125884
FT                   /transl_table=11
FT                   /locus_tag="XALC_0093"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14639"
FT                   /db_xref="GOA:D2U8A2"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14639.1"
FT                   /translation="MSISNEALIAKIDADPKYHALKRQRNALGWTLTILMLLVYFGFIG
FT                   LIAFDKAFLAQPIGSGVTTIGIPIAIGVMVFTIVINAIYVRRANSHYDRLTAQILEDAR
FT                   S"
FT   gene            125881..127611
FT                   /gene="actP"
FT                   /locus_tag="XALC_0094"
FT   CDS_pept        125881..127611
FT                   /transl_table=11
FT                   /gene="actP"
FT                   /locus_tag="XALC_0094"
FT                   /product="probable cation/acetate symporter protein"
FT                   /function="the solute:sodium symporter (sss) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14640"
FT                   /db_xref="GOA:D2U8A3"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14640.1"
FT                   /translation="MNIVMRIPVLLLATLLPVGVALAAGGDVGQTDKQPTNWVAIVMFA
FT                   FFVACTLWITKWASKKTRSAADFYTAGGGISGFQNGLAIAGDFMSAASFLGITAAVMAN
FT                   GYDGLIYAIGFLVGWPILTFLMAERLRNLGKYTFADVAGYRFAPTAIRGFAAAGTLVVV
FT                   LFYLIAQMVGAGALIKLLFGLDYWVAVSLVGVLMMVYVLFGGMTATTWVQIIKAVMLLT
FT                   GVTFMAVAIMLHFHFSFEALFAEGVRVKTAVAAHAGASPDEAASAGRAIMGPGGFVKDP
FT                   ISAISFGMALMFGTAGLPHILMRFFTVPDAKQARKSVLWATTWIGYFYILIFIIGFGAI
FT                   ALVLTNPQFADVATGTIHGGKGAANMAAVLVGNAVGGNVFMGFISAVAFATILAVVAGL
FT                   TLSGASAVSHDLYATVLKKGQPAPGSELKVSRITTIVLGVIAVLLGIVFEKQNVAFMVS
FT                   LAFAIAASANFPVLLLSLLWKDCTTRGAVIGGFLGLISSLVLTVLSPSVWVDTLGNATG
FT                   SAPFPYTSPALFSVTIGFVGIWLFSLLDRSAQADKERAAFKAQQIRAETGLGASRGSAH
FT                   "
FT   gene            127732..129162
FT                   /locus_tag="XALC_0095"
FT   CDS_pept        127732..129162
FT                   /transl_table=11
FT                   /locus_tag="XALC_0095"
FT                   /product="putative aldehyde dehydrogenase protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="1.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14641"
FT                   /db_xref="GOA:D2U8G0"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14641.1"
FT                   /translation="MPIPVADAADTPLVALPATVQRLRAAWQAAKPERSQRRDDLLKLR
FT                   ATLKRRLPEMADAIADDFGHRSRHESLIADGMIVLGEIDHLLRHLTGWMRPQRVGGGWR
FT                   LWPARAEVRPVPVGVVGVIAPWNYPVNLALIPLATAIAAGNHVYLKPSEHTPRTAQFLQ
FT                   SLLAEVFPPQRVAVALGGAEVGAAFAALPLDHLVFTGSTAVGRKVMAAAAPNLTPLTLE
FT                   LGGKSPAIVCPDYPPGRAAARLASGKWFNAGQTCIAPDYVLIDAGRIAALVQALRAQVL
FT                   ARYGDFANAEDYTRIVNEGQYRRLRGYLDDARARGLEVIELASIDPVRAERERLIVPTV
FT                   VLQPGDDALVMQEEIFGPILPLRGYLTLDAAIAEINGRDRPLALYPFSHDRDQIETILH
FT                   ATVAGGVTINDSLLHFAANALPFGGIGASGMGAYHGRAGFDAFSKALPILWQSRRAGTD
FT                   LLKPPYARIARMLSFLLR"
FT   gene            129583..130689
FT                   /locus_tag="XALC_0096"
FT   CDS_pept        129583..130689
FT                   /transl_table=11
FT                   /locus_tag="XALC_0096"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14642"
FT                   /db_xref="GOA:D2U8G1"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14642.1"
FT                   /translation="MNIPLVSSPMTRACCVFGALVVMAALPQMVLANCNDNVGTKMSNI
FT                   LFADSSADTIVLAHRGLWGKYSSFPDMPENSRGALQLADDQCMDGVELDIKMTRDGVPV
FT                   LLHDWNLGRTTNVWTSRAGKIKYNPMKNQGYNPSITVTPWSVVSRLFLLTPDRRTTTGY
FT                   HVPRVDDLFAYFKRHRLKTPIVFDFKDAASVRAVSRAADAAFSVASPSFVAGKVNATLY
FT                   PTRSAFRADGSSMVGIPVFTTNMLTKINVSNAVSDWLGDNKEAMEINVKQLGGLLQNEA
FT                   DRVRERGARVGVFQAIPDSPLAGQFYKKSGACCYRLSDLYFSYSGGRDTADNRGDLNFI
FT                   VNQEDFNLITTDDPKGAIAYLKARGKHD"
FT   gene            130790..131662
FT                   /locus_tag="XALC_0097"
FT   CDS_pept        130790..131662
FT                   /transl_table=11
FT                   /locus_tag="XALC_0097"
FT                   /product="hypothetical ppic-type peptidyl-prolyl cis-trans
FT                   isomerase; protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14643"
FT                   /db_xref="GOA:D2U8G2"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14643.1"
FT                   /translation="MSLFFAKSAVLAVCALTAFVALAMPADVGTAAVDPVVLRVGAQQF
FT                   TASEYHALAGEGTRGVASIDDPSVVRRFADRAILLDQARQQHLQDDPVVAARLRRAADA
FT                   ILADAARARLGATAQIDESMLHQQFAAYPDDYTEYHLRHLFVALHPQGGPRGGQSLTEA
FT                   QALQRAEALKRQLDGGADFATLAMHESDDGATAAEGGQLSPTFGRYLADAFVAPIHQLA
FT                   VNQVSAPVRGPDGYHLIYLDAKTDARFEAVRGQIELQLREQAAADAMQRLRQAHPMAFD
FT                   RAAYAAAVH"
FT   gene            131671..132504
FT                   /locus_tag="XALC_0098"
FT   CDS_pept        131671..132504
FT                   /transl_table=11
FT                   /locus_tag="XALC_0098"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14644"
FT                   /db_xref="GOA:D2U8G3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14644.1"
FT                   /translation="MLSRPALIWLTGAVAVVALAASLWLPTAMPVAAVAVVLSRPSSPP
FT                   SALLSSPVSVAALPELALPAGASEAQRLYATALLAVDCRQRAQAPAPSAVLPPGVDDTT
FT                   AEDAAARRAAEGQWRAACRGVGQVDAAQIEAMLRTAATRGDPDAQRYLLNQRVAQLVAH
FT                   AGDIAPDGQRPRLSATDERDAEDVVTQLEDRALHGDRQSIETLAQLLQSPALAVADPPY
FT                   AAAWELAARQAPERPFPPPEQAVGAEELLDGLNEAQRQQALGLAPMLFAQCCARR"
FT   gene            132583..133362
FT                   /locus_tag="XALC_0099"
FT   CDS_pept        132583..133362
FT                   /transl_table=11
FT                   /locus_tag="XALC_0099"
FT                   /product="probable exodeoxyribonuclease III protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14645"
FT                   /db_xref="GOA:D2U8G4"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14645.1"
FT                   /translation="MKIASWNVNSLNVRLPHLQQWLDTFAPDVVGIQETKLEDHKFPDA
FT                   ALAEAGYRSVFAGQKTYNGVAILSRTPLSDVQIGVPGLEDEQKRAIAATVGDLRIVNLY
FT                   VVNGQDVGSDKYAYKLRWLEAVHAWLAVELQRYPRLVVLGDFNIAPDSRDVHDPLVWND
FT                   DHILTSTAERNALRKLFDLGLHDGFRLHHADGGIFSWWDYRQAGFRRDLGLRIDLTLVS
FT                   ETLKEHTRGAGIDRTPRTWERPSDHAPAWIALEPTQA"
FT   gene            complement(133487..133738)
FT                   /locus_tag="XALC_0100"
FT   CDS_pept        complement(133487..133738)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0100"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14646"
FT                   /db_xref="GOA:D2U8G5"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14646.1"
FT                   /translation="MGIIIWLIVGGIVGWLASIIMRRDAQQGIIMNIVVGIVGALIAGW
FT                   LFGGGINQAINLWTFLYSLIGAIILLAVVNLVTRGRAR"
FT   gene            133856..134485
FT                   /locus_tag="XALC_0101"
FT   CDS_pept        133856..134485
FT                   /transl_table=11
FT                   /locus_tag="XALC_0101"
FT                   /product="putative 4'-phosphopantetheinyl transferase
FT                   protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14647"
FT                   /db_xref="GOA:D2U8G6"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14647.1"
FT                   /translation="MSAPIPLPTSAALPDWRIGPVALWLRPHPPRTSGEATARCLLAAE
FT                   LGVTSAQLPLYRDARGRPGLHAPLAHVDTGWSHSGDYLLVAVAANARLGVDIERQLPRP
FT                   RLLELAQRFFHPDEAAALLALATPAREALFFRLWCAKEALLKAHGHGLAFGLHRLCFAE
FT                   DATGGLHLAWCDPALGSAACWQVHEWQAASGYRAALAWRRLDSSSR"
FT   gene            complement(134519..136063)
FT                   /gene="phoD"
FT                   /locus_tag="XALC_0102"
FT   CDS_pept        complement(134519..136063)
FT                   /transl_table=11
FT                   /gene="phoD"
FT                   /locus_tag="XALC_0102"
FT                   /product="probable alkaline phosphatase d precursor
FT                   (apased) protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14648"
FT                   /db_xref="GOA:D2U8G7"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14648.1"
FT                   /translation="MLTGLGLLAATPLLSPFARARGSDDPFTLGVAAGDPLPDGLVLWT
FT                   RLAPQPLAPDGQGGLHDPVPVRWSIATDAGMAQVVQRGVAIAHPRWGHSVHVEVNGLQP
FT                   GRPYWYRFEALGAQSPLGCARTTPAPERMDSARFGFVSCSHWEQGYFSAYRHLAAEQPD
FT                   LVFFLGDYIYEYTHKGATAANVVRAHGSGDCLDLAGYRNRYALYRTDPDLQALHAVSAC
FT                   VATWDDHEVQNDYANRWSQDPSISTASFLRRRAAAYQAMYEHFPLRARHRPHGPNMRLY
FT                   RALDYGALARFFVLDGRQYRSEQPCPMSNGWRGGHVATSDCKEIDDPARSMLGAAQERW
FT                   LYAGFARSQARWNVIAQDLLVAPILQRERDNSQLGHWTDGWDGYPATRTRMLQAVARSG
FT                   MRNPVFWGGDIHSYWVTDLKTDASDPHSPTLATEFVGTSVTSDGPPYASITQMLTDNPQ
FT                   VRYAESRYRGYVSVSLSPTQMETRLQTISDRRDREATVSTLKRFVVEDGRAGALEA"
FT   gene            136223..136864
FT                   /gene="gidB"
FT                   /locus_tag="XALC_0103"
FT   CDS_pept        136223..136864
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="XALC_0103"
FT                   /product="probable methyltransferase gidb
FT                   (glucose-inhibited division protein b)"
FT                   /function="regulation go:0050789"
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14649"
FT                   /db_xref="GOA:D2U8G8"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14649.1"
FT                   /translation="MTDASLPDSVRAVLEQGLRAQALDAVVLAPPLLAYLALLARWNRT
FT                   YNLTAIRDPHEMVTRHLLDSLAMQPFVGEGVLADLGTGPGLPGLPLAIARPHLHVTLVE
FT                   SNGKKARFLREAVRQLRLDNARVAETRAEALDEPGGYDLLTARALDTLAGIVAVGGHLL
FT                   RPGGRLLAMKGVRPDAEIAALPSGWTVPTVHRLQVPGLGEDRHLVVVERD"
FT   gene            136952..137749
FT                   /gene="parA"
FT                   /locus_tag="XALC_0104"
FT   CDS_pept        136952..137749
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="XALC_0104"
FT                   /product="probable chromosome partitioning protein"
FT                   /function="cell processes go:0009987; cell division
FT                   go:0000910"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14650"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8G9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14650.1"
FT                   /translation="MARIIAIANQKGGVGKTTTAVNLAAALVRQTQRVLLVDLDAQGNA
FT                   TMGSGIDKRELDASTCDVLLGERTAVQIRVTAPEGFDLLPGNIDLTAAEIQLMDQTARE
FT                   QRLKTALTPLRAEYDFILIDCPPALSLLTLNALTAADSVIVPMQCEYYALEGLTALLET
FT                   IEALRVELNPGLEIEGVLRTMFDVRNNLANAVSAELTNHFGDKVFRTIVPRNVRLAEAP
FT                   SHGQSIVGYDRTSRGGVAYLGLAGEVVRRRNQRNRPMPVMETF"
FT   gene            137749..138666
FT                   /gene="parB"
FT                   /locus_tag="XALC_0105"
FT   CDS_pept        137749..138666
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="XALC_0105"
FT                   /product="probable chromosome partitioning protein"
FT                   /function="cell processes go:0009987; cell division
FT                   go:0000910"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14651"
FT                   /db_xref="GOA:D2U8H0"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14651.1"
FT                   /translation="MSAKPPALGAKKRGLGRGLEALLGSTAASTPTVDTLQPGDSLRRL
FT                   PVGQLQPGKYQPRQEMDQAKLQELAESIKAQGVIQPIVVRELVPGTFEIVAGERRWRAS
FT                   QLAGLSDVPVVVRELDDRTVIAMALIENIQREDLNPLEEALALQRLIDEFSLTHAEAAE
FT                   AVGRSRASVSNLLRLLELPPTIRMLLEARRLEMGHARALLTLSPELASRLASDAADQGW
FT                   SVREVEHRAQQFAAGKVPSNRKPKPGRNAPQADIASLETELSESLGTKVAIAHGAGGKG
FT                   KLVIHYTDLDTLDGVLERLRGKTS"
FT   gene            138770..139735
FT                   /gene="gla"
FT                   /locus_tag="XALC_0106"
FT   CDS_pept        138770..139735
FT                   /transl_table=11
FT                   /gene="gla"
FT                   /locus_tag="XALC_0106"
FT                   /product="putative nucleoside-diphosphate-sugar epimerases
FT                   protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14652"
FT                   /db_xref="GOA:D2U8H1"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H1"
FT                   /protein_id="CBA14652.1"
FT                   /translation="MTVLVTGAAGFVGAYTCRALAARGETVVGLDNYNDYYDPQLKRDR
FT                   VAALCPQVDIRTLDLTDREGLSALFDETRPERVVHLAAQAGVRYSLQNPQAYVDSNLVG
FT                   FVNMLELCRHRRVQHLVYASSSSVYGDSAAAPFSEDQRIDQPRSLYAATKAANELMGHT
FT                   YAQLYGLRATGLRFFTVYGPWGRPDMAPLLFSRAVLAGRPIEVFNHGRMRRDFTFIADI
FT                   VAGVLGALDHPCIDALPHRVFNLGNHRPVELERFIGVIETAAGRTAEKLYRPMQPGDMI
FT                   ETMADTARAHAAFGFDPTTPIETGLPQVVQWCRDYFGAAA"
FT   gene            139827..140549
FT                   /locus_tag="XALC_0107"
FT   CDS_pept        139827..140549
FT                   /transl_table=11
FT                   /locus_tag="XALC_0107"
FT                   /product="putative glycosyl transferase protein"
FT                   /function="metabolism go:0008152; polysaccharides,
FT                   cytoplasmic go:0000271"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14653"
FT                   /db_xref="GOA:D2U8Q5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14653.1"
FT                   /translation="MNQLSLSVVVPVFNERDNVSSLVDEILAALRGAIDFEIVYVDDHS
FT                   RDDTLAVLEGLKATTPELRVLHHVSQSGQSTAVRNGVKAAHGRWIATLDGDGQNDPADI
FT                   PKLLAAHAAASPQVKLFAGWRVSRQDSSSKRWASTWANAIRARMLRDATPDTGCGIKLF
FT                   EREAFLDLPYFDHMHRYLPALMQRAGWQTSSVPVNHRPRTAGVSKYNNLNRALVGIRDL
FT                   RGVAWLIARSRRTAVQER"
FT   gene            140551..140892
FT                   /locus_tag="XALC_0108"
FT   CDS_pept        140551..140892
FT                   /transl_table=11
FT                   /locus_tag="XALC_0108"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14654"
FT                   /db_xref="GOA:D2U8Q6"
FT                   /db_xref="InterPro:IPR011499"
FT                   /db_xref="InterPro:IPR014546"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14654.1"
FT                   /translation="MPPHLLDQPIQSLYWTGVHVTGWKLIGYIGALMFGGRWLLQFIAS
FT                   KRAGKPVIPRMFWYMSVIGSLMTLSYFLFSAKQDSVGVLQNLFPAFTAFYSLYLDIRHR
FT                   GWRRDRASH"
FT   gene            141350..141586
FT                   /gene="rpmB"
FT                   /locus_tag="XALC_0109"
FT   CDS_pept        141350..141586
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="XALC_0109"
FT                   /product="probable 50s ribosomal subunit protein l28"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14655"
FT                   /db_xref="GOA:D2U8Q7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14655.1"
FT                   /translation="MSRVCQVSGKRVQTGNNVSHANNKTRRRFLPNLHERRFWVASENR
FT                   WVKLKVSAHALRTIDKNGIDTVLAELRARGEKV"
FT   gene            141600..141764
FT                   /gene="rpmG"
FT                   /locus_tag="XALC_0110"
FT   CDS_pept        141600..141764
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="XALC_0110"
FT                   /product="probable 50s ribosomal subunit protein l33"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14656"
FT                   /db_xref="GOA:D2U8Q8"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14656.1"
FT                   /translation="MAGKRDKVRMISSAGTGHFYTTDKNKKNTPGKMEFLKYDPVVRKH
FT                   VLYKEGKIK"
FT   gene            141926..143344
FT                   /locus_tag="XALC_0111"
FT   CDS_pept        141926..143344
FT                   /transl_table=11
FT                   /locus_tag="XALC_0111"
FT                   /product="probable cardiolipin synthase protein"
FT                   /function="metabolism go:0008152; phospholipid go:0008654"
FT                   /EC_number="2.7.8.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14657"
FT                   /db_xref="GOA:D2U8Q9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR022924"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8Q9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14657.1"
FT                   /translation="MLPVWLEGTWLLALDWLIRLVALLWIPTRTTPGAARSWLLLVGFV
FT                   PLLGLPLYLLLGHPWLSRERVRRQVLASQVIREQQGPLTALRWTPPADTVVAEVVPLIE
FT                   RQGDFMPTHGNTVELLDRYAPSLQALIEDIETAVERVHLLYYLMFDDAVGDAVVAALLR
FT                   AAARGVRCRLLLDARGGRRALRRYRIRLHAAGVEVQALLPGGLRWRRSGRMDLRNHRKI
FT                   AVIDNRVGYIGSQNLAAPDFVPGHPNRELVARVQGPVVGHLEAVFASDWFIETGQRLSV
FT                   VSPATARGNGVPAQLLPSGPAYPFENARDTVNALIHQARRRIVMVTPYFVPDEVTLSAL
FT                   RIAALSGVEVQLILSESNNQPLSAWAQEACYDELLRSGVKIALYRPHFLHAKHLSVDES
FT                   IVLVGSINLDIRSFALNAEIGMLCYSAEVLQQLRVVEAEYLADARVLSLETWRKRPAWR
FT                   RSREGIARLADALM"
FT   gene            143447..144880
FT                   /locus_tag="XALC_0112"
FT   CDS_pept        143447..144880
FT                   /transl_table=11
FT                   /locus_tag="XALC_0112"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14658"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038732"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14658.1"
FT                   /translation="MPNMSELLPSKPIDDDCDVAIIGGGAAGVLAALHLLHQADGPLRL
FT                   QLIESQPALAQGVAYATPRAEHLLNVPVGRMSAFANAPEDFLDWLQHQALYPELTRDAL
FT                   AQAYVQRRHYAVYLRTRLTQAQATRPARLQWRQARVLAMQPDAAGGHMLHLHDARQLRA
FT                   GATVLALGNSLRPLPARGAASLSESMRVEAWNYPQLCEIPREATVCIVGSGLSMADSVL
FT                   TLLSNAHRGLVHVVSRHALLPLPHAAHGTPAEFDPQALLALSLRQRLRALRGYAAAAQA
FT                   HGHPWQSVMDRVRPFGQALWQSLSATEQRRFLRHTVRYWDVHRHRVAEPVYAQLQEIHR
FT                   SGQLRVHRARLESVSAVDTCVQVNGMGADGVPLQLQAHCVINATGVELRVQTIRNPLLH
FT                   QLLGSGHAQQGPHGIGLATGADGALLDANGRADPRIRVLGSLRIGSLWESLAIPELRMQ
FT                   AQATAQALLSLELPLARIS"
FT   gene            144995..147196
FT                   /gene="uvrD"
FT                   /locus_tag="XALC_0113"
FT   CDS_pept        144995..147196
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="XALC_0113"
FT                   /product="probable atp-dependent dna helicase protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14659"
FT                   /db_xref="GOA:D2U8R1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005753"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14659.1"
FT                   /translation="MDVSHLLDDLNPAQREAVSAPPGHYLVLAGAGSGKTRVLTHRIAW
FT                   LHEVHGVPVHGMFAVTFTNKAAGEMRHRADLQLRNGSRGMWIGTFHGLAHRLLRLHWQD
FT                   ARLPESFQVLDADDQLRLVKRVVQQLELDEGKFPPKQIAWWINQQKDEGRRAQHIQPEP
FT                   HDVWINTLRNAYALYQERCDRAGLVDFAELLLRAHELLRDTPALLAYYRARFAEILVDE
FT                   FQDTNAIQYAFVRVLAGDSGRVFVVGDDDQAIYGWRGAKVENVQRFLKDFPGAQTIRLE
FT                   QNYRSSANILNAANAVIAHNPDRIGKQLWTDSGDGEPIDLYAAYNEVDEARYVLERARQ
FT                   WVRDGGSYSEAAVLYRSNAQSRAFEEALLAEQVPYRVYGGMRFFERAEIKDTLAYLRLV
FT                   ANRADDAAFERAVNTPARGIGDRTLDEVRRLARVQSLSLWTAAQHAAQQGGELAARARN
FT                   ALGQFLGLIEQLVLEVADLSLPEQIDHVLARSALRDHWSKESRSGLDSESRTDNLDELV
FT                   SVASRFVRVDAEDDADEARQAMSELVAFLAYAALEAGEGQARADEDGVQLMTLHSAKGL
FT                   EFPLVFLVGMEDGLFPSARSLEESGRLEEERRLAYVGITRARHTLVLSYAESRRIHGQD
FT                   NYNVPSRFLREIPRELLHEVRPKVQVSRSASLGAPRNPGHPRIEAPAIKLGANVQHPKF
FT                   GGGVVIDYEGSGAHARVQVQFDEAGAKWLVMAYANLTVR"
FT   gene            complement(147279..149216)
FT                   /locus_tag="XALC_0114"
FT   CDS_pept        complement(147279..149216)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0114"
FT                   /product="putative glycyl aminopeptidase precursor protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14660"
FT                   /db_xref="GOA:D2U8R2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR007963"
FT                   /db_xref="InterPro:IPR024191"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040756"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14660.1"
FT                   /translation="MPAPFRPAFRCLDLALSLGIALAVSGTAHAQAARTADVPAPRDTP
FT                   YPGTITLQVDAGDVRQGIYRVHETIPVGAGRLTLQYPQWIPGDHSPSGPVAMLAGLTLT
FT                   ANGKPLPWRRDTFDVYSFHVDVPEGVRAIEASFQYLSPRDDGFEMTDKMLQLEWNKVAL
FT                   YPAGHDTRQITVAPSVILPAGWEFGTALETASHSGATTIFKPVDFTTLVDSPIYAGRYF
FT                   KRVDLTPPGSAPVHLDMVADAPRFLEISPEQRQAHRNLPVQAIKLFGSHHYDHYDFLFS
FT                   LSDVLGGNGLEHHQSSENGLGADYFSAWADNAADRDLLPHEYTHSWNGKFRRPADLWTP
FT                   TFNVPMGDSLLWVYEGQTQYWGYVLAARAGMWTPQQFRDALAMTAANYDRNRAGFRWRS
FT                   LQDTTNDPTAAHRAPLPYRSWQMSEDYYSGGQMVWLAVDAKLRALSGGRKSLDDVAKAF
FT                   FGVDDGSHAVKTYSFDDVVAALDGVAHFDWTTYLQRRVYAVDPPLLEGLQASGWKLVYT
FT                   DQPSEFEKQYDGSHPSARHRYNFAWSIGLVMNDDASINDVLWDGPAFKAGISTGATLLA
FT                   VNGQDYSRDTLKQAIAEAKGGTAPIVLTLKYQGNLRDFAVHYHDGLQYPHLVRVNGTPD
FT                   YLSQIIAARH"
FT   gene            149599..150045
FT                   /locus_tag="XALC_0115"
FT   CDS_pept        149599..150045
FT                   /transl_table=11
FT                   /locus_tag="XALC_0115"
FT                   /product="putative universal stress protein (usp)"
FT                   /function="cell processes go:0009987; adaptation to stress
FT                   go:0006950"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14661"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R3"
FT                   /protein_id="CBA14661.1"
FT                   /translation="MYQRILIAIDGSELSAKGLQHGLALAAKLGAQVDILTVSEPWAMG
FT                   MYDAMGWGVGYEASPGYRRDREASAQSILAPALAAAAAAGVTAHGRHLLDRYAAEGIID
FT                   MAIDCASDLIVMTSHGRRGMSRILLGSQTAEVLANSKLPVLVIR"
FT   gene            150602..151297
FT                   /locus_tag="XALC_0116"
FT   CDS_pept        150602..151297
FT                   /transl_table=11
FT                   /locus_tag="XALC_0116"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14662"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14662.1"
FT                   /translation="MSILAFHPPHLAHHFPQGVHAIEHPADTFPDRAQIVAALPRTDQG
FT                   EVQLHYDTLWIGGGHGDVDDQGAPTQFNGCRNVAVFQRFIADLVDIGIRTPALIVDTCF
FT                   SLASLPQLAPLLTEDGVFAGWSCICATTRNELLASHRLPALVEQTETALAEVTTAASSQ
FT                   VVYLAPDRVLIRHARLTASAGGMEANDLPDAEATLARVGSLTWQHRPLIATDQPIEGHD
FT                   AFIDRLRQL"
FT   gene            151354..151779
FT                   /locus_tag="XALC_0117"
FT   CDS_pept        151354..151779
FT                   /transl_table=11
FT                   /locus_tag="XALC_0117"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14663"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14663.1"
FT                   /translation="MTTYTNNNTGTFSSASSKIRDHVLDDYLAAKIANYVGIRRDDVND
FT                   ATVIRIPANYANSEGVIKGMELVKGLRVDLQAAQVHGGNRYATWQVQWGTGSGGKNGGA
FT                   YAGVLMRVDTDFTFAEFRQAMRESFGYTPGAYCRLDP"
FT   gene            complement(151826..152113)
FT                   /locus_tag="XALC_0118"
FT   CDS_pept        complement(151826..152113)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0118"
FT                   /product="putative secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14664"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14664.1"
FT                   /translation="MKALILIPLLLLAGCASTGTGPDGAPMDMRGAQVTQRKMENGDTV
FT                   DEYRIAGQLRMVKVTPARGPAYYLYDRNGDSHMDGNKDNVSPVYWKLYSW"
FT   gene            152206..154974
FT                   /gene="polA"
FT                   /locus_tag="XALC_0119"
FT   CDS_pept        152206..154974
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="XALC_0119"
FT                   /product="probable dna polymeraseIprotein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14665"
FT                   /db_xref="GOA:D2U921"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2U921"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14665.1"
FT                   /translation="MSRLVLIDGSSYLYRAFHALPPLTNAAGEPTGALFGVVNMLRATL
FT                   KERPEYVAFVVDAPGKTFRDALYPQYKANRPPMPDELRAQVEPMCQIVHALGITILRES
FT                   GVEADDVIGTLALQGVGDGMDVTISTGDKDFAQLVRPGVQLVNTMSGSRMDSDAAVMEK
FT                   FGVLPHQIVDLLALMGDTIDNVPGVEKCGPKTAAKWLADYGSLDGVIANADAIKGKIGD
FT                   NLRAALGRLPLNRDLVTIKTDVVLSGGPRTLGLREPEPEQLRGLYQRYGFTQALRDLDG
FT                   GVAAPYVASEASPSLRGTAAGYARAAAAPDGALDPALAAKGHYAAVTTAEQFDALLARL
FT                   RAADGFAFDTETDALDAMRANLVGLSFAIEPGHADYLPLGHDYPGAPVQLDRVQALAAL
FT                   APLLEDPAKRKVGQHGKYDLHVLRRHGVQVHGYADDTMLESFVLNSTASRHDMDSLAKR
FT                   YLGYDTVKYEDVAGKGAKQIAFSQVAIDDATGYAAEDADITLRLHRALSAQLDAEPALA
FT                   RVYREIEMPLVPVLTRIEANGVCVDIAELRKQSQVLSQRMLAAQQKAVALAGRSFNLDS
FT                   PKQLQAVLFDELKLPALLKTPKGQPSTNEEALEAIADQHELPRVILEYRGLAKLRSTYT
FT                   DKLPEMVNPETGRVHTSYHQAGAATGRLSSSDPNLQNIPIRTEDGRRIRRAFVAPPGRK
FT                   LIACDYSQIELRIMAHLSEDPGLLRAFSQGVDVHRATAAEVFGRTLEQVSANERRAAKA
FT                   INFGLMYGMSAFGLARNLGIGRGEAQDYVALYFSRYPAVRDFMERMREQARTQGYVETL
FT                   FGRRLYLNDINAKQQGLRAGAERAAINAPMQGTAADIIKRAMVSVDTWLQDHRARALMI
FT                   LQVHDELVFEVDADFVEILLPEVTWRMAAAAELKVPLVVDSGVGDNWDEAH"
FT   gene            complement(155608..156507)
FT                   /gene="hemF"
FT                   /locus_tag="XALC_0120"
FT   CDS_pept        complement(155608..156507)
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="XALC_0120"
FT                   /product="probable coproporphyrinogen 3 oxidase, aerobic
FT                   protein"
FT                   /function="metabolism go:0008152; heme, porphyrin
FT                   go:0006783 go:0006779"
FT                   /EC_number="1.3.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14666"
FT                   /db_xref="GOA:D2U922"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:D2U922"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14666.1"
FT                   /translation="MQTFDRVRDYLTGLQDRICATVEATDGQARFAEDVWQRAEGGGGR
FT                   TRILRDGAVFEQAGVGFSDVSGTRLPPSASANRPELAGASWRAVGVSLVFHPLSPYIPT
FT                   THTNVRYFEAEREGATVAWWFGGGFDLTPYYPFDEDARHWHQTAHDLCAPFGAERYPAH
FT                   KRWCDEYFYLKHRNETRGVGGLFFDDLHADFERDFAYQRAVGDGFLDAYLPIVARRRAL
FT                   PWGEREREFQLYRRGRYVEFNLVYDRGTLFGLQSGGRSESILMSLPPRVRWEYGFQPEP
FT                   GSPEARLAEYLVPRDWLA"
FT   gene            complement(156646..157197)
FT                   /locus_tag="XALC_0121"
FT   CDS_pept        complement(156646..157197)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0121"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14667"
FT                   /db_xref="GOA:D2U923"
FT                   /db_xref="UniProtKB/TrEMBL:D2U923"
FT                   /protein_id="CBA14667.1"
FT                   /translation="MSPPPLHPAGHQMIDAMGKIALLLGVLSLLSALAQALTLMALPDG
FT                   NIETMLQPFGLPLPPWLHTCMTHAIALSWLAATLALALCATSWALLQRHEWARRVFVAF
FT                   LVVTAVANFAMLPLLWQLFDMLQAWAPQHGFDAHMQHQLHSSRITVLFSALLTALVFAV
FT                   LHGWLVYQLSRPALRSAFRR"
FT   gene            complement(157430..159781)
FT                   /locus_tag="XALC_0122"
FT   CDS_pept        complement(157430..159781)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0122"
FT                   /product="putative dipeptidyl-peptidase iv protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14668"
FT                   /db_xref="GOA:D2U924"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D2U924"
FT                   /protein_id="CBA14668.1"
FT                   /translation="MLSLSCLPPLVAAQNVAPLTIEQTMADPDWIGPPVEDAWWAWDGR
FT                   QVQYKLKRNGSPVRDTYRQGIDGSTAQRIEDTQRSTLDAANPVYDAARRRMLFVRNGDV
FT                   FLRDLRSGALTQLTRSNQAAARPQFSTDGGALWRVGNDWYRWNPDSGIAQAALLKAERD
FT                   PDTAPKLDTLRAQQLHTLETLARDRAQRDLLRQQEQAWRRADGSRAPAPVYLGEDVVID
FT                   DSALSPDGRHLLVVTHAKGADEGREGKMPKYVTESGYEEFQEVRTRVGRNPPLAQNLWL
FT                   VDIAAGSARKLDFAVLPGIHNDPLAALRKAAKQEPLHGPRAIQVETDGDGSGATMHWSE
FT                   DGRNVAVMLRAVDNKDRWIASVDLDKAVLQPRHRLTDPAWINWNFNDFGWMPDNQTLWL
FT                   LSEQSGDAHLYTQHGTDKPRQRTAGNWEVSAPVMSADGQGFLFLCNRKWPGDYEVCKLD
FT                   LRDDSVVELTSLEGVEDFALSPDGQHLLVHYSGAYLPPQLAVLPASGGSARVLTDTRSA
FT                   AFKARPWIQPQFVQIPSTHGAGTVWGKYYGPPHPEPGKRYPVVMFVHGAGYLQNVSVRY
FT                   TPYFREQMFHNLLVQKGYIVLDLDYRASAGYGRNWRTAIYRDMGHPELEDYLDGLDWLV
FT                   ATKQGDRHRAGIYGGSYGGFITYMALFRSPGTFKTGAALRPVADWSQYNHEYSADILNT
FT                   PDLDPQAYRTSSAIEYASGLRDHLLIAHGMIDDNVFFKDSVDMTQKLIELHKDNWEIAP
FT                   YPLERHGFTRADSWLDEYKRILKLFEQELK"
FT   gene            160080..161483
FT                   /locus_tag="XALC_0123"
FT   CDS_pept        160080..161483
FT                   /transl_table=11
FT                   /locus_tag="XALC_0123"
FT                   /product="putative cytochrome bd ubiquinol oxidase,
FT                   subunitIprotein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14669"
FT                   /db_xref="GOA:D2U925"
FT                   /db_xref="InterPro:IPR002585"
FT                   /db_xref="UniProtKB/TrEMBL:D2U925"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14669.1"
FT                   /translation="MDALLLSRIQFGFVISFHILFPAFTIGLSSWLAFLEWRWLRTRDT
FT                   VWRDLYFFWLKIFAVSFGMGVVSGIVMSFQFGTNWAVLSERAGNIIGPLLNYEVLTAFF
FT                   LEASFLGVMLFGWHKVPEKLHFLSTCLVAIGTLISTFWILSANSWLQTPAGYVIVDGVF
FT                   HPANWGEVIFNPSFPYRLTHMVLAAFITTCFVIGGVSGWYLRRGEHVDAAGCMLKLAVA
FT                   FAAIALPLQIAAGDAHGLNTLEHQPIKVAAMEAHWHREAPGQGVPLVVFAVPNEAEERN
FT                   DYALTIPHLGSVILTHTLNSEITPLTAVPADERPPVKPVFFAFRVMVGLGMAMLLLAFV
FT                   SLFFWWRGTLLRRRGLHLAWNVMLPAGFVALLAGWFVTEIGRQPYVIYGLLHTRHAVSP
FT                   IISPAMVWISLGVYVVVYALVFGFGSWYILRMLRHGPLPHEPAPRLHDGGKTPARPLSV
FT                   VDDDIEETC"
FT   gene            161483..162499
FT                   /locus_tag="XALC_0124"
FT   CDS_pept        161483..162499
FT                   /transl_table=11
FT                   /locus_tag="XALC_0124"
FT                   /product="putative cytochrome bd ubiquinol oxidase, subunit
FT                   II protein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14670"
FT                   /db_xref="GOA:D2U926"
FT                   /db_xref="InterPro:IPR003317"
FT                   /db_xref="UniProtKB/TrEMBL:D2U926"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14670.1"
FT                   /translation="MDMATVLPVIWFGVIGFGVLMYVLLDGFVLGLGILAPFAEDEGQL
FT                   DLMMNTAAPIWDGNETWLVLGGAGLLAAFPKAYAVVLSALYLPVLLMLIALVFRGVAFE
FT                   FRFKARSSKYLWGWAFALGSLCAAFWQGVILGALVEGMPLQDGKYLGGVLGWFSPFSML
FT                   TGAALVFGYALLGGSWLILKTEGAMQHIARTLTRPLVLVVVVFMGLVSAWLPFLDSRIM
FT                   ARWFHDGNFWWLSPVPLLVLVNAVALWRAAMAQGRDARPFVLTLCFFVLGFFGLVLGIW
FT                   PNIVPPGLTIWEAASPPSSQGFVLVGLALLLPVILGYTAWSYRVFRGKITADTGYHH"
FT   gene            162617..163969
FT                   /locus_tag="XALC_0125"
FT   CDS_pept        162617..163969
FT                   /transl_table=11
FT                   /locus_tag="XALC_0125"
FT                   /product="putative amp-dependent synthetase and ligase
FT                   family protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14671"
FT                   /db_xref="GOA:D2U927"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2U927"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14671.1"
FT                   /translation="MSAVSASSLLHPLAVGDAERPLAFADGEHIDLATFLGHVRGLAAA
FT                   LPSGQHALNLCEDRYRFMVAFCAVALRGQTSLLPSSRAPAVVAEVQRTHPDGYCLGDLF
FT                   MVDAPPGYWQLPEPLPTLDGPMPQLADDALVAIGFTSGSTGVPKPNPKTWGSFLTSTRQ
FT                   DLLALAGLWSADAVPQVVATVPPQHMYGMEMSVLLPLVTPLAVHAARPFFPEDVASALA
FT                   QLPVPRLLVTTPVHLRALVESGVELPPLAGIVSATAPLAQELAAAAQARFGGEVREMFG
FT                   STETCIFASRRTAQEVSWTPLPGVRVLPQPDGTLVHAPHLAQPVLLADLMEVDAQGRFQ
FT                   VRGRQADLLEIGGKRASLADLTRRLLALPGVVDAAMLQLDPEPGQAVGRIAAAVVAPTL
FT                   DEDAILDALRRELDPLFLPRRLRLLDALPRNETGKLPRERMLALLAGVREG"
FT   gene            complement(164075..165091)
FT                   /locus_tag="XALC_0126"
FT   CDS_pept        complement(164075..165091)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0126"
FT                   /product="probable pteridine-dependent deoxygenase like
FT                   protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14672"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D2U928"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14672.1"
FT                   /translation="MSPPYQQFQEHAQHHPQLQVEYIAETDPSQVLGEDKVLAVFGFGD
FT                   AAPHHDDPRYLRVPLQPYGPRMLEIWRTDTPVRSGRAGAIAWASDGQLQFAAIEIDERA
FT                   LDLDIEKAATQAYAQISAFVAGSATPCLLRIWNHLDAITLGSGDRERYRRFCVGRARGL
FT                   GDFDANRLPAATAVGRCDDAPVMQIYWLAAARAGTPLENPRQVSAYNYPRQYGPQPPSF
FT                   ARAMLPPVGSDMPLLLSGTASVVGHASMHRGQLLAQLEETFANFDALLGAARTHVPDLP
FT                   AQFGDGTRLKVYVREKADLPLVAAALDARFGERIPRLLLHAVICRDELAVEIDGVHG"
FT   gene            complement(165088..166308)
FT                   /locus_tag="XALC_0127"
FT   CDS_pept        complement(165088..166308)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0127"
FT                   /product="putative oxidoreductase protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="1.14.13.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14673"
FT                   /db_xref="GOA:D2U929"
FT                   /db_xref="InterPro:IPR006905"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2U929"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14673.1"
FT                   /translation="MSVLEKDRHPRFHIGESLLPMNIPILRRLGVLEQVRAIGVLKLGA
FT                   DFPNDAGGYNTFRFAHALGARSDYAFQVPRADFDRILAERARAVGATVHEGTRVEAVQL
FT                   DGARPVVQARSAEGLCHYRPRYLIDASGRDTFLGNTLKLKRANARHASAALFSHFRGVM
FT                   RRPGEDAGNISIYRHAHGWMWLIPLPDDVMSVGAVCDPSYMKTRQGDSEGLLMRTLALN
FT                   PDVAARMTGAQRVAPVHATGNYAYECTRMSGPRWLMLGDAYAFVDPIFSSGVYLAMHSA
FT                   ERGAAMIDAALRDPTSEARLQRRLEKQLRGGLDQLKWFIYRFTSPTMRELFAQPRNVLQ
FT                   VEQAVVAMLAGDVFDNRAVLRRLRVFRIIYAISALAMSPRAWRAWRHRRREAREQFHGD
FT                   TLHREPS"
FT   gene            166575..166844
FT                   /locus_tag="XALC_0128"
FT   CDS_pept        166575..166844
FT                   /transl_table=11
FT                   /locus_tag="XALC_0128"
FT                   /product="putative acyl carrier protein"
FT                   /function="metabolism go:0008152; acyl carrier protein
FT                   go:0042967"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14674"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:D2U930"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14674.1"
FT                   /translation="MSSQTPAERELAELLVESLNLEDVQPDDIDPEAALFNTGLGLDSI
FT                   DALELALAISKRYGFQLRSDNDENRRNFASLRALSAHVEANKTH"
FT   gene            166867..167145
FT                   /locus_tag="XALC_0129"
FT   CDS_pept        166867..167145
FT                   /transl_table=11
FT                   /locus_tag="XALC_0129"
FT                   /product="hypothetical protein (fragment)"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14675"
FT                   /db_xref="GOA:D2U931"
FT                   /db_xref="UniProtKB/TrEMBL:D2U931"
FT                   /protein_id="CBA14675.1"
FT                   /translation="MPALGVLLALVSVAALVPLWRSPHALLLLSVPPVLFAAWVAWFFG
FT                   RSLQRGRTPLITRIVEALYRQAAMPISPEQPRYTRRLTLAWTLCCWR"
FT   gene            167130..167411
FT                   /locus_tag="XALC_0130"
FT   CDS_pept        167130..167411
FT                   /transl_table=11
FT                   /locus_tag="XALC_0130"
FT                   /product="hypothetical protein (fragment)"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14676"
FT                   /db_xref="GOA:D2U9E6"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9E6"
FT                   /protein_id="CBA14676.1"
FT                   /translation="MLLALTLLSLMLALCVQPGVVLVQLGRASPLPTSDAHTALVANLF
FT                   GYGIIGGFFVGEYLLRGRWFPQRPYRNLFDFLHRLARLGPVFWRDLLR"
FT   gene            167439..168218
FT                   /locus_tag="XALC_0131"
FT   CDS_pept        167439..168218
FT                   /transl_table=11
FT                   /locus_tag="XALC_0131"
FT                   /product="putative xanthomonadin biosynthesis
FT                   acyltransferase protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14677"
FT                   /db_xref="GOA:D2U9E7"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR004552"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9E7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14677.1"
FT                   /translation="MQIIKGKSKNISPTRMLSRTAWAVCNALQLLFTMVYTALGIVVVL
FT                   LLLPMTGPRLPLRMAARIWAPALLFGAGVRLQVEGRERVDWSRNHLFVSNHQSIIDICA
FT                   LFMALPVPLRFLLKDEMLKVPFVNCYARYTGMLFLDRNSRRAGAVVRREAAALLRRDED
FT                   LCLFPEGTRSRSGELAEFKAGLLQAAIDAGVDVIPVALDGAGKVLPPSSLFRVRPGIIR
FT                   VRIGAPIRVQSDNGPLTRQMLTQRAHQAVRAMLEPRI"
FT   gene            168228..168515
FT                   /locus_tag="XALC_0132"
FT   CDS_pept        168228..168515
FT                   /transl_table=11
FT                   /locus_tag="XALC_0132"
FT                   /product="putative xanthomonadin biosynthesis acyl carrier
FT                   protein dehydratase"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14678"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9E8"
FT                   /protein_id="CBA14678.1"
FT                   /translation="MYFVVPHDHPSLPGHFPGRPVVPGVVVLDHVLQAVEAAHGARAPL
FT                   RLPQVKFLQPLLPDQSARVELEGIAPRWRFRVLRGEDLLVSGELSAEAMA"
FT   gene            168512..169486
FT                   /locus_tag="XALC_0133"
FT   CDS_pept        168512..169486
FT                   /transl_table=11
FT                   /locus_tag="XALC_0133"
FT                   /product="putative xanthomonadin biosynthesis
FT                   acyltransferase precursor protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14679"
FT                   /db_xref="GOA:D2U9E9"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR014548"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9E9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14679.1"
FT                   /translation="MSAVWKQRPEAGGRFALWLIRSIARYGGRTIGRLLLYPITLYFLL
FT                   VRRPERRDSRRYLSRVFGRPATLLDVARHIHTFASTILDRVFMLCGHIHRFRIQIHGLD
FT                   QLRVQMDRGRGVLIFGSHLGSFDALRVLATKRPDVQVKVVLDKAHNPALTDLLAALNPS
FT                   LAANIIDAGMDSTAVVMAIKQAADEGALIALLVDRPQPEDPALPVDFLGEQARFPTSPW
FT                   LIAAALKVPVMLAFGLYRGGNRYELVFETFSECLDLPRRQRAPALAALMRDYAARLEHY
FT                   TRSAPYNWFNFYDFWNTPHADASHLVIDADTAVQRRTAIRRVA"
FT   gene            169410..170057
FT                   /locus_tag="XALC_0134"
FT   CDS_pept        169410..170057
FT                   /transl_table=11
FT                   /locus_tag="XALC_0134"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14680"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14680.1"
FT                   /translation="MPMRRTLLSMLILLCSAARLYAASPEPLDPDWILQQLVRPVPVST
FT                   AFVELRGSVLLKAPLRVQGEYRRPDAQTLVREVTAPYHEITTLRGGEAMLERDGKPPKR
FT                   FSLARVPELAGLQSGFGALLSGDRAQLQQQYTLSSVGTREHWQLQLQPKQPALAAHVRS
FT                   LRLYGRGTELRCIETTPASGEVQRTLLAGAAQAAADIAETAALTALCHGDAT"
FT   gene            170083..172461
FT                   /locus_tag="XALC_0135"
FT   CDS_pept        170083..172461
FT                   /transl_table=11
FT                   /locus_tag="XALC_0135"
FT                   /product="hypothetical xanthomonadin exporter protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14681"
FT                   /db_xref="GOA:D2U9F1"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14681.1"
FT                   /translation="MGAAMTRTLGSKMRIWLALLWLALLTVAGVWLGNALQLSGDLRKF
FT                   MPEARTPAQKLLLDELGEGPGSRLLLMSLSGAEPATLARQSQALRAQLAAQREVFELVA
FT                   NGADAGLDAVPERLLPYRYLLSDSFDAKPLDAATVADALQARLQDLGSPAADMVEPLLP
FT                   RDPTMEVLHLAESLQPAGAPQPRDGVWFDRAGKEALLVAQTHAAGFDPTGQQRAVDAIH
FT                   RAFAKVAAGSTSRLTLTGPGAFSVEIGGRTQAEAQWIGTLDTVGLIVLLLVAYRSWKIP
FT                   VLGVLPLASAGLAGLGAVALLFDGVHGITVAFGFTLIGVVQDYPIHLFSHQRPGLDPRE
FT                   NARHLWPTLATGVVSTCIAYVTFLFSGVDGLRQLAVFTIAGLLVAALTTRLLLPALIDP
FT                   SPRDHADSPALARLWRGIARLPRPRWSLLPLALAAVAIIVFAPGPFWQNDLSKLTPVPA
FT                   ADLARDAHLRQELGAPDVRYVLALPAASVDAALAASERLRPRLDALVAQGELAGYDMAA
FT                   RYLPSVATQRRRQAALPDPTQAQALIAAAIAATPFRRDAFAPFLADLQRARSAPPLTTR
FT                   DLRGTPLATSVGGLLLERPDHATALVSLTGLRDPARLASAVQGSGAQLLDLKDASESLV
FT                   AAYRGRVLGALSVAALLLVLTVAIALRTPRRIARVLLPMALTTLLILAILRGCGVELNL
FT                   FHLIALILAAGLGLDYALFFDHAGDDRADQLRTLHALIVCSLMTLLVFALLAASSIPVL
FT                   RAIGSTVALGVLFNFVLALLVSRETASEAAQESRHAHSH"
FT   gene            172445..172906
FT                   /locus_tag="XALC_0136"
FT   CDS_pept        172445..172906
FT                   /transl_table=11
FT                   /locus_tag="XALC_0136"
FT                   /product="hypothetical xanthomonadin biosynthesis protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14682"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14682.1"
FT                   /translation="MHTHTDGLDGRDAIAALVPHQGLMCLWEQVVAWDAQRIVLRSQAH
FT                   RSVEHPLRCGQRLRALHLCEYGAQAMAVHGGLLGRAAGMPVRPGMLVALRGVQLHVTDL
FT                   HDLPQAIECEAELLLQMESGQQYAFRIVHAGQPLAEGRATVMPGTAERA"
FT   gene            173038..173775
FT                   /locus_tag="XALC_0137"
FT   CDS_pept        173038..173775
FT                   /transl_table=11
FT                   /locus_tag="XALC_0137"
FT                   /product="putative short-chain dehydrogenase/reductase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14683"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14683.1"
FT                   /translation="MSSSPVSRRALVTGGSGDLGGPICRTLAAQGLHVIVHANAGLARA
FT                   VAVVEAIVAAGGSAEAIAFDVTDAQACADALAALLEAGPIQVLVNNAGIHDDAPLAGMS
FT                   AAQWHRVIDVSLHGFFHVTQPLLLPMARTRWGRIVSVSSVSAVLGNRGQANYAAAKGAL
FT                   HSASKSLAREMASRGISVNVVAPGVIESAMAGAAFAPEAIKQLVPAGRAGRPEEVAALV
FT                   GFLCTDLAGYINGQVIGVNGGMG"
FT   gene            complement(173915..175591)
FT                   /locus_tag="XALC_0138"
FT   CDS_pept        complement(173915..175591)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0138"
FT                   /product="putative tannase/feruloyl esterase family
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14684"
FT                   /db_xref="InterPro:IPR011118"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F4"
FT                   /protein_id="CBA14684.1"
FT                   /translation="MSHALSVLTLSLASLAVSSTAMAQKGPAVPAQLQQSCEALAANPN
FT                   LSYPDTTFTGVRTVPAGALSVAGKPIDAHCQITGTMHTRVSPVDGQTYAIGFEMRLPTT
FT                   WNGRFFYQANNGLDGYVNTAVGDIGGSAQQDNPLHMGFAVIDSDAGHNGDKNRFFGLDP
FT                   QARLDYGYQAVQALTPMAKHTIQTAYGKPPDVSYFGGCSNGGRHAMVAAARDAQDYDGI
FT                   LAGDPGFHLPKAAIAEMAAAQQLATLTDGNDIQSGLTGAERAFVASRIVATCDALDGVS
FT                   DGMVQNVSACQTLFSLASNVPTCGNAGRTGQCLTRAQKQVLAAIYAGPHDSAGTALYAP
FT                   FPYDPAIGSGDWGGWRQYNSMTLVPNSMAFVFASPPENMSVNQNLGQYTLHFNLDRDAS
FT                   KIFGTSGTYNASSWSFMVPPDETHLTTLKSRGGKLLVYHGTGDSIFSFTDTADWYQRLT
FT                   TADPNAASFARLFAVPGMVHCGGGPATDQFDALTPLIAWVEQGQAPTAITATARGRGSV
FT                   SPNGEVPANWSSQRSRPLCPYPQVAQYVAGDVESASSFVCR"
FT   gene            complement(175782..177404)
FT                   /locus_tag="XALC_0139"
FT   CDS_pept        complement(175782..177404)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0139"
FT                   /product="putative halogenase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14685"
FT                   /db_xref="GOA:D2U9F5"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14685.1"
FT                   /translation="MNERCADVVIVGGGLAGLTLALQLRQRVPELRISVLERHAHPVRE
FT                   AAFKVGESSVEIGAHYFAEVLGLREHLDAEQIRKFGFRFFFSDRREDLDRCTELGVSQL
FT                   LPTPSWQIDRGRFENFLGTRARALGVEFLDASTVRGIDLADDDGNHCVRYARDGVEAAL
FT                   HARWVVDASGRAGLLKRKLGLAQDNAHRANAVWWRVDGHIDPNVWSQDNAWLQRCTPPD
FT                   RWRSTNHMCGPGYWFWMIPLSSGAHSLGIVCDATLHPLETMNSHDKAMAWLRTHQPQIA
FT                   RTLEHSAYAVQDFMFLRDFSYGCKHVFSAQRWALTGEAGVFLDPFYSPGNDFIAISNTY
FT                   ICELIALERDGRNIAPYATLYQQLYFSFYENTLTLYQDQYPLFGDAQVMPVKVIWDYTY
FT                   YWSLLAPLYCSGRTTNVAVLGQLRSAFEQARALNLGVQALLRDWGAANRAQDAVVIDGR
FT                   LLDQYLIDWFHELNRALHDRLDDAAFVARLHDNVAHMATLASEILERAHARHPALADHG
FT                   LTVYSSAPGPAPILSAAWYADAA"
FT   gene            complement(177401..178222)
FT                   /locus_tag="XALC_0140"
FT   CDS_pept        complement(177401..178222)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0140"
FT                   /product="putative glycosyl transferase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14686"
FT                   /db_xref="GOA:D2U9F6"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F6"
FT                   /protein_id="CBA14686.1"
FT                   /translation="MSRAPLNDADAAILIPALNEALRIREVVSDALAHCPRVIVVDDGS
FT                   DDGTSDCLAGLPVTLIRHPQRLGKGAALRSGFAEAQRQGARAVMTMDGDGQHSASDFPR
FT                   LLAAANRHPGCVIVGARLRKRASQPAIRRLGNDFGDWGIAWGCGFRLVDSQSGQRLYPH
FT                   SVYTLRDVPGEGFVFEAQLLISAARQAGARVVAVPIETRYAQQTPGTFRKSHFRLVRDL
FT                   WKITSHVVVQVWQYGHVVREYRRARANPVVIDDADSGGAALSMASGKESTT"
FT   gene            complement(178219..178995)
FT                   /locus_tag="XALC_0141"
FT   CDS_pept        complement(178219..178995)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0141"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14687"
FT                   /db_xref="GOA:D2U9F7"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F7"
FT                   /protein_id="CBA14687.1"
FT                   /translation="MLKAAIEGVGFWMPGLPSWAAAQAFARGAKAPLETPARPSPQLLA
FT                   PNERRRAPDTVAVSLEVALAACQDAGRDPATLPSVFTSTHGDMIITDYMCATLASEPLS
FT                   ISPTKFHNSVHNAAAGYWTIGAGATTATTALSAHHGSFAQGLLEALSQLAAGDEAVLLV
FT                   GYDSRSVGVLGRISHSAGLLGGALVLSTATRSDLPRLQAHLRDGVAVPGAGALARHAAA
FT                   NAMAPMLPLFDALAVGATGCMLDAGGGRCLQVDLPA"
FT   gene            complement(179004..180203)
FT                   /gene="fabF"
FT                   /locus_tag="XALC_0142"
FT   CDS_pept        complement(179004..180203)
FT                   /transl_table=11
FT                   /gene="fabF"
FT                   /locus_tag="XALC_0142"
FT                   /product="probable 3-oxoacyl-[acyl-carrier protein]
FT                   synthase II precursor"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14688"
FT                   /db_xref="GOA:D2U856"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:D2U856"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14688.1"
FT                   /translation="MAPVAIRAYTATTALGSGVQAQASALREGRSGLRRNDFGTQPLPC
FT                   WIGRVDALERAALPPALAYAESRNNRLAWLAMQQDGMAAVVADAAHRHGAERVAVVMGT
FT                   STSSIGASEEAYTRLEYDAQGPRFPEDLNQPIVHTPHSLGDFVRRATGLRGPCITVATA
FT                   CSSSAKVFAQAARLIANGVVDAALVGGVDTLCGSVLFGFNALQLVSPEPCRPFDMRRVG
FT                   LSLGEAGGYALLERNDAIDAPPALALLCGYGESSDAHHMSTPHPQGLGARLAMRGALQR
FT                   AGVDPAEVGYLNLHGTATQANDSVEAAAVAAVFPATLHASSTKAWTGHTLGAAGIVDSV
FT                   FALLALRDGLLPGTLNSAMPDPVCGPQIRFDTAHAQVRYAMNNSFGFGGNNCSLLFGRP
FT                   "
FT   gene            180434..180694
FT                   /locus_tag="XALC_0143"
FT   CDS_pept        180434..180694
FT                   /transl_table=11
FT                   /locus_tag="XALC_0143"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14689"
FT                   /db_xref="InterPro:IPR027354"
FT                   /db_xref="InterPro:IPR038068"
FT                   /db_xref="UniProtKB/TrEMBL:D2U857"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14689.1"
FT                   /translation="MQAYVYKSQRKPDTYLYLAARDDFGCLPPTLLATLHPLTFVLEVA
FT                   LSAERTLARADPVAVRANLSGCGFHLQLPPRPDGLIDRHDD"
FT   gene            180687..184004
FT                   /locus_tag="XALC_0144"
FT   CDS_pept        180687..184004
FT                   /transl_table=11
FT                   /locus_tag="XALC_0144"
FT                   /product="hypothetical ankyrin-like membrane protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14690"
FT                   /db_xref="GOA:D2U858"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D2U858"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14690.1"
FT                   /translation="MTESFFRTRAPMLAAALGALLALAAGVGPFAALLGGWLAQPAFAL
FT                   AVSWHRGSRSRPTSLKALAATVTPLLVLWAGGLAVVALLVAWPLAALRDSGSLTAALAL
FT                   SLAASAVLLGLWRIWPLWHGCECADGSLRPRWHALVQQDVQAWRGLGVAGLVLALAGLG
FT                   VLMAWPGLLATTTRWPLALAYAMLSPLLHAALQRVAPPQVLSPVPSSADLFAEFSAAVP
FT                   RMDEPAPPQEQLHVALYDAARSGRVDRALQLLQAGGDPHALPAADWRDQRSLPVLAAVL
FT                   PDLRLLRDLIVRGVDVNRPHLGMTPLLAATRDSWHGRPEAVMTLLANGADPRASDSDGN
FT                   TPLHHAARSSDPGVAALLRDAAAELDVPNRDGLTPLAVACQVGNWRMGKFLLERGAKPE
FT                   PPDASPVLLAAAGTEEDDPAGVQLLLKHKARVDARDHQQRRSALHEAAQAGHVEIVQAL
FT                   LGAGANLEARDALGRTPWLEAARHGRVAVLERLLPHKPDVHAVDGDGRNALLLACTADQ
FT                   VSPDLIRRLRELGVSAAQPDHAGRRAVDVAAEAGRWAIVSALDPDYPLPAAVSDGQGEI
FT                   GSAGLPDRAPLELLREGLQLGQPGDGLAALARLCAVEELGTLLHDKDVALKPRAVDWLL
FT                   AHGAAPEVLDADGDTPMFALLARGVEALPSLQVLLRNGVSPAGRGGLTRLLAACAQHDH
FT                   ASRALEQFALELLERGADPFAPSPAGDPPLSLAVRLGWLRLQLHLLERGADREARDSHG
FT                   MTALHLAAALGREASLKLLIQQGASPEARAADGQTPLGVALASGRRDLAVWLDWRIWPL
FT                   PLRPLREADVPAAAMVGDADAIRRLIDLGLPVDAVDAQGCTALLRAAGGGHAAALDLLL
FT                   ARGANLHHAAASGVTPLSAAVSMRQVGIVSALLQAGAQIEHRLPGGVTVLMLACALGLP
FT                   DIAARLLAAGADVHASDAQQRTPLHCATLYAFSARDKSRLLALLDTLLLAGAEADRGSA
FT                   DGVTPLLSLLGSRAEPGTACEELVVLAGVERLLDEEVSLDVQDAHGFGPLHLAALHGLP
FT                   LLVQRLLRAGADPDLRDTLNRTAREIAVMRGFVDVAGQFQPALPGVSSMARFLRETR"
FT   gene            184175..186166
FT                   /locus_tag="XALC_0145"
FT   CDS_pept        184175..186166
FT                   /transl_table=11
FT                   /locus_tag="XALC_0145"
FT                   /product="hypothetical glucose-6-phosphate 1-dehydrogenase
FT                   (g6pd) protein"
FT                   /function="metabolism go:0008152; misc. glucose metabolism
FT                   go:0006006"
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14691"
FT                   /db_xref="GOA:D2U859"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2U859"
FT                   /protein_id="CBA14691.1"
FT                   /translation="MRDANPITPPCLIVVFGARGDLTRRLVLPALYNLRRSGALPEQFA
FT                   VIGVDHGQVGEAGWRRMLGDALRALMAERDVEFKADAAHEQAWSWLRSRLYYLRGDFAD
FT                   AGTYRALGELLETIGAQQRSGGNVLFYLATAARFFAPVIEHLGAAGLVRQVAGEGWRRV
FT                   IVEKPFGHDLRSAQELNAIVGRVLDEDQVFRIDHFLGKETVQNILAFRFANGLFEPVWN
FT                   RDRIDHVQITAAETIGVEGRGGFYDPTGCLRDMVPNHLFQLLAMIAMEPPAAFTPAAML
FT                   RRRAEVIEAVRPLTPVDVVRGQYAAGAIGRNAVPGYREEDTVSPDSNTETYVAMKLQVD
FT                   TWRWAGVPFYLRTGKRLRERTTEIAIRFKPAPLAPLRSAEIGGYGPDWLVLHIQPDEGI
FT                   SLQFDVKRPGARISLAPVRMDFRYRDWFPKEYTVGYERLLQDCMHGEAGLFQDATMVEA
FT                   AWRIVQPILDTWQTSADEVAQYPAGSAGPATADALLALNGGHSWRALTAGRRSPAAAAA
FT                   PARPSRQRDVLADVDAAGCASRVCVRRGPQAGQAGAGVRRAGRESGQARAGQGRKTSLK
FT                   QTVQALRVERLRASAQQASVFSANATRRRSRPVVSNAHSVGASESCAFFVGRRVAAVGA
FT                   EALGSRRLRLPSHARRRCCARIRCVLAA"
FT   gene            complement(186144..187982)
FT                   /gene="kefC"
FT                   /locus_tag="XALC_0146"
FT   CDS_pept        complement(186144..187982)
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="XALC_0146"
FT                   /product="probable glutathione-regulated potassium-efflux
FT                   system protein kefc (k(+)/h(+) antiporter"
FT                   /function="the monovalent cation:proton antiporter-2 (cpa2)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14692"
FT                   /db_xref="GOA:D2U860"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2U860"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14692.1"
FT                   /translation="MHSSGLELALVLLLAAVIAVPVFKRLGLGAVLAYLAAGVVLGPDW
FT                   LGFVQDTQRIFNAAEIGVVMLLFLIGLELSPARLKVMRHAVFGAGTAQVALSALPLGVL
FT                   LLCLGMNWKGALVVGMALALSSTAVGLQLLAERKALNSDYGRLGFAILLFQDLIAIPLL
FT                   AAVPLLGGAKNDTLTWTEVGQALGALALVVLCGRFVLRHLFRVVARTRMPEVFTASALL
FT                   VVLGNAWFLQKAGLSPSLGAFLAGVLLADSEFRHELEAQIEPFKGLLLGVFFIAVGMGI
FT                   NLHRIAAEPWLIVSGVATLLLVKFGLLAGIGRMLRLPWRNALLLGSLLWLGGEFAFVVL
FT                   IEAQRVGLLDDASHDRLVAIVGVSMGLTPLLLIGMQRLLDGGADAKTRRTSPVPATHYD
FT                   TVEAQPAQVLIAGMGRFGQVVARLLTAQRIPFVALEHNPDTVEDLRRFGNKLYYGDPSR
FT                   PDLLRAAGSDSIRLFVVAMDDPETNIKTIRLIRRLYPSARVLARARNRQHAWRLMDLGA
FT                   EPFREVFASSLELSEQVLVGLGLDQATARDRIARFREHDEQLLRAQHLVYDDDTAVVQT
FT                   ARAARADLMQLFEADVQDTHTARADDTTSITPPTRT"
FT   gene            188165..190849
FT                   /locus_tag="XALC_0147"
FT   CDS_pept        188165..190849
FT                   /transl_table=11
FT                   /locus_tag="XALC_0147"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14693"
FT                   /db_xref="GOA:D2U861"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2U861"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14693.1"
FT                   /translation="MSTYHLQSVFRPAAVAVVGGSPRERSAGRAVVRGLRAAGFPGQIG
FT                   WVSPRYREIDGVPTVRHLADLSWVPDLVVITAPARMVPRIVAIAARRGVASAIILTAGL
FT                   GSGPGSAAARVEHVARVKGLRVLGPHCLGVIAPHARLNASIAAHCPQPGDLALVSESSA
FT                   IAAALVEWGVARAVGFSAVVSLGDTLDVDFADLLDYFATDERTRAILLYVEHIRDARKF
FT                   MSAARAAARAKPVVVVKSGRLLRIDPDADTHVQALASADAVYAAAFARAGLLRVRALDE
FT                   LFAAAQTLGRLSTFPGRRLAILSNGGGVGRLAMDTLVELGGTLAALSPQTQQRLHQALP
FT                   QEEPHANPVDILVDADGERYAAAIAALLDDVENDAVLVVNVPTAFTSSAEVAQALTRTL
FT                   DQRPHHHRAKPVFAVWLGNEASATAARIPTYATEADAVRGFMHLVRYREAQAALMETPP
FT                   SLPDDVVFDVAAARAIVDAALAAGQAWLDPLATTQLLAAYGIPTAPVVQAASADAAAEL
FT                   AGPMLAQGIAVAVKIHSADIPHKSDVDGVRLNLVSVEAVRDAAEGILARARAARPDARI
FT                   DGVLVQPSLLRPKARELIVGIADDPVFGPVIVFGRGGTAVEVIDDKALALPPLDLRLAH
FT                   ELIGRTRVSRILKAYRDVPAADERAVAMVLVKLAQLAVDLPEIREVDINPLLADRDGVI
FT                   AVDARVAVAPSRRLHKGRGHPRFAILPYPKEWERRIVLNDGAEAFVRPVRAEDDALFRR
FT                   FFARVSEEDLRLRFFQAFKHFSHEFIARLTQLDYARSIALVAIEPSTGEMLGAVRLHAD
FT                   ADYGHGEYAILIRSDLKGHGIGWQLMRIMIEYAGWLGLQVIEGQVLRENRTMLAMCRQL
FT                   HFSVTADPDDPMLMNVMLPVGKR"
FT   gene            complement(191016..191762)
FT                   /locus_tag="XALC_0148"
FT   CDS_pept        complement(191016..191762)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0148"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14694"
FT                   /db_xref="UniProtKB/TrEMBL:D2U862"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14694.1"
FT                   /translation="MKLTAHVLDGHTLDVRPAPRERPWMDLTAERYAYRCLPLDIANTH
FT                   GWELLCQTAFEADWNGGNALDDLRVHPSADTQAPAVSHFGYGVLTFHVPCLFRTESGVD
FT                   LYVTAPINRPKDGIAGLTGLIETDWSPYTFTMNWQFTRPGRVRFDAGEPFCHFFPVQRQ
FT                   LLTQTQPRWQPLSQTPELEREHQTWMHSRGQFLQDLAQPDSAASREGWQRSYFRGPAPG
FT                   QCPAGVEHRVKLRLAPFTREEDSHDD"
FT   gene            complement(191844..193853)
FT                   /gene="accC"
FT                   /locus_tag="XALC_0149"
FT   CDS_pept        complement(191844..193853)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="XALC_0149"
FT                   /product="probable biotin carboxylase, acetyl-coa
FT                   carboxylase subunit a protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14695"
FT                   /db_xref="GOA:D2U863"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2U863"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14695.1"
FT                   /translation="MATPNLTTFDKILIANRGEIACRVIATCRRFGIATVAVYSDADRN
FT                   ARHVRMADDAVYIGAAPPRESYLHSERILDAAQHCGAQAIHPGYGFLSENATFAEHCAR
FT                   RGIVFIGPPPAAIRAMGNKSAAKALMQAAAVPLTPGYHGERQEMEFLRTQADAIGYPVL
FT                   IKASAGGGGKGMRRVDHNADFATALVACQREAQAAFGNAHVLVEKYVLRPRHIEIQVFG
FT                   DQHGEFVYLFERDCSVQRRHQKVLEEAPAPGMREEQRAAMGQAAVEAARAVGYVGAGTV
FT                   EFIVAPDGAFYFMEMNTRLQVEHPVTEYITGTDLVEWQLRVAAGQPLPQRQHELTIHGH
FT                   ALEARLYAEDPARGFLPSIGTLRHLRLPAADAHTRVDAGVEQGDVIGPHYDPMIAKLIV
FT                   WDTTRAGALRRMQTALSACQVVGVATNAAFLQRLVATRAFAQADLDTALIEREHAALFD
FT                   TATPTADAIWYLAALAWLLHERAQVAHPDDPYSPWDLRDGWRLGASAPRQLTLQHGEMR
FT                   RCLRLSTQANGWRVHDSDTNTELDVAGQWHDDRLTAHLGTQRMQADVVFVGNQLHLFVA
FT                   GQGYLFERHDPIAEADQPAIDSGGLTAPMPGRVIALLVAPGTQVTRGTPLLVLEAMKME
FT                   HTLQAPTDGTVHGYRVREGELVADGVALLEFEAA"
FT   gene            complement(194646..196256)
FT                   /gene="accD"
FT                   /locus_tag="XALC_0150"
FT   CDS_pept        complement(194646..196256)
FT                   /transl_table=11
FT                   /gene="accD"
FT                   /locus_tag="XALC_0150"
FT                   /product="probable acetyl-coenzyme a carboxyltransferase
FT                   beta subunit protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14696"
FT                   /db_xref="GOA:D2U864"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D2U864"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14696.1"
FT                   /translation="MPAIQTQLQPGSDSFAANAAALGALVDDLQRTQARIAQGGSEAAR
FT                   AKHQARGKLLARERIDALLDPGSAFLEIAALAALGLYDDEVPCAGVVAGIGQVCGVECV
FT                   IVANDATVKGGTYYPMTVKKHLRAQEIAQQNRLPCLYLVDSGGAFLPLQDEVFPDRDHF
FT                   GRIFYNQANLSAQGIAQIACVMGSCTAGGAYVPAMSDETVIVREQGTIFLGGPPLVKAA
FT                   TGEDVSTEELGGADIHTRISGVADHLADNDVQALARVRAIVAQLNWRKPTPALALRAPE
FT                   PPLYPAEELYGVIPADPRKPFDVREVIARIVDGSRLDEFKARYGTTLVTGFAHLHGYPV
FT                   GIVANNGILFSESALKGAHFIALCAQRGIPLVFLQNITGFMVGRKYEHGGIAKDGAKLV
FT                   MAVACAKVPKFTVVIGGSFGAGNYGMCGRAYSPNFLWMWPNARIGVMGGEQAASVLATV
FT                   RRDGIEAKGGQWSAEEERAFKTPIREQFEHQCHPYYASARLWDDGIIDPAQTRRVLGLG
FT                   LSAALNAPVEPSRFGVFRM"
FT   gene            complement(196313..197476)
FT                   /locus_tag="XALC_0151"
FT   CDS_pept        complement(196313..197476)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0151"
FT                   /product="putative acyl-coa dehydrogenase protein"
FT                   /function="metabolism go:0008152; carnitine degradation
FT                   go:0042413"
FT                   /EC_number="1.3.99.3"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14697"
FT                   /db_xref="GOA:D2U865"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D2U865"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14697.1"
FT                   /translation="MLMPSLNFDLGEEIDLLRDSVAAFAAREIAPLAAQADRDNTFPVS
FT                   LWRKLGEQGLLGLTVEEEYGGSAMSYLAHVVAMEEISRACGAIGLSYGAHSNLCVNQVR
FT                   KNGNAAQKTHYLPKLCSGEHVGALAMSEPGAGSDVVSMKLRAEARGDRYVLNGNKMWIT
FT                   NGPDADVLVVYAKTDPAGGARGITAFVVEKTMPGFSTAQKLDKLGMRGSNTCELVFQDC
FT                   EVPAENVLGEVGGGVRVLMSGLDYERVVLSGGPLGLMAAALDVVLPYVHERHQFGEAIG
FT                   NFQLMQGKLADMYVGLNACRAYVYAVARSCDAGRTTRQDAAGAILYAAEKATWLTGQAI
FT                   QVLGGNGYINDYPTGRLWRDAKLYEIGAGTSEIRRILIGRELFEQTK"
FT   gene            197949..198467
FT                   /locus_tag="XALC_0152"
FT   CDS_pept        197949..198467
FT                   /transl_table=11
FT                   /locus_tag="XALC_0152"
FT                   /product="putative cytochrome c precursor protein"
FT                   /function="metabolism go:0008152; energy
FT                   production/transport; electron donor go:0009053"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14698"
FT                   /db_xref="GOA:D2U866"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D2U866"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14698.1"
FT                   /translation="MRNYDLEFLKRFSLVIGLLMLITLGLMALAFYLQRAIPPEVSPVA
FT                   LKRTEERIAPVGAVYAGSTGAAAQAAAQAAALAKASAQAAYGGTTDGKTIFNNLCTACH
FT                   TNGVGKAPTLDHAHWDARIAQGKPTLYKHAIEGYNGPDGGIMPPKGGNPGLTEAQIHAT
FT                   VDWMLSNLK"
FT   gene            198718..198942
FT                   /locus_tag="XALC_0153"
FT   CDS_pept        198718..198942
FT                   /transl_table=11
FT                   /locus_tag="XALC_0153"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14699"
FT                   /db_xref="UniProtKB/TrEMBL:D2U867"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14699.1"
FT                   /translation="MADCDQQARNAWQADGDALDSQAFAKMQKVDAANLTCLRAVLSAH
FT                   FPTAAEVGQEGVQSAWLLLQHADADPALQ"
FT   gene            198946..199095
FT                   /locus_tag="XALC_0154"
FT   CDS_pept        198946..199095
FT                   /transl_table=11
FT                   /locus_tag="XALC_0154"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14700"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A4"
FT                   /protein_id="CBA14700.1"
FT                   /translation="MLKRLNPSHLPDGIDHKAYSLLVDRVQINLKQPQVYGSQFHRVDK
FT                   TWVP"
FT   gene            complement(199241..199630)
FT                   /locus_tag="XALC_0155"
FT   CDS_pept        complement(199241..199630)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0155"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14701"
FT                   /db_xref="GOA:D2U8A5"
FT                   /db_xref="InterPro:IPR004891"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14701.1"
FT                   /translation="MPVKSLPQPFLDASAMLLSGLCLLHCLALPLLATALPLLGTWAQA
FT                   EWVHLLFVAIAAPLAGLALWRAHQHEPLPWPLWALALLGLAGLLTGALDLAGKDNETRI
FT                   TVAGSLALASAHLWNWRRHRRHCSS"
FT   gene            199696..201030
FT                   /locus_tag="XALC_0156"
FT   CDS_pept        199696..201030
FT                   /transl_table=11
FT                   /locus_tag="XALC_0156"
FT                   /product="putative cobalamin synthesis protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14702"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14702.1"
FT                   /translation="MSAMSISAVSDRRLPVTVLSGFLGAGKTTLLNNVLRNREGRRVAV
FT                   IVNDMSEINIDAALVREGGAALSRTEETLVEFSNGCICCTLRDDLRQEVQRLADSGRYD
FT                   YLLIESTGISEPMPVAATFAMRDADGHGLADVARLDTMLTVVDGVSFLRDFASAERLTD
FT                   RGLQAGDDDDRGLVNLLVEQIEFADVIVISKSDLADTVMLDRTRAVLRALNRDARIVEA
FT                   SRGDVPLDLVLETGRFDFVRAQLAPGWMQALRGEHTPETEQFDIGSFVYRARRPFHPLR
FT                   FAHLTQRGLRDVIRSKGFFWLASRMDWVGELSIVGPAIQTQAAGFWYAARERVDQGLLE
FT                   TPLVLPPSPLPYTELGWQRQQTACWNAPPPQAEEVGDAREYAALRAMWHPLWGDRRQEL
FT                   AVIGVGLDEVRVRAELDACLLDDAELRQGPVAWQGLDDPFPAWRR"
FT   gene            201166..201831
FT                   /locus_tag="XALC_0157"
FT   CDS_pept        201166..201831
FT                   /transl_table=11
FT                   /locus_tag="XALC_0157"
FT                   /product="putative hydrolase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14703"
FT                   /db_xref="GOA:D2U8A7"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14703.1"
FT                   /translation="MTSPAFPTASAALTLHGPAGPIEAAVDLPDADVVALPVTAIVCHP
FT                   LSTEGGSMHNKVVTMVARALRELGVCVVRFNFRSVGASAGSFDHGVGEQQDLAAVAAWV
FT                   RAQRPHDALWLAGFSFGAYVSLRASAALQPQVLISIAPPVGRWDFDRVAPPPQWLVIQG
FT                   DADEIVDSQAVYAWLETLPSPPQLVRMPDTSHFFHRKLIDLRGALQHAVKGWLPAAQA"
FT   gene            201828..202925
FT                   /locus_tag="XALC_0158"
FT   CDS_pept        201828..202925
FT                   /transl_table=11
FT                   /locus_tag="XALC_0158"
FT                   /product="putative atpase protein"
FT                   /function="metabolism go:0008152; unassigned reversible
FT                   reactions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14704"
FT                   /db_xref="GOA:D2U8A8"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14704.1"
FT                   /translation="MSSAAIPSQRYADGVARGDWRDDPAQHAALAELDRLHRVIVDSEQ
FT                   SGWLDRMAAFWKKSEPVRGLYFWGGVGRGKTFLVDLFYDGLPIERKYRTHFHRFMRGVH
FT                   ERLREQAGHSDPLARIAQEWRTRLRVLVLDEFFVTDIGDAMLLGRLLERLFAEGVTLVT
FT                   TSNTAPQNLYLNGLQRASFLPVIALLQKYCVELYAEGAEDYRMRALTRSPVYRTSLVEE
FT                   ADAWLEQRWSELTGNAEARRGNIEIEARKIPVRARGKSIVWFDFAALCEGPRSPNDYIE
FT                   IAREFTTLLLGGIPHFGRGNEDAARRFVNLIDELYDRHVNLVCTAQDPPPLLYTGERLA
FT                   GAFERTASRLIEMQSAEYLAAAHRG"
FT   gene            203196..203663
FT                   /gene="ohrR"
FT                   /locus_tag="XALC_0159"
FT   CDS_pept        203196..203663
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="XALC_0159"
FT                   /product="probable organic hydroperoxide resistance
FT                   transcriptional regulator protein"
FT                   /function="transcriptional level go:0006355; repressor
FT                   go:0016564"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14705"
FT                   /db_xref="GOA:D2U8A9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8A9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14705.1"
FT                   /translation="MWHMNPLPSTAATDLLRLDNQLCFALYSANLAMHKLYRGLLRALG
FT                   LTYPQYLAMLVLWEQDQRSVSDIGERLFLDSATLTPLLKRLETLGLLTRRRAAEDERRV
FT                   VVALTERGHALRERAQVLPERVLCAVACDLEQLTRLKHELEDVRGKLLVAS"
FT   gene            203766..204197
FT                   /gene="ohr"
FT                   /locus_tag="XALC_0160"
FT   CDS_pept        203766..204197
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="XALC_0160"
FT                   /product="probable organic hydroperoxide resistance
FT                   protein"
FT                   /function="cell processes go:0009987; detoxification
FT                   (xenobiotic metabolism) go:0006805"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14706"
FT                   /db_xref="GOA:D2U8B0"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019953"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8B0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14706.1"
FT                   /translation="MASPTTIAYTATATATGGRDGRAVTPDKTLDVKLSTPRELGGAGG
FT                   DGTNPEQLFAAGYSACFLGAMKFVAGQDKLKLPAEPTIEGKVGIGQIPGGFGIAVELRI
FT                   AVPGMERAALQSLVDKAHQVCPYSNATRGNIDVNLIVVD"
FT   gene            204892..207303
FT                   /gene="nrdA"
FT                   /locus_tag="XALC_0161"
FT   CDS_pept        204892..207303
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="XALC_0161"
FT                   /product="probable ribonucleoside-diphosphate reductase
FT                   alpha subunit protein"
FT                   /function="metabolism go:0008152;
FT                   2'-deoxyribonucleotide/ribonucleoside metabolism
FT                   go:0009265"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14707"
FT                   /db_xref="GOA:D2U8B1"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8B1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14707.1"
FT                   /translation="MSQTHSLPAAASIDDTVDSTTAAAIAQPTTASSEPSNDQRAVTWI
FT                   VKDGGNRRMAFDRSRLQRTLDRIHAEFPQLDVSDYERKAFAFIEKKESLSADEMVDYLI
FT                   REAESRVDIATPEWEYFAARLYLDRLYKRASKNRFYDAGEKYGSYVGLQESLADRGVYS
FT                   INILKNYSKEELAEAGRMIDPERDKLFAYNGLYLLATRYLATDNSRKVYELPQERWLTI
FT                   ALYLMQDEKPRERRMQLVGEAYWALSNLYMTVATPTLSNAGKIGGQLSSCFIDTVDDSL
FT                   QGIYDSNTDVARVSKHGGGVGAYLGYVRSSGSAIRGVKNSSGGVVPWIKQLNNTAVSVD
FT                   QLGQRKGAIAVYLDIWHRDIEAFLDLRLNNGDQRLRAHDVFTAVCVPDIFMEAVERRGE
FT                   WYLFDPYEVKEVKGWYLQDFFDEKRGEGSFRAKYEEVVADERIGRKVVKAIDMFKRIMV
FT                   SQLETGNPFMFYRDEVNRMNPNKHQGMVYSSNLCTEILQNMSPTRVIQEMISGDQIVTT
FT                   KQAGDFVVCNLSSVNLGRAVTAQPDLLSPDILERLIRVQVRMLDNVIDLNDLPVPQATI
FT                   TNQKYRAIGLGTFGWHHLLAQKGIEWNSRQAEDYSDTLYERINYLTIQASLALAQEKGA
FT                   YKVFKGSDWQNGEYFSKRGYDSAQWQELAAQVSVHGVRNAWMVAVAPNMSTAQIAGSTA
FT                   SIDPIYSAFYYEEKKDFRRPVVAPGLTVDTYPYYEKGAYKVDQFASVRQNARRQRHVDQ
FT                   SISFNFYVPSGIRAGTLLDLHMTAWKEGLKTTYYVRSNDIDISECEWCSS"
FT   gene            207417..208457
FT                   /gene="nrdB"
FT                   /locus_tag="XALC_0162"
FT   CDS_pept        207417..208457
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="XALC_0162"
FT                   /product="probable ribonucleotide-diphosphate reductase
FT                   beta subunit protein"
FT                   /function="metabolism go:0008152;
FT                   2'-deoxyribonucleotide/ribonucleoside metabolism
FT                   go:0009265"
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14708"
FT                   /db_xref="GOA:D2U8B2"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8B2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14708.1"
FT                   /translation="MAIALDRIKILEPLHPNRSTGIINGTTSGILNWNDIPYPSFYRAY
FT                   KELSTNFWIPDEVDMKGDAKQYGELSAREKNAYDSIIGLLATLDSPQTRFIYNVAEYIT
FT                   DPAAHANAAIIGQQEVIHNESYSYVLASIAGLADQNRVFEIARTHPTIVARNQPIMQAY
FT                   DDFMREKTAETLLRSLIQSSILEGINFYSGFAYFYNLVRQNRMTGTGKIISFINRDELA
FT                   HTKFISELIRAIIGENAELQTNELTDYVHQAFEHAIRLETEWSSEVLDGIEGIDVDEMI
FT                   QYVKYRANKMSGMLGIEKLYTGASDNVMPWIKAYADNFTETKTDFFEMRNASYKKTNSD
FT                   NGFDDL"
FT   gene            208514..209038
FT                   /locus_tag="XALC_0163"
FT   CDS_pept        208514..209038
FT                   /transl_table=11
FT                   /locus_tag="XALC_0163"
FT                   /product="putative flavodoxin protein"
FT                   /function="metabolism go:0008152; riboflavin (vitamin b2),
FT                   fad, fmn go:0009231 go:0006747 go:0009398"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14709"
FT                   /db_xref="GOA:D2U8B3"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010088"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8B3"
FT                   /protein_id="CBA14709.1"
FT                   /translation="MQILLAYASLSGNTRDVARRVHAQCEAAGHQVTWIHTDLQTLHGV
FT                   LGDPSCATGFDLHLLGSWTDNAGRTPSEMKRYIAELVEAVGRHAEVAVFGTGETQWGLE
FT                   YYCGAVKRIARFFDSAYPLLEIEQMPHGERDVAAIDAWCAQVLALRAARAAAPAAASQV
FT                   SAAALPLHGSG"
FT   gene            209117..209449
FT                   /locus_tag="XALC_0164"
FT   CDS_pept        209117..209449
FT                   /transl_table=11
FT                   /locus_tag="XALC_0164"
FT                   /product="putative thioredoxin protein"
FT                   /function="metabolism go:0008152; thioredoxin, glutaredoxin
FT                   go:0042964 go:0042965"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14710"
FT                   /db_xref="GOA:D2U8B4"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8B4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14710.1"
FT                   /translation="MLTTITVSSPEQFADALAAHPRVLADFNKDNCPGCRMLDKSLERF
FT                   AESDSAQGLTLLKVKMEDVGEDFFRAQGLRQTPTLMLFRHGEEVARVPGFVPPAKIDEA
FT                   VRTHLG"
FT   gene            209895..210758
FT                   /locus_tag="XALC_0165"
FT   CDS_pept        209895..210758
FT                   /transl_table=11
FT                   /locus_tag="XALC_0165"
FT                   /product="putative nad-dependent deacetylase (suirtin)
FT                   transcription regulator protein"
FT                   /function="transcriptional level go:0006355"
FT                   /EC_number="3.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14711"
FT                   /db_xref="GOA:D2U8H2"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026587"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR026591"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14711.1"
FT                   /translation="MPQLLQDPSDPAHAVTTALEAFVVRHRRLFVLTGAGCSTDSGIPD
FT                   YRDVAGEWKRTPPVTYQAFMGELATRQRYWARSLIGWPRFGYAQPNATHAALAHLEARG
FT                   QVALLLTQNVDGLHQAAGSRAVIDLHGRLDVVRCMQCERRMPRETFQQQLLQHNPHWAT
FT                   LQAGQAPDGDADLDGVDFAAFVVPACPHCGGVLKPDVVFFGENVPRERVTSAFAHLQQA
FT                   DAMLVVGSSLMVYSGFRFVQAAAKAGVPIAAINLGRTRADDLLDLKVNQPCAQALAFLY
FT                   PAAGLA"
FT   gene            210879..211976
FT                   /locus_tag="XALC_0166"
FT   CDS_pept        210879..211976
FT                   /transl_table=11
FT                   /locus_tag="XALC_0166"
FT                   /product="putative nadh:flavin oxidoreductase protein"
FT                   /function="metabolism go:0008152; riboflavin (vitamin b2),
FT                   fad, fmn go:0009231 go:0006747 go:0009398"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14712"
FT                   /db_xref="GOA:D2U8H3"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14712.1"
FT                   /translation="MSLLFSPLALGPLSLSNRIVIAPMCQYAADAGRANDWHLQHLGQL
FT                   AQSGAGLLILEATAVEPCGRITPADLGLWDDATEAALREVLTSVRRWSPMPLGIQLAHA
FT                   GRKASTHRPWDGGAAIAPTEPNGWQTVAPSPQPFAADDAPPQALDLTGIEAIVAAFVAA
FT                   ARRAERLGFALIELHAAHGYLLHQFLSPLSNLREDAYGGSLDNRMRLLLRVHAAVRAAV
FT                   SSTIAVGVRISATDWVEGGWDVAQSMVLAQALQAQGCDYLHVSSGGLDRRQRIPVAPGY
FT                   QVPLAETLHRAVDMPVIAVGLITEPQQAEAILAEGRADAIALARGILYDPRWPWHAAAA
FT                   LGATLRPAPQYMRCAPYAARSLFDA"
FT   gene            212038..212913
FT                   /locus_tag="XALC_0167"
FT   CDS_pept        212038..212913
FT                   /transl_table=11
FT                   /locus_tag="XALC_0167"
FT                   /product="hypothetical dehydrogenase protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14713"
FT                   /db_xref="GOA:D2U8H4"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14713.1"
FT                   /translation="MNIGFLGLGTMGRPIAHNLLRAGHPLTVWNRSAGAAQPLVEAGAQ
FT                   LVARPAEAVCGPVLFSMLADDAAVRETLLERGALDALTAGSVHVNMATISVALARELSA
FT                   LHAERGVAYLAVPVLGRPEVAAAGQLNLLAAGDADALARVQPLLDVVGRKTWYFGAAPE
FT                   QANVVKLAANLCLASAIGTMAEAAALVRGHGVEAAEFLGMLSGSVFAAPAYQIYGDMIA
FT                   QQRYSPAGFKATLGLKDVRLALSAGETGHVPMPLAAVLRDQFIEAIAHGDGDLDWSALA
FT                   KVAARRAGQA"
FT   gene            complement(213140..215113)
FT                   /locus_tag="XALC_0168"
FT   CDS_pept        complement(213140..215113)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0168"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14714"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14714.1"
FT                   /translation="MLVKRPKLSAACILCLVIPATALQAAELVPKQLAGPPEEFAQMRA
FT                   PAPAETAILSRSALLPVEFSAAHSGSPAQWHATLPVENGQLHFLVLSDGHDWQPRLIAP
FT                   TATSATNAVLTPSAQTSRLGTGNATVQTRDYHVDSAANGDWTLTLQADSNTAQRGYVLL
FT                   EGDARTQLASYPSDRRQLQRGQRIGITALLSGIDAQGAIALGNSTSAGRIDNAQLRVIA
FT                   PDGTVSQWPMADDGRHGDGAASDGLYAGDFPATASGTYIAQVVVHGHDASGQAFVRTSE
FT                   HVLPVLDTTLRIATDAVVASAQPGTRLTLPIAVRTGGAQTPTHYRVLGELWGTGRNGKA
FT                   VPVAWLGGMIAPQDGRLPLSVDERWIVRADARAPFTLRNLRVEDPDNFVPLATHDTLAL
FT                   TLPALRSDSIARGGAIDESMRMGERPATLRTMASTEPQGTGQKLVLVHGYCSDGKVWPL
FT                   EQFTNAALFLDINQNRSNDQFAQLLGQFGSQWHSFGTIAHSQGGMAALHLYAYYWSGLD
FT                   NASGGLLMQSVGTPYQGTNLAGILAAGGKYFGQGCGSNRDMTYDGAKAWLAGIPNSARA
FT                   KVNYYTTSFTKKRWYDSYCDKSTEMVLSDPNDGVVEKVNGQLPGGVNMGHTTGECHTTG
FT                   MNYPAQSLDASRNATMNTNAAR"
FT   gene            complement(215343..217634)
FT                   /gene="metE"
FT                   /locus_tag="XALC_0169"
FT   CDS_pept        complement(215343..217634)
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="XALC_0169"
FT                   /product="probable
FT                   5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   s-methyltransferase protein"
FT                   /function="metabolism go:0008152; methionine go:0009086"
FT                   /EC_number="2.1.1.14"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14715"
FT                   /db_xref="GOA:D2U8H6"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14715.1"
FT                   /translation="MTIVTNLGFPRIGARRELKRALERYWRRETDSAQLQDTARELRQR
FT                   HWQLQRDVGVDVPPSNDFSLYDTMLDTAFLFDAIPQRYRALADADPLAGYFAMARGTQE
FT                   NGLDLHALEMTKWFDTNYHYLVPELARNQHFRLRGDKPLGDFLEAKAQGILTRPVLIGP
FT                   VTFLALSKTVDGSDRWALLDSLLPVYAELLQKLQAAGAEWVQIDEPALVLDLDEATHDA
FT                   YRRAYAFLAGKPRPKLLLTTYFGELGDNLDLAIGLPVDGIHVDLVRGVAQLDAVLKALP
FT                   ADRILSAGLVNGRNVWRTPLDNALTLARYAAGHLGRERLWLAPSCSLLHVPVDLQQETR
FT                   LDPDLFTWMAFAKQKLQELRTLADALDDLPQAQTALAAARDALAARRASTRVHRPDVAQ
FT                   RLAALNEDAGHRQTPYPKRKQAQQAALQLPAYPTTTIGSFPQTEQVRQARAQHKAGKLS
FT                   DAEYDAFIAAETERCVRIQEQLGLDVLVHGEFERNDMVEYFGEQLDGFAFTQYGWVQSY
FT                   GSRCVKPPVIYGDVQRPAPMTVRWSQYAQSLTNRPMKGMLTGPVTMLQWSFVRDDQERA
FT                   QTCRQIALALRDEVRDLEAAGIGVIQIDEPAFREGLPLRSADWQAYLDWAVQCFRISAA
FT                   GVRDTTQIHTHMCYSEFNDIIESVAALDADVISIETSRSRMELLDAFVRYSYPNSIGPG
FT                   VYDIHSPRVPSTREMVELLDKARAVLDPQHIWVNPDCGLKTRGWPETRSALKAMVEAAQ
FT                   QLRTQHAQAA"
FT   gene            218847..219464
FT                   /locus_tag="XALC_0170"
FT   CDS_pept        218847..219464
FT                   /transl_table=11
FT                   /locus_tag="XALC_0170"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14716"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H7"
FT                   /protein_id="CBA14716.1"
FT                   /translation="MNLLTMGKANAVNVPVSVFETPEPKNGVGMLGIKWIAANRVVLDY
FT                   PGKRVLVSPDAMQTSTLRASLLAKGYVAVPMQFDKEQERYTVRAALGSVERSMTVSTVG
FT                   EVDIDPEFASQAGVEKSEESKLMSGPKGAQNYAYLTKHPVVVRIGDWSSKPMQDAWIED
FT                   QYAYMSQPRPTGEALGGMLGADFLVNAGAVIDFGNKTLYLRK"
FT   gene            complement(219737..219967)
FT                   /locus_tag="XALC_0171"
FT   CDS_pept        complement(219737..219967)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0171"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14717"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H8"
FT                   /protein_id="CBA14717.1"
FT                   /translation="MAAAEHSTFWILYGHYGPTMSVEQFRAEFTPKLMMKTLQNWIARG
FT                   DAPRPVNGVLDVRDVAAWWDAQRTNAAPSGS"
FT   gene            complement(219954..220112)
FT                   /locus_tag="XALC_0172"
FT   CDS_pept        complement(219954..220112)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0172"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14718"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8H9"
FT                   /protein_id="CBA14718.1"
FT                   /translation="MTLFDLERGRMFNPRLSTLMAISKATKTAFTKIASLAATQRLQQQ
FT                   EVRDGSG"
FT   gene            complement(220210..220815)
FT                   /locus_tag="XALC_0173"
FT   CDS_pept        complement(220210..220815)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0173"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14719"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8I0"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14719.1"
FT                   /translation="MAEKPILFNGEMVRAILDGRKTQMRRPMKNQPQPVVVPGLGPVLA
FT                   IDQPHSPNRWLWPNAREEVVASCPFGKPGDLLWVRESYQRFSEDGEILYMADSNSWEEM
FT                   NQLKCEGDPEAHWRPSIHMPRWACRIVLEITDVRVERLQAISERDAIAEGVGSAITRDC
FT                   KVPKFAALWDQLHGAGAWHANPWVWVIDFTRVEDNRHG"
FT   gene            complement(220933..221172)
FT                   /locus_tag="XALC_0174"
FT   CDS_pept        complement(220933..221172)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0174"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14720"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8I1"
FT                   /protein_id="CBA14720.1"
FT                   /translation="MNKININFADSLRVVNDENASSDARVIASLALAYLTVIEVADEIQ
FT                   HETASIAQKLMRMTASEIDKAREDQDERARRGLQ"
FT   gene            complement(221165..221425)
FT                   /locus_tag="XALC_0175"
FT   CDS_pept        complement(221165..221425)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0175"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14721"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8I2"
FT                   /protein_id="CBA14721.1"
FT                   /translation="MTALQRQMLREAMDKQMTDEEAIGLIVDMGTLIACLAKIAKPKDQ
FT                   FEMVRKAIRIGNLADYATRRFALAILARRDAPQTREGGSNE"
FT   gene            complement(221430..221789)
FT                   /locus_tag="XALC_0176"
FT   CDS_pept        complement(221430..221789)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0176"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14722"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8I3"
FT                   /protein_id="CBA14722.1"
FT                   /translation="MPATALKKLDAAYFASTTAQVQQEIWRDAMRYRWLRLQPVDGGPY
FT                   GLPRIAIPQSPNAGDFVNDDDADESIDTAMLAAMLDAERAQEQAEQKKEAGADETDYTP
FT                   GELDPTAPGQEVERG"
FT   gene            complement(222328..222621)
FT                   /locus_tag="XALC_0177"
FT   CDS_pept        complement(222328..222621)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0177"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14723"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R7"
FT                   /protein_id="CBA14723.1"
FT                   /translation="MKTEAAAMMTIFQIDDMEWWIGIDAESVLKAVKDEYGHSDEDLKD
FT                   FQEISQEALDRLMFQPANEDGKPIGSPHSFRIQIEIEIAKGGKFPRYFAGDF"
FT   gene            complement(222836..223684)
FT                   /locus_tag="XALC_0178"
FT   CDS_pept        complement(222836..223684)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0178"
FT                   /product="putative n6 adenine-specific dna
FT                   methyltransferase protein"
FT                   /function="dna structure level; methylation go:0006306"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14724"
FT                   /db_xref="GOA:D2U8R8"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R8"
FT                   /protein_id="CBA14724.1"
FT                   /translation="MITSPAFRYHGGKFRLSPWVQQHLPPHRTYVEPFGGAAGVLLTKP
FT                   RSYAEVYNDLDGDVVNLFRVLQSPSDRDRLIEACLLTPYARSEFEIAWHATSDPVERAR
FT                   RLLIRAQMGFGSAGATKGTTGFRIDSQRAYGTAQQLWARFPPSLIDVAKRFTGVLIENR
FT                   PAIEVMQQHDTPQTLHYVDPPYVHSTRVRAAGKAGYYKHEMSEADHQQLLDCLLSLDGM
FT                   VMVSGYRTNLYDTTLAGWRRVETRARISGGRGTKIRTECMWISPSCAVSVRQGNLALGA
FT                   A"
FT   gene            complement(223701..223967)
FT                   /locus_tag="XALC_0179"
FT   CDS_pept        complement(223701..223967)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0179"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14725"
FT                   /db_xref="GOA:D2U8R9"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8R9"
FT                   /protein_id="CBA14725.1"
FT                   /translation="MTIFRMLRFCIAVFFAVVACVLADLLRRCVIVDAWSIAPYVVVVL
FT                   VLSLYATRMAWRAARRSRLPTDFVRPKQPQSPDFPDTPKRGIR"
FT   gene            complement(224102..224311)
FT                   /locus_tag="XALC_0180"
FT   CDS_pept        complement(224102..224311)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0180"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14726"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S0"
FT                   /protein_id="CBA14726.1"
FT                   /translation="MNGQLVQFPRKYQLRRLKSACLIAAGIGWNVSGTRAWMIEKAYSQ
FT                   FALNYLSEIAREIRTQKAMEARNG"
FT   gene            complement(224308..224526)
FT                   /locus_tag="XALC_0181"
FT   CDS_pept        complement(224308..224526)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0181"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14727"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S1"
FT                   /protein_id="CBA14727.1"
FT                   /translation="MSAPVDVVAVLDSQIAEFHASGDTGNVENLVWARDAFATLIAEAR
FT                   KIEHSIHLFGMTCEEFSTSIKNCVGQP"
FT   gene            complement(224523..224744)
FT                   /locus_tag="XALC_0182"
FT   CDS_pept        complement(224523..224744)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0182"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14728"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S2"
FT                   /protein_id="CBA14728.1"
FT                   /translation="MSRSNTSASMAPSMQASERANAAHWHERQLPVSISTAVAYKNRER
FT                   AELQAHLNEFLRRHGRIQLLPNTLGGAP"
FT   gene            complement(224741..225013)
FT                   /locus_tag="XALC_0183"
FT   CDS_pept        complement(224741..225013)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0183"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14729"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S3"
FT                   /protein_id="CBA14729.1"
FT                   /translation="MSISITKHIMTWAEVDISVEELAAEIEFADLHKIAAIKSTSLNLG
FT                   FGFGDGDAASLCRLINDAERSLRAMGNAPRELLDLMYYVHGRAIA"
FT   gene            complement(225013..225303)
FT                   /locus_tag="XALC_0184"
FT   CDS_pept        complement(225013..225303)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0184"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14730"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S4"
FT                   /protein_id="CBA14730.1"
FT                   /translation="MTMALQPVAQRALLAAFNSPGHRLRRAAGGFVAAPPKVHTSGPLE
FT                   VPAFTRRAVNWLDNAGLVTFDDPEFPSCVTLNARGLAEAQKLLAPDSKAVR"
FT   gene            complement(225348..225617)
FT                   /locus_tag="XALC_0185"
FT   CDS_pept        complement(225348..225617)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0185"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBE70789"
FT                   /db_xref="UniProtKB/TrEMBL:D2UGZ2"
FT                   /protein_id="CBE70789.1"
FT                   /translation="MKSALLNLLDVLRAGRRIYNADGAYMMLDAHTTRRLDAAIAEVTA
FT                   AMSAEMTRGHMLPPAPPAYLLDDTDPRELTPEQMHEGHEAQQRG"
FT   gene            complement(225614..225955)
FT                   /locus_tag="XALC_0186"
FT   CDS_pept        complement(225614..225955)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0186"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14731"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S5"
FT                   /protein_id="CBA14731.1"
FT                   /translation="MEFSPDFRTRPEKSAPMINIIVDSKHVWACIKLRGQQIAHGSTIA
FT                   QHCRFAVYVCGDSICIGTHIVVQRGCMAPIVAWLRKHKVEVLIEDDSPHAPDLIDLQTG
FT                   EFISEGSPT"
FT   gene            complement(226128..226931)
FT                   /locus_tag="XALC_0187"
FT   CDS_pept        complement(226128..226931)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0187"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14732"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S6"
FT                   /protein_id="CBA14732.1"
FT                   /translation="MGTSTPSIDAARLAEVQKMDLSNGSHSGISEGMCVMEAVSFVAGE
FT                   PWSDHPQCACPVIGAFLRIWNDSLPDDERTELLRDLVPLLVGTRSTPSVEQRRGTMAAD
FT                   WLIRTYTPAWLRLAGLTSQADQLAALPEIFDFAQTPGLIPILRAARRDAATVRHATGCP
FT                   GNADVWADVLITAGDAVRDAARAAVLATGEATGEVIVLDDALDDVWDDVWSTSRAAVWA
FT                   TVKATAKATAKATAGDALKSIKAELQQSAKALVIRMCECTTVGAE"
FT   gene            227070..227882
FT                   /locus_tag="XALC_0188"
FT   CDS_pept        227070..227882
FT                   /transl_table=11
FT                   /locus_tag="XALC_0188"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14733"
FT                   /db_xref="GOA:D2U8S7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S7"
FT                   /protein_id="CBA14733.1"
FT                   /translation="MPQSFVCVHPLLLGAADYLFIAICAGLISHPVKDCCMAFSHNLKR
FT                   LRQARGMTQEELALACGWGGQSRVANYESNSPKAREPKLSELSAIAEALCVSITELLTD
FT                   HDLGEIGSGVRQPALISGHMIGDRLKDLREAAGMNQPEFAAIAKTSKQYVGRLEKGYNK
FT                   DPNPKFIELWARHFGVRMEWITAGKLPKDAGSKDVQRPAEVITASRQVDPRLLSRVHAL
FT                   LAIDRAYDLGNQEDAILFARAYEWLAQQGEVADSPQSFDKFLRWAAVR"
FT   gene            227964..228398
FT                   /locus_tag="XALC_0189"
FT   CDS_pept        227964..228398
FT                   /transl_table=11
FT                   /locus_tag="XALC_0189"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14734"
FT                   /db_xref="UniProtKB/TrEMBL:D2U8S8"
FT                   /protein_id="CBA14734.1"
FT                   /translation="MKSLTKCQVAAGALISAMFVTGHAAAQCCPSGGSGSPKPAAMGLG
FT                   ESFPVAENLSANPAWRVYKFSRDGIAYVQINDAYGRVHAAIGSVGNTAWVMPIGRDADN
FT                   VGISNANMLGTVIYNSDDFTIRLLKGTKSSSWIVVPRDKK"
FT   gene            complement(228314..229888)
FT                   /locus_tag="XALC_0190"
FT   CDS_pept        complement(228314..229888)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0190"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14735"
FT                   /db_xref="GOA:D2U932"
FT                   /db_xref="InterPro:IPR007895"
FT                   /db_xref="UniProtKB/TrEMBL:D2U932"
FT                   /protein_id="CBA14735.1"
FT                   /translation="MGKRIACIVKASALAAAYFCGYKFAWQHSADQFFLPAGLRMASLI
FT                   FLPYRMWPSIFFGDAAAMLSLRLPIAEAEGVSIIWAYSSSLLLCPLASIVPFAARRFYS
FT                   IAIQKVQLFPIILIFCALWGVISNTSLNSIFGYPLPEQTIRYIYRFGIGQYLAIMIFVL
FT                   PCLLWKRRTEEYGETAQFIKHSIIAAGSLLCTYFAAGISTETWLRILLLGCMLAPVLAM
FT                   TARHGWRGAAIGISFANLALGFSMPTTGIFGNKDTDVFIAQQTLAIISTFILITGSMIS
FT                   AASEKSKCTIRAALKESRALVRSQDIQIEQALRDRAEAIALAQSEINSLYRDTVRKLKS
FT                   SGHYELAMSVNAQSLTNTKMLCAQVSALYPFKIEVHGLYSALHDSEFSEYLNGSTIELR
FT                   LDGSTANLSATLQLVTYRSICRAIDILPAERYRVHVRTWSLHSERGISVRVQAIPAVKS
FT                   VGSAKSKLAETQLRSKMHAYGGSSKRRRNGVFFMLGDGDHFLSRGTTIQDELFVPLSSL
FT                   IVKSSEL"
FT   gene            complement(229923..230408)
FT                   /locus_tag="XALC_0191"
FT   CDS_pept        complement(229923..230408)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0191"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14736"
FT                   /db_xref="UniProtKB/TrEMBL:D2U933"
FT                   /protein_id="CBA14736.1"
FT                   /translation="MLTIEEIRRIRLAQLVREYGSQAELAREINKDKNQVGQWLGRANS
FT                   RSISSETARDIELVCQKPRGWMDNLPIAKVGKLPSVIENDTSLIKALKEHIDATLIEYA
FT                   ELRIELGQRTPANPFGKIDHFAGLLADEVEMLREQEELARLVQERRSASGKLSTKTK"
FT   gene            230505..230759
FT                   /locus_tag="XALC_0192"
FT   CDS_pept        230505..230759
FT                   /transl_table=11
FT                   /locus_tag="XALC_0192"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14737"
FT                   /db_xref="UniProtKB/TrEMBL:D2U934"
FT                   /protein_id="CBA14737.1"
FT                   /translation="MGSAMDLITYISDMTRRRALADACATSPDYLWQIATRWQGRRPSP
FT                   DLAARIEEATARLGPEMVPKEPLIFGASPQQPEADDAAH"
FT   gene            complement(230791..231288)
FT                   /locus_tag="XALC_0193"
FT   CDS_pept        complement(230791..231288)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0193"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14738"
FT                   /db_xref="UniProtKB/TrEMBL:D2U935"
FT                   /protein_id="CBA14738.1"
FT                   /translation="MGLSSLVNTIGAAKTALEIRDFNATGAAISEMTQKVLNLQAELIA
FT                   VNTAFFEIQQENTALGKQVRELKEKSAQRERYSLFKLSPGVFVQRLNDSPETAGTVNPG
FT                   LPEPIHFLCPRCFEEGIRSILQQSSGPGRITHDCFRCGSKYPTENDRPPKRTRGIVNPG
FT                   IS"
FT   gene            complement(231511..231744)
FT                   /locus_tag="XALC_0194"
FT   CDS_pept        complement(231511..231744)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0194"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14739"
FT                   /db_xref="UniProtKB/TrEMBL:D2U936"
FT                   /protein_id="CBA14739.1"
FT                   /translation="MEETREQRAISMLLDKVSALEHFIEDFMPLIIAASSNREQVEREM
FT                   SKWALQETGEEDQEHHYRVQLAADVLERLQSL"
FT   gene            231937..232464
FT                   /locus_tag="XALC_0195"
FT   CDS_pept        231937..232464
FT                   /transl_table=11
FT                   /locus_tag="XALC_0195"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14740"
FT                   /db_xref="UniProtKB/TrEMBL:D2U937"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14740.1"
FT                   /translation="MTCLRTDMHWRDALYNAVTQVPGGIRAAAAFLTERRGRSISGESL
FT                   RKKLRGLEGESVSVEIAEMLTEWMEEQVTGKALATTWIQSLGAQFGVAMDFVPDGDSVS
FT                   ADEIAVLQTTLLHISHNAGALSGLGIEAIADGEISRAEADALIRATRNARTMLHRFERS
FT                   VMQAHAKARGGA"
FT   gene            232466..232681
FT                   /locus_tag="XALC_0196"
FT   CDS_pept        232466..232681
FT                   /transl_table=11
FT                   /locus_tag="XALC_0196"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14741"
FT                   /db_xref="UniProtKB/TrEMBL:D2U938"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14741.1"
FT                   /translation="MHQPRAPRPAHARPRQPGPIARAAIREAQALLYGGKPGLQGDDAL
FT                   AERERLRLEDEDKASRQGQLPLRSDP"
FT   gene            232828..233022
FT                   /locus_tag="XALC_0197"
FT   CDS_pept        232828..233022
FT                   /transl_table=11
FT                   /locus_tag="XALC_0197"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14742"
FT                   /db_xref="UniProtKB/TrEMBL:D2U939"
FT                   /protein_id="CBA14742.1"
FT                   /translation="MLGSAVEQRRRMCEARHYLRRGYTTGIKVQRLIDAIALRRGHAAA
FT                   QQLRAEMRAQWACRREWLA"
FT   gene            233259..235727
FT                   /locus_tag="XALC_0198"
FT   CDS_pept        233259..235727
FT                   /transl_table=11
FT                   /locus_tag="XALC_0198"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14743"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D2U940"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14743.1"
FT                   /translation="MVASNYSDVLQQLLDAGLIIPNDGLRIGTHKPVRVLVQDGGRERR
FT                   GWYLLKEWSPSYDRLLIVGSFGVWHGSNNGAQKVALPKDDTGRITPEQRDAMKRVWADA
FT                   AKAAELQRKQEAEAAAARALKAWSRLLPDSNSPYLQRKGVLGYGLKYTERGTAVVPLTD
FT                   TTGKIYGLQFLRSAAQAQEAKRPAKEFWPAGLKKKGHFHLLGHTPHWIVLVAEGYATAA
FT                   SLHAATGYPVACAFDAGNLQPVAEALRKRYKRAKILVCADDDILGKCRHEDCRARIALP
FT                   LNPHNCPECGRDHGCKNAGIEAASTAAMAVAGEWLAPQFADQDGRIQRYLDGKGKDSDF
FT                   NDLQALESLAVIGAQVASRLSDLKWSPPALRAVSSSEPGGGGGKLRPIQQLDELLARYS
FT                   LIYGGGGAIFDRREHCLLPLTDMKNACIRPELHKAWMEHVDRDIVRPAEVGFDPAGEDP
FT                   QITCNLWGGWPTTPQPGKCDRIIDLLHYLCSEERNSRELFDWVLRWCAYPIQHPGAKMK
FT                   SCVVVHGAQGAGKNLFFEAIMAIYGQYGSILDQNALVDKHNDWASRKLFLIADEVVAQA
FT                   HRFEQKNLLKVLVTGTRIRINPKHIAAYDEVNHCNLVFLSNEKMPVVLEKDDRRHCVIW
FT                   TPSIKEEEYYQAIRDELGNGGLEAFHDYLLNVDLGNFNPGTRPLMTEAKSDLIDLAKDS
FT                   PLDFIDALTSWNMPPMKPMPGLTEDWYQVYQRWCVNTGTKPASLKRFIHSLKKDCKIKF
FT                   DRKGHLQGQKITNPLSTILFGFSAPEGRVESTWLGEQIIAMRNRKDDYIAGNRQDADAW
FT                   VSGDESWGDE"
FT   gene            236084..236710
FT                   /locus_tag="XALC_0199"
FT   CDS_pept        236084..236710
FT                   /transl_table=11
FT                   /locus_tag="XALC_0199"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14744"
FT                   /db_xref="UniProtKB/TrEMBL:D2U941"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14744.1"
FT                   /translation="MVDPDLPETESFREFADRIGTKPSYVTELRKAGRLVLTKDGRRVC
FT                   VAASLDRIQSTRNPAHAGVRARHAATRDATPALPIPHPPTDAPEAAQADASAAIDDDDL
FT                   PFNAPHQMRRAKALADKEEALARKALREEQVEMGQLLVRDETLAAVTDAVVMLRSRLEL
FT                   IPPTLAPRMAALSDEDQVRVLLRDEIEQALEDLARKFSAIGKVPA"
FT   gene            237006..237311
FT                   /locus_tag="XALC_0200"
FT   CDS_pept        237006..237311
FT                   /transl_table=11
FT                   /locus_tag="XALC_0200"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14745"
FT                   /db_xref="UniProtKB/TrEMBL:D2U942"
FT                   /protein_id="CBA14745.1"
FT                   /translation="MDEEFRDDVLLLLVVVSQLRAAVSQLRDENMDMATEAKKYAEEAG
FT                   CLAALLLDAQRDAQRYRRIRRGQHWSVINGVGDELRADVLDAAIDAAIAKEKGAQG"
FT   gene            237362..237589
FT                   /locus_tag="XALC_0201"
FT   CDS_pept        237362..237589
FT                   /transl_table=11
FT                   /locus_tag="XALC_0201"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14746"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F8"
FT                   /protein_id="CBA14746.1"
FT                   /translation="MVKICELCEENREMAEELKKYAEETGRIAALLHYAQRDIARLDSA
FT                   RIILGDTEFVGIDLRSAIDASIAAKKDAQG"
FT   gene            237586..238029
FT                   /locus_tag="XALC_0202"
FT   CDS_pept        237586..238029
FT                   /transl_table=11
FT                   /locus_tag="XALC_0202"
FT                   /product="hypothetical dna methyltransferase protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna restriction/modification go:0006304 go:0009307"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14747"
FT                   /db_xref="GOA:D2U9F9"
FT                   /db_xref="InterPro:IPR008593"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9F9"
FT                   /protein_id="CBA14747.1"
FT                   /translation="MSQYVDWYGKGRAQNWRTPQSIFDALHDEFQFTLDGASEPGNGLL
FT                   PLASTADEQIDWTGHRVFCNPPWSNIRPFLERAPAADCAVFLVPARTNAKWFHRAIDLG
FT                   AAVRFFEGRPKFELPHRSGPGNSSPVDCLLLILRKDVAREVQG"
FT   gene            238328..239617
FT                   /locus_tag="XALC_0203"
FT   CDS_pept        238328..239617
FT                   /transl_table=11
FT                   /locus_tag="XALC_0203"
FT                   /product="putative dna (cytosine-5-)-methyltransferase
FT                   protein"
FT                   /function="dna structure level; methylation go:0006306"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14748"
FT                   /db_xref="GOA:D2U9G0"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G0"
FT                   /protein_id="CBA14748.1"
FT                   /translation="MHVSSSRSAYEGSNVMRYLSLFSGLEAAHLALSPLGWECVGVAEI
FT                   DAAACALLRHRLPHVPNLGNVTEITDAVIAQLGAIDVVIGGSPCQDLSVAGKRAGLAGA
FT                   RSSLFHEQLRIFHAARTFCSARWLWWENVPGAFSSNKGRDFAVVVGALAGCEFAVPADG
FT                   WKDEGVALGDNGLVEWSVLDAQWFGVAQQRRRVFAVLDVGNWTNRPPVLLEPDRLRGDS
FT                   APRRQAGESVAGTIAGGARQRGGYSNDNVPLIAGTLQANGRAAGSVTQQDAHAGMLVVQ
FT                   QAFGGGANCNATNVSTALTAHPGGSRLDFLSETFLVQEVAHTLRADGFDASEDGTGRGT
FT                   PIIPVPASQTGMQVRRLTPTECERLQGVPDGWTLVPNARGKPMADGPRYKMLGNSFAVP
FT                   VIRWIGEQIQAAHACEIHHLTVGGKQRRAP"
FT   gene            239863..240066
FT                   /locus_tag="XALC_0204"
FT   CDS_pept        239863..240066
FT                   /transl_table=11
FT                   /locus_tag="XALC_0204"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14749"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14749.1"
FT                   /translation="MEIRNPDIRYLLCGMSPRGTNHTVIACGGGYDWDPHPDGGFLVGP
FT                   LTSGYYEITFLLPLSMQQRSAA"
FT   gene            240063..240320
FT                   /locus_tag="XALC_0205"
FT   CDS_pept        240063..240320
FT                   /transl_table=11
FT                   /locus_tag="XALC_0205"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14750"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14750.1"
FT                   /translation="MTKKLAKNIHDRLQRVGKRAGLASAQKQVVQTGPAETVEQFLARG
FT                   GCVQQFPGDARRLRYYQEQTEIAERAAGTAEHIALPEVTS"
FT   gene            240317..242512
FT                   /locus_tag="XALC_0206"
FT   CDS_pept        240317..242512
FT                   /transl_table=11
FT                   /locus_tag="XALC_0206"
FT                   /product="hypothetical phage terminase large subunit
FT                   protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14751"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G3"
FT                   /protein_id="CBA14751.1"
FT                   /translation="MTTMTSSATSTYASAQSEVNKALARAIAPRKPMRVSEWAVRHRRL
FT                   SQKGSSIPGVWRNERNPLLVEIMDCFSARSPVHDVVAMLPIQFGKSEMEANILGYTMCE
FT                   NPQPIMVVLPGEVSMNKWIDQKLNPLIEETAAIQSVLTSTSSRESSNRRSFKDFQGGQL
FT                   YFEHAGNPVRLKSTSAGLLMCDEFSSFANHLRSGDDPGDMLDGRTSAFPSTYKRFKVGT
FT                   PEIAGLCRISELYAQSDRRRWHWPCPHCGHRQAFEWSGLMWTPDARRCWYVCSDCGSVI
FT                   EEHEKPQLISAGGWVPENPSARIRGYHANALYYPMGLGPRWLDLVHMWLAAQNDPAKLK
FT                   TFINDRLAEPWEDKTARKAAPNIIKDRREPYRLRVAPLGVLAVTAGVDTQDDRLAVQII
FT                   GWGRGMVAWVLDYIELSGDPGEDKVWASLVDLLNRPLPHARGGFVQVEATAIDAGGHRT
FT                   ESVKHFCRQRRIRRATCIFGARPNNAPILSRPKLEDVNYQGKLDKKGIKIRHVGTVAVK
FT                   QWLFRCLAADADKPVDARLIHLTEDLDDFYVDGLVSERYNPRTNRYDKVRGGVRNEPLD
FT                   TFVYAYAVTHHQDLRLHRATTADWDAREQRIIDLARSEYRVDSRGTSQPETPAPTAPPM
FT                   HTRAVLDAILTRIERDPMAPVASADRDAWAAATGGTTEETAALSALVARLTDTQAPIGA
FT                   LLPQDMVAMARTALRGPAITPSTPRRFVRGTRHPGLR"
FT   gene            242525..242878
FT                   /locus_tag="XALC_0207"
FT   CDS_pept        242525..242878
FT                   /transl_table=11
FT                   /locus_tag="XALC_0207"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14752"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G4"
FT                   /protein_id="CBA14752.1"
FT                   /translation="MHEPQSLEQHLQAWVNAYGGEQFTKLGYASDDRLAGASNASGDAV
FT                   ADRVEKIVQRLENIGRWKEARVLRIETFMPALPESERLARLKRDGINIGRTAYYVYLNA
FT                   ACAAVELYLSEKP"
FT   gene            243008..243223
FT                   /locus_tag="XALC_0208"
FT   CDS_pept        243008..243223
FT                   /transl_table=11
FT                   /locus_tag="XALC_0208"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14753"
FT                   /db_xref="GOA:D2U9G5"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="InterPro:IPR036626"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G5"
FT                   /protein_id="CBA14753.1"
FT                   /translation="MATLQEQLDEALAARHAWCIGRTRVTVTFGDRTLQYSVEGMKQLD
FT                   AYIAQLRRQINGVAPVRNRVRYVTPD"
FT   gene            243225..244853
FT                   /locus_tag="XALC_0209"
FT   CDS_pept        243225..244853
FT                   /transl_table=11
FT                   /locus_tag="XALC_0209"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14754"
FT                   /db_xref="GOA:D2U9G6"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G6"
FT                   /protein_id="CBA14754.1"
FT                   /translation="MTGSAAIARDRLSAAIALDKHARQVAAQLSAPRAEGPSEIQDTRW
FT                   RGASRTLRSMTNWMAPIGSATSDLPGAEQSTLRARSRDAGRNHMPARAALMRNRTSVVG
FT                   TGLVCRPAVDHETLGLTPEEAANYNTTIRAAWERYAKNPLECDYEGTLDIYAQQGLVLL
FT                   SAMSSGDVFVITPQLQRAGGLSELKLQLIEADRVCNVNDAIDTPDCINGIQYQDGMPVG
FT                   CWVRSIHPGDRVDMRMPRWDYYAFQGDDTGRRRVLHIWNDKERPGQVRGAPYLAPILEP
FT                   LKQLERFSSAELMAAVISAMLTVFIERKAEETDEAGNPVAAFDSADSAGNIALGNAAVV
FT                   DLAAGETANMVNPSRPNANFDPFFDAILKQIGAALELPLDVLLLQFNSSYSAARAAMLE
FT                   AWRMFLCRRRLLTTQFCQPVYGLFLDEEVASGRLQLPGYGDPVRRHAWSSAMWIGPARG
FT                   SMDEQKEAAAAKTRIEIGVSNASMETAAMNGEDWSDVNAQRAREINIMRANGTYIDPTS
FT                   VIIKSTSDGAGTKPSETPDNPEETP"
FT   gene            244850..246151
FT                   /locus_tag="XALC_0210"
FT   CDS_pept        244850..246151
FT                   /transl_table=11
FT                   /locus_tag="XALC_0210"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14755"
FT                   /db_xref="GOA:D2U9G7"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G7"
FT                   /protein_id="CBA14755.1"
FT                   /translation="MTDAFHLAASRPWLIQQESLETILAIAQRYGDPEALQTRTGRPLD
FT                   NARTISMRDGVAVVPITGPVFRYANLFTEISGATSTQVLATDIQSALDNPYVRAIVLDI
FT                   NSPGGEATGINELAKLIHAGSACKPIKAYAGGTMASAAYWLGAAADEIVIDDTAVLGSI
FT                   GVVMSYLDTSARDAKSDVRRVEIVSSQSPDKRVDPSTDEGRAKVQAQVDALADVFVAAV
FT                   ARYRNTSTDTVLSDFGRGGVRVGADAVKAGMADRIGSLESVIAELAGSASHSKRTTNMS
FT                   TTKPQVTVSTTEDLRNAFAAGYTAEQIVIASNDDAIAAARRHGEEKGRAAATETAVAAE
FT                   RARIAEIQALARDGFDAELKAAIDNGDSPAAFALTLLKAAQDRGITLDAIRRDAPKAAA
FT                   HAKPGNDVQTAPNSIISHSDIFAARRKAMTGANQ"
FT   gene            246161..246526
FT                   /locus_tag="XALC_0211"
FT   CDS_pept        246161..246526
FT                   /transl_table=11
FT                   /locus_tag="XALC_0211"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14756"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14756.1"
FT                   /translation="MTVLNENARSGDFLLSEGNGCYSRENEILASGENLQAGTVLGVIT
FT                   ASGKYTILAPAATDGSQNAGGILLSTTNATAADTAVVVVERAAEVKAAALIWPAGITTD
FT                   QKTAAIAQLSTLGIVLR"
FT   gene            246544..247578
FT                   /locus_tag="XALC_0212"
FT   CDS_pept        246544..247578
FT                   /transl_table=11
FT                   /locus_tag="XALC_0212"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14757"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9G9"
FT                   /protein_id="CBA14757.1"
FT                   /translation="MYLISDIFNADAFSLLSLTKAINNIPFVPSRAGQVAGWEELSIST
FT                   TSVMLEEQDGKLELIDPTPRGGPGITSEPSSRRARSLVVPHYQADDFITADSVQNVRAF
FT                   GQSGQLEVLSDRVNTRMTQLVSWKLDPTLEHQRIGALKGVILNSKGDTVYNLFDEFGVK
FT                   QETEVNFDLDNPNPASGVLRETCAAVVRTIADNLGGVAIGPIYAECGNSFFDHLIKHPE
FT                   VVASYRNTDMASVLRQGYVTPNGTVYGVFEFGGIIWENYKGSVNKKPFVDDDKCHIFPT
FT                   GVPGLFSTVYAPADYEETVNTLGLPRYAKQYPSLSGKGRSIEVQMNALSYCARPKVLMQ
FT                   GRRA"
FT   gene            247649..247960
FT                   /locus_tag="XALC_0213"
FT   CDS_pept        247649..247960
FT                   /transl_table=11
FT                   /locus_tag="XALC_0213"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14758"
FT                   /db_xref="GOA:D2U9U7"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9U7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14758.1"
FT                   /translation="MTDSNDNQTRMERVAENSITRTLVHLITPILLAVIAWLGQRQLNA
FT                   IETNQADMSKTQQQQASHMGTMASDIRDLNTRFDLAAIKRIDELEVRVKHLEQVTKTP"
FT   gene            247957..248337
FT                   /locus_tag="XALC_0214"
FT   CDS_pept        247957..248337
FT                   /transl_table=11
FT                   /locus_tag="XALC_0214"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14759"
FT                   /db_xref="GOA:D2U9U8"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9U8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14759.1"
FT                   /translation="MKSLLKFWTMLKSAAYVSQEFTLWLPGLVALTVLGWIVLGALGRV
FT                   GPDAIAALLEVPVICTYAMAALGMSWLIKRLYLYDLDRNDECTLQGLALAGDTGARWVL
FT                   IKDRLETLACVTAMLIFFYPAR"
FT   gene            248295..249155
FT                   /locus_tag="XALC_0215"
FT   CDS_pept        248295..249155
FT                   /transl_table=11
FT                   /locus_tag="XALC_0215"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14760"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9U9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14760.1"
FT                   /translation="MRHRHAHLLLPCALTMTARLLLIFTLMLLTACDRAIAIPRSAAPA
FT                   SGVGGMDTAIQSAQSGAAATIAPVVMGLRTSVQSAVPLPTMTQSRSVSPVAAAHILHWE
FT                   VISPAWYTQRLQRPVWPGGASGITWGIGYDGGYQTPVVIASDWIGHTHLAQLQRAAGVV
FT                   GPAAAAALPAYRSITTPYALASAVFTGVSLPLWRQTTSRIYGPAFDALPANAAGALVGN
FT                   TYNRGGSMVGARNAEKRVIRDRCIPAGDLHCIAAQLRAQCRLWPDTPGLCARRQDEARL
FT                   VETAR"
FT   gene            249211..249657
FT                   /locus_tag="XALC_0216"
FT   CDS_pept        249211..249657
FT                   /transl_table=11
FT                   /locus_tag="XALC_0216"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14761"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14761.1"
FT                   /translation="MSILSVLTIKPVLYAAGLLAVLCLGEGVALRTQAALHRAAITKVK
FT                   ADLDRWRNDAAVARAKESELIEANDGWQITAEKLHIRLEEEQRQCVALAARNDKAIAAA
FT                   KADAADADAALKSFVARYDAAVHKPDCASALHALTTSCHSLEGY"
FT   gene            249659..249952
FT                   /locus_tag="XALC_0217"
FT   CDS_pept        249659..249952
FT                   /transl_table=11
FT                   /locus_tag="XALC_0217"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14762"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14762.1"
FT                   /translation="MHRNILLLSVLMLAVLTGCPLRNDTRAPHACAVLPQPVEIVRRVY
FT                   VPINPLLTTPEPVAEGPLSECPDVAAQRKAALKRANSHLQQIKQIQGTEVKP"
FT   gene            249949..250260
FT                   /locus_tag="XALC_0218"
FT   CDS_pept        249949..250260
FT                   /transl_table=11
FT                   /locus_tag="XALC_0218"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14763"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14763.1"
FT                   /translation="MSADAIFADAAVDLFAEQGVPATVRRGKDAPVAVTIIVQRNQERL
FT                   GNYGVAVSCVDTVAFLVAAWTPQSGDVVVWTDLLGTHTRKVDGLPANDGFVATAVLHG"
FT   gene            250253..250687
FT                   /locus_tag="XALC_0219"
FT   CDS_pept        250253..250687
FT                   /transl_table=11
FT                   /locus_tag="XALC_0219"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14764"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14764.1"
FT                   /translation="MADTAPMAWRIMQATAERLRLIRTSDGARTDLGADVRLEAQPFDP
FT                   SDTTGRITLYTASVVHPDGARSPSERELTLIIELTVPAAWDAAQATTLGAAEDVEDMLG
FT                   DWMPFNGALPLRFRESIFLERPDGMPCIVTQMMFGTGWRR"
FT   gene            250684..251298
FT                   /locus_tag="XALC_0220"
FT   CDS_pept        250684..251298
FT                   /transl_table=11
FT                   /locus_tag="XALC_0220"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14765"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14765.1"
FT                   /translation="MSRVLSQRYDVHGALEVARNLGVLASRLPGIQQRAALTLRRRLPV
FT                   QARRDIQTEYNITAQRVNKDMYVAMDGDSAVKLIGRFRGIGLMNFDARQTLKGVTYSVL
FT                   RGKRELSEGAFIATLINGNRQVVSRVGRKRVMTQGRYKGKRREPIAVEYGATLAQMLGK
FT                   QRRPERLAEFARGVLGKEVERLLAYYDRGTGYLDSLNEASP"
FT   gene            251295..251483
FT                   /locus_tag="XALC_0221"
FT   CDS_pept        251295..251483
FT                   /transl_table=11
FT                   /locus_tag="XALC_0221"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14766"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14766.1"
FT                   /translation="MTRLYIYAPHTHAGVRYDPPPEGVEIEVSAQDAEFLYALGKTTPP
FT                   AAPALPPLANTDDASDD"
FT   gene            251524..252282
FT                   /locus_tag="XALC_0222"
FT   CDS_pept        251524..252282
FT                   /transl_table=11
FT                   /locus_tag="XALC_0222"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14767"
FT                   /db_xref="InterPro:IPR016893"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V6"
FT                   /protein_id="CBA14767.1"
FT                   /translation="MKDFSFQGIVYLGTRLPGGKPGALTDAGDVPKCDVALQVQTEKRT
FT                   ESRSGNRLTSAVLQKSKESTIVVTLNHATFKNWMMVLYGTKIVIPAGSITGELLPPNLM
FT                   SNDVVALAQGAISSLVITDSAGTPATLVENTHYAITSPKGGVIKIINPSSFVQPFKAAY
FT                   AHDPSINITMFTAPPPEVYLFLDGINTIDNSRVRTHLYRVQFDPGSSLPLINESFGQFE
FT                   LPGTVLFDSEAEADALMGGFGKIELVGETG"
FT   gene            252286..252804
FT                   /locus_tag="XALC_0223"
FT   CDS_pept        252286..252804
FT                   /transl_table=11
FT                   /locus_tag="XALC_0223"
FT                   /product="hypothetical protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14768"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V7"
FT                   /protein_id="CBA14768.1"
FT                   /translation="MAHKVEQPTPPLADASEDSLVALHPDMTITVAGRAVTVREYGFFE
FT                   GLEVAARCPGFIASIAGMVNADNLSYARVRRLFGLHREEVIHAAATAANVEAEWVAGLQ
FT                   GADAEVFMSTWFGVTGGFFVREAVQEVVELRARTPTNPTPTSGTASSPNSPPPGSATLT
FT                   SSDAAQKGS"
FT   gene            252932..256642
FT                   /locus_tag="XALC_0224"
FT   CDS_pept        252932..256642
FT                   /transl_table=11
FT                   /locus_tag="XALC_0224"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14769"
FT                   /db_xref="InterPro:IPR009628"
FT                   /db_xref="UniProtKB/TrEMBL:D2U9V8"
FT                   /protein_id="CBA14769.1"
FT                   /translation="MGNRDFEIELKLKADYQSAQKAAEDTKEGIDSIVTATERANQALD
FT                   AGASQQSNRLREMVQRSLAQMDHVESAVAPSSESVSSSGDHATLQARRANVAASQALQH
FT                   SVAAEMSLIGELETRLHRGAISMQELADTEQRLDQAMRRDLISTEDYDAALVKLNTEQA
FT                   RLEKSAAAAAAQQQRQQAARQRVADAEAASLDRTVGAYDKVSAGMRKIATDEARITQAF
FT                   QSGKVSGEDYVRALSGITNARTKLQGLQDGVTQSANAMKGLNFQAAQSQRSLAELLQYA
FT                   ATGRWNMVEREVLLLGRTTGAMGMLFSSTGLAIGGAVAAVAAFGAAAVAGYLQMRAFEG
FT                   AIIATGDAAGVTAGQLGDMRNNIGKSTGEYGEAQAALAAFVNSGQMAGDSLEQASRAAV
FT                   NLSTLTGESIEQTTTKILELAKSPTATLVELNQRYHFLTEAVYLQVRALEAQGRTQDAL
FT                   KIGLQALDEETAHRVTTMKAQAGLLARAWESVSHAVSSAIQSMKDIGRTDLNAQLANAQ
FT                   ITLDNMRNPISQERGYSTPMQIEQQKKIVEGLKQQIAASEALAKADGARRKAQTDLIND
FT                   DQKIKDDAEKAKKDIDEKLAKSDKLIARQQRLNKLIEDYNVIAAADPNDKRLYDGSYEK
FT                   IKKEIIKETTEKAKHVAKGPKSEEEKEQDAAQHELENLKKMVALEDSLTDGKKKAAEQA
FT                   RIEFEVTQGAYRLADESIKQQLRDQAKLADVATARAEADRKLIEVRERILGVQDGREDA
FT                   ALAKARHELELLQADLQKQGRFADAADVSKLLGLDQAQTDLKNLRKTYEQVMGEISIEV
FT                   QRIQVEQQAGFLTEVDAQQKIINLYRSKLGVLKAMVPQMRAAALTLGGDVGKAALNNVE
FT                   QIEVKLREMETTTNAMQQAFGTTFQQSLNSTLDSLIKGTATLGDAVRGFFASLLQGMAQ
FT                   FAAQNVAQKASNWVKGLMRGDKTGAGDSDATAPAAITTAGTTAATAIVNAGDTVAAAIR
FT                   GASVGAGGVGAPAAGQADTPAPASTSVVVNGTSAANAMQDAGTSVSAGAAAIGQSAVQL
FT                   ASAAGGLSPGAASVVSAALQLWQAAQTLLVANSASVASGFADGGFTGAGGKYTPAGVVH
FT                   AGEFVHRQEVVRQPGALPFLWDFNRRGMAALQHWAGYADGGHVGSTLYAWANSADSRRF
FT                   SPEANLRASNDDAIKRGAETSRGALNQRIRLVVVDDPNRIPAALKSEVGEESFLYHAGR
FT                   NVGQLKQLLDV"
FT   gene            256642..257565
FT                   /locus_tag="XALC_0225"
FT   CDS_pept        256642..257565
FT                   /transl_table=11
FT                   /locus_tag="XALC_0225"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14770"
FT                   /db_xref="UniProtKB/TrEMBL:D2U868"
FT                   /protein_id="CBA14770.1"
FT                   /translation="MAYVKGTASNYLDLLDKLRTFLTSNADLVAANQQWTQLRWSNNEL
FT                   FVRGPGLDGRQQIYCGIRALTFASLDAYNFGIVSAMSYSDGLPFQGQPGSNPECFVPLW
FT                   NDSMPYWFVANGQRIIVVAKISTRYMALHLGYGLPWALGGDYPAPLYVGGCTDTSTDRW
FT                   SSNDYGFRSFADPGNGAQVLSPAGTWLQVRNFHNFANQEWEDDKLNVWPYGGLNQGPVS
FT                   GSDGASSNVLRSLRNNGDGSYTPFPLIIHGNAPSPEIYMELDGCYYVSGFNNAAETILP
FT                   IAGVDHLVVPNIFRSDRWGYWLLRLS"
FT   gene            257565..258473
FT                   /locus_tag="XALC_0226"
FT   CDS_pept        257565..258473
FT                   /transl_table=11
FT                   /locus_tag="XALC_0226"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14771"
FT                   /db_xref="UniProtKB/TrEMBL:D2U869"
FT                   /protein_id="CBA14771.1"
FT                   /translation="MAYQTGTASDPVALLNSLAAFASNNGWTTGSVQSGMSFASPDGAK
FT                   FTIAAGADTLSIRGCTDFDSSKTPDAQPGASPFTTTLNAIAGPFAGYTFFAGAESGAAY
FT                   LHGVIEAAAGIYKPFALGRLVKFDATVGGEYASAVNWYYSSYAVNDPENAYHDYLFDSE
FT                   NTYNVNQSLSHVRADFDGKISNWMRLRYLWEGNNAIGSARRQGMLTSLIGIGYQRYNKL
FT                   VPVLPIYVFGDRPNNLRSPIGYVPHLRIVDLQLLEPKQIITLGSEEWQVFPAHQRTLTW
FT                   GASPSTTPSSAYYGYAFRRIA"
FT   gene            258470..260173
FT                   /locus_tag="XALC_0227"
FT   CDS_pept        258470..260173
FT                   /transl_table=11
FT                   /locus_tag="XALC_0227"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14772"
FT                   /db_xref="UniProtKB/TrEMBL:D2U870"
FT                   /protein_id="CBA14772.1"
FT                   /translation="MIAPGLRADVGVYINPALGHRHPWWNPTIGWSGQLPPPAAMRGVR
FT                   PVLAEPVRSAPATIGRQFGFLSWYQRVHLSDTLLALGNVVSTQNRQIRVWNGYVDRSVS
FT                   VTTVNVVGGEGIDLVAPAPLPTAFRPLQTWTWLLSVSLDGPPTVAATITWVLNTDPSLT
FT                   LRVTGSRVTAWGWTPDWDQGVKERLEWLTDVLQSPTAAEQRRKLRPWPRRSFSANMLVD
FT                   GNDRVSLDLALYGWGARNWALPIWPDVTWLTTRVTAGSTSIALDTRGMDYRGGGLALLL
FT                   GATALDVEVIEIDAVRDNGLDLVRPVQAEWGLGSQIYPVRIARLSEQPQESRLTDQSSR
FT                   YDVNFDIVDACAWPATPPATIYRGVPVLEEVPDESEDLSRQYQRMLTLLDNSINAPTVT
FT                   DLVGTGVAIQQHRWWIAGRAAHSAWRSLAYYLCGRVGAIWLPTFAEDVQIKAVVAPTAS
FT                   TMDIQLIGYARFGTGNTGRRHLRIELRDGRVVHRRITGAVVVDASTERLSLDHPPEIEL
FT                   SPAAVRRVSWLQLMRLQDDAVEIDHQTDIEGLANASAMFRSLREDLELSA"
FT   gene            260170..260997
FT                   /locus_tag="XALC_0228"
FT   CDS_pept        260170..260997
FT                   /transl_table=11
FT                   /locus_tag="XALC_0228"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14773"
FT                   /db_xref="InterPro:IPR011928"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:D2U871"
FT                   /protein_id="CBA14773.1"
FT                   /translation="MTFADRERSVRAGAPVGLFEFSRGPLVWRYTNCGADYDARGIVYT
FT                   NVPGFTDDVISQSGEIERDSLTLTVPASLPVVQHYLSVKPSTRTRLAIRSVHFGDEDPD
FT                   LEWVGYIAAIRRKRTGERLVTCQSIAATFGRPGLRLCWSRGCPYVVYDNRCTVNPDKFA
FT                   VSTVLGQVSGIAVSAAALSAAPEDGYYSGGVMRWTSADGVDEVRGLDLHDRAAGTVQVF
FT                   GGTQGLSSGQTVTVMPGCDYTVETCERRFNNRVNCGCHKGMPGKSPFDGTEVF"
FT   gene            260997..263471
FT                   /locus_tag="XALC_0229"
FT   CDS_pept        260997..263471
FT                   /transl_table=11
FT                   /locus_tag="XALC_0229"
FT                   /product="hypothetical phage-related protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14774"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:D2U872"
FT                   /protein_id="CBA14774.1"
FT                   /translation="MWVSIALILVSILYSAYMARKNQPHAAIFEDGDFPTADEGTPQYV
FT                   VFGDCWSADWCVIAWGNQRNRKVKKGGFLSKHTVGYRYFASLQMGLGRGPLNAITAIRV
FT                   GDKVAWTGSAEGNAAINIDKFDLFGGDEGQGGIVGTAQVLMGERTQQAPDLLQKLLGGA
FT                   TTGCRGVATVLFDGMLCAMSKSPQPWVFRHWRTTQGWDRDPWYPEKALILLRNDLADLS
FT                   DYPADQRDAMRNIHAINGAHMLVEVATSHDWGRGMDLSELDLDSYKAAADQLYAEGLGL
FT                   CLRYTRGGSLDDFVQQVLDHISGAQFVSLSTGLLTLRLIRADYNVADLPTFGYDSGLLA
FT                   IEDMETSTDEEVNVVIGTYSDPVKREQRQVRARNTGAVQATGSNVVMTRDYPGLPTWQL
FT                   AQRAVERDLRVKTGGAKNYKVTLDRRGRWIEPAGLMVIHAPEEGLDQLVLRVAKIERGK
FT                   ITDGKIVITCAVDVFGLGALRLSNPPGSVYIPPATDAQPAIAQSAWELSYRDLAHSLSL
FT                   ADLAALPARSGYVGAVGKRPTSSTSDFALAVSTANATYNEVAEVECTPYARIAADMARS
FT                   DQAITIHLVGETDLDALNVGQALLIDSEIVRLDAIDLQTHLCTIARGCADTVPAAHPAG
FT                   TVVWGYEAGLGVDPTLRFFGDTVNLKLLTRTSSDKLDPILATSMSVTLADRAARPYPPA
FT                   CLRINGLGYPDQLYGSLAATWAHRDRTQQSGTLVASDAGSIGPESGTNYTTNWYLDGAL
FT                   VRNQSGISSAGDVYSPPPGSGGKTVRVEVESLRDTHESWQKLQHTFLYRAQLVTEEGDR
FT                   IVSEAGGVFILE"
FT   gene            263474..264292
FT                   /locus_tag="XALC_0230"
FT   CDS_pept        263474..264292
FT                   /transl_table=11
FT                   /locus_tag="XALC_0230"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14775"
FT                   /db_xref="UniProtKB/TrEMBL:D2U873"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14775.1"
FT                   /translation="MADIKISQLPDAATLDGTERFPVVQAGQNAKASPDQLASYAFGLL
FT                   QRYIDGLKLEWVSTTSLRVTNGVAYVPSVKRIIALPQSVTMASLALDASAWYHCYLTAA
FT                   AGIQLVKDAPDAAYAGVARTKTADSSCRYLGSVLTDSSGQIYNFLHVGNQIFYRNAQAK
FT                   NPFRVLDSGTATSIATVSCAAVVPVTARVATLQLYNFASGVNMGTGTSDDSAIGPPSAP
FT                   NDALYLIRQDATALVPHPLASDGSLQYWLTGTPTGGAGAYIDVFGYIYER"
FT   gene            264350..265141
FT                   /locus_tag="XALC_0231"
FT   CDS_pept        264350..265141
FT                   /transl_table=11
FT                   /locus_tag="XALC_0231"
FT                   /product="putative n6 adenine-specific dna
FT                   methyltransferase protein"
FT                   /function="dna structure level; methylation go:0006306"
FT                   /EC_number="2.1.1.72"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14776"
FT                   /db_xref="GOA:D2U874"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2U874"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14776.1"
FT                   /translation="MTKPIIPWPGSKRRLIRHLYTHFPAHECYVEAFAGGAAALLMRPM
FT                   PAPVEVLNDINGDLVRLYRCVQHHLDEFVRQFRWSLVSRKMFEWAQLQHPETLTDIQRA
FT                   ARFYYLQKLAFGGKVTGQSFGYTTTVGGLKLNLLRIEEELSAVHIRLANVIVEHLPWHD
FT                   CLQRYDRSGTLFYLDPPYWQTEGYGVDFPWAEYERLANMMRNMQGRAILSINDHPDIRA
FT                   LFADMTHVPLQIRYSIGRDRGGESFGELIIKNWDDKQASLL"
FT   gene            265340..265717
FT                   /locus_tag="XALC_0232"
FT   CDS_pept        265340..265717
FT                   /transl_table=11
FT                   /locus_tag="XALC_0232"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14777"
FT                   /db_xref="UniProtKB/TrEMBL:D2U875"
FT                   /protein_id="CBA14777.1"
FT                   /translation="MNYMKKWIREHVAEVIKANELSRWVDDSDMKFAMYVVECGQGAQL
FT                   AQDVGREIGNETIVAIAQTVIDTIDEVSRGGTPRTRSRRKITDKQRHVLAVVLLEKYGT
FT                   ARGIAAAGWGLTDEEIDNADV"
FT   gene            265710..266282
FT                   /locus_tag="XALC_0233"
FT   CDS_pept        265710..266282
FT                   /transl_table=11
FT                   /locus_tag="XALC_0233"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14778"
FT                   /db_xref="UniProtKB/TrEMBL:D2U876"
FT                   /protein_id="CBA14778.1"
FT                   /translation="MSDDLDFSELSDDQIVELAVALAREAMRRNPALQAAFAQALLDER
FT                   ERVEAAARGSARVKQAAAQRLEQDAERAELAAERERRRQRIHGALVAYLARLAEIIGRP
FT                   LGELTLVWKPKDYGRGPGPRLQVNQGATGADVRWHLLDFVAVDERLYTSPGLRSRQTEL
FT                   LPWFREVAAVANAFGLVHTFVVKGIEA"
FT   gene            266438..266866
FT                   /locus_tag="XALC_0234"
FT   CDS_pept        266438..266866
FT                   /transl_table=11
FT                   /locus_tag="XALC_0234"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14779"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D2U877"
FT                   /protein_id="CBA14779.1"
FT                   /translation="MAEDGRRKIDILRDAVDAARGPARLIAFSRTAREVEQIPEPESNT
FT                   DLVAGLALAKSLDPGTTLLISDGEPDNEAAALALARTYRGAIDVLYIGSADNFRAIDFM
FT                   RRLASAAGGGVTLNDITARDGARLLQQRIAGLLSGPQA"
FT   gene            266863..267306
FT                   /locus_tag="XALC_0235"
FT   CDS_pept        266863..267306
FT                   /transl_table=11
FT                   /locus_tag="XALC_0235"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14780"
FT                   /db_xref="UniProtKB/TrEMBL:D2U878"
FT                   /protein_id="CBA14780.1"
FT                   /translation="MSRYLIWLVLNDGVSERVSERDIDASEEAGVIDRVLIPLMRGEQG
FT                   RLGGRNSPYSVTGAVSGKRALARLWDEESPLADIGVCLHSRAAPCLWAELHADDCGGLA
FT                   DINQPADAPWCAVRCYAPEQVLPTWFDSWTKTLAMALVRRDGW"
FT   gene            267440..267883
FT                   /locus_tag="XALC_0236"
FT   CDS_pept        267440..267883
FT                   /transl_table=11
FT                   /locus_tag="XALC_0236"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14781"
FT                   /db_xref="UniProtKB/TrEMBL:D2U879"
FT                   /protein_id="CBA14781.1"
FT                   /translation="MAWYTLTYACGHTEQKQLYGKTSERERIINSAQSYDCPACRLAAA
FT                   KAIEADIGLPPLTGSDKQIAWAAGIRAKAQSSLVAFESELDARWDSLDDKQKAASAQSL
FT                   AAMMDAIRTIRRQTQAGWWIDHKNFGARDMVGMICRGQDLDCR"
FT   gene            268039..268413
FT                   /locus_tag="XALC_0237"
FT   CDS_pept        268039..268413
FT                   /transl_table=11
FT                   /locus_tag="XALC_0237"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14782"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAM5"
FT                   /protein_id="CBA14782.1"
FT                   /translation="MTISTRKQSAAFAAAGVHNMPRTRSHIWTNVVASVPEAVLSSMTS
FT                   RQLAAVIAAAHKSYHDGRATNQAEVIDDAIWIGAGVDRLLPLAALKSITEDHSREPIEW
FT                   SKSGDTWAVIRYRMDYNERV"
FT   gene            268413..268703
FT                   /locus_tag="XALC_0238"
FT   CDS_pept        268413..268703
FT                   /transl_table=11
FT                   /locus_tag="XALC_0238"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14783"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAM6"
FT                   /protein_id="CBA14783.1"
FT                   /translation="MSTKNRSITQLLRKKGYSQERKQAILDDWIAEWRRDTTSIVAQLD
FT                   DAESTGNWNKVHNATKQLATGANKRLDSLPRVIAAMNQNAGTEDDNQDQQV"
FT   gene            268729..269193
FT                   /locus_tag="XALC_0239"
FT   CDS_pept        268729..269193
FT                   /transl_table=11
FT                   /locus_tag="XALC_0239"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14784"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAM7"
FT                   /protein_id="CBA14784.1"
FT                   /translation="MSDLPLDRIVLHEAIRQLVSDGETFPGDLADQVIVSLPLTGQGYW
FT                   IRITGAFRQRQAPDRLSLASGPQDTGDDKWVEFGKEGGHRIGLYVVEHFPGKIYIRSIT
FT                   SNTNDGGGEACLHYRRRRATSMRLSVVKTIVISRARLALVTWRAWKRRQD"
FT   gene            269220..269699
FT                   /locus_tag="XALC_0240"
FT   CDS_pept        269220..269699
FT                   /transl_table=11
FT                   /locus_tag="XALC_0240"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14785"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAM8"
FT                   /protein_id="CBA14785.1"
FT                   /translation="MTYDIAHITLTTGDVAKQGREAIVDTTLAIVGSWLTSALVSGKPE
FT                   PIPGIKSGNAALALQQDGALVVTVYGPTPDVGKADALVTFGVATHSMHANNLWSMLLQT
FT                   QPYIRKDLQQPCMPWCAVVPYPNLLNHTDAAAWIADFERCVAWAWASRNPELRGI"
FT   gene            270038..270520
FT                   /locus_tag="XALC_0241"
FT   CDS_pept        270038..270520
FT                   /transl_table=11
FT                   /locus_tag="XALC_0241"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14786"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAM9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14786.1"
FT                   /translation="MRNLNLILAAILLSIAASTASAGSSKPNPADLIPGMGESVPSGVK
FT                   NISLSPKFKVYKFEKDGLRYVQVNSLKDEILSITIVTPGVQTILPLGRAAEGAMAVVND
FT                   DKQRPIGMVTAAATCPCSAQTVYEDANTKIVVIFGEGGEYIQTVVINKHPQPSPNH"
FT   gene            complement(270640..271683)
FT                   /locus_tag="XALC_0242"
FT   CDS_pept        complement(270640..271683)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0242"
FT                   /product="putative phage integrase protein"
FT                   /function="extrachromosomal; prophage genes and phage
FT                   related functions"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0242"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14787"
FT                   /db_xref="GOA:D2UAN0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN0"
FT                   /protein_id="CBA14787.1"
FT                   /translation="MYPHCTNRMGLHQVALIEKRGKKWRALVRLKGHPTASKTFNGRKA
FT                   AEDWARAAEDALRGGTALPQESITLSALIDRYVKEMSKFRPVSATKRGNLKRWEESLGD
FT                   REVASLTGQDILTHIGQRKAGPATMTMELGFLGEVLAAGRSLWGMTIPDVVASSRPVLR
FT                   RAGAIAKPVERDRRPTGKELDDLAAFFRFNLGAIPMRDLIPFAIDSAMRMGEIVALRWE
FT                   DYRSGDKPTIQIRDRKDPMDKRGNNQWVPLLGQTVEIIERQQRAGPLIFPYKPDSIGAA
FT                   FRRACMRLQIEDLHFHDLRHEGASRLFERGYSIPEVAIVTGHRDWKSLKRYTNLTPESL
FT                   HRDPKAG"
FT   gene            271762..272748
FT                   /gene="dusA"
FT                   /locus_tag="XALC_0243"
FT   CDS_pept        271762..272748
FT                   /transl_table=11
FT                   /gene="dusA"
FT                   /locus_tag="XALC_0243"
FT                   /product="probable trna-dihydrouridine synthase a protein"
FT                   /function="information transfer; rna related go:0016070;
FT                   trna go:0006399"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14788"
FT                   /db_xref="GOA:D2UAN1"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004653"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14788.1"
FT                   /translation="MLNIKEIRLSVAPMMDWTDRHCRVFHRLLAPSARLYTEMVHANAV
FT                   VLGDRARLLDYDAAEHPLALQLGGSDPALLAQAARIGQDWGYDEINLNCGCPSDRVQAG
FT                   RFGACLMREPGLVAECVAAMAAAVDVPVTVKCRLGVDQDNDEAAFLAFVDHVAAAGCRQ
FT                   FVVHARNAWLQGLSPKENREVPPLRYDWVYRLKRERPQLQVVLNGGLANVETAQAQFVV
FT                   VDGVMLGRAAYHDPYVLHRLDAALTGAALRPRAELLRALRPYVEVRLAEGLALKHIARH
FT                   LLGLFHGQPGGRAFRQVLSEGAHRSGADWALLEQALQVTEGVRCVAA"
FT   gene            273192..273539
FT                   /locus_tag="XALC_0244"
FT   CDS_pept        273192..273539
FT                   /transl_table=11
FT                   /locus_tag="XALC_0244"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14789"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN2"
FT                   /protein_id="CBA14789.1"
FT                   /translation="MIALALASSAAGHDRGPQQSTPGAVIPSEPDPARGRESAASSLSD
FT                   AVRRVQRSTGGQIQILGAERVPFDGHDINRVKYMDGRGRVRYMDDPQPARAPPQATRPS
FT                   EPDQPPHDDHP"
FT   gene            273614..274297
FT                   /gene="phoP"
FT                   /locus_tag="XALC_0245"
FT   CDS_pept        273614..274297
FT                   /transl_table=11
FT                   /gene="phoP"
FT                   /locus_tag="XALC_0245"
FT                   /product="probable two-component system regulatory protein
FT                   phop"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14790"
FT                   /db_xref="GOA:D2UAN3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14790.1"
FT                   /translation="MRILLVEDEAPLRETLAARLKREGFAVDAAQDGEEGLYMGREVPF
FT                   DVGIIDLGLPKMSGMELIKALRDEGKKFPVLILTARSSWQDKVEGLKQGADDYLVKPFH
FT                   VEELLARVNALLRRAAGWSKPTLECGPVALDLAAQTVSVSGSNVDLTSYEYKVLEYLMM
FT                   HAGELVSKADLTEHIYQQDFDRDSNVLEVFIGRLRKKLDPDGELKPIETVRGRGYRFAI
FT                   PRTEG"
FT   gene            274335..275750
FT                   /gene="phoQ"
FT                   /locus_tag="XALC_0246"
FT   CDS_pept        274335..275750
FT                   /transl_table=11
FT                   /gene="phoQ"
FT                   /locus_tag="XALC_0246"
FT                   /product="probable two-component system sensor protein
FT                   phoq"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14791"
FT                   /db_xref="GOA:D2UAN4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14791.1"
FT                   /translation="MAARSSWYKRWRPRSLQARQLLAASLSLVAFLAAAGYALDQAFAD
FT                   TALSNLRERLKNYATAYANNIDVARDGSLYINNDKPPPDPHFDRPGSGLYAQIVMPNER
FT                   WISMSSEGPLPPRGGMLEPRQETFDGPWQMTQIDGSVGEVYRYGIGLAYVRRDKETPVT
FT                   IYIMEDTRALGAQLRVFRGRVWFNLGGAGLILLVLQAFILQWSLRPLRRVINELTKVQR
FT                   GEAVRMGDRHPRELEPLTDSINAFIESERENLDRQRNTLADLAHSLKTPLAVLRTQLDS
FT                   GARGEELREELDAQLRRMNNLVSYQLARAASSGHKLFSAPLPIEPSAEEIVRGLEKVYA
FT                   AKGVLCEFDIEPSARFHGEPGDLQELLGNLLENAFKWARRRVLLTVRPAPAAGSRRAGL
FT                   VIAVEDDGPGIAPEEVAHILQRGVRGDERVHGHGIGLAIVQDLVKGYRGELQVSRSEEL
FT                   GGASFLATLPPGL"
FT   gene            275890..277473
FT                   /locus_tag="XALC_0247"
FT   CDS_pept        275890..277473
FT                   /transl_table=11
FT                   /locus_tag="XALC_0247"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14792"
FT                   /db_xref="InterPro:IPR014917"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14792.1"
FT                   /translation="MPEFRHRPVASRLRVHGRRVLRKTQRLVLSLMLVLFTVGAIAASQ
FT                   KLLERDDARWLQSMTNGLDGPSVAQFQRDGRKRFLRAQLQAPDGDATLPAPVRAELDGY
FT                   EALHTPVQELLRQQAAAQEAIKAMPDGDAKVAAKKANQHHADLLLMQTRQAQVLRAVYA
FT                   TDQLREQMVWFWLNHFSVFANKGRLRWTVADYADNAIRPHALGKFSDLLLATLQSPAML
FT                   EYLDNAQNAKGRVNENYARELMELHTLGVNGGYTQHDVQQLALILTGVGIVPPDRAAPP
FT                   KLPPPLQSQYLRRGAFEFNPARHQPGDKTLLGQRIVGGGFDEVERAVQLIVRQPACAQF
FT                   VSRRLAESFVADDPPPALVQKMARTFQHRDGDIAAVLQVMFTAPEMTAGSPHKFKDPYR
FT                   FLVSALRLAYDGQIIVNPQPLLGWLNQMGEPSFGRVTPDGWPLQSSAWNSSGQLAQRFE
FT                   IARAIGNGNTQLFTRDGQQGGGFPQLSSPLYYQAIEPQLSTATRQALAQARSPQEWNEY
FT                   LLASPDFNYR"
FT   gene            277504..278694
FT                   /locus_tag="XALC_0248"
FT   CDS_pept        277504..278694
FT                   /transl_table=11
FT                   /locus_tag="XALC_0248"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14793"
FT                   /db_xref="InterPro:IPR010869"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14793.1"
FT                   /translation="MHRRHFLLASASVAANLPFAGRLFAAPAPSPRLLVVFLRGGYDSN
FT                   NLLVPYASDFYYASRPSLVIARPDPANLQSAIALDTQWGLNPRLRDTLLPLWNDKHLAF
FT                   VPFAGTDDLSRSHFETQDSIEAGQPAGRRSDYRTGFLARLSQVATGMPSIAFTDSLPLS
FT                   FQGGRDIPNLSLKRNPTPAFDQRQADILAGMYHGTPLASAAHDGLVLRQQVSQALRDEM
FT                   QQANRGAASARTFAEETRRIATLMRERYRLGFVDVGGWDTHVNQGSTDGALADNLTNLS
FT                   EGLTAYADTLGPEWRNTVVVVLSEFGRTFRENGNKGTDHGHGTTYWVMGGAINGGRIAG
FT                   EQVAVSKDSLFQDRDYPVLTNYRDLFAGLLGRMWGLSLTQLQTVFPQAHARDLALV"
FT   gene            complement(278861..279529)
FT                   /locus_tag="XALC_0249"
FT   CDS_pept        complement(278861..279529)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0249"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14794"
FT                   /db_xref="GOA:D2UAY0"
FT                   /db_xref="InterPro:IPR010384"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR042252"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14794.1"
FT                   /translation="MASLDTPREQRLRGLATEFLHRKTISPLGGLQLDAPQCSVLAALC
FT                   CLPLLEFGASGLHGWSQLLVYPNAFRVQRSHIDAAGVLHEWEDELIGESWDNGPLILSW
FT                   ADVQADLDDPRAGYCVAVHEMAHKLDALDGVLDGTPLLPRTWQRQWAADFQRNYDAFCK
FT                   RVDRGRASEIDAYAAEAPEEFFAVVSEYHFSAPQRLQRAMPDVAAHLQRFYGPSPFATD
FT                   "
FT   gene            complement(279616..279882)
FT                   /locus_tag="XALC_0250"
FT   CDS_pept        complement(279616..279882)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0250"
FT                   /product="putative secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14795"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14795.1"
FT                   /translation="MRRLLPCLILLPFLLVVAHASNAMADKQHSDCAYNDATDMDEAQI
FT                   RPATAPRAHAATDKPSASDGGGGDLMPHLRMPKWHSFLPGMFR"
FT   gene            280023..281000
FT                   /gene="birA"
FT                   /locus_tag="XALC_0251"
FT   CDS_pept        280023..281000
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="XALC_0251"
FT                   /product="probable biotin--[acetyl-coa-carboxylase] ligase
FT                   protein"
FT                   /function="metabolism go:0008152; biotin go:0009102"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14796"
FT                   /db_xref="GOA:D2UAY2"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14796.1"
FT                   /translation="MEPALDERELLTRLSQGRLSGDALARSCGLTRAAVWKRIQALRAA
FT                   GVEIDGRAGEGYGLARPLELLDVQAIRAGLVPAAHEELASLEVAWTLVSSNTTLLARPI
FT                   PAHGCEVLLAERQTGGRGRRGRVWASPLAAHLYLSVARGFQGGLGRLGGLSLAAGVAVA
FT                   EALHAAGFAKVGLKWPNDLLADGCKLGGLLVEGGGEFAGPARAVIGLGLNVRMPAASAA
FT                   AIDQPWTDLTTLAAATVSRNAIAAVVVSHLLPALALFDAQGLAPFLPRYAALDLLAGRA
FT                   VRIDDGGVAREGVALGLAEDGALRVAFADGERPLHAGDVSVRPV"
FT   gene            280997..281737
FT                   /locus_tag="XALC_0252"
FT   CDS_pept        280997..281737
FT                   /transl_table=11
FT                   /locus_tag="XALC_0252"
FT                   /product="putative transcriptional regulator, bvg accessory
FT                   factor family transcription regulator protein"
FT                   /function="transcriptional level go:0006355; activator
FT                   go:0016563"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14797"
FT                   /db_xref="GOA:D2UAY3"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14797.1"
FT                   /translation="MSDWLFDLGNSRFKFAALEHGQVGTVQAWPHGAEAMEMAAVAALP
FT                   RGATAYVASVAAPALTAVVLEALEARFAQVQVVRTAAVCAGVRIAYAQPRSLGVDRFLA
FT                   LLAAHGQGDVLVVGVGTALTIDLLDRDGLHRGGRIAPSPTTMRQALQHRAAQLPADGGA
FT                   YHEFAADTADALASGCDGAALALIERSLQYADALLGRWPRLLLHGGGVSTLLHALPTAE
FT                   LRPSLVLEGLALWVQAHAVTRDAR"
FT   gene            281747..282550
FT                   /locus_tag="XALC_0253"
FT   CDS_pept        281747..282550
FT                   /transl_table=11
FT                   /locus_tag="XALC_0253"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14798"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14798.1"
FT                   /translation="MLVRALLVVLTILNLGVALWWGMQPPAPRTTPLPALPVGVATLQL
FT                   VQPPFAAAPAQRSESPAASVTTAGDATLPVPSAPAVFAGTEKTVAAGAAAVPSPSAAAA
FT                   TEQAVATPAPAAPVCLSLGPYADRAAAEAALAAVPATQAHPHLRESTDSGTTTFRVLLP
FT                   VIGGEDGLRVAAERIAAAGIRDYYPIRQGETGNAIALGQYRSREGAERRLVELARSGVN
FT                   ADLIPGSGRTHWWLDLRADSAAQAAMLRWHLGRVRQRPLDCATLR"
FT   tRNA            282625..282700
FT                   /gene="tRNA-tRNA_Thr"
FT                   /product="transfer RNA-typeThr,AnticodonTGT"
FT   gene            285201..285353
FT                   /locus_tag="XALC_0255"
FT   CDS_pept        285201..285353
FT                   /transl_table=11
FT                   /locus_tag="XALC_0255"
FT                   /product="putative entericidin ecnab precursor protein"
FT                   /function="extrachromosomal; colicin related"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14799"
FT                   /db_xref="GOA:D2UAY5"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY5"
FT                   /protein_id="CBA14799.1"
FT                   /translation="MKRLTTLMMLTLFCAGLLSGCNTVAGAGKDMQKAGEKVEDKAQDC
FT                   SAGKC"
FT   gene            285455..285595
FT                   /locus_tag="XALC_0256"
FT   CDS_pept        285455..285595
FT                   /transl_table=11
FT                   /locus_tag="XALC_0256"
FT                   /product="putative entericidin ecnab precursor protein"
FT                   /function="extrachromosomal; colicin related"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14800"
FT                   /db_xref="GOA:D2UAY6"
FT                   /db_xref="InterPro:IPR012556"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14800.1"
FT                   /translation="MKRTFAWMLLAIFSAGLLSACNTVAGAGKDVQKAGEKVEDAAAKK
FT                   N"
FT   gene            285792..287081
FT                   /gene="trpS"
FT                   /locus_tag="XALC_0257"
FT   CDS_pept        285792..287081
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="XALC_0257"
FT                   /product="probable tryptophanyl-trna synthetase
FT                   (tryptophan--trna ligase) protein"
FT                   /function="information transfer; amino acid-activation
FT                   go:0006418"
FT                   /EC_number="6.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14801"
FT                   /db_xref="GOA:D2UAY7"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="InterPro:IPR036913"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14801.1"
FT                   /translation="MTTRVLTGITTSGTPHLGNYVGAIRPALQASRRPGIESFFFLADL
FT                   HSLIKAQDPMRTQRSTLEIAATWLAAGLDPAQVWFYRQSDVPETNELTWFLTCVASKGI
FT                   LNRAHAYKAAVDKNRADGEDEDAGVTAGLFMYPVLMAADILLFKAQQVPVGRDQIQHIE
FT                   MARDFAQRFNHVYGRDYFTLPDALIDEQVATLPGLDGRKMSKSYDNTIPLFAPREELKK
FT                   RVFAIVTDSRAPGVPKDTEGSALFQLYQAFANVEETAAFAQAFADGIGWGEAKQQLFER
FT                   IDVEIAPMRERYDALMARPEAIEATLRDNAQRLRVRYATPFLVELRHAVGLRDLSQRDA
FT                   VSNATATKQVLPSFKQYREGDGQFYFKLLDGEGTLLLQSTGFASPRDAGQTIAALKQVT
FT                   QVDALQAIPVVLVAPAETAMHALQRLREAG"
FT   gene            287241..288173
FT                   /locus_tag="XALC_0258"
FT   CDS_pept        287241..288173
FT                   /transl_table=11
FT                   /locus_tag="XALC_0258"
FT                   /product="putative metallo-beta-lactamase superfamily
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14802"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14802.1"
FT                   /translation="MPRDPSIHLVDTGFQRAQFDAAYLMVEEGRGAFVDCGTSHAVPVL
FT                   LHALECAGLAPDEVDWLILTHVHLDHAGGAGALLQRLPNARLLVHPRGASHMIDPARLI
FT                   AGATAVYGEEEMARSYGSIVPVPVERVVVAEDGHRLRLGARELLCIDTPGHARHHLCVW
FT                   DARSRSWFTGDTFGLSYRELDSARGAFAIPTSSPVQFEPEAMRASIQRILDHVPQTLYL
FT                   THYGPVEGAAPLAAELFEQLDAMVAIARGCDGRPDRHRCLVAALTALYLERARMHGCSL
FT                   DDAGVERVLHMDIELNAQGLGCWLDRLAG"
FT   gene            complement(288577..289071)
FT                   /locus_tag="XALC_0259"
FT   CDS_pept        complement(288577..289071)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0259"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14803"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAY9"
FT                   /protein_id="CBA14803.1"
FT                   /translation="MASIDTSLPSVGSAPNPFATATTNPFGNTVQASNDTAAVQQAVSL
FT                   SSDASVILSLGTSSPAEQGLTYTAAGLFNTIVSAGSADGTSPDLNQNQANQSYSQGILD
FT                   GIGNPPSTPGIYNASGVFTGQNTLTPALSSALKENPNLTGTVVGDLLNQGIVGGLISTT
FT                   A"
FT   gene            289619..290536
FT                   /locus_tag="XALC_0260"
FT   CDS_pept        289619..290536
FT                   /transl_table=11
FT                   /locus_tag="XALC_0260"
FT                   /product="putative drug/metabolite transporter superfamily
FT                   protein"
FT                   /function="putative uncharacterized transport protein
FT                   go:0005215 go:0006810"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14804"
FT                   /db_xref="GOA:D2UAZ0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14804.1"
FT                   /translation="MAMSVAEHDLRRGLWMTAATFALWGVAPLYWHLLKAVPSAHIIAH
FT                   RVVWSAMLVVAWLLYSARLQWWRRIAAQPRALVTLAFSSLAIAFNWGLYIWAINAGHVI
FT                   ESSLGYFISPLVNVLLGVLVLHERLRRLQWLAVACAALGVAWLTVDAGTPPWVALGLAC
FT                   SFGLYSLLRKLAHVDAVAGLGVESVYLFLPALGFVLWGEAGHGGGFLGAWGWRDDVLLI
FT                   CGGAVTAAPLIGFAYGVRRIPLSLIGLLQYISPSLQLLLGVWFFGEPFDADRALGFAAI
FT                   WIGLLLFAGESVWRSGIGRRRGAA"
FT   gene            complement(290575..291717)
FT                   /locus_tag="XALC_0261"
FT   CDS_pept        complement(290575..291717)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0261"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14805"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB93"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14805.1"
FT                   /translation="MSSRLCLLLVLCASVCLGACSSTSLSDRLVAPGGVSPLMDEERIQ
FT                   SLLATLPNRSGHVVVPGGIPIFWRAIDPGDYRMRYRYEHASRNANGHEHADFAMDVATP
FT                   VPGTHLAPRGTVVLLHGWMMDGDSLLPWSLDLAQAGYRSISIDLRNHGRSGGGPAGYGT
FT                   RESDDVVAVIHALRARGEVQGPVYLFGVSYGAATALFAAQKLGKAVEGVVALESFANAG
FT                   RGIRDMIPHMLASHPRGWMASAAMDLARWRYGDQNLDAVIASANQRLALNLDQVDVTAA
FT                   ARIATACVLLLHGSADQHIPVAHGRLLALDAPRAHYLEMPGENHLSLPMRLDLLAPTIE
FT                   DWFAELPAPRHDGDCPQPLPPRVDATQEFTVTPTVNTNRS"
FT   gene            292058..292672
FT                   /locus_tag="XALC_0262"
FT   CDS_pept        292058..292672
FT                   /transl_table=11
FT                   /locus_tag="XALC_0262"
FT                   /product="putative two component system regulatory protein"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14806"
FT                   /db_xref="GOA:D2UB94"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB94"
FT                   /protein_id="CBA14806.1"
FT                   /translation="MFDSVLAEDQAMVRGALGTLRLDLEADIDVAARVADGEVACRVLH
FT                   ARSPDLPVIDIETSEFSGLEMALRIQRQQLLVRVAMVTPFVSPGLPGLLWREWWVGAIR
FT                   QVYRGAARAIQNWHWTLGPSEADSHNHRERRVLRLAGEGAMARDMTATPGFLCATGGNC
FT                   LFEAIGNWRRQLYRSGAAGASQGGDMIRSGFALGTHLAVCA"
FT   gene            292669..294456
FT                   /locus_tag="XALC_0263"
FT   CDS_pept        292669..294456
FT                   /transl_table=11
FT                   /locus_tag="XALC_0263"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14807"
FT                   /db_xref="GOA:D2UB95"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB95"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14807.1"
FT                   /translation="MIPHFGLGPEDDGPSLSPRVDVMSCATINRYGVPLALLLLIGISA
FT                   ALLLGSQRFLADAASVERSNQVVAGINVLQFNLSDCDAALRGFLLLDDNEDLVDFHRCE
FT                   QSLPSRLQQLSTRLQDNPAQLSRLRLVQAQIRERMQISEHAIARLQVNDATMRPEMARV
FT                   RQAGTLSQATRRNTDAMLHSERDLLATRMLATADSAGMLRLLAFGGIPGVCVLTLCLYM
FT                   LLRREIGRRTQAERLGHHANALLVGTVQQMQRTEQDLRTLNRCSRGLQSCVQQDEAVEV
FT                   ARQALERLLGAAGCSVYCTDAAGEQVVCVAHWGMDAACAPSLSLERCESLCRRATQVMQ
FT                   PGATSLCAQTSDVICDPAQALYGACVPMIVQGERLGMIHLSSPNLAVLERLNLVEVVAE
FT                   QLAMALHNLHLRHRLRTQSIRDPLTGLYNRRYLEESLLRELSRCARRDLPLALMMLDLD
FT                   HFKALNDRFGHAGGDALLAAFGQLLGGLVRPEDIACRYGGEEFTVILPGAAADVAQRRA
FT                   EQIRAAVEQMQVQHHGQMLPSITVSIGVAAYPEHGSTGEELLRCADAALYCGKRSGRNR
FT                   VASAVTERSVNDNRQLASS"
FT   gene            complement(294478..295053)
FT                   /locus_tag="XALC_0264"
FT   CDS_pept        complement(294478..295053)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0264"
FT                   /product="hypothetical cytochrome b561 protein"
FT                   /function="transport go:0005215 go:0006810; heme go:0015886
FT                   go:0015232"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14808"
FT                   /db_xref="GOA:D2UB96"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB96"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14808.1"
FT                   /translation="MNPSNRSGHFNLTARVLHWLMAAMILTMLFVGVGMVASVSQRPWL
FT                   LDLHRPLGIAIGLLALVRLSNRLRHRPPPLPADLPRWQKIAAHASHGLLYALMLAMPLL
FT                   GWAMLSAGGYPIVLWAGVHLPAIVSHNPALYAGLRCAHGWLGYLLFATVLGHLCAALFH
FT                   AWIRRDDVFASMARGTTAARPTATPERT"
FT   gene            complement(295050..296141)
FT                   /locus_tag="XALC_0265"
FT   CDS_pept        complement(295050..296141)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0265"
FT                   /product="hypothetical catalase precursor protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14809"
FT                   /db_xref="GOA:D2UB97"
FT                   /db_xref="InterPro:IPR011614"
FT                   /db_xref="InterPro:IPR018028"
FT                   /db_xref="InterPro:IPR020835"
FT                   /db_xref="InterPro:IPR024168"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB97"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14809.1"
FT                   /translation="MPHPDPTPPQRPWLALAGIATIAVALAAAFAWSAGWLGGPQRLTA
FT                   QHMTDALEAGGPPHPGFRRAHNKGVCVSGHFESNGQGQALSEARVFAQASVPVLGRLSI
FT                   GGSDPHGADGQARVRSMALQLRSDDGQEWRMAMNNFPFFVVATPEGFMAQIQASQPDPA
FT                   TGKPDPAKMAAFLQRYPEAHMFQAWAMSAPWSNSWANTEYNSVNAFRFTAADGSSRYVR
FT                   WSMRPHTPFVPLSAAQRALVDANFLGEDLQTRLAHGPLRWDLVITVAAPGDPIEDPSRS
FT                   WPPTRQNVVAGTLVLDHAEPQATGPCRDLNYDPLILPHGIAGSGDPILAARSAVYAQSF
FT                   NRREREIARGQAPDAIGQKGTAQ"
FT   gene            complement(296481..296864)
FT                   /locus_tag="XALC_0266"
FT   CDS_pept        complement(296481..296864)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0266"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14810"
FT                   /db_xref="GOA:D2UB98"
FT                   /db_xref="InterPro:IPR005133"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB98"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14810.1"
FT                   /translation="MNALLHIALALLLIVGCFFILIGALGLVRLSDFFKRLHASTTAST
FT                   LGVGCILLASVGYHLFLGQDPQPRELLITAFLFITAPISAHMMAKAALSLMLAERPATP
FT                   GSGDADQKRLPMSTRTKQQPPLP"
FT   gene            complement(296861..297145)
FT                   /locus_tag="XALC_0267"
FT   CDS_pept        complement(296861..297145)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0267"
FT                   /product="hypothetical monovalent cation:proton antiporter
FT                   subunit f protein"
FT                   /function="the monovalent cation:proton antiporter-1 (cpa1)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14811"
FT                   /db_xref="GOA:D2UB99"
FT                   /db_xref="InterPro:IPR007208"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB99"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14811.1"
FT                   /translation="MTHDMFIDTTIVVCMHMVALAMLLALWRLLRGPTLPDRILALDML
FT                   SITAIAEVMLLGMYLDSPVYFEAALIIAMLGFGSTVVLSKYVLRRDIVE"
FT   gene            complement(297142..297645)
FT                   /locus_tag="XALC_0268"
FT   CDS_pept        complement(297142..297645)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0268"
FT                   /product="hypothetical monovalent cation:proton antiporter
FT                   subunit e protein"
FT                   /function="the monovalent cation:proton antiporter-1 (cpa1)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14812"
FT                   /db_xref="GOA:D2UBA0"
FT                   /db_xref="InterPro:IPR002758"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14812.1"
FT                   /translation="MVRSSWSRRLFPSWPLSLTVTTFWLLMSDSVSPSQLLLGGGLGVA
FT                   VPLFAARLDREFARIGTLRPVPKMLCVAAWDIVRSNVMVALQVLGPQTRIRPGFVWVPL
FT                   DIANIHGIAALTSMITLTPGTVSAALSDDRKYLLVHVLHLDNAERLIRQIKTRYEAPLM
FT                   EIFP"
FT   gene            complement(297647..299215)
FT                   /locus_tag="XALC_0269"
FT   CDS_pept        complement(297647..299215)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0269"
FT                   /product="hypothetical monovalent cation:proton antiporter
FT                   subunit d protein"
FT                   /function="the monovalent cation:proton antiporter-1 (cpa1)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14813"
FT                   /db_xref="GOA:D2UBA1"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14813.1"
FT                   /translation="MSHVLILPILIPLLGAGLSLFLERRRAGRRLQRLLAWAALVALAA
FT                   AVTTLCAQVGDGQVHAYLLGDWPARLGIVLMADRLSAWMLATTTLLAAACLLHACAGWD
FT                   RRAPHFHALFQFQLVGLNGAFLTGDIFNLFVFFEVMLIASYGLLLSGGRGLRLRAGFHY
FT                   VVFNVTSSTVFLIALGLLYALLGSLNMAELSQRMSQAPAQNVALIKAAIGLLLLVFCAK
FT                   AALLPLYLWLPETYARAPAAVAALCVIMTKVGLYAMLRVSTLMLGSQAPMLHGYGGDWL
FT                   LWLGLATLLLGALGVLAAVRLRVLIGYLVIVSAATLFVAFALQRPGMLSAGLYYLAHSS
FT                   FVAAALFMIAELIRRRGGHAGDRKSRIATLPEKTLSGLLFLIAAISVAGLPPLSGFLAK
FT                   VALLGATPAALTAPVWTTVLLSSLMVITGLSRSGVRLFWHVPSHQNTVDHGTAQLPALI
FT                   PVPRMALGRRLEIAATLLLLGYGMTMTLAAEPLLRYTDAIAAQVLRPSAYVTQLRATAP
FT                   VLREP"
FT   gene            complement(299212..299571)
FT                   /locus_tag="XALC_0270"
FT   CDS_pept        complement(299212..299571)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0270"
FT                   /product="hypothetical monovalent cation:proton antiporter
FT                   subunit c protein"
FT                   /function="the monovalent cation:proton antiporter-1 (cpa1)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14814"
FT                   /db_xref="GOA:D2UBA2"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14814.1"
FT                   /translation="MELALASAIGVLTAVGVYLLLRARSFDVILGMNVLSYATNLLIFA
FT                   GGRLTRGRPPVLRDGIAPTLAEHADPLPQALVLTAIVIAFAMTALSIVLALRNRGDNHS
FT                   DHVDARADQDEENAP"
FT   gene            complement(299571..302402)
FT                   /locus_tag="XALC_0271"
FT   CDS_pept        complement(299571..302402)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0271"
FT                   /product="hypothetical monovalent cation:proton antiporter
FT                   subunit a protein"
FT                   /function="the monovalent cation:proton antiporter-1 (cpa1)
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14815"
FT                   /db_xref="GOA:D2UBA3"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR007182"
FT                   /db_xref="InterPro:IPR025383"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14815.1"
FT                   /translation="MMPILIILLALPFLIAASVVALRHRTRAVLAWVAAIAPLAGLVLL
FT                   GTLTTTVLQGDIVRSDHAWLPQIGLQFSLRLDGLAWMFAGLVLAIGTLVVMYAHYYLSA
FT                   RENAARFYASLLLFMGAMLGMVLAGNLLLLMVFWELTSISSFLLIGFWSHRKDARDGAW
FT                   MALVITGGGGLALLGGVLLLGRIVGSYQLDAVLAAGETIRASALYPWALGLILLGIFSK
FT                   SAQFPLHFWLPQAMAAPTPVSAYLHSATMVKAGVFLLARLHPALAGSPLFFYTVSGIGA
FT                   ITLLTGAWLAIFQHDLKGLLAYSTISHLGLITMLFGLSTPMAVVAGVFHMLNHAVFKAS
FT                   LFMAAGIIDHETHTRDMRRLGAMRRWMPITSTLAIIAAMAMAGIPLLNGFLSKEMFFAE
FT                   ALDTNGPAAMRVFIASAALLAGVFGVAYSLRFVYETFFGEGPRDLRTMPHEPPRWMKIP
FT                   VAILVLVCVAVGTVPALTVAPVLRSAASAILGDALPDYSLALWHGWNAPLAMSLAGVIG
FT                   GVTLYFGLRRLTALYTEVRRSLGKRLFHWHMQTLSTLAARATRLLVNGRLQRSLRCLLL
FT                   AAVMVAAAPFVATPPPWPSWTAPQPMPPLGWALWWLIVGSALATLRLYRQRLLAVVVVG
FT                   GSGLGVSLVFVFLSAPDLALTQLLVEMVTLVLMLLGLHYLPNVSPPEPRRWPQLRDATL
FT                   AIAAGVGMALLAYAVMTRPTSSMAGELLQRALPQAYGRNVVNVILVDFRGLDTFGEISV
FT                   FAIAALVVHALLRGVRMAPETIMPGPPITLPVPADLTQLLFPLTLTVSIFLFLRGHNAP
FT                   GGGFIAGLVLAVPLLMQYVIQGAASVESRFGLDYIRCIALGLLLAALSGMGALLFGAPL
FT                   LTSGHLDLPLPLIGEVSLTSALGFDTGVFLAVFGSTMLILSMLGTIMPSRMREAHRGRI
FT                   DPTRRSAITGEMH"
FT   gene            302483..303517
FT                   /locus_tag="XALC_0272"
FT   CDS_pept        302483..303517
FT                   /transl_table=11
FT                   /locus_tag="XALC_0272"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14816"
FT                   /db_xref="GOA:D2UBA4"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14816.1"
FT                   /translation="MHAHRRSDSQRAMRLRALCRRKLGVVACAGYAVAMTDAPASAVPM
FT                   QHPPTSPRIALVFGGSGQIGEPLLHGLLAAGWQVHAYSRTIQPARPGLHWHLGELGTLS
FT                   MPPLPVDVVFSCGPLDAFADWYQRVPVHVPRVVAFGSTSLEVKRDSLDDTERDVARRLR
FT                   EAEATLFALAAARGAAVTVLRPTLVYGAGRDRTLSAIAALARRSGWFVLSRSACGLRQP
FT                   VHVQDLAEAALAVLSFAVTHGQSYALGGGETLRYRDMVHRVLAVLQPPARLLLLPHAVF
FT                   ALLLALAHACGRLRGMNRAALQRMREDLVFDLAPARRDFGYAPRAFAPDAAMLGVTPGA
FT                   VVRQ"
FT   gene            complement(303511..303993)
FT                   /locus_tag="XALC_0273"
FT   CDS_pept        complement(303511..303993)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0273"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14817"
FT                   /db_xref="GOA:D2UAN7"
FT                   /db_xref="InterPro:IPR009305"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN7"
FT                   /protein_id="CBA14817.1"
FT                   /translation="METTVYARPIDRYFAHYSDAHRNAANQRIHVIAVPGILWAVVALL
FT                   WCIPVGASWFQSGVWAALSMFVAWMYYNRLSRPLGYGMLAVFFFYGCLCRLLEAHLGLQ
FT                   GLRWMALAVLMLASIAQCIGHTLEGRRPNFCTDAMALLIGPAWVLAKLYRHMHWRY"
FT   gene            complement(304308..305234)
FT                   /gene="purC"
FT                   /locus_tag="XALC_0274"
FT   CDS_pept        complement(304308..305234)
FT                   /transl_table=11
FT                   /gene="purC"
FT                   /locus_tag="XALC_0274"
FT                   /product="probable
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase
FT                   protein"
FT                   /function="metabolism go:0008152; purine biosynthesis
FT                   go:0006164"
FT                   /EC_number="6.3.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14818"
FT                   /db_xref="GOA:D2UAN8"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14818.1"
FT                   /translation="MSTTLLQSDLPGLPLRHRGKVRDVFDLPRDRLPANAPTGDYLLMV
FT                   ATDRLSAFDVVLPDPIPGKGEMLCQVSNFWFKKTEHLMPNHLTGIDVAAVLPEGVDTAL
FT                   YAKRAVVTRKLKPVPVEAIARGYLIGSGWKDYQRTGKVSGIELPDGLRQAEKLAEPIFT
FT                   PSTKAAVGDHDENIDFDAMVKTVGAELAERVRDATLRIYRFAADFAAERGILLADTKFE
FT                   FGTDLDGRLYIMDEMLTPDSSRYWPADEYEIGTSPPSYDKQFVRDYLETLDWGKTVPGP
FT                   RLPQDVIERTRSKYAEALQRLAGISVD"
FT   gene            305372..305710
FT                   /locus_tag="XALC_0275"
FT   CDS_pept        305372..305710
FT                   /transl_table=11
FT                   /locus_tag="XALC_0275"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14819"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAN9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14819.1"
FT                   /translation="MSKPWYGKLLGAIAGALLLRPTPVLGAFIGLLIGHAFDADWFKLS
FT                   QREDPYRELGLTRDATDAEIELAYRRLMSQYHPDKVANASPELRASAEKKASQLNTAYD
FT                   RIRLLRKR"
FT   gene            305720..306388
FT                   /gene="rpe"
FT                   /locus_tag="XALC_0276"
FT   CDS_pept        305720..306388
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="XALC_0276"
FT                   /product="probable ribulose-phosphate 3-epimerase protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14820"
FT                   /db_xref="GOA:D2UAP0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14820.1"
FT                   /translation="MSDCIIAPSILSADFARLGEEVDAVLRAGADWIHFDVMDNHYVPN
FT                   LTIGPMVCKALRKHGVTAAIDVHLMVEPVDRLIPDFAEAGASLISFHPEASRHVHRSIQ
FT                   LIKSHGCQVGLALNPATPLEILDWVLDDLDLVLVMSVNPGFGGQTFIPSALDKLRAIRT
FT                   CIDASGKPIRLEIDGGVKPENIAAVAAAGADTFVAGSAIFNAPDYAEVIARMRAAVAAR
FT                   "
FT   gene            306390..306872
FT                   /locus_tag="XALC_0277"
FT   CDS_pept        306390..306872
FT                   /transl_table=11
FT                   /locus_tag="XALC_0277"
FT                   /product="putative n-acetyltransferase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14821"
FT                   /db_xref="GOA:D2UAP1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14821.1"
FT                   /translation="MALVQIRPALAADAALILRMIRDLARYERAEDAVQTDEASLRASL
FT                   FGPHSRAYALICEVDAQPAGYAVYFYNYSTWLGRNGLYLEDLYVDPAHRGFGAGRALLR
FT                   HLARQAVAEGCGRFEWSVLDWNRPAIDFYEAAGAQAQDEWTVYRLQGEALSRFAAG"
FT   gene            307041..307226
FT                   /locus_tag="XALC_0278"
FT   CDS_pept        307041..307226
FT                   /transl_table=11
FT                   /locus_tag="XALC_0278"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14822"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14822.1"
FT                   /translation="MRRAVLSIPNPPYAVSAKHAAWSAQAAHGSSALVFDFQVARWSLR
FT                   AAPMSAPVPQTRFRRP"
FT   gene            307594..309069
FT                   /gene="trpE"
FT                   /locus_tag="XALC_0279"
FT   CDS_pept        307594..309069
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="XALC_0279"
FT                   /product="probable anthranilate synthase componentIprotein"
FT                   /function="metabolism go:0008152; tryptophan go:0000162"
FT                   /EC_number="4.1.3.27"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14823"
FT                   /db_xref="GOA:D2UAP3"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14823.1"
FT                   /translation="MITREQFQHYAAEGHTRIPVVREVLSDLDTPLSVYLKLADAPHTY
FT                   LFESVEGGERFGRYSIIGLPVRRVYTFRGHTLEVRDHGNLVERREVADPLAEVEALRVQ
FT                   HTVPRIEGVPGFTGGLVGWFGFECIGYIEPRLAGGDAHDELDTPDILLMLSEEVAVFDN
FT                   LKGRLYLIVHVDPSVADAWEMAQARLDALTATLRQPGAGYPAPLARDVLDERDFVSGFT
FT                   REGFIAAVEKSKDYIRAGDIFQVVLSQRLSVPFNTRPLDVYRALRALNPSPYMYFIDVG
FT                   DTQVVGSSPEILVRLEAGQVTVRPIAGTRRRGKTVEEDLALEAELLADPKERAEHLMLI
FT                   DLGRNDAGRVSQAGSVAVGERFVIERYSHVMHIVSEVTGTLLPGLSYADVLRATFPAGT
FT                   VSGAPKIRALEVIRELEPIKRNVYAGSIGYLGWHGDADTAIAIRTAVIKHGRLHVQAGA
FT                   GIVYDSDPQAEWDETMSKGRALFRAVAEAAKGL"
FT   gene            309908..310486
FT                   /gene="pabA"
FT                   /locus_tag="XALC_0280"
FT   CDS_pept        309908..310486
FT                   /transl_table=11
FT                   /gene="pabA"
FT                   /locus_tag="XALC_0280"
FT                   /product="probable aminodeoxychorismate synthase, subunit
FT                   II protein"
FT                   /function="metabolism go:0008152; folic acid go:0046656"
FT                   /EC_number="2.6.1.85"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14824"
FT                   /db_xref="GOA:D2UAP4"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14824.1"
FT                   /translation="MLLMLDNYDSFTYNLVQYLQALGAEVKVVRNDALSVDEIERLAPE
FT                   RIVISPGPCTPNEAGVSLQLIERLGQRTPILGVCLGHQSIGQVYGGQVVRAGTIMHGKT
FT                   SRIRHQGLGVFAGLPDGYEATRYHSLVVEKTTLPQCLEITAWTEHADGSMEEIMGLRHR
FT                   QFPVEGVQFHPESILTEHGHALLKNFLER"
FT   gene            310537..311175
FT                   /locus_tag="XALC_0281"
FT   CDS_pept        310537..311175
FT                   /transl_table=11
FT                   /locus_tag="XALC_0281"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14825"
FT                   /db_xref="GOA:D2UAP5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14825.1"
FT                   /translation="MHDRTETFHFYEPAHGHGLPHDPFNAIVGPRPIGWIGSRGADGVA
FT                   NLAPYSFFNAFNYVPPIVGFASIGWKDSVRNIEASGEFTWNLVTRVLAEAMNASSAAVA
FT                   PEVDEFALAGLAVAPSRLVGAPRVAASPVSFECRLSQLLPLQTARGEPIQTWLVLGEVV
FT                   GVHIARSALQDGLYDPAAVGTLLRAGGPADYFEVLAQGRLRLERPARPG"
FT   gene            311226..312284
FT                   /gene="trpD"
FT                   /locus_tag="XALC_0282"
FT   CDS_pept        311226..312284
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="XALC_0282"
FT                   /product="probable anthranilate phosphoribosyltransferase
FT                   protein"
FT                   /function="metabolism go:0008152; tryptophan go:0000162"
FT                   /EC_number="2.4.2.18"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14826"
FT                   /db_xref="GOA:D2UAP6"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14826.1"
FT                   /translation="MTITPQQALQRTIEHREIFHDEMVGLMRQIMRGEVSAAMTSAILT
FT                   GLRVKKETVGEIAGAAQVMREFSRTVDVADRRHMVDIVGTGGDGSHTFNISTCAMFVAA
FT                   AAGAKVAKHGNRSVSSKSGSADALEALGAAIELQPEQVAQALHATGIGFMYAPVHHPAM
FT                   KVVAPVRREMGVRTIFNILGPLTNPAGAPNILMGVFHPDLVGIQARVLHELGAERALVV
FT                   WGRDGMDELSLGAGTLVGELRDGQVREYELHPEDFGIAMSASRNLKVADAAESMAMLRG
FT                   VLDNVPGPALDIVAFNAGAALYVAGVAADIAAGIALARAAIADGRARAKLEAYVVCTRE
FT                   LVQARNQGSEAH"
FT   gene            312454..313248
FT                   /gene="trpC"
FT                   /locus_tag="XALC_0283"
FT   CDS_pept        312454..313248
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="XALC_0283"
FT                   /product="probable indole-3-glycerol phosphate synthase
FT                   protein"
FT                   /function="metabolism go:0008152; tryptophan go:0000162"
FT                   /EC_number="4.1.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14827"
FT                   /db_xref="GOA:D2UAP7"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14827.1"
FT                   /translation="MSDILRTILARKTEEIVERSARVPLAELAARAEAMPSTRGFARAL
FT                   QAAIANGDPAVIAEVKKASPSKGVIRPDFHPADIAVSYQFGGAACLSVLTDEDFFQGHD
FT                   RYLQQAREACTLPVLRKDFTIDPYQVYEARALGADCILLIVAALDDLQLAELSSLALQL
FT                   GMDVLVEVHDIDELERALQVPAPLIGINNRNLRTFEVSLQTTLSMKDAVPRDRLLVTES
FT                   GILGAADVATMRAAGVHAFLVGEAFMRAEEPGEALRQLFFSA"
FT   gene            313245..313967
FT                   /locus_tag="XALC_0284"
FT   CDS_pept        313245..313967
FT                   /transl_table=11
FT                   /locus_tag="XALC_0284"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14828"
FT                   /db_xref="GOA:D2UAZ1"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14828.1"
FT                   /translation="MSAPYPVPHADAPVVVFDFDHTLYDGDSGSHLFAWLIRRSPLRLI
FT                   AALLATLLLGPLVAMLPTRRTGISGYVWIASFGLRRVREFNVIIDQYVLRHQVQIRQRL
FT                   LPQALEVFARHRAAGDRVVVATGAPPELARAILGFVAHQDVPVIGSLIAPRLGAVVATR
FT                   HCHNQEKLRMLRELGYGAIAKAYSDSIADLPLLQAAVAPVVVNPKTSAVAVFRRTLPSG
FT                   TPILNWGCRDRAGDAVSA"
FT   gene            complement(314006..314212)
FT                   /locus_tag="XALC_0285"
FT   CDS_pept        complement(314006..314212)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0285"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14829"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14829.1"
FT                   /translation="MPTPCSRKTSRPRPKIDVVNAAEKRNSAWAYWQFEGSFGTYDIDH
FT                   GQWIGPIHQALVASDSAYSARDR"
FT   gene            complement(314717..315406)
FT                   /locus_tag="XALC_0286"
FT   CDS_pept        complement(314717..315406)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0286"
FT                   /product="putative cap-like protein"
FT                   /function="transcriptional level go:0006355"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14830"
FT                   /db_xref="GOA:D2UAZ3"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ3"
FT                   /protein_id="CBA14830.1"
FT                   /translation="MSPGNATIATPVRIAPSPLTLDNATIDRFLAHSHRRRYPARTDVF
FT                   RPGDPAGTLYYVVSGSVSIIAEEDDDRELVLGYFGNGEFVGEMGLFIESDQREVILRTR
FT                   TPCELAEISYERLHQLFLGSLSADAPRVLYAIGVQLSKRLLDTSRKASRLAFLDVSDRI
FT                   VRTLHDLAQEPEAMSHPQGMQLRVSRQELARLVGCSREMAGRVLKKLQVDGTLHARGKT
FT                   VVLYGAR"
FT   gene            315549..316343
FT                   /gene="speD"
FT                   /locus_tag="XALC_0287"
FT   CDS_pept        315549..316343
FT                   /transl_table=11
FT                   /gene="speD"
FT                   /locus_tag="XALC_0287"
FT                   /product="probable s-adenosylmethionine decarboxylase
FT                   protein"
FT                   /function="metabolism go:0008152; polyamine biosynthesis
FT                   go:0006596"
FT                   /EC_number="4.1.1.50"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14831"
FT                   /db_xref="GOA:D2UAZ4"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR009165"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14831.1"
FT                   /translation="MVKPLPRLRLQGFNNLTKALSFNIYDVCYAISEDERQRYIEYIDE
FT                   QYDADRLTQILTDVAEIIGANILNIARQDYDPQGASVTMLISEEPVIDKKAAGKEIISD
FT                   AVVAHMDKSHITVHTYPETYSQHGIATFRADIDVATCGVISPLKALNYLIESLESDIVI
FT                   MDYRVRGFTRDVKGKKHYIDHKINSIQNFLAKNIKSRYEMFDVNVYQENMFHTKMHLKD
FT                   FDLDQYLFEEKAKNLSFKERMRIEALLKREIEELFHGRNLVE"
FT   gene            complement(316765..317277)
FT                   /locus_tag="XALC_0288"
FT   CDS_pept        complement(316765..317277)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0288"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14832"
FT                   /db_xref="GOA:D2UAZ5"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ5"
FT                   /protein_id="CBA14832.1"
FT                   /translation="MPAATLHSHSLLIRRLSRLLFASLFALCSGVLLYQLLGDYAHASA
FT                   ILRDHSVATVPVIADGAFGMQARPLVRYRFHYLFQSRGRLHNGAFEASGAEAAPLLLDG
FT                   ATVEIAYANADPSQFGRLDQLQHAGNLGGMLTRVIIALSITALLAVVAHRLLIGRLLAR
FT                   WQRMPIA"
FT   gene            complement(317471..318112)
FT                   /locus_tag="XALC_0289"
FT   CDS_pept        complement(317471..318112)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0289"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14833"
FT                   /db_xref="GOA:D2UAZ6"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011566"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14833.1"
FT                   /translation="MTDSRQHSPLDRILVEAQRALETVFGDPPAQRPYPGASADVVLAP
FT                   DERRHAAGLMRINHVGEVCAQGLYFGQAAVARDPATRAQLLEAAQEETDHLAWCAKRLR
FT                   ELDSRPSLFNPLWYAGSYAIGTLAGLRGDGWNLGFVVETERQVEAHLDEHLQTLPPADL
FT                   RSRDILTVMKVDEARHAEHAEHAGARHLPVPIPTMMAAASRLMKAVAYRL"
FT   gene            318329..318757
FT                   /gene="rplM"
FT                   /locus_tag="XALC_0290"
FT   CDS_pept        318329..318757
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="XALC_0290"
FT                   /product="probable 50s ribosomal protein l13"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14834"
FT                   /db_xref="GOA:D2UAZ7"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14834.1"
FT                   /translation="MSTLTAKSETVQRDWYLVDAAGKTLGRLSTELARRLRGKHKPVYT
FT                   PHVDTGDYLVVINAEKIVVTGNKLKDKKYHRFTGYIGNLKTESLEQALERHPERVIEIA
FT                   VKGMLPKGPLGRAMYRKLKVYSGAQHPHAAQQPQVLDI"
FT   gene            318761..319153
FT                   /gene="rpsI"
FT                   /locus_tag="XALC_0291"
FT   CDS_pept        318761..319153
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="XALC_0291"
FT                   /product="probable 30s ribosomal protein s9"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14835"
FT                   /db_xref="GOA:D2UAZ8"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14835.1"
FT                   /translation="MAITQNYGTGRRKSSTARVFLRKGTGNISVNGRPLDEFFGRETAR
FT                   MIVRQPLELTKNTESFDIVVTASGGGTTGQAGAIRLGIARALVEYDETLKSELRKAGFM
FT                   TRDAREVERKKVGLHKARRATQFSKR"
FT   tRNA            complement(319543..319617)
FT                   /gene="tRNA-tRNA-Gln"
FT                   /product="transfer RNA-typeGln,AnticodonCTG"
FT   tRNA            complement(319659..319735)
FT                   /gene="tRNA-tRNA-Met"
FT                   /product="transfer RNA-typeMet,AnticodonCAT"
FT   gene            319856..320467
FT                   /gene="nudH"
FT                   /locus_tag="XALC_0294"
FT   CDS_pept        319856..320467
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="XALC_0294"
FT                   /product="probable (di)nucleoside polyphosphate hydrolase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14836"
FT                   /db_xref="GOA:D2UAZ9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAZ9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14836.1"
FT                   /translation="MIDPDGYRPNVGIVLMRPDGQVFWARRVRRDGWQFPQGGMNTDET
FT                   PVEAMYRELREETGLLPEHVEVLGATPGWLRYRLPSRAIRRNERQVCIGQKQVWFLLRM
FT                   QCDESQLNLELTETPEFDHWRWVDFWYPVEHVVLFKRGVYARALRHLAPLAQNIAGSGI
FT                   RAMPALAQEAWLPGNTAGHERPRKRPRKRGGPWAARVNHD"
FT   gene            320547..320756
FT                   /locus_tag="XALC_0295"
FT   CDS_pept        320547..320756
FT                   /transl_table=11
FT                   /locus_tag="XALC_0295"
FT                   /product="putative bacterioferritin-associated ferredoxin
FT                   protein"
FT                   /function="regulation level unknown"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14837"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB00"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14837.1"
FT                   /translation="MYVCICNGVTDRQIREAAEAGCCNVSELTMRTGCGATCGSCLEMA
FT                   ADLLERSLTRELPLPVLVGLARAA"
FT   gene            320858..321328
FT                   /gene="bfr"
FT                   /locus_tag="XALC_0296"
FT   CDS_pept        320858..321328
FT                   /transl_table=11
FT                   /gene="bfr"
FT                   /locus_tag="XALC_0296"
FT                   /product="probable bacterioferritin protein"
FT                   /function="cell processes go:0009987; fe aquisition
FT                   go:0006826"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14838"
FT                   /db_xref="GOA:D2UB01"
FT                   /db_xref="InterPro:IPR002024"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB01"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14838.1"
FT                   /translation="MKGDSKVIEFLNKVLYNELTAINQYFLHAKMLKNWGLKELAEHEY
FT                   KESIDEMKHADKLADRILFLEGLPNFQALGKLRIGENPKEILECDLALEQDGTATLREG
FT                   IAYAESIQDYVSRQLLADILESEEEHIDWLETQLDLIARIGEPNYLLTKLED"
FT   gene            complement(321526..324042)
FT                   /locus_tag="XALC_0297"
FT   CDS_pept        complement(321526..324042)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0297"
FT                   /product="hypothetical two-component system sensor-response
FT                   regulator hybrid protein"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14839"
FT                   /db_xref="GOA:D2UBA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14839.1"
FT                   /translation="MSAQKRQPLPWLAVLGTGSAIGSAILALPPMALPAPWPWLAPACM
FT                   IAAAILAATAGWRAQQQIRELDAALTRADLAESERNALQRDVHLRERLERELVQAKQAA
FT                   EAAVLAKGEFLATMSHEIRTPLNGIIPMLELIAHSPLDLDQREMLRAANTSSLQLLRIV
FT                   DDILDYSKLEANRLELETTAFNLRELLDDVLQLMQRAAEAKGLRMALQLDRAVRLPVRG
FT                   DPVRLRQVLSNLLGNAIKFTARGGIDLHVRRLGESPAQHVLRFEVRDTGIGISAERQER
FT                   LFQAFTQADASTTRLYGGTGLGLAICKRIVELMGGRIGLESKLDHGAIFWFEIPLLKVI
FT                   GDLSQGNGQMPCLHALLVSADPRLYQRLNRLLPNWGVQVSKVDCTQEALERLRNGNSAR
FT                   STYDLVIGDLDGMRHSARALQRAVARLPAPQTTRLIWLYGDMEIPEEIRAHGALLSRQA
FT                   ADLDLRSMLALDPPATAVNAGMPKEYTAVDTLPATDTKTEIESERAKGRGTPDNTPRTD
FT                   AMTSKSNLQTTPSQYRLLLVEDNPVNMMVAQRLLEALGYRADTVENGAAALTQLAQQAY
FT                   DLVLMDCQMPVLDGYAATRQWRQSEANATQARLPIVAMTANAMAGDRQRCLDAGMDDYL
FT                   SKPIDQTRLKACLQRWLPTRPSMSAQAHVPATMVPGMGATMADSSAVHNASSSTQLPPT
FT                   KQPTATIAATPTPASAATESTKPLALAQQVLEIEVLDELRDVVGNANTAQIVDTFLGDA
FT                   PQLIQRMEQAVATTQDALLRDAAHTLKSSAANVGAQALSAAARRIEAGVRAGTLEHPTV
FT                   EVSQVIAEFAQARLALKGYLTTLRNA"
FT   gene            complement(324046..325965)
FT                   /locus_tag="XALC_0298"
FT   CDS_pept        complement(324046..325965)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0298"
FT                   /product="putative two-component system regulatory protein"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14840"
FT                   /db_xref="GOA:D2UBA6"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14840.1"
FT                   /translation="MATRDTTPFPDHEQPRTHDVRAETPPPHYWQRWAADTVAEPPTAD
FT                   LAPGPLASDGTADSLSGTAASTPEADAVGADAAHDTSPQRQDNAYRILIVEDDRSQALF
FT                   AQSVLHGAGMDAKVQLQAEEVQQTIAEYQPDLILMDLHMPGLDGMRLTTLIRQQPQHQL
FT                   LPIVFLSGDANPELPYEVLDSGADDFLTKPIRPRHLIAAVSNRIRRARQQAQQTQQSQQ
FT                   GSAEQIPLNNPETGLPTSAYLLHLLETALHARRPGSLFFIEIASALGLRERYGYAAFER
FT                   LVTQAGQRLAGANAPLPLARLNDNSFLLLTEDSDADAQLQRAQALRDTLTGHGFPLRDD
FT                   ETLHLRCAVGYADLMQGFEDAGATLEAVERTALQARLHPQSVVAYVPPRTEEDLARIAM
FT                   LEGQLEPAYQPIVAVAGGDIAQYQVLLRVRQRDGTLISAGKLLPAAEAGGLIADLDQQV
FT                   LDHALGLLQLYQNATPPLRLFVSQSSRTLARSAFTDWLIDAIAQRGVTGTSLVIDLRLD
FT                   DALIHTATLQQFCARLMPLGVQFCISQFEPGAEAEALIAQLPLGYLRLSARFANAHGNP
FT                   QLRDQLRTAIDLAHRAGLLIIGQQIEQAQAAAAMWMGGVDFIQGNLVQSAGDQLNFDFQ
FT                   NAVL"
FT   gene            326477..327217
FT                   /locus_tag="XALC_0299"
FT   CDS_pept        326477..327217
FT                   /transl_table=11
FT                   /locus_tag="XALC_0299"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14841"
FT                   /db_xref="GOA:D2UBA7"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14841.1"
FT                   /translation="MNRPVPRFQIVPNGVALRRGRAVWLLFAVLWLLSMGLTWWFASRQ
FT                   AAPRLGAVSAQLREAEHKLLAQQQQIQALHQHQATLARSDQISRAANNEVQSSLAEREE
FT                   EIASLRADVAFYERLVGATSQRKGLSVHSVEFSAEVGGTWRYNVVLTQNLNRGAISQGQ
FT                   MRLTVEGVRGGKLASVGWDELHQKTGMPGQDYSFRYFQQLDGSVILPKGFTPQRVRVWL
FT                   SGGGAPVNQTFDWALAGNSNGKGE"
FT   gene            327222..327677
FT                   /locus_tag="XALC_0300"
FT   CDS_pept        327222..327677
FT                   /transl_table=11
FT                   /locus_tag="XALC_0300"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14842"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14842.1"
FT                   /translation="MFGNKSGRSGQTVVDTLIGAQVVIRGDLVFSGGLYVEGRILGKVM
FT                   AEEGVPAMLTLSEHGTIEGEVRAPVVVINGQLIGDVHATERVELAPKARVQGNVHYQVV
FT                   EMNAGAQLTGRLIHAGSIAALAPPQVPNAIALGDRESPPPALTVDQA"
FT   gene            327709..328095
FT                   /locus_tag="XALC_0301"
FT   CDS_pept        327709..328095
FT                   /transl_table=11
FT                   /locus_tag="XALC_0301"
FT                   /product="hypothetical iron-sulfur cluster assembly
FT                   accessory protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14843"
FT                   /db_xref="GOA:D2UBA9"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBA9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14843.1"
FT                   /translation="MSTLVSLPGAAPTPDYQSLERPLNFTSAAAAKVRELIREEGNDAL
FT                   ALRVYIQGGGCSGFQYGFEFDENRAEDDLAVQTDAVTLLVDPLSLQYLMGAEVDYSEGL
FT                   HGAQFVIRNPNAKTTCGCGSSFSV"
FT   gene            328144..329070
FT                   /locus_tag="XALC_0302"
FT   CDS_pept        328144..329070
FT                   /transl_table=11
FT                   /locus_tag="XALC_0302"
FT                   /product="hypothetical nudix hydrolase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14844"
FT                   /db_xref="GOA:D2UBB0"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14844.1"
FT                   /translation="MPEPMPMPVSFAFATSTLDRADALRNDPAALRRAWEQARVLVLDA
FT                   DGHAYADVQGCLCVYASAMLGDALERAVFLGLDDGQAWFALIADVLPHDLAPAQRLDLR
FT                   RAAAEWPVAVAGVFAYARAMLHWQSRTRFCGVCGGVIKFLRGGFLGQCTQCGIEHYPRV
FT                   DPAVIVAVSDGQRLLLGRQASWPARRYSLIAGFVEPGESLEQTVVREVAEETRVRVQPG
FT                   SCRYYAAQPWPFPGALMLGFTALAMPDVPQVDGELEDARWFDREDIGAALERATAQGDS
FT                   ADDGHGLRLPPRISIARALIEDWHRRG"
FT   gene            329125..330021
FT                   /locus_tag="XALC_0303"
FT   CDS_pept        329125..330021
FT                   /transl_table=11
FT                   /locus_tag="XALC_0303"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14845"
FT                   /db_xref="GOA:D2UBB1"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14845.1"
FT                   /translation="MFTTLVAVIVTLVLSHVAPGMVASLRRFDAFGDWLSWLDAHAGDG
FT                   SVWRGRDGMLLALLPVLLLVGLVQWLLAVPYLGLFALLFGIAVLVFSWGPRDLDRDVEA
FT                   VIEADDAATRRLAVAQLRADGGPLREDPAGLVQTVAVAALRRWFAVLFWFLLLGPFGAL
FT                   GYRLLALSVAGPYAARLPPATAAGARLLLGALEWPVAHLMTFSLALVGNFEAVFGVWRA
FT                   LGGGRWRLDSSFIGPVACASVRGELDAEAHDYSDAGMLVPALRPLPELRDAMSQMWRVL
FT                   LLWLLLLAMLVIAGWVG"
FT   gene            complement(330228..332150)
FT                   /locus_tag="XALC_0304"
FT   CDS_pept        complement(330228..332150)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0304"
FT                   /product="putative fatty acid permease / acyltransferase
FT                   fusion protein"
FT                   /function="putative uncharacterized transport protein
FT                   go:0005215 go:0006810"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14846"
FT                   /db_xref="GOA:D2UBB2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14846.1"
FT                   /translation="MSAHNQFALLRQRRFLPFFVVQALGAFNDNVYRQAIIGLLFYLGV
FT                   TPQQRTLYTNLAPALFILPFFLFSSLAGQIAERLEKSRLVVITTTMEIAIMSLAAVGFL
FT                   TEHMTLLLLALFCSGLQATLFGPVKYSILPSVLKPEELTGGNGLVEMGTSLAILCGMIV
FT                   GGLIFQIAGNHGPVAAATAVIALALTGNLVARRMPKVDAGAPQLKIHWNPLPQSLAIMR
FT                   LTRRQLAVRNAVLGVSWFWFLGTVLTAQLPTYAEVNLGGTQELYIFALALFSIGTCTGA
FT                   LLCEKLSGHTVEIGLVPLGAFGISGFMLDLYFARPGAALHTGLEIGGFVHQSGSWRLML
FT                   DLIGIGLCSGLFVVPLFALIQSRTPKAEISRVIAGLNIQNALFIVLAATIGIALQLPHL
FT                   SLFGLRVPMPELNIPQVFLALAIANALVALWIFSIVPEFLMRFLSWVMVQALYRLRVHG
FT                   IERHVPDEGAALIVCNHVSYMDALVLAASLPRPVRFVMYYRIFNLPVMRWIFRTAKAIP
FT                   IAGAREDPMLLERAFDAIDAALAEGELVCIFPEGTLTKDGQIGAFKSGVEKILARRAVP
FT                   VVPMALRNMWSSMWSRRDSRLGRMRVPRRFRAPIEVIADTPIAGTQASAEVLEAQVRRL
FT                   RGEAA"
FT   gene            complement(332292..334517)
FT                   /locus_tag="XALC_0305"
FT   CDS_pept        complement(332292..334517)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0305"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14847"
FT                   /db_xref="GOA:D2UBB3"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB3"
FT                   /protein_id="CBA14847.1"
FT                   /translation="MHTASLESHLSRLWAHEKASYGLRVFIALAAAMGLCWHRQQLDAL
FT                   PAIFLGTIASAIAETDDNWLGRIKSVLLSLLCFAAAAAGVVVLFPYPLAFAAGLALSTF
FT                   ALTLLGALGERYASIAQGTVALAIYAMIGIEHGNPSGHLGASAWHGVALLLLGASWYSV
FT                   LSVLWTVLFANRPVRERLSRLFVELGRYLELKAALFEPIRQSDLHARRLALAEQNAQVV
FT                   AALNAAKTAIMSRFGRSGRPGVQSGLYFRLYYMAQDFHERASSSHYPYEALTDAFFHSD
FT                   VLYRCQRLLALQGKACAALGEAIRLSKPFDYGEQTQQATTDLRQSLDFLHAHADPQQAR
FT                   LLGSLELLVTNLQSIERRLAEAARLDANSDTLDTRLRDASPHTLREMLVRIGQQLTPGS
FT                   VLFRHGLRMAIALTIGYAIIQAMHTRNGYWVLLTTAFVCRPNYGATRLRLAERIAGTLI
FT                   GLGAAWALMQLFPSTEVQLLFALVATLLFFVTRTDRYMLATAAITVMALFCFNLIGDGF
FT                   VLIWPRLLDTLIGCAIAAAAAFLILPDWQGRRLNQVMATVLTSCARYLAQVLEQYRSGM
FT                   RDDLPYRIARRDMHNADAALSVALSNMLREPGRYRRNLDAGFRFLALSNTLLGYLSALG
FT                   AHRAALAGEADPDIDRAGAYLQETLGGLADALSQRRDLPMADTTAEIALADALEREDGI
FT                   DDSKRRLVRNQLALTLRLLPKLREAARAVTDMATSASASALTVPNAG"
FT   gene            complement(334759..336048)
FT                   /gene="purD"
FT                   /locus_tag="XALC_0306"
FT   CDS_pept        complement(334759..336048)
FT                   /transl_table=11
FT                   /gene="purD"
FT                   /locus_tag="XALC_0306"
FT                   /product="probable phosphoribosylamine--glycine ligase
FT                   (gars) (glycinamideribonucleotide synthetase)
FT                   (phosphoribosylglycinamide synthetase) protein"
FT                   /function="metabolism go:0008152; purine biosynthesis
FT                   go:0006164"
FT                   /EC_number="6.3.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14848"
FT                   /db_xref="GOA:D2UBB4"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14848.1"
FT                   /translation="MKLLVIGAGGREHALAWKLAQSSRVSEVLVAPGNAGTASEAKCRN
FT                   VAVKVTDLDGLLTLAQTEGVALTVVGPEVPLVLGVVDRFRAAGLRIFGPTAAAAQLEGS
FT                   KAYAKDFLHRHGIPTAFYAVHTEVDAALAYVYEKGAPIVIKADGLAAGKGVIVAMTLAE
FT                   AEAAVRDMLSGNAFGEAGARVVIEEFLDGEEASFISMVDGVSALPMATSQDHKRVGDGD
FT                   TGPNTGGMGAYSPAPVVTAEVHARVMREVVEPTVRGMQADGVPFTGFLYAGLMIDTSGA
FT                   PKVIEFNVRFGDPETQPVMLRLQSDLVDLVEAALDGRLHATQAQWDPRPSLGVVLAAAP
FT                   YPDTPVTGEPITGLEAVPADAKVFHAGTALDAQGRVVSAGGRVLCVAALGDSVADAQRR
FT                   AYAGVARIHWASAFHRHDIGWRAIARERGA"
FT   gene            complement(336312..337898)
FT                   /gene="purH"
FT                   /locus_tag="XALC_0307"
FT   CDS_pept        complement(336312..337898)
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="XALC_0307"
FT                   /product="probable protein purh, bifunctional
FT                   phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/imp cyclohydrolase"
FT                   /function="metabolism go:0008152; purine biosynthesis
FT                   go:0006164"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14849"
FT                   /db_xref="GOA:D2UBB5"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB5"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14849.1"
FT                   /translation="MSSDFLPVRRALLSVSDKTGLIDLARALAARKVELLSTGGTAKAL
FT                   REAGLTVQDVSELTGFPEMMDGRVKTLHPRVHGGLLGRAGTDDAVMAEHGIAPIDLLVL
FT                   NLYPFEQVTADAACTLDVAVENIDIGGPAMLRSAAKNFARVAVATDPAQYADLLAELDA
FT                   NAGALSAAKRFALAVAAFNRVAQYDAAISNYLSAVVEHTEAGVCRSAFPAQSNSSFVKV
FT                   MDLRYGENPHQQAAFYRDLSPAPGSLATFEQLQGKELSYNNIADSDAAWECVRQFDAPA
FT                   CVIVKHANPCGVAVGTGCGDTYELAYATDPTSAFGGILAFNRTLDAATAKLILDRQFVE
FT                   VLIAPDYEDAALQYAKKKANVRVLRIPLAPACHGFIDTKRIGSGLLMQTADDHVVTRDA
FT                   LKVVTRLAPSEAQFADLLFAWQVAKYVKSNAIVYARDHRTIGVGAGQMSRVYSARIASI
FT                   KATDAGLTVEGAVMASDAFFPFRDGIDAAAAAGIKAVIQPGGSMRDAEVIAAADEHGIA
FT                   MVFTGVRHFRH"
FT   gene            complement(338172..339116)
FT                   /locus_tag="XALC_0308"
FT   CDS_pept        complement(338172..339116)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0308"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14850"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14850.1"
FT                   /translation="MNKTMLLCLLALALPAFAKHAKTADDYIYLSTGDFAKAKPLLARS
FT                   DIKGAQVIYPWRMLEKSKGVYDFTAIEHDLAYLQSVHKPLFVQLQDRFFSADARRIPEY
FT                   LLKDPIYGGGLAKQGDSTSGEGWVSMQWNSHVRERYQALLKALAERFDGRIRGINLPES
FT                   AIDLDKPKDSAGGFSCDGYFQATLENAAYARAVFKHSAVVQYINFWPCEWNNDHRYMQR
FT                   AFDFAVAHHIGIGGPDVLPNKNAQMHNAYPFFHAYKGRLDLVAMAVQEPDLDYRDPRTG
FT                   QVVGKVEQSTFATDYLGAHIIFWSLSSPWLQSH"
FT   gene            complement(339466..339738)
FT                   /gene="fis"
FT                   /locus_tag="XALC_0309"
FT   CDS_pept        complement(339466..339738)
FT                   /transl_table=11
FT                   /gene="fis"
FT                   /locus_tag="XALC_0309"
FT                   /product="probable dna-binding protein fis
FT                   (factor-for-inversion stimulation protein)"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna recombination go:0006310"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14851"
FT                   /db_xref="GOA:D2UAP8"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR005412"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14851.1"
FT                   /translation="MNAATTRLDSSRGAPKPPLREHVAQSVRRYLRDLDGCDADDVYEI
FT                   VLREMEIPLFVEVLNYCEGNQSRAAALLGIHRATLRKKLKEYGLA"
FT   gene            complement(339851..340588)
FT                   /locus_tag="XALC_0310"
FT   CDS_pept        complement(339851..340588)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0310"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14852"
FT                   /db_xref="InterPro:IPR021834"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAP9"
FT                   /protein_id="CBA14852.1"
FT                   /translation="MRMSDPTPPRPSLATLLRQPDRSATHTDAAATSEPGTVADVPAHG
FT                   ASTLQTEPDTADTTPDMLEAITDAATHTLETAPNAAPSFLRRPVLRSRPWQWIALVGLS
FT                   ALLAMQTLIADRQQLSADAHWRPWVTGICKVLHCSVPAWREPRAFTMLSREVRPLPGSD
FT                   GILLVHATFRNDARWAQAWPLLQLSLADADGRTIGSRVLRPMDYLGSTRPDNDTLEPGQ
FT                   SAQIAFQVREPTAETAAFSFDFY"
FT   gene            complement(340859..341779)
FT                   /gene="prmA"
FT                   /locus_tag="XALC_0311"
FT   CDS_pept        complement(340859..341779)
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="XALC_0311"
FT                   /product="probable ribosomal protein l11 methyltransferase
FT                   (l11 mtase)"
FT                   /function="information transfer; rna related go:0016070;
FT                   rna modification go:0009451"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14853"
FT                   /db_xref="GOA:D2UAQ0"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14853.1"
FT                   /translation="MPFLELTLRCTDATQPRYETALEDVGALAVTLLDADADTSNERAI
FT                   LEPGVGETPLWGTLVLSALFPEEQDALLLLAALDAFDPGLDWSQATFRKVDDQDWERAW
FT                   LDQFQPMRFGARTFIVPWNHVLPEEASGADAAVVRLDPGLAFGSGTHPTTALCLRWLDA
FT                   LASEGALAQARVLDFGCGSGILALAALKLGAAAAVGVDNDPQALLASHDNAERNAIGAR
FT                   LAVYLPADEPTATYPVVVANILASALDVLAPTLAARVAPGGRIALSGILHGQEQDLLQR
FT                   YAAWFEQLRTEQDSDWIRIDGVRRT"
FT   gene            complement(342004..343371)
FT                   /gene="accC"
FT                   /locus_tag="XALC_0312"
FT   CDS_pept        complement(342004..343371)
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="XALC_0312"
FT                   /product="probable acetyl-coa carboxylase, biotin
FT                   carboxylase subunit protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="6.3.4.14"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14854"
FT                   /db_xref="GOA:D2UAQ1"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14854.1"
FT                   /translation="MLDKVVIANRGEIALRILRACHTLGIRTVAVHSTVDRNLKHVAMA
FT                   DESVCIGPAASAESYLNIPALIAAAEVTDAQAIHPGYGFLSENADFAERVEQSGFIFIG
FT                   PKADTIRLMGDKVEAIRAMKAAGVPCVPGSGGPLGEDIVANTKIAREIGYPVIIKAAGG
FT                   GGGRGMRVVHSEAALKAAIETTKSEAKAAFSNDQVYMEKFLENPRHVEIQVLADGQGNA
FT                   IHLGERDCSMQRRHQKVVEEAPAPGITEELRNEIGKVCVDACIRIGYRGAGTFEFLFEN
FT                   GRFYFIEMNTRIQVEHPVTERITGIDLVCEQLRIAAGHKLSIKQKDIVLRGHAIECRIN
FT                   AEDPETFMPNPGLITGFHPPGGPGVRVDTHIYSGYKVPPNYDSMIGKLIVHGPDRETAI
FT                   ARMRVALSEMVVDGIKTNIPLQQRIMRDKGFQAGGQNIHYLEKRLAERKNKSIALV"
FT   gene            complement(343500..343982)
FT                   /gene="accB"
FT                   /locus_tag="XALC_0313"
FT   CDS_pept        complement(343500..343982)
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="XALC_0313"
FT                   /product="probable biotin carboxyl carrier protein of
FT                   acetyl-coa carboxylase (bccp)"
FT                   /function="metabolism go:0008152; biotin carboxyl carrier
FT                   protein go:0042966"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14855"
FT                   /db_xref="GOA:D2UAQ2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001249"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14855.1"
FT                   /translation="MDLRKIKKLIDLLEESNLAEIEIKEGEESVRLARTPKGMVGSAPQ
FT                   YVAAPPAAVPAPTAAMPMHSPTEASTGGSAKPGNALPEGHVLRAPMVGTFYTSPSPDKP
FT                   AFVSVGQTVKIGETLAIIEAMKMFNPIEADVAGTIVAILGESGQPVEFDQPLFVIG"
FT   gene            complement(344035..344511)
FT                   /locus_tag="XALC_0314"
FT   CDS_pept        complement(344035..344511)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0314"
FT                   /product="putative 3-dehydroquinate dehydratase protein"
FT                   /function="metabolism go:0008152; chorismate go:0009423"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14856"
FT                   /db_xref="GOA:D2UAQ3"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14856.1"
FT                   /translation="MARLLLLHGPNLNLLGSREPDVYGHATLAQIDAALLAQANAAGHQ
FT                   LDSLQSNAEHVLVERVQAARDDGTAFILINPAAFTHTSVALRDALVAVAVPFIEIHLSN
FT                   PHSREPFRHHSYFSDRAVGVVCGFGADSYRYAMDAALTRLGAGACAIQARSIPV"
FT   gene            complement(344713..345297)
FT                   /locus_tag="XALC_0315"
FT   CDS_pept        complement(344713..345297)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0315"
FT                   /product="putative redoxin protein"
FT                   /function="cell processes go:0009987; other stresses
FT                   (mechanical, nutritional, oxidative) go:0009612 go:0007584
FT                   go:0006979"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14857"
FT                   /db_xref="GOA:D2UAQ4"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ4"
FT                   /protein_id="CBA14857.1"
FT                   /translation="MTATPRRLLVVAAVAAVLGMIAAQGWQRTRLTRSIPAAPADDPAA
FT                   HALAARPGEHAPTLRLTTLNGERITLGQFHGRPLLINVWASWCEPCVREMPELERLARR
FT                   PSKGGLQVLGIALDRVEDVRAFLQRVPIGYPIALETPGPTDASVRLGDTRGLLPYSVLI
FT                   DADGRIVKQKLGPFAAGEAERWTRDSSSPAY"
FT   gene            complement(345294..347579)
FT                   /locus_tag="XALC_0316"
FT   CDS_pept        complement(345294..347579)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0316"
FT                   /product="hypothetical cytochrome c biogenesis protein"
FT                   /function="metabolism go:0008152; cytochromes go:0017004"
FT                   /EC_number="1.8.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14858"
FT                   /db_xref="GOA:D2UAQ5"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14858.1"
FT                   /translation="MNLLHRVTALCLLAMAAFPALAISEKDLLPVDQAFVLSAQAPEPG
FT                   RIVLHWNIAKGYYLYRHRIAVRVIDGFKANPTLQLPAGHKKTDPYFGEVETYRNELTAV
FT                   QSGLAAPGTTRLQMEVRYQGCADAGVCYPPQKRMLEVMLPAVVAADAAPPTTSALPSNR
FT                   SGAEEKPLFGPSAATDALQGLPLPSDQAFGFEAIVSDGNTLLLRFTPAPGYYLYRDRTA
FT                   LALEGAPGIRTGMPRWPQGRSHQDEHFGNVVVYFSQSEVTVPLQRQRTNAAEATLVATF
FT                   QGCQTDGICYPPMTRRVKLSLPKGTLTPLNQATVTPLLVSPLDSRQTDANNATTTASQA
FT                   TAPTPKPTPAASAHSDARRAPPPHAPQNLLWILLLALGGGLVLNLLPCVLPILSLKVLG
FT                   LAQSGESRSRARHHALWYTLGVLTSFAVVGGIAVAARLLWGFQLQRPGFVAVLVYLMFV
FT                   VGLSLSGVFTLSTNLGGLGQSLSARSGPVGDFFTGVLACVVSSACIGPFMGPALGYALT
FT                   APPATAMLVFLTLGLGLALPFLLIGFVPSLATRLPKPGAWMETLKQVLAFPMYLTAIWL
FT                   LWVLGKQRGVDAVALLLIGATLLALGLWWFERARWRGHALGMRAASVLLLLALLPAWGV
FT                   TRLPPPSATMEEGNTVAYSPEMLDRLRTDNRVVFVNMTADWCVTCKANERNVFRSDAFR
FT                   DTLKRVDAVYMKGDWTNEDQRISAFLAEHKAVGVPLYVVYGPGAPPTVLPPVLTQAVVE
FT                   DALLRAAR"
FT   gene            complement(347599..347940)
FT                   /locus_tag="XALC_0317"
FT   CDS_pept        complement(347599..347940)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0317"
FT                   /product="putative periplasmic divalent cation tolerance
FT                   protein"
FT                   /function="metabolism go:0008152; cytochromes go:0017004"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14859"
FT                   /db_xref="GOA:D2UAQ6"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14859.1"
FT                   /translation="MASPALRLLFSTCPDVASATRIALALVGERLAACVSRMPGLHSTY
FT                   RWQGTVEQTDEVLLLIKTAADRLPALRQRLCELHPYEVPELLEVEVTDGLPAYLQWLHA
FT                   QTREELEEP"
FT   gene            348196..348483
FT                   /gene="groS"
FT                   /locus_tag="XALC_0318"
FT   CDS_pept        348196..348483
FT                   /transl_table=11
FT                   /gene="groS"
FT                   /locus_tag="XALC_0318"
FT                   /product="probable 10 kda chaperonin (protein cpn10) (groes
FT                   protein)."
FT                   /function="information transfer; chaperoning, folding
FT                   go:0006457"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14860"
FT                   /db_xref="GOA:D2UAQ7"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14860.1"
FT                   /translation="MSIKPLYDRVVVQPIEADEISAGGIVIPDSAKEKSTKGKVVAVGP
FT                   GKPLDNGSVRAPALKVGDKVIYGQYAGSSYKSEGVEYKVLREDDVLAVVG"
FT   gene            348595..350241
FT                   /gene="groL"
FT                   /locus_tag="XALC_0319"
FT   CDS_pept        348595..350241
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="XALC_0319"
FT                   /product="probable 60 kda chaperonin (protein cpn60) (groel
FT                   protein)."
FT                   /function="information transfer; chaperoning, folding
FT                   go:0006457"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14861"
FT                   /db_xref="GOA:D2UAQ8"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14861.1"
FT                   /translation="MAAKDIRFGEDARSRMVRGVNILANAVSATLGPKGRNVVLEKSFG
FT                   APHITKDGVSVAKEIELADKFENMGAQMVKEVASKTSDNAGDGTTTATVLAQALIREGS
FT                   KAVAAGMNPMDLKRGIDKAVAAAVVELKKISKPTADDKAIAQVGTISANSDASIGDIIA
FT                   DAMKKVGKKGVITVEEGSGLVNELDVVEGMQFDRGYLSPYFINNQQSQSADLDDPFILL
FT                   HDKKISNVRDLLPLLEGVAKAGKPLLIVAEEVEGEALATLVVNTIRGIVKVVAVKAPGF
FT                   GDRRKAMLEDMAVLTGGTVISEEVGLSLEKATLKDLGRAKKVQVSKENTTIIDGVGDTA
FT                   AIESRIKQIELQIAETSSDYDKEKLQERMAKLAGGVAVIKVGAATEIEMKEKKARVEDA
FT                   LHATRAAVEEGVVPGGGVALVRALSAIGSLTGDNEDQTHGIQIALRAMEAPLRAIVTNA
FT                   GEEPSVILNKVKEGTGNFGYDAAKGEFGDMVAFGILDPTKVTRSALQNASSIAGLMITT
FT                   EAMVAEAPKKDEPAAPGGMGGGMGGMGGMDF"
FT   gene            350847..353726
FT                   /locus_tag="XALC_0320"
FT   CDS_pept        350847..353726
FT                   /transl_table=11
FT                   /locus_tag="XALC_0320"
FT                   /product="putative tonb-dependent outer membrane receptor
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; the outer
FT                   membrane receptor (omr) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14862"
FT                   /db_xref="GOA:D2UB02"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB02"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14862.1"
FT                   /translation="MHIRSFTTLAFGIVLALYAAPDARAQSASPDADATDLGQVVVTGS
FT                   RIKRAEVEGVEPVLVISAQQIQQEGFLTVYDVLKTLNQQGSVEADTKYGSHTPNAAPIN
FT                   LRDLGPGRTLLLVNGHRVADYPQPYAGESNFANFANIPSAAVERIEILTGGASAIYGSD
FT                   AVAGVINVILKKGYTGNQLRVRGGTATEGGRDVFDLSWVGGHGGDKWNLTYALQWTRRD
FT                   PLSVGERPKMDSQNDESYSNWTAQARKYGFNPFTGLSLIDADSNQRLAPPSGTCARFGG
FT                   QFIDAQRLSYDYNSDTVRNRGRYCGMAHDYADWLAAKGGDNGSAYLYGTFDFDNGVQAW
FT                   STLSTTKSRGYWTYDPPYVYLGPFHDTDSDRNLYAIRQLTRYESGGWKNLANITKEFSW
FT                   DLSAGLKGRLADRFDWEVAIGRARYTVDEYVRTVDTQKATDYFLGPQLGSTADGTPIYA
FT                   LNEDRWYQPLTGAQYNALAVKADNRADSWVNQASANITGELIQGWAGPIKFAAVGEVAK
FT                   QGYRLVPDPCANNCYPLDVVDHGGGERLRYSGGIEFNVPLLSSLNASLAARHDRYGDYR
FT                   SYSSDLGTAIGTQSDTTWSAGLEWRPLSTLLLRGSVATSFRAPDMQYVLGEPSSTQQTV
FT                   IDQYRCIQKGYYLTGACNAENSDVYYLMQVNRRGTPDLESEHGRSVTTGFVWDITEGLS
FT                   LTTDYYKIRLQDMIKDLNRDEVLSAEAGCRTGLTTAGGVWVNPGGAEYCTRIVSRVSRD
FT                   AAGRVTGIEQGPINIAQMRVSGIDAALKYRMTTARWGNFNFALDYNNLIGYHEQTYRTD
FT                   DDKNLRDQKVRTKLRGSVHWENGGPLDLTVYAKRFGSTEAVNWGTCTRFDDGYQPSPSA
FT                   ECRVTDRGNRHFGESTIRYFGRVGPALYWNLTAGYRITPKMKVNLYVNNVFNTVGYDNK
FT                   ERYYGYQFYNTTLYDAVGREVAAEYVFDF"
FT   gene            354113..355186
FT                   /gene="aroG"
FT                   /locus_tag="XALC_0321"
FT   CDS_pept        354113..355186
FT                   /transl_table=11
FT                   /gene="aroG"
FT                   /locus_tag="XALC_0321"
FT                   /product="probable 3-deoxy-7-phosphoheptulonate synthase
FT                   protein"
FT                   /function="metabolism go:0008152; phenylalanine go:0009094"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14863"
FT                   /db_xref="GOA:D2UB03"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB03"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14863.1"
FT                   /translation="MAPHTDDLRIRKIEPLTPPSQLLALLPCDESASQTVATARAALHA
FT                   ILHGQDDRLAVVIGPCSIHDPVAALEYAQRLRPLRDTYGDALEIVMRVYFEKPRTTVGW
FT                   KGLINDPDLDGSFDINKGLRLARGLLRDINRLGLPAGVEFLDIISPQYIADLVAWGAIG
FT                   ARTTESQVHREMASGLSCPVGFKNGTSGDVKIAVDAVGAASHPHHFLAVTKDGYTAVAA
FT                   TAGNPDCHVILRGGMQPNYDADSVAAAAQVLEKAGLPARLMIDASHANSAKNPDNQPKV
FT                   IQNIASQLEAGQPRIVGVMIESHLRGGRQDLRPGQPLVYGQSITDGCIDWDTSVQVLER
FT                   LAQAVRARRRAGTAQAA"
FT   gene            355428..355715
FT                   /locus_tag="XALC_0322"
FT   CDS_pept        355428..355715
FT                   /transl_table=11
FT                   /locus_tag="XALC_0322"
FT                   /product="putative endonuclease protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna repair go:0006281"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14864"
FT                   /db_xref="GOA:D2UB04"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB04"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14864.1"
FT                   /translation="MAVSTPWFLYLLECRNGSYYAGITPDLQARYQAHLRGSGAKYTRA
FT                   NPPLRLLASRLYPDRAAAARAEWVLKRLPRARKLAFLCAPELLAGSDSAP"
FT   gene            complement(355856..356011)
FT                   /locus_tag="XALC_0323"
FT   CDS_pept        complement(355856..356011)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0323"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14865"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB05"
FT                   /protein_id="CBA14865.1"
FT                   /translation="MILSAFLEECTLQCKIKLHSSFCLDTALSVYIFQHTASYDESDRS
FT                   AGCTHE"
FT   gene            356152..356367
FT                   /locus_tag="XALC_0324"
FT   CDS_pept        356152..356367
FT                   /transl_table=11
FT                   /locus_tag="XALC_0324"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14866"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB06"
FT                   /protein_id="CBA14866.1"
FT                   /translation="MALNARERGLTRVDHLHFNADKSGIVAEQKSNGFGMSHQFSGTNI
FT                   QHAMQTLPALGHSALRRWSVMRACRR"
FT   gene            356899..359508
FT                   /gene="glnE"
FT                   /locus_tag="XALC_0325"
FT   CDS_pept        356899..359508
FT                   /transl_table=11
FT                   /gene="glnE"
FT                   /locus_tag="XALC_0325"
FT                   /product="probable [glutamate--ammonia-ligase]
FT                   adenylyltransferase protein"
FT                   /function="metabolism go:0008152; glutamine go:0006542"
FT                   /EC_number="2.7.7.42"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14867"
FT                   /db_xref="GOA:D2UB07"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB07"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14867.1"
FT                   /translation="MLDPAQPATWPALLRRYRAAASACLVWRDVVGLDDVETTLAGSTQ
FT                   LAEDCLALALQALESEFAARHGVVRAADGSVQRLVVFGLGKLGGGELNFSSDVDLVYAY
FT                   PQGGDSDGARPLAAEEYFARLGQRLARLLDETTIDGFVHRVDLRLRPFGNAGRVALSFA
FT                   GMDQYFQREGRDWERYAWLKARTVAGDVAAGEHWLQSLRPFVYRRYLDYTALDGLRAMK
FT                   AAIIAEVARHDRLDDIKRGAGGIREIEFLVQSLQLIRGGREATLREPRLLSALHALIAA
FT                   GQVAEAHGATLAQAYCFLRRVENRLQMLRDAQTHALPEDPLDRARIAFGLGYADWAELY
FT                   AALQCQRDRVAAEFAQLLAPRGRTPASDALADYWRNMAAGDRAQVLREAGFAAAEAADQ
FT                   ALRGFAQSQGVRRLSDAARARLDRVVPALLHATARAAQADAALHRVLGLLQAVLRRASY
FT                   LALLDEQPSALERLVDVLARSAFLSERLVAHPLLLDELLDSRVTAPMPEPTAMQQLCDS
FT                   AVAAADDDPEAALRSLNEARQALSFRIALATLDRRQPVLHSTRQLAQLAQAVVVTVLRL
FT                   AHAELVATHGQVPGGSFAIIGYGSLGGLELGIGSDLDLVFLYDHPSSVEVSNGPKVMES
FT                   GRWFARLAQKVIALLGTVTGGGRLYDIDVRLRPDGGKGALVSSLASYSEYQRDRAWTWE
FT                   HQALVRARGVAGDSALLQRFEQVREQTLARTREAGALCEEVRGMRARMRAELDRSDAAR
FT                   FDLKQGAGGLIDLEFLTQAGVLLGAAQQPALLQPRDTATLIDVLAHAGWLEATMAARLH
FT                   AAHAVLVEAGLSCTLDRRAQLTAPSVEIEAARATIRDVAARLGLSFVEGRGSDAAAR"
FT   gene            complement(359559..360620)
FT                   /locus_tag="XALC_0326"
FT   CDS_pept        complement(359559..360620)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0326"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase protein"
FT                   /function="metabolism go:0008152; glycerol metabolism
FT                   go:0006071"
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14868"
FT                   /db_xref="GOA:D2UB08"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB08"
FT                   /protein_id="CBA14868.1"
FT                   /translation="MAIVAVTAMAASRESKPLVIGHRGASALRPEHTLASYAKAIADGA
FT                   DYIEPDLVSTKDGVLVARHENEIGGTTDVATHPEFAARKTVKQIDRQRVEGWFTEDFTL
FT                   AELKTLRARERLPELRSTAFDDQFQIPTLDEIIDFTAAESATRGRLIGLIPEIKHGTYF
FT                   STHGLAMEGRLLKTLDAHTYTRRAPVVIQSFEIGNLKALHRTLGRTHPNVRLVQLLGDP
FT                   NARPGDRLNDGPTYAQMGTAQGLRAIAKYAQWVSPNLRAIVPVDADGALAGPTAFVADA
FT                   HAVGLQVVPYTFRPENSFLPKQLQDARGPAAINVAGSIAEIHALLAAGIDGFFTDDPAV
FT                   GRAAVDGTPPPTR"
FT   gene            361434..363335
FT                   /locus_tag="XALC_0327"
FT   CDS_pept        361434..363335
FT                   /transl_table=11
FT                   /locus_tag="XALC_0327"
FT                   /product="putative protease protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14869"
FT                   /db_xref="GOA:D2UB09"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB09"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14869.1"
FT                   /translation="MIDRMLQQRLLITALSAAMLVCSGAQAVQNQNGALQNANLDAMTS
FT                   ALRATPVNFDVYLPLRDEAGLDTLLADRQDPQSKNYHHWLTTDEFASRFGPLPAQVAKV
FT                   RAALQAEHMNVTQEGGTLHVSASADSVERLFAAPLTLELQAGKQARLTAASPLQLPPAL
FT                   RNSGAVVTGLQRGSVPYHLDSKQMPLVNLDNRRGPNGIYTYNDLKQAYGYPSYQATIGP
FT                   AGHHQRLDGTGTTIAILIPSDVLDSDVDMLFDEENFSVHGAGHVNPKLYARRYVAGAKP
FT                   GINEEIDGAGGEAALDVEMAMGGAPGAHVILYVIPDISDASILAGYRQIVQDNEADVVS
FT                   VSFGACELYFTPAYNGGKDGTPVLRIYDALFRQGNAQGITFIASSGDNAGLSCADTNYA
FT                   VDGKDGRFVAGVDHPAVNPHVTAVGGGNLFTAYKKGSGDSSYVRETAYADPLISKDYYN
FT                   VGAMLSGGYWGAGGGVSTIFKRPVYQSRALGGGSDQMRLLPDVGMLVGGCPDNATQPCQ
FT                   EGRVPFASAVVAAYKGKFHGYIGTSVAAPEFASVAALLVEKQGRQGNLNLYLYRLAANY
FT                   AKAFHRNILGYNGVVSNDVPLQGKYNYTVGLGTPDVRLLIGALDAAPAGVPRSASNP"
FT   gene            363461..365359
FT                   /locus_tag="XALC_0328"
FT   CDS_pept        363461..365359
FT                   /transl_table=11
FT                   /locus_tag="XALC_0328"
FT                   /product="putative protease protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14870"
FT                   /db_xref="GOA:D2UB10"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015366"
FT                   /db_xref="InterPro:IPR030400"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB10"
FT                   /protein_id="CBA14870.1"
FT                   /translation="MINRMPHQRLLTTVLSAAMLLCSGAQATQNPTLQNRTLDAMTTAL
FT                   RAAPVTFDVHLPLRDQAGLDALLAEMQDPQSPHYHQWLKPEEFASRFGPLPAQVAQVRA
FT                   ALEGAHMTVTQQGETLHVSASADDVERLFAVSLTADLQAGKRDRLASDSPLQLPAPLRD
FT                   SGATVIGLDRGLPPYQVNSIIKQLNQAQLDNLNSPTGPYAYNDLKQAYDYPSYQAMIGP
FT                   PGHHRRLDGTGTTVAILMASDVLDSDVDLFFNQQNFSRNGAGHVNPKLYARRYVAGAKP
FT                   VINDKSSAAPEAALDVETVLGGAPGANVILYVIPDFSDESIYAGYRQIVRDNKADVVSL
FT                   SLGGCELYRTPAYNGGKDLTSLLRTYDELFRQGSAQGITFIAASGDNGGLGCADTNYLV
FT                   DGKDGRYVLGVQYPAADPHVTAVGGGNLFTAYKQGSADSSYLRETAYADPLTAKDYYGK
FT                   GAILAGGYWGAGGGVSTIFNRPLYQLRALGCRYGQMRLVPDVGMLVGGCPGSATQPCQE
FT                   GRKIGASAALLAYNGQMHEAIGTSVAAPEFASVAALLVEKQGRQGNLNPYLYRLAANYP
FT                   KAFHRDIPGYNGVVSNDVPLQGKYNYTVGLGTPDVRLLIGALDAAPAGVPRSPSNP"
FT   gene            complement(365428..366390)
FT                   /locus_tag="XALC_0329"
FT   CDS_pept        complement(365428..366390)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0329"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14871"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB11"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14871.1"
FT                   /translation="MDECWAISDGHAGNARQAEALAAALAVNPAQPPQTLVLQPHMPWR
FT                   WLAPRRLPGATRAYGPDFADLLRHPPALAIGCGRQAALATRLLRTRGSQVVQVLDPRLP
FT                   TRHWDMLVVPEHDRLRGDNVLTLLGSLHPVDDGWLAQGRAAFPELGMLPSPRTGLLVGG
FT                   PAGLAPWNSAQASAAFDAIATHLRATGGSILASASRRTPAEVAAALRRVFADLPGVIWC
FT                   DERDGANPYAGILGWAERLACTPDSVNLLSEACATRTPVRVLMPELACGRAQAFHRALH
FT                   ERGRLTSTHDAGDATAAGIEPLRETARIAARIREHLRAG"
FT   gene            366528..367118
FT                   /gene="rutE"
FT                   /locus_tag="XALC_0330"
FT   CDS_pept        366528..367118
FT                   /transl_table=11
FT                   /gene="rutE"
FT                   /locus_tag="XALC_0330"
FT                   /product="putative nadh dehydrogenase/nad(p)h
FT                   nitroreductase oxidoreductase protein"
FT                   /function="the proton- or sodium ion-translocating nadh
FT                   dehydrogenase (ndh) family"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14872"
FT                   /db_xref="GOA:D2UB12"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB12"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14872.1"
FT                   /translation="MSAALHAAALDQLFRTARTQNAFLDKPVDEATLRALYDLVKWGPT
FT                   GANGSPARFVFVTSPQGKEKLKPALSEGNLAKTLAAPVTVIVAHDEDFHEKLPYLFPHT
FT                   DAKSWFDGPREGRSEVAFRNGSLQGAYLILAARALGLDAGPMSGFDNAKVDAAFFAGTT
FT                   IKSNFLVNLGHGDPKGLYPRLPRLSFDEAARIA"
FT   gene            367203..367832
FT                   /locus_tag="XALC_0331"
FT   CDS_pept        367203..367832
FT                   /transl_table=11
FT                   /locus_tag="XALC_0331"
FT                   /product="conserved hypothetical protein."
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14873"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB13"
FT                   /protein_id="CBA14873.1"
FT                   /translation="MKTRNLLLPLALSLAVVGAQPVSTAFAAPAAAAAFKGVSGTYKLD
FT                   PAHTDVLVQWSHFGFSNPSANFGDVEGTLVYNAQDVSKSSVNVTLPLSGLNTFTAKLDE
FT                   HLRSADFFDAAKFPTATFKSTKVTAAGANKLKVAGDLTIKGTTKPVVLAVTLNGAGPHP
FT                   MHKVQALGFDATTTVKRSDFGLSAYVPNVSDEVKIRITTEALLQEK"
FT   gene            complement(367945..368382)
FT                   /locus_tag="XALC_0332"
FT   CDS_pept        complement(367945..368382)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0332"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBE70790"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D2UGZ3"
FT                   /protein_id="CBE70790.1"
FT                   /translation="MTTHSNDSRRNFLLGTAATAIAAIIPVATAAAVNPVATQAPAHGR
FT                   ALPETQTFMMQVLGDLRQAPTGLQLAPGQLSEPITLAGNGTYRVKISPTDITTRFGPIY
FT                   KLVLADAHGTPLEEMNIGSDTTATFTRHGVQVYALSIEQAL"
FT   gene            complement(368677..369768)
FT                   /locus_tag="XALC_0333"
FT   CDS_pept        complement(368677..369768)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0333"
FT                   /product="hypothetical protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14874"
FT                   /db_xref="GOA:D2UBB7"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB7"
FT                   /protein_id="CBA14874.1"
FT                   /translation="MQQQRKLPKLIQCRRLQRFAQPTTRQWMNQTMLSETIVAEALSPR
FT                   IFSLILLPTEKCNFRCTYCYEDFATGRMQPKVVDGIKALISKRVPSLDRLNISWFGGEP
FT                   LLAREVVMDIGQHAHATCAQHGVAFNAGFTTNGYLLEPDLLQRLVQLRHREFQITLDGD
FT                   ADWHDKTRITANKGGTFQKIWSNLIAYRALPSDFAISLRLHLHQDNIDSVKRLYTKLHR
FT                   ELLDDPRFSVYFHKVSNLNPSSRIEETVLPRDRYLEAIAYITDNAERTKNSERPISEEH
FT                   LDGYICYAAKPNSLMIRANGRIGKCTVALNDDRNDLGKLHADGTIEIANDKLRLWMNGF
FT                   SDLSEQSLGCPLSSLATTNLATI"
FT   gene            complement(370125..370508)
FT                   /locus_tag="XALC_0334"
FT   CDS_pept        complement(370125..370508)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0334"
FT                   /product="hypothetical anti-sigma factor antagonist
FT                   transcription regulator protein"
FT                   /function="transcriptional level go:0006355; sigma factors,
FT                   anti-sigmafactors go:0016987 go:0016989"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14875"
FT                   /db_xref="GOA:D2UBB8"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14875.1"
FT                   /translation="MTTLSLQIDPAQDKRQRITLSGRLDTHTYQTLDEALAPLLATPIT
FT                   TLVLDLSQLDYISSAGIRSIFKARKLLAARDGQVLVVNPAPQIRKVFDLVKAVPLNEIF
FT                   TSIQELDDYLDEMQRRVVEQGDS"
FT   gene            complement(370505..370858)
FT                   /locus_tag="XALC_0335"
FT   CDS_pept        complement(370505..370858)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0335"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14876"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBB9"
FT                   /protein_id="CBA14876.1"
FT                   /translation="MRTDHVQRARLIVEELACNTLEHGHLRREQTPIELILELERATLV
FT                   LEFHDSGPAFDPRSAPIPDLDADIAERPIGGLGLHLVKQLADRIDYHHDAGRNVVRITL
FT                   LHPFDPASQEFPA"
FT   gene            complement(370942..372747)
FT                   /locus_tag="XALC_0336"
FT   CDS_pept        complement(370942..372747)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0336"
FT                   /product="putative regulatory protein"
FT                   /function="regulation go:0050789"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14877"
FT                   /db_xref="GOA:D2UBC0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC0"
FT                   /protein_id="CBA14877.1"
FT                   /translation="MARLTQQTARSLEATLGSVQVSGRTLAAAAAGVGRQPFNLRSLLQ
FT                   ATLQGDPDIAGTMLVIEPGTLKNDDRGFAWRLQRTRDRVLEQPVTALDLDDQRMPWYRR
FT                   TLAATAPWWSEPYRDASAGGAFLTSYNLPLRLPGDGPQAQAIGMVRVDVPLQRLRAIVA
FT                   KLPAKAGLQPMLLSPDGLFVLHPDPTLHFHRALEAQVARARPDLSPLAAAVQTRTPVRF
FT                   VHTAPDGERYLTESAVVGDTGWTFALSVSERYILAGLNRIVMWGGLVSATALALWLWLL
FT                   HRYTARLAGPLEDLTDSAVHLSQGAFDYPLRHMERQDEVGVMARAFDSARTSIKQQLQE
FT                   IATLAQARQRMQSELSIAREIQHAMLPAARTFDSAHKHLETYALLEPATMVGGDFYQFV
FT                   ETEPGLLWFVVGDVSDKGVPAALFMARAITVLEVAARRHTRPDAILIAASQRLVEGNEP
FT                   CMFATVLCGLINVHSGDYWLASAGHEPPLLLDADGHAQMLSLESGPPLGLEPQSHYPVL
FT                   QGRLATGATLLSYTDGITEAMDAHNRPYGEARLLAALQPGADAQAQCLAILTDVQAFTE
FT                   PAAQSDDITLLAIRLHHGSAAETTA"
FT   gene            373127..375817
FT                   /gene="aceE"
FT                   /locus_tag="XALC_0337"
FT   CDS_pept        373127..375817
FT                   /transl_table=11
FT                   /gene="aceE"
FT                   /locus_tag="XALC_0337"
FT                   /product="probable pyruvate dehydrogenase
FT                   (acetyl-transferring) protein"
FT                   /function="metabolism go:0008152; glycol degradation
FT                   go:0042846"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14878"
FT                   /db_xref="GOA:D2UBC1"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14878.1"
FT                   /translation="MNWLNEVLQNDPNPTETQEWIESLKAVIDIAGPERAHQLLEDMVE
FT                   LTRRSGAYLPFSPTTEYVNTISPANEAKSPGDAAIEWKIRSIIRWNAMATVVRANRKPG
FT                   DLGGHIASFASSATLYDVGFNHFWRAPSEQHPGDLLYIQGHSSPGIYSRAFLEGRISED
FT                   QLNNFRMEVGGQGISSYPHPWLMPDFWQTPTVSMGLGPLSAIYQAQFMKYLEHRGLIEK
FT                   SDRKVWCFIGDGESDEPETLGAIALAGREGLDNLIFVVNCNLQRLDGPVRGNGKIIQEL
FT                   EGVFRGGGWNVIKLLWGGYWDALLAKDSNGVLRKLMMETVDGEYQNCKAFGGAYTRANF
FT                   FGKYPETAAMVAGLSDEDIWRLNRGGHDPHKVYAAYHQAVNTQGMPTVILAKTVKGYGM
FT                   GSAGEALNPTHQTKKLDDDAVRAFRDRFNIPLSDKQLADAEQVPFYHPGPDSPEVQYLQ
FT                   QRRAALGGYLPQRRRKASLSIPAPGLDKFERLLKDSGERTYSTTMAFVQSLNIALRDKE
FT                   LGPRIVPIVADEARTFGMEGMFRQIGIYAPFGQKYKPVDADQLMFYREDQSGQVLQQGI
FT                   SEPGAISSWMAAGTSYSVSDVPMLPFYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTA
FT                   GRTTLNGEGLQHEDGFSQIVAGGIPNVRSYDPTFGFEVTVVMQYGIQRMMQEQVDEYYY
FT                   ITLMNENYAHPDMPAGAEHGIIKGMYLLKDAGKLKKGELRVQLLGSGTILREAIAAAEL
FT                   LEKDFGVTADIWSCPSFNELRRDGFDVERWNRLHPEATQRKPYVTELLEGRQGPAIAAT
FT                   DYVRGFADQIRAFVPMGYTVLGTDGFGRSDTRTNLRRFFEVDRYYIAHAAIAALAKEGK
FT                   MTGKDVAKAIKQYKIDPEKANPVGV"
FT   gene            376131..376343
FT                   /locus_tag="XALC_0338"
FT   CDS_pept        376131..376343
FT                   /transl_table=11
FT                   /locus_tag="XALC_0338"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14879"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC2"
FT                   /protein_id="CBA14879.1"
FT                   /translation="MRYAVVIEQAGNNDSAYVPDLPGCVATGATIAEVGGLIREAIGLH
FT                   LAGMREDGEVIALPSSRVEYVDVAA"
FT   gene            376684..376944
FT                   /locus_tag="XALC_0339"
FT   CDS_pept        376684..376944
FT                   /transl_table=11
FT                   /locus_tag="XALC_0339"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14880"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC3"
FT                   /protein_id="CBA14880.1"
FT                   /translation="MGRPLRWMSSQFPSTANRGCRCRSRSERRLQPGLEHDESVGIEAD
FT                   AADGCELHPVVWRFKHKLLQAMSEREAGRQLPPDMQSRAAG"
FT   gene            complement(376941..377480)
FT                   /locus_tag="XALC_0340"
FT   CDS_pept        complement(376941..377480)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0340"
FT                   /product="putative transferase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14881"
FT                   /db_xref="GOA:D2UBC4"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC4"
FT                   /protein_id="CBA14881.1"
FT                   /translation="MPPIRPFLDKTPQLGDRVYLDPACTIIGDVVLEEDVSVWPGTVIR
FT                   GDVNHVRIGARSNLQDGTIVHVSHHSPYNKAGYPTVIGADVTVGHGTILHACTIEDLCL
FT                   IGMGACILDGATVRKYGFVGAGAVVGPGKTVGERELWLGNPARPARLLSDKEIESLHYS
FT                   AQHYVRLKDQYIGVND"
FT   gene            377746..379056
FT                   /locus_tag="XALC_0341"
FT   CDS_pept        377746..379056
FT                   /transl_table=11
FT                   /locus_tag="XALC_0341"
FT                   /product="hypothetical major facilitator superfamily
FT                   protein"
FT                   /function="the major facilitator superfamily (mfs)"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14882"
FT                   /db_xref="GOA:D2UBC5"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC5"
FT                   /protein_id="CBA14882.1"
FT                   /translation="MPHAAAVPGSLVQDRMGGFQWMAIGICVLLTMLDGFDVMVMAFTA
FT                   SHVSDEWQLSGKLLGGLLSAGLIGMAVGSLCLAPLADRWGRRRLILGCLAILTVGMGAS
FT                   AMAQNVQQLWVLRVFTGLGIGGMFPGVGAITAEYASAKWRSTAVVLQTTGYPIGAAFGG
FT                   VIADLILEHWHLHWHAVFLFGAGCSLLFMPLVLACLPESLDFLIGRRPPNALAQLNATL
FT                   LRMRQAPLSELPALPRRDAVPRQGYAVLFVGAMRRRSLLLALAFFLHMFAFYFVLSWTP
FT                   KLLVAAGMSVQQGITGGTLLNLGGIVGGGVFGWLAVRWSLRWLTLGMFLLAALAMLVFA
FT                   GYSTQLAAAFAIALFIGAAVFAAMSGLYATAPVVFDAWIRGTGLGWAIGIGRLGAILSP
FT                   PTVGLLIDAGWEPSRLYMIFTLPLLLAAAALLALRAR"
FT   gene            379421..380509
FT                   /locus_tag="XALC_0342"
FT   CDS_pept        379421..380509
FT                   /transl_table=11
FT                   /locus_tag="XALC_0342"
FT                   /product="hypothetical membrane fusion protein"
FT                   /function="accessory factors involved in transport; the
FT                   membrane fusion protein (mfp) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14883"
FT                   /db_xref="GOA:D2UBC6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14883.1"
FT                   /translation="MSLSRVGVMTLSAHALPVERTLPGRTVAYETADVRPQVGGLLRQR
FT                   LFVEGQEVKAGQPLYQIDPAPYQAAYDIARGNLVQAEAALASARPKAERYRTLVGMDAA
FT                   SKQDADDAISALRQDEAAVIAAKAGLQAARINLDYTRITAPISGRTGASAYTVGALLTA
FT                   AQDAALTTIQRLDPIYLDVTQSSTQILALRRQLDAGRIRAIDGKAQVQVRLEDGSTYPH
FT                   AGTLEFVGTQVNAGTGNVTLRAVVPNPEHLLLPGMYLRAVLPMATNQGAILVPQQAVTR
FT                   DSKGEPLVKLLDAHNRVVERHIRTGDALGHDWVVEDGLKPGERLIVVNGSRAEIGKTVT
FT                   PYPVSAAELDAAPTVPGAAQAD"
FT   gene            380520..383648
FT                   /locus_tag="XALC_0343"
FT   CDS_pept        380520..383648
FT                   /transl_table=11
FT                   /locus_tag="XALC_0343"
FT                   /product="probable rnd superfamily protein"
FT                   /function="the resistance-nodulation-cell division (rnd)
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14884"
FT                   /db_xref="GOA:D2UBC7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14884.1"
FT                   /translation="MSRFFVNHPMVAWVMAIVIVLIGMLAIHALPVERYPQMAPPTITV
FT                   RATYNGASAQTVENTVTQLIEQSQQSLDHLLYMTSTSASDGTAQVNLVFQTGTNPDTAQ
FT                   VQVQNQLQSVMSILPQAVQQNGLIITKSSGSLFEVVAFTSDDGSMDSFDVANYMESRID
FT                   DQISRISGVGNIQPIGSEYAMRIWLDPEKLRKYALMPSDVENALQSQNTDVSAGELGGQ
FT                   PSLRGQRLDATVTTRSRLQTPAQFGAIVLKSDPDGAAVHLSDVARIGLGPETYGTLSRF
FT                   NGKPSASLGIELNSDANAVEVSKAIEKRLGELKQYWPHGYNYHVAFSSTPFVITSIKEV
FT                   VITLIEAVLLVVAVMYLFLQNWRATLIPTIAVPVVLMGTFGVLAAFGYSINTLTMFAMV
FT                   LAIGLLVDDAIVVVENVERVMGQEGLSPKEATLRSMQQIGGALIGIVLVLTAVFVPMAF
FT                   FNGVTGVIYRQFSITIAASMILSVLVAMTLTPALCVTILKPLHQGEAPIGSHGRLGWFF
FT                   IWFNTRFRHMSERYRAVVERVLGQRALGLLAYALLLVVTGVLLWRLPGAFLPDEDEGML
FT                   NVLVKLPAGSTLEQTQMVADRLTQVAMKDPGVRSVLSSAGFSVTGSGQNVGMAFVRLKD
FT                   WDDRDDDAATIAERLKKALADVPDADLFVTSPPAITGLGDASGFTFELMDYEGAGHAAL
FT                   LAARDKLLRLAADDPKLMNVRYASLEDAPVYAVKIDDNKAQALGVDPGDINATLNSALG
FT                   GDFVNNFIYKGRIKKVYVQGDAHTRMAPQDVERWTVRNTGGDMVPMSAFTTSRWTSAPA
FT                   ALERYNGVSAMELTGQARLGVSSGAAMDEMAELSKQLPHGFGYAWSDMAYQEKLSANQA
FT                   PALYAISLLFVFLCLAGLYESWSIPFAVMLAVPVGIFGAVLLMTLRGLENDVYFQVGLL
FT                   TTVGLSAKNGILIVEFARDLEHRGESLLAATLHAVQMRLRPILMTSLAFLLGVLPLMFS
FT                   HGAGSAARHSLGTGVTGGTLASITLGLFFVPLFYVIVRRLFPERRVASEEVGS"
FT   gene            383645..385084
FT                   /locus_tag="XALC_0344"
FT   CDS_pept        383645..385084
FT                   /transl_table=11
FT                   /locus_tag="XALC_0344"
FT                   /product="putative outer membrane efflux protein"
FT                   /function="the outer membrane factor (omf) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14885"
FT                   /db_xref="GOA:D2UAQ9"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAQ9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14885.1"
FT                   /translation="MSALCRASVAAATLLALAGCTLAPHYVRPAAPVPANLAAADASAA
FT                   HAAGQPADTLVMPDWQAVFLDPRLRQTIALALQNNRDLRVAMLSIDKARAQYRIQRAAQ
FT                   LPSLDASASQNRERVSAASSDTGVSQINVSDTLQVGLSSWQLDLFGQLRSLKQEALQNW
FT                   LASAQTQRSVRLSLIAQVAAAWLTVAADQAQLALAQQTLDSQTQTLQLTERQHSVGTVS
FT                   ALDLAQQQTSVEAARVSAASAATQLAQARDALQLLVGAPVDAALLPSAQAIDRSVALAP
FT                   VPAHLSSSVLLKRPDVLAAEHSLQAANADIGAARAAFFPSLSLTASTGRSSDALSTLFS
FT                   AGARTWSFVPSITAPIFHGGALKASLDASKIGKDIAVAQYEKAIQSAFAEVADALAAKD
FT                   HMEAQLTAQQALVDASQRSYTLADARYRAGLDGHLAVLDAQRSLFAAQQALIALRLQDA
FT                   SNRVTLYQVLGGGADAQVGTP"
FT   gene            385311..386168
FT                   /locus_tag="XALC_0345"
FT   CDS_pept        385311..386168
FT                   /transl_table=11
FT                   /locus_tag="XALC_0345"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14886"
FT                   /db_xref="GOA:D2UAR0"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR018935"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14886.1"
FT                   /translation="MKIPPGLQPLIDDGVIDGVLRPLKSGKEAAVYVVQAGDDVLCAKV
FT                   YKDMAQRSFQARVQYQEGRKVRGSRQSRAMGKATKFGRREQEAAWKDTEANTLYQLVDA
FT                   GVHVPQPRGYFHGVLLMELVTDAEGQSAPRLSEVELLPEQARAFHARLIGDVAKMLCLG
FT                   LIHGDLSEYNVLVAADGPVVIDFPQVVSAAGNNAARAMLLRDVHNLRDCLGRFAPDLNV
FT                   THYGEEMWALYEKGALLPDSPLSGRFAFDTRRADVRAVRASIEDARQEALIRQQGREAA
FT                   ASDD"
FT   gene            386433..387392
FT                   /locus_tag="XALC_0346"
FT   CDS_pept        386433..387392
FT                   /transl_table=11
FT                   /locus_tag="XALC_0346"
FT                   /product="putative esterase/lipase/thioesterase family
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14887"
FT                   /db_xref="GOA:D2UAR1"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14887.1"
FT                   /translation="MYFDPDVVRFFDQMKQSGQPPIEQLPLPAARAKFSALGSQFGFPP
FT                   LEMAEVRGAQAPGPCGPVPLRLYRPVGVESLPAPTCVYVHGGGGVLGDLDSHDDICRQL
FT                   AARAGCQVLAVDYRLAPEHPAPAGIEDVIAVVQWLAANSAEVGADPQRLAIAGDSIGGA
FT                   LAASAALAARDAGISLRCQVLVYPLTDARPDNPFPSRVQNAVIPPLTEAAMRFFDSKLL
FT                   PDPVVTTDWRISPALAPDVAGVAPALVVLADRDALYDEGLHYAQRLRQAGVEVTMRVYP
FT                   GMIHGFVSMGAVLRAAGEVIDLAALQLRQRLLPVAAQA"
FT   gene            complement(387424..389316)
FT                   /gene="gidA"
FT                   /locus_tag="XALC_0347"
FT   CDS_pept        complement(387424..389316)
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="XALC_0347"
FT                   /product="probable trna uridine 5-carboxymethylaminomethyl
FT                   modification enzyme gida protein"
FT                   /function="cell processes go:0009987; cell division
FT                   go:0000910"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14888"
FT                   /db_xref="GOA:D2UAR2"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14888.1"
FT                   /translation="MSDSSFYRYDVIVIGGGHAGTEAALASARAGAGTLLLTHNMETVG
FT                   AMSCNPAIGGIGKGHLVKEIDALGGAMAQAADLAGIQWRTLNASKGPAVRATRCQADRS
FT                   LYRNAIRRLVEAQPNLTVFQAAVDDLVMDGERVRGVLTQTGLRFEAGAVVLTAGTFLAG
FT                   KIHIGQTQYAGGRAGDPPATALAQALRDGRFGVDRLKTGTPPRIDGRSLDYTAMEEQPG
FT                   DAPLPVMSFLGDVAQHPRQVSCWITHTTERTHAIIRGALDRSPLYTGQIEGIGPRYCPS
FT                   IEDKVVRFAEKASHQIFVEPEGLDVVEIYPNGISTSLPFDVQLELVRSIRGFERAHITR
FT                   PGYAIEYDFFDPRGLKASLETKAMPGLFFAGQINGTTGYEEAAAQGLIAGLNAARQVQG
FT                   LEPWSPRRDQAYIGVLIDDLITHGTSEPYRMFTSRAEYRLQLREDNADARLTGIGRELG
FT                   LVDEARWARFQTKQDAVARENERLRGFWATPSNALGREVAATLGVAVSRETNVLDLIKR
FT                   PELDYAALMRVPLLGPGVADTQVAEQVEIGIKYAGYLERQREEIARQQRHEDTTIPTAF
FT                   DYAQVRGLSAEVQQKLQRVRPQTVGQAQRIPGMTPAAISLLLVHLERARRSRVA"
FT   gene            complement(389932..390354)
FT                   /locus_tag="XALC_0348"
FT   CDS_pept        complement(389932..390354)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0348"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14889"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR3"
FT                   /protein_id="CBA14889.1"
FT                   /translation="MTLRLICAAGLLATLGGCATYDYAGGNEGGYYRGAPSVEYRYPAG
FT                   YSEYAYPYGMAPYAYGPGYYGYYGYYSYGVPYYYYHRDSYHGGDGPPRPHPVLMPPSGG
FT                   IGIPSPLRQQTVDRPPRSHPMLVPRGGGIGIRTPLR"
FT   gene            390902..391516
FT                   /locus_tag="XALC_0349"
FT   CDS_pept        390902..391516
FT                   /transl_table=11
FT                   /locus_tag="XALC_0349"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14890"
FT                   /db_xref="GOA:D2UAR4"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14890.1"
FT                   /translation="MKHGSKSRRWCGWLLWTIRLCVLLGLWLLGVVIYIVWVGDRDQAA
FT                   PADAIIVLGAAAYDAKPSPVFEERIRHALDLYRRGYAPTLIFTGGFGNGARFAEAQVAR
FT                   RYALRQGVPADAVLIETISRTTRQNLIQARQIMRAHGLRRVIVVSDPLHMARALRLCRE
FT                   LQIDALASSTPSSRFRSFQTRWPFLLQEVYFFHRDLLEQAN"
FT   gene            complement(391684..392580)
FT                   /gene="bioC"
FT                   /locus_tag="XALC_0350"
FT   CDS_pept        complement(391684..392580)
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="XALC_0350"
FT                   /product="probable biotin synthesis protein bioc"
FT                   /function="metabolism go:0008152; biotin go:0009102"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14891"
FT                   /db_xref="GOA:D2UAR5"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR5"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14891.1"
FT                   /translation="MTSSAFDPQHIRRAFSRAAASYDATAALQHEVEKRLLESLDYLGD
FT                   RVPQVVLDVGSGPAHAAATMKKRWPRAQVIALDQALPMLQQAKRHAGWWKPFGRICADA
FT                   RALPLAEHSVDVIFSNLCLQWVEDLPAVFAGFRRILRPGGLLLCSSFGPDTLIELREAF
FT                   AQADRETPHVSHFAPIAQFGDALMLAGFRDPVLDRDLFTLTYPDLTALMRELRAIGATN
FT                   ALHARRHTLTGRGRFDAASAAYAALRTSEGSLPSSWEVIYAHAWAPPPGTPIREAHGEI
FT                   AAIPLSAIPIRRRDAVR"
FT   gene            complement(392726..393508)
FT                   /locus_tag="XALC_0351"
FT   CDS_pept        complement(392726..393508)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0351"
FT                   /product="putative short-chain dehydrogenase/reductase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14892"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14892.1"
FT                   /translation="MDLGIAGKWALVCAASKGLGLGCARALVDEGVHVTIVARGQETLE
FT                   AAAAHLRTRPGRGEVIAVAADIATESGRATALAACPQVDILINNAGGPPPGDFRTWERE
FT                   DWLRALDANMLAPIALIRATVDAMQARGFGRIVNITSAAVKAPIDSLGLSNGARAGLTG
FT                   FVAGLARRTVAYNVTLNNLLPGQFDTDRLRGNIAHAAQREGVDAATLTARKHSQIPAGR
FT                   FGTAEEFGAVCAFLCSVQAGYLSGQNLLLDGGSYPGTF"
FT   gene            complement(393595..394356)
FT                   /gene="bioH"
FT                   /locus_tag="XALC_0352"
FT   CDS_pept        complement(393595..394356)
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="XALC_0352"
FT                   /product="probable carboxylesterase bioh (biotin synthesis
FT                   protein bioh)"
FT                   /function="metabolism go:0008152; biotin go:0009102"
FT                   /EC_number="3.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14893"
FT                   /db_xref="GOA:D2UAR7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR010076"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14893.1"
FT                   /translation="MHIETLGHGPDLVLLHGWALNGGIFAPLLERLSAQYRMHVVDLPG
FT                   HGHSREDDTPLALPHVVSAIAAATPPAVWLGWSLGGLFALHAAATQPQVRGLAMLAATP
FT                   RFVRGSDWPHAVAPEVFAQFGHDLTEDYRGTLDRFLALDTLGSAHAQAELRTLRATLGA
FT                   RSEPDAQVLQDGLTLLERSDLRRALPSLRVPSLWIGGQRDRLVPPAGMAAAAALAPNAQ
FT                   SLCIKGGGHAPFLGHADDVAEALDGFLSALA"
FT   gene            complement(394617..395840)
FT                   /gene="bioF"
FT                   /locus_tag="XALC_0353"
FT   CDS_pept        complement(394617..395840)
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="XALC_0353"
FT                   /product="probable 8-amino-7-oxononanoate synthase protein"
FT                   /function="metabolism go:0008152; biotin go:0009102"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14894"
FT                   /db_xref="GOA:D2UAR8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14894.1"
FT                   /translation="MPAPTAMARPDLHDRLQSLRSLRQAHGRLRVRRSVGRRDGVRLEL
FT                   DGRWLTGFCSNDYLGLAQQFEVIAALQDAAARDGVGSTGSHLICGHHALHDTLEREIAD
FT                   WLGYPQALLFSSGFIANLAVQQALLSEEDDVCVQDRLNHASLLDAARLAGCRLRRYPHL
FT                   DAEGAMRQLKHAAEGAAMLATDGVFSMDGDIAPLRALALVARTQQALLYVDDAHGVGVV
FT                   GPHGRGCVAEAGLGADEVPLQLVTLGKALGGYGAVVVGNPVLIQHLAETARPYLYTTAL
FT                   PPAQAAATLAAVKLARRDQWRRERLLELIAAFRGGARHHGLELMASETPIQPLLCGDET
FT                   SALALSAALEEAGFLVSAIRPPTVQEGKSRLRVTLSALHTQTQVQALLDALALARDRLA
FT                   AHPLSVPA"
FT   gene            complement(395925..396968)
FT                   /gene="bioB"
FT                   /locus_tag="XALC_0354"
FT   CDS_pept        complement(395925..396968)
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="XALC_0354"
FT                   /product="probable biotin synthase protein"
FT                   /function="metabolism go:0008152; biotin go:0009102"
FT                   /EC_number="2.8.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14895"
FT                   /db_xref="GOA:D2UAR9"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAR9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14895.1"
FT                   /translation="MHAVVRHDWQRQELLALFDLPFPELLHRAAQVHREHFDPAQVQVS
FT                   TLLSVKTGGCPEDCAYCPQAQRYNTGVEAQKLMSTEAVLSKARQAKAAGASRFCMGAAW
FT                   RSPKERDIPKVAEMIREVKALGLETCATLGMLDGAQAQALKAAGLDYYNHNLDTAPDFY
FT                   DTIIHTRQYQDRLDTLAHVRDAGLKTCCGGIVGMGESRDQRAGLLQALANLPVHPDSVP
FT                   INRLVQVAGTPLHGTAELDAFEFVRTIAVARIVMPQAMVRLSAGRESMSDELQALCFCA
FT                   GANSIFYGEKLLTTGNPDTERDQALFARLGLRPMQVMVDADAHDHPGTVHADITTPTDT
FT                   PHDTALA"
FT   gene            397018..397749
FT                   /locus_tag="XALC_0355"
FT   CDS_pept        397018..397749
FT                   /transl_table=11
FT                   /locus_tag="XALC_0355"
FT                   /product="putative competence protein
FT                   (amidophosphoribosyltransferases)"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14896"
FT                   /db_xref="GOA:D2UAS0"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2UAS0"
FT                   /protein_id="CBA14896.1"
FT                   /translation="MESPVNFAIANRVDGCWRWLQRRLLPERCLVCTEPGAPGLDLCPA
FT                   CCDALPWNAHACRHCALPLPGLDADQLCGACQRCPPPLHLVVSACVYAAPVDGLLRRFK
FT                   FHQDLVAGRLLAALLQARCAALPRPQALLPIPLHTARLRERGYDQALELARPLARALDV
FT                   PVCHGLQRVRATVAQSELDARARRRNLRGAFAVPDPAVLPAHVALIDDVMTTGATLHAA
FT                   AQALRRAGVTRVDAWVVARVP"
FT   gene            complement(397898..398800)
FT                   /gene="ubiA"
FT                   /locus_tag="XALC_0356"
FT   CDS_pept        complement(397898..398800)
FT                   /transl_table=11
FT                   /gene="ubiA"
FT                   /locus_tag="XALC_0356"
FT                   /product="probable 4-hydroxybenzoate octaprenyltransferase
FT                   ubia protein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14897"
FT                   /db_xref="GOA:D2UB14"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB14"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14897.1"
FT                   /translation="MSYERYEMPGAPPALPRIGQYWKLLRGDRPIGALLLLWPTWWALW
FT                   LAADGVPPLWTLCVFTAGVWLTRSAGCVINDYADRWLDPHVERTRNRPLATGAVSGREA
FT                   LGVFALLMLAAFALVLTMNRLTIGLSVVGLFLAASYPYLKRYTYLPQVYLGMAFGWGIP
FT                   MAFAAVRGEVPALGWLLYATNILWSTAYDTWYAMVDREDDLRAGSKSTAILFGKLDLLI
FT                   QGILYTLMFVALVCVGQRAALGICYWAALGVAALLVASEFFIARHRERAACFRVFLHNN
FT                   WVGLTIFVGIAVALALRAR"
FT   tRNA            399001..399077
FT                   /gene="tRNA-tRNA-Arg"
FT                   /product="transfer RNA-typeArg,AnticodonCCG"
FT   gene            399421..400248
FT                   /locus_tag="XALC_0358"
FT   CDS_pept        399421..400248
FT                   /transl_table=11
FT                   /locus_tag="XALC_0358"
FT                   /product="hypothetical hydrolase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14898"
FT                   /db_xref="GOA:D2UB15"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB15"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14898.1"
FT                   /translation="MTRLRSPLSKPAVRLLGADDALAYLRVGDGAPVVLVHGALCDYRY
FT                   WMPQLRGLADRFQLSAVSLGQYYPRLRSASRHVFGWRWHAQQVAAFIASEARPVHLVGH
FT                   SRGAAVAWQVALQQPAAVASLSLFDPGGPQSHGLSAEVLAVRARAVALLQDGQLEAGLE
FT                   CFVDSVSQPGAWARSSTTFRQMVRDNAQTLLPQIDDALPAYRPEQAASLALPVLLVTGE
FT                   HSPVQYRDNAAALAQWLPDPRLHLLAGASHGMTFTHARRCNALLAEMVRAISG"
FT   gene            complement(400322..401878)
FT                   /locus_tag="XALC_0359"
FT   CDS_pept        complement(400322..401878)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0359"
FT                   /product="hypothetical competence related protein"
FT                   /function="cell processes go:0009987; cell division
FT                   go:0000910"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14899"
FT                   /db_xref="GOA:D2UB16"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB16"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14899.1"
FT                   /translation="MSLALVHSRARAGVLAPPVRVEVHLSGGLPATQIVGLPEAAVRES
FT                   RDRVRAAILCAQYAFPARRITVNLAPADLPKEGGRFDLPIALGILAAAGQLDPQAMEQY
FT                   EFLGELALTGELRPVDGVLAAALAAAHAGRTLIVPADNGAEAALAQHVRAFTARTLLEV
FT                   CGLLNGSKTLPVAEALPAAALPFPDLSDVRGQAQARRALEIAAAGHHHLLLIGSPGCGK
FT                   TLLASRLPGILPEASEAEALESAAIASVSGRGLDPARWRQRPYRSPHHTASAVSLVGGG
FT                   THPRPGEISLAHNGVLFLDELPEWNRHALEVLREPLESGQVTVSRAARSAEFPARFQLV
FT                   AAMNPYPCGWAGDPSGRCRCNEDSIRRYRARISGPLLDRIDLHVEVPRLPPQALRADAT
FT                   TSEPSVAVRARVEQARQRQLMRAARPNGQLDHYQTMRDCRLQPHDEALLEHAIDRLRLS
FT                   ARSLHRILRVARTIADLDGSDAIATPHLTEAIAYRQLDRGEAITPGAESTPRGALRRNP
FT                   E"
FT   gene            complement(401891..402160)
FT                   /locus_tag="XALC_0360"
FT   CDS_pept        complement(401891..402160)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0360"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14900"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB17"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14900.1"
FT                   /translation="MIDLNHLDDLARRLSDLVPPGLRQSRDELQNTFKSALQAGLSKLD
FT                   LVTREEFEVQRAVLLRTREKLEALERTVAALEAAHSAQTPPSNT"
FT   gene            402336..402674
FT                   /gene="glnB2"
FT                   /locus_tag="XALC_0361"
FT   CDS_pept        402336..402674
FT                   /transl_table=11
FT                   /gene="glnB2"
FT                   /locus_tag="XALC_0361"
FT                   /product="probable nitrogen regulatory protein p-II"
FT                   /function="metabolism go:0008152; nitrogen metabolism
FT                   go:0006807"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14901"
FT                   /db_xref="GOA:D2UB18"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB18"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14901.1"
FT                   /translation="MKMVMAVIKPFKLDDVREALGAQGVSGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKLEVAVTDGRVEPVVEAIVKAACSGKIGDGKVFVYDMGAVVRIRT
FT                   GELDADAL"
FT   gene            complement(402713..403564)
FT                   /gene="speE"
FT                   /locus_tag="XALC_0362"
FT   CDS_pept        complement(402713..403564)
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="XALC_0362"
FT                   /product="probable spermidine synthase protein"
FT                   /function="metabolism go:0008152; polyamine biosynthesis
FT                   go:0006596"
FT                   /EC_number="2.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14902"
FT                   /db_xref="GOA:D2UB19"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030373"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB19"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14902.1"
FT                   /translation="MSANDTWYIEHFQPTGSAIGYRITGKLDEVQSPFQKIEIYDTTDW
FT                   GKLMVIDGAVMLTTRDNFFYHEMISHPALFTHPAPKRVVIIGGGDCGTLREVLKHPGVE
FT                   RATQCDIDEHVTRMAEKYFPELCESNSDPRAELLFDDGIAYMANCPTGSVDIVIVDSTD
FT                   PVGPAEGLFNKAFYASCFKALKDDGILVQQSESPLALLDLIKEMRAEMGKAGFTSFHTV
FT                   PFPQPCYPTGWWSVTMARKQGGFDFRQHDAATKPFATRYYSAHLHTGTQVLPPFVAEAL
FT                   SV"
FT   gene            403803..405692
FT                   /gene="speA"
FT                   /locus_tag="XALC_0363"
FT   CDS_pept        403803..405692
FT                   /transl_table=11
FT                   /gene="speA"
FT                   /locus_tag="XALC_0363"
FT                   /product="probable arginine decarboxylase protein"
FT                   /function="metabolism go:0008152; polyamine biosynthesis
FT                   go:0006596"
FT                   /EC_number="4.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14903"
FT                   /db_xref="GOA:D2UB20"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002985"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR040634"
FT                   /db_xref="InterPro:IPR041128"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB20"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14903.1"
FT                   /translation="MSDWSLDQARKTYSIPHWADGYFDVDTAGRVVVRPQGADGVTIAL
FT                   PDVVDAARAAGAKLPMLVRFPDILGERLGKLQAAFAQAQADWDYVGGYTAVYPIKVNQH
FT                   RGVAGTLASHQGEGFGLEAGSKPELMAVLALSRPGGLIVCNGYKDREYIRLALIGRKLG
FT                   LQTFIVIEKPSELKLVLDEARVLDVRPGLGVRMRLASLGAGKWQNSGGDKAKFGLAPRQ
FT                   LLDLWKTLRDTEYADALNLLHFHMGSQISNVRDIANGMREATRYFVELSKLGAKISHVD
FT                   VGGGLGIDYEGTRSRSECSINYGLHAYASNIVQPLASACEEHGLAPPRIVTECGRAMTA
FT                   HHAVLVANVSEVEQAPEGRVPDVHDDEPAAIRHMREIHAELDQRPAVELFQEAQHFHAE
FT                   GLSAYALGQIDLAQRARIDDLFYAIAHGVRARLSSQEKSHRPILDELNERLVDKYFVNF
FT                   SVFESIPDVWAIDQVFPIVPIERLDEAPQRRGIIADMTCDSDGMVKTYVENESLDSSLP
FT                   LHALKQGESYRLGFFLVGAYQEILGDIHNLFGDTDAVEVAVEGTGYRIVQQRRGDTTDV
FT                   MLDYVGYRLDTLRAAYAERIEAAQLPDACAQELRDALEAGLTGYTYLSDAPLV"
FT   gene            406261..410310
FT                   /locus_tag="XALC_0364"
FT   CDS_pept        406261..410310
FT                   /transl_table=11
FT                   /locus_tag="XALC_0364"
FT                   /product="probable non-ribosomal peptide synthetase
FT                   protein"
FT                   /function="information transfer; non-ribosomal peptide
FT                   synthetase go:0019184"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14904"
FT                   /db_xref="GOA:D2UB21"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020802"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB21"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14904.1"
FT                   /translation="MHADTPSSFPLTRAQRGLWVGSKLQVDKMLMLSEALELFGPLDPT
FT                   LLLQANRQITREFDVLRLCIHEQNGLPEQIVLPEYPGELQYLDFSDEPAPRAAAERWVG
FT                   DQLGKRENLRDGPLWFCVVFRLGQDHHLWVQYTSHLVMDGFTGTMLAQRLASLYNAYAF
FT                   GQEPEPAAYGSVLELVTLEQEYRASDRYRRDREYWMQQLSNLPPAVTLAKPGEQNSAGL
FT                   LRATGEFSPETVLRLRALGAAHGASLPQTLIALVAAYYHRYTGAEDLVMAMPVTGRVGA
FT                   RYRQVPGLAANAIYLRLTMRPNQPFHALFPHVSSVVRHGLRHQQYRVEDVRRDLGMFAN
FT                   MQRIARLAVNIEAFDYGLRFGEAQAVPHNLCNGLADDLTIFCYERGNGMALRFDLDANP
FT                   ALYDREELAEHCRRLSLLADAILDAPERPLALLDILGTQERCRLLWECNATAMPLPIMA
FT                   TLPHQLLERYASMPAGIVVQCDERTLDDAQVCELAARIAARWIADGIKPGDVIAVALPR
FT                   SEQLLLVLLAVMWSGAAYLPLDPDGPLVRNRHMLDDAAAIGLVCEPVLRDTLLLDGMVW
FT                   LDPCPADLPAPIAPLATPEGTAYVLYTSGSTGIPKGVEISHRSLLNFLFAMRHDLGLRP
FT                   RDRMLAVTTVTFDIAGLELYLPLLVGARVVIAQGAITHDPRGLARLIAQAQVSVIQATP
FT                   SLWRILLANDDLPLDKVHALVGGEALGAELATRLLARVGRLTQLYGPTESTIWSTIMPL
FT                   QLTDAPHPPIGRPIANTRVYVLDPQQQLLPTGAVGELYIGGAGVAKGYRGKPQLTSERF
FT                   VCDPFVGDGSRMYRTGDQVRLRPDGVLEFIGRIDDQLKIRGHRIEPREIENALQQHPQV
FT                   AQAVVVGHRDHDGTMQLLAYVVALPEQSVEVDALRQYLQACLPSAMLPSRWMSLPALPL
FT                   TATGKLDRKALPVPDAPPPREHVPPRDPIEQQLAAMVEDILGINGIGVHDSFFELGVDS
FT                   LGAAQMAARFPQMFGIELPLVTLLNEPTIAGVAEVIRRNAQLHSDPLASALTLREGEVG
FT                   TPALFCIHPVMGMSWSYATLLSQLDPRWPVVLLQSPGLADSSYRPDSIEAIAHDYLARM
FT                   RSVQPHGPYRLVGWSLGGLIAHAIAAELRAAGELVELLALLDSYPLPPQDAQADDMISI
FT                   PAALRVLDVELAPGTPLPTTMAELAKVLCDHYGLLSFPLARQLLEQQHDLVLNIGELIQ
FT                   HHLHLACHHRPSAIDVDVLFVEATRRPDIGMDATDLIDHRPQVWQELVRSLRVEAFDTD
FT                   HYGILSLAHVGRLAKLLQASVALPTRGSVLDSGSTPTPTPTPTPTPTPTPTPTPTPTSD
FT                   GVAEYA"
FT   gene            410303..411631
FT                   /locus_tag="XALC_0365"
FT   CDS_pept        410303..411631
FT                   /transl_table=11
FT                   /locus_tag="XALC_0365"
FT                   /product="putative glucosyltransferase protein"
FT                   /function="metabolism go:0008152; carbon compound
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14905"
FT                   /db_xref="GOA:D2UB22"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB22"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14905.1"
FT                   /translation="MLEHRLSGEQNAGSEDRPIVIATLGTHGDVRPVIALGRGLQQRGH
FT                   PVRVLTSENFAPLVKANGLAFFPLTGDHQRMLQVNPIRAGQSMWANCRMFRHHIASWAR
FT                   DWPSQGRAACADARLLIGVGSASILVDSLSQALQIPLVYAQLQPLTVSRHLPLVARPQL
FT                   RLPGPLHVGLQHAMRFGGWQLLREVIDGSVRAPLGLPPYGWRGPDTSTIRVLYGYSEHL
FT                   CPRPSDWPARIQVCGFWSLPQLQWQPPAALLDFLDAGPPPLYVGFGSMIDADAARLTTT
FT                   VKAALRLTGQRALLATGWGGLIADQDVDSDQCFALEHAPHDWLFPRVIAAVHHGGAGTC
FT                   AAALTAGIPSVVVPFGYDQPFWAHCLAQRGVAPPALKRDGLQPEVLAHALRQATSPTMC
FT                   AAAQALGQRLREEDGVAKAVAQLEQWGLLRDAGIVRQHADVVC"
FT   gene            412087..412974
FT                   /locus_tag="XALC_0366"
FT   CDS_pept        412087..412974
FT                   /transl_table=11
FT                   /locus_tag="XALC_0366"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14906"
FT                   /db_xref="GOA:D2UB23"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB23"
FT                   /protein_id="CBA14906.1"
FT                   /translation="MKKFVVISAIILLAIGASIFLFIGEHKEKIDSKDNGDGYISKVRA
FT                   MDHSKINSSTNVDDMRSSSEVKSSKYYYLNFAKIKSEAENGSSTAQKELAHIYSFCMFY
FT                   SIRPEVQLATIDDLAKYAKGSTVGLRNVKERLKRRCDNVDGGQPIPYVAYSLWLKEAAR
FT                   RGNVAAKIELRVQSAAPLSVNEASDLADIVRKSHDPEAMYQLSNLMAVPMSEDIPEKYS
FT                   GLMGSALAGHAWAVAACQSGLDCESGSMIMDSVCITTGLCDYENYEQFIRAQAIVPADQ
FT                   AKLDEDIRKIKTLR"
FT   gene            413159..414274
FT                   /locus_tag="XALC_0367"
FT   CDS_pept        413159..414274
FT                   /transl_table=11
FT                   /locus_tag="XALC_0367"
FT                   /product="hypothetical acyltransferase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14907"
FT                   /db_xref="GOA:D2UB24"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB24"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14907.1"
FT                   /translation="MRYPALDLLRGIAIVWVMLFHSFVVGGLGPDWSWLSRDGWMGVDL
FT                   FFVLSGFLIGCQVLAPLARGEPLRYGDFYRRRAYRVLPAYALVLALYLAWPGFREAPGI
FT                   APWWMFATFTLNLGIDYANQLAFSHAWSLCVEEHFYLLFPLLAAWMLRRPSVSRFVALC
FT                   GSLVLAGIALRTTIWLHDHALERVGVGLQRNWFIEDLYYPTWNRLDALLAGVILAVLKT
FT                   FRPQYWQRLQRHATAATLAGVALCGLAIWLFRDRTGLLGNAIGWPVLSLGLALLVSAGA
FT                   CLDGPLGRCRVPGAAWLAAVSYSLYLSHKAVFHLTHAWIGPVLEGRGLLAFAVYAGMAL
FT                   LAGAALHYAVERPFLRLRDRRCVRSHALAGS"
FT   gene            complement(414306..416420)
FT                   /locus_tag="XALC_0368"
FT   CDS_pept        complement(414306..416420)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0368"
FT                   /product="putative tonb-dependent outer membrane receptor
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; the outer
FT                   membrane receptor (omr) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14908"
FT                   /db_xref="GOA:D2UBC8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC8"
FT                   /protein_id="CBA14908.1"
FT                   /translation="MLAPRNVKLIDQPNAHTLRRLAPSRMVLAVLTAFAAGDGAAQNLT
FT                   SDRTTTLGTVEAQQQIAASPSIRNILSSVDVLGSEQIGDKNVMNSWELLGQMPGVQLTQ
FT                   TGQGAESGRATFRAFNGEGYINAIKLLIDGVPSNVNSGTQRFLDMIFPLEIAYIEAVRG
FT                   TNDPRYGLHNIGGNVNIATRQGGDYRDLRLSVGSFATRELQFALGHESDGLAQNYFIGA
FT                   QAAHGNREHDTSRKYTLGGKWFYGEDDDSARIGLIARIYHHEADEPGFLTATQMAEDRT
FT                   QSPPKNANDGDNRDMRQASIHADFRLDEGLHLRNTLYFNRYEDERLVTFTNYPLGNAPR
FT                   QRRQWNESQIGLLSTVTWQANDVLSVESGFNAEHQDNRYQRYRYAYAVPTNFWSTPARV
FT                   QNDDRYTLDNLGLYLQAVIQPTDALKIVPAFRADRFSGDTALPGGVHAPLQPYGWIDQP
FT                   KLSVIYALTPRLSVYANWGQTFQVLTGSTAPAYLTPGQQALEPSINTGKELGLKLQPIA
FT                   GTEARLALWRQDATNEVANNVSSGTTVGLGHTRRQGVDLQLSTQLGEHWTAWLSHAVQE
FT                   AKVVTAYTATGVSLHGREVFSTPRYISTAGLDYRPDARWKFGLQAHAQGNYYIDALNAH
FT                   GKYGGFTVVDASVRYQLSARSSIDLQIKNLTDDRYAYVWYDNFFWGGNDQPMFSPAPGR
FT                   SAYLGFELRL"
FT   gene            complement(416948..417703)
FT                   /locus_tag="XALC_0369"
FT   CDS_pept        complement(416948..417703)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0369"
FT                   /product="hypothetical short-chain dehydrogenase/reductase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14909"
FT                   /db_xref="GOA:D2UBC9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBC9"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14909.1"
FT                   /translation="MTQTALITGATSGFGAAAVQRFAAAGWRVIATGRRAERLQPLLEA
FT                   FGPERVHIAAFDIRDTGALDAMLAALPDAFRNIDLLVNNAGLAQGTAPAQAADLDDWRT
FT                   MIDTNITALVTLTHRMLPTLIKRRGAIINISSVAALYPYPGGNAYGGTKAFVSQFSLGL
FT                   RSDLHGSGVRVTAIEPGMAETEFTLVRTHGDQNASDTLYQGAQPMTAEDIAEQIFWVAT
FT                   LPPHLNINRLEIMPVTQSFAGFQVARQPR"
FT   gene            complement(417879..418706)
FT                   /locus_tag="XALC_0370"
FT   CDS_pept        complement(417879..418706)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0370"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14910"
FT                   /db_xref="GOA:D2UBD0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14910.1"
FT                   /translation="MAARRGKTQARRNSNNGTPGWVWLIAGAAIAAVVFLGAPGLFKKG
FT                   GDSFLRIGGPHANPDAQPAQVADADIDAAPELSKPATTTAGNAKTDAKKNAQTQYDFYT
FT                   LLPGKEVQMSDAELAASARAEAARQAKLAPPPTTTATVPGATATTTTPAITSPTPLPET
FT                   PSTTAGTVAPPAASPKPIATTPASAASSASAPRPDTAHYILQAGSFGASGDAESTKAKL
FT                   AMLGLSARVESAQISGKTVYRVRMGPYGTASELAEAKQKLNGSGLSAIAIKAQ"
FT   gene            complement(418725..420413)
FT                   /gene="argS"
FT                   /locus_tag="XALC_0371"
FT   CDS_pept        complement(418725..420413)
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="XALC_0371"
FT                   /product="probable arginyl-trna synthetase (arginine--trna
FT                   ligase) protein"
FT                   /function="information transfer; amino acid-activation
FT                   go:0006418"
FT                   /EC_number="6.1.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14911"
FT                   /db_xref="GOA:D2UBD1"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14911.1"
FT                   /translation="MKSQLRALIAQGIEALRATGILPTDTLPPDFVVERPKTREHGDFA
FT                   SNAAMLLAKAARTNPRALAQQLVDALPANDDIRKVEIAGPGFINFHLGPGAYQREVLTV
FT                   LKQGHDYGRSLVGNGRTVGVEYVSANPTGPLHVGHGRAAAIGDCLARLLEANGWNARRE
FT                   FYYNDGGGQIENLARSVQARAHGKTPDSHDWPEEGYRGDYIQDVADAYMTGATVNLEGH
FT                   LVKGAKDPNDLEAIRRFAVAYLRNEQNHDLAAFGVDFDIYFLESSLYRDGKVEEAVQKL
FT                   IASGHTYEEGGALWLKSTDFGDDKDRVMRKSDGTYTYFVPDVAYHLSKWQRGYVRAITE
FT                   LGADHHGSLARVRAGLQAMDLGIPKGWPEYVLHQMVTVMRGGEEVKLSKRAGSYLTLRD
FT                   LIEEAGRDATRWFLIARKPDSQLTFDIDLARQQSNDNPVFYVQYAHARVCSLLRQAQEK
FT                   QRDYDPADGMSQLNRLNDTTSLELMMELSRYPEVVENAGHVLEPHLIAQYLRELATAFH
FT                   TWYHGTPVLVDDASERNAKLALAVAAQQVLANGLNLLGVCAPEKM"
FT   gene            complement(420553..421227)
FT                   /gene="radC"
FT                   /locus_tag="XALC_0372"
FT   CDS_pept        complement(420553..421227)
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="XALC_0372"
FT                   /product="probable dna repair protein radc"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14912"
FT                   /db_xref="GOA:D2UBD2"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD2"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14912.1"
FT                   /translation="MHISNWPCDERPREKLLTRGPQALSDAELLAIFLGSGLRGRDAVQ
FT                   TSRDLLQQHGPLRTLLDRPPNELLRLPGLGPARVCRLSAAMELGQRHLAAELQRGDTLN
FT                   DPSVVGRYFSQRLRARPYEVFAVLFLDTRHRWLAFEELFQGTVDWTEVHPREVVRRALT
FT                   LNAAAIIIGHNHPSGNPEPSSADFAVTERLRKALDLIDVRLLDHFIIGDGMPISLASRG
FT                   WI"
FT   gene            421324..422610
FT                   /gene="coaBC"
FT                   /locus_tag="XALC_0373"
FT   CDS_pept        421324..422610
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="XALC_0373"
FT                   /product="probable coenzyme a biosynthesis bifunctional
FT                   protein coabc (dna/pantothenate metabolism flavoprotein)"
FT                   /function="metabolism go:0008152; coenzyme a go:0015937"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14913"
FT                   /db_xref="GOA:D2UBD3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD3"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14913.1"
FT                   /translation="MTATSERPLQGRRVLLCVGGGIAAYKALELVRRLRDVGAEVQVAM
FT                   TAGAQQFVTALSFQALSGHITRTTLWDSSAEQAMGHLELARWAQQVVVAPATADLLARL
FT                   AHGLADDLVGTLCLASTAPLTVCPAMNHRMWLHPATQANVATLRQRGAHVVGPNDGPLA
FT                   EGESGPGRLAEPQQIVAALAGIGNAAAQPATPLEAIVPARSATPSTTSRDGALRGLRLL
FT                   ISAGPTYEDLDPVRYLGNRSSGKMGYALAAAAVRRGAQVVLVSGPVQLPTPDGVQRIDV
FT                   RSAVQMRQAVLGALPADIYIGTAAVADYTPKQVLTEKIKKNRDTLILELIRTPDILAEV
FT                   AAQTQALKLVVGFAAETHDIERYARGKLADKHLDLIIANQVGVVGNGFESDQNAATAYW
FT                   QHGARSFPAVVKTQLAEQLLDLIAERLHA"
FT   gene            422607..423077
FT                   /gene="dut"
FT                   /locus_tag="XALC_0374"
FT   CDS_pept        422607..423077
FT                   /transl_table=11
FT                   /gene="dut"
FT                   /locus_tag="XALC_0374"
FT                   /product="probable deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase (dutp pyrophosphatase) protein"
FT                   /function="metabolism go:0008152;
FT                   2'-deoxyribonucleotide/ribonucleoside metabolism
FT                   go:0009265"
FT                   /EC_number="3.6.1.23"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14914"
FT                   /db_xref="GOA:D2UBD4"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14914.1"
FT                   /translation="MSIPTPVPLQVKLLDPRFGDSWPLPDYATEASAGLDLRAATEAPL
FT                   TLDPGDTALIPSGLSIYIADPQLCAVVLPRSGLGHRHGIVLGNGTGLIDADYQGPLLIS
FT                   VWNRSREAFTIAPGDRIAQLVVMPVVRVALQVVDTFADSARGTGGFGHTGVR"
FT   gene            423151..425460
FT                   /locus_tag="XALC_0375"
FT   CDS_pept        423151..425460
FT                   /transl_table=11
FT                   /locus_tag="XALC_0375"
FT                   /product="putative phosphomannomutase/phosphoglucomutase
FT                   protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="5.4.2.8"
FT                   /EC_number="5.4.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14915"
FT                   /db_xref="GOA:D2UBD5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14915.1"
FT                   /translation="MLTVLLFLLAGWFGWSAVRQWRAEQVTMTLERARDASVVRTTQVL
FT                   EGAGKRLSECLQQPAVQTALARGDAAAVVQALRGDWKQVEDAQLLPVDLESGYADPPRF
FT                   GYGRLALLEKAVLTGKVASGVVHDGGGVQLGLAAPVSLGERASVVYLRLPLGLLTDPVA
FT                   QVTVPDSGYLALRQGSYDVIAAGNSALSNRADALSRPLGDTGLRMVAALPDTEAGPFGL
FT                   GAWPCLLVAVLLVVLRILLALAPRGYLSPRAGRAVAVTEEQTLQQSLQNQESLPPLPPS
FT                   PPSPPSPPLSRSPAELTPAMPVPASAVTADIFRAYDIRGVVGRDLNPQVAALIGQAIGT
FT                   MMQEQGLNEVVVGRDGRLSGPELAAALIDGLRRAGCAVIDIGVAPTPVVYFASYHLRAG
FT                   SCVAVTGSHNPADYNGFKIVIGGQTLSGAAIAELHACICEGRLSTAAEPGRLQQRDVGR
FT                   DYVQRIADDVQLDRPLKVVVDAGNGVGGELGPRLLEAIGAEVIPLYCDVDGTFPNHHPD
FT                   PSDPHNLEDLVQTVRRFDADLGVAFDGDADRLGVVTHDGKVIYPDRLLMLFAADVLQRN
FT                   PGALVIYDVKCTGKLSDYVLRNGGSPLMWKTGHSLIKAKMRETDAELAGEMSGHFFFKE
FT                   RWYGFDDGLYAAARLLEILAQREESPSEVLAELPESIATPEIKVPLDGQDGHALIAQLA
FT                   IQAQQEGSPFAGARLLTLDGVRADFPDGWGLVRASNTTPALVLRFEADNATALERVKAL
FT                   FRAQLQTALPTAMLGF"
FT   gene            complement(425510..426196)
FT                   /locus_tag="XALC_0376"
FT   CDS_pept        complement(425510..426196)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0376"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14916"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD6"
FT                   /protein_id="CBA14916.1"
FT                   /translation="MTPIHSPWSCAVPALLIILALPASAQQQQQAHAKKLYCWNQNGQR
FT                   MCSDALPPEAVNQARDEFNATSGMRSAEVGRALSSEERAAAAADAAQQRANQAALETRK
FT                   RTDQAMLLSFQTEDELRRVFSERADIVDNNIQTSRYNVDSLRQGLVEVLANAGAQELAG
FT                   QKVANNLAEDVQRRHHALVQQMRIQKDLEQQRLSLDEEIKDTVQRYRAAKGNGPQAEPA
FT                   TTLSGG"
FT   gene            complement(426222..426872)
FT                   /gene="pyrE"
FT                   /locus_tag="XALC_0377"
FT   CDS_pept        complement(426222..426872)
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="XALC_0377"
FT                   /product="probable orotate phosphoribosyltransferase
FT                   protein"
FT                   /function="metabolism go:0008152; pyrimidine biosynthesis
FT                   go:0006221"
FT                   /EC_number="2.4.2.10"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14917"
FT                   /db_xref="GOA:D2UBD7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14917.1"
FT                   /translation="MTDYRQRFLQLALDAEALRFGEFTLKSGRLSPYFFNAGRFDSGAT
FT                   MAQLATCYADAADAAGLDFDLLFGPAYKGIPLATALACEYARRGRDLALAFNRKEAKIH
FT                   GEGGSLIGAPLAGRRVLIVDDVITAGTAIRDALGIIRAAGGTPAAILVALDRQEIATEQ
FT                   DHRSAAQAVAAESGISVVSVAHLGDLLAFIEGNADLAGFHASLLAYRARYGCD"
FT   gene            426988..427788
FT                   /locus_tag="XALC_0378"
FT   CDS_pept        426988..427788
FT                   /transl_table=11
FT                   /locus_tag="XALC_0378"
FT                   /product="probable exodeoxyribonuclease III protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="3.1.11.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14918"
FT                   /db_xref="GOA:D2UBD8"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14918.1"
FT                   /translation="MRIVSFNANGLRSAATKGFFEWFAGQQTDVLCVQETKAQAPQLAG
FT                   PAFLPEGYRVWFRDASTKKGYSGVAIYSKREPDEVRTALGWPEFDEEGRYLEVRFGQLS
FT                   VVSFYIPSGSSGEVRQGYKFQVMDWLRPILVQWLHNGRDYVLCGDWNIVRSALDIKNWK
FT                   SNQKNSGCLPAERDWLNGLCADRAEDADAASGRGWVDAYRALHPDGQDYTWWSNRGAAR
FT                   ANDVGWRIDYQFVTPSLRERLHGCAIYTEQRFSDHAPFTVDYRT"
FT   gene            427785..429149
FT                   /locus_tag="XALC_0379"
FT   CDS_pept        427785..429149
FT                   /transl_table=11
FT                   /locus_tag="XALC_0379"
FT                   /product="putative major facilitator superfamily mfs
FT                   protein"
FT                   /function="the major facilitator superfamily (mfs)"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14919"
FT                   /db_xref="GOA:D2UBD9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBD9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14919.1"
FT                   /translation="MIGGLGTWWRSLDVYANPRVRAMLFLGFSSGLPFALVLTTLSARL
FT                   RQAGIDRTTIGYFSLVGLMYSLKYFWSPIVDRLPLPVLSRMGRRRSWMLLAQVCIVAGL
FT                   VALALVDPAFNTQEFALLAVLTAFAASTQDIVVDAYRIEAAQTDAQGAMAAAYQTGYQV
FT                   ALICAGAGALTVAAQLGWKASYLSMAACGLLGLVTTLCIAEPMANNRGPVRSVEPLVEA
FT                   FQLRAQHWPAWIRAMVAWCIGAVVCPFVDFFVRMGWKAGIPALALVVAYRLNYVTMGVA
FT                   ANTFYLDMGFTLEQIALVSKVYGILMTIGGAFLAGLLIRRYGIARTLLIGLLLLSGANL
FT                   IYAYIASIHPGIAWLAAAISADNVANGIAGTAFIAYMSSLTSPHYTATQYALFGTLWSL
FT                   PAKSIASQWGRIVDVWGYPPFFIYTAAIGIVALPMVIWLIWRESRSNGDMRASTH"
FT   gene            429309..429536
FT                   /locus_tag="XALC_0380"
FT   CDS_pept        429309..429536
FT                   /transl_table=11
FT                   /locus_tag="XALC_0380"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14920"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB25"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14920.1"
FT                   /translation="MTDLLLRDIDPLMLERIGHIAVARGLTQHQTVLALIEQGLFASEQ
FT                   DLRKGFKSVELDALSEAITALRALPPGVRL"
FT   gene            complement(429558..430685)
FT                   /locus_tag="XALC_0381"
FT   CDS_pept        complement(429558..430685)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0381"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14921"
FT                   /db_xref="GOA:D2UB26"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB26"
FT                   /protein_id="CBA14921.1"
FT                   /translation="MSNSNVPDAHLFLGLMSGTSADGIDAALVRFNAAGRAQLCLGRTY
FT                   AWAPRQRAALIALGEGGNITSLDALGQLDAEVAIAFADATRRLLDEAGVAPATVRAIGS
FT                   HGQTVRHRPLADPAFTWQLGDGNRIAELTGIATVCDFRRRDVAAGGHGAPLMPAFHAAM
FT                   LGTTHEDRAVLNLGGIGNLTLLPAHGQVRGFDTGPANALLDAWCQRHLDQPYDAGGVFA
FT                   ASGQIDADLLQRLLGDPWFALAPPKSTGREHFHLRWLEAHLDTTALMPAAVQATLLELT
FT                   ATTIADALLAQQPATQQLLVCGGGVHNPLLLARLQAHMPGMEVASTQSLGLDPDYVEAM
FT                   GFAWLARQTLAGLPGNLPSVSGARGPRILGAIHPA"
FT   gene            complement(430784..432235)
FT                   /locus_tag="XALC_0382"
FT   CDS_pept        complement(430784..432235)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0382"
FT                   /product="hypothetical membrane-bound metalloendopeptidase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14922"
FT                   /db_xref="GOA:D2UB27"
FT                   /db_xref="InterPro:IPR007340"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB27"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14922.1"
FT                   /translation="MHNRDQERMRRQRFKQRLHVLHGTVLHRKLKEHLPNGRWTRRHWI
FT                   HASLFATIGALVATIVPGFSNAINVPLQTTHATLALPLPPISLAQQQQRASDDNWQVVR
FT                   IQSGQTLGAVFEQLGIPATVMQRVLEHPGSRDALTKLRPGAELAFNLPEAGNLRGIRFD
FT                   RDATHRMELSLRGDDIQEKVTERETSTHSVVSSGEITSSLYVAARKAGLSPSAIATMTD
FT                   EIFKYDIDFDKDLQPGDRFSVVMDETWREGERIDSGKILAATFTTRGKTYTGFRFERDG
FT                   KPAEYFDVNGRPLKKSFIRMPVSYSRISSTFGERLHPVLGTMRMHKGIDYAAPMGTPIM
FT                   AAGDARVQFVGTQHGYGNMVILDHGKGYSTVYGHMSRFGSIKMGQHINQGTVIGYVGMT
FT                   GMATGPHLHYEFRVDGVQRNPASVTMPPPTPLAGAELAAFRAQTSPALARIQRVEKLIY
FT                   ADAEPAKAKKKVMASAKPASSHDAG"
FT   gene            432405..433616
FT                   /gene="tyrS"
FT                   /locus_tag="XALC_0383"
FT   CDS_pept        432405..433616
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="XALC_0383"
FT                   /product="probable tyrosyl-trna synthetase protein"
FT                   /function="information transfer; amino acid-activation
FT                   go:0006418"
FT                   /EC_number="6.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14923"
FT                   /db_xref="GOA:D2UB28"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024108"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB28"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14923.1"
FT                   /translation="MSVIEESLALIGRGADEILKQEALEARLRSGRPLRVKAGFDPTAP
FT                   DLHIGHTVLLNKLRQFQQLGHQVIFLIGDFTGMIGDPTGKNATRKPLTREEVLANARTY
FT                   EEQVFKVLDRARTEVRFNSEWFGQMSAADMIRLAGQHTVARMLERDDFTKRYAAQQSIA
FT                   IHEFLYPLVQGYDSVALKADVELGGTDQKFNLLMGRGLQEHYGQPAQIVLTMPLLEGLD
FT                   GVNKMSKSLGNYIGINEPAIDIVTKTMKIGDDLMWRWIELLSFDIGLNEAQMLRQQVQA
FT                   GSLHPREVKLRLARELATRFHDAVAAEQAIIGWHAVVTGQGDTSVLPLQQLVVPADGVR
FT                   IAALLTAAGLTASNSEATRKLKERAVRVAGEVVEDPQHSFTPGFEGVLQVGKRTFARVQ
FT                   LVAG"
FT   rRNA            434235..435734
FT                   /gene="rRNA-rRNA-16S"
FT                   /product="ribosomal RNA-probable ribosomal RNA-16S
FT                   ribosomal RNA"
FT   tRNA            435841..435916
FT                   /gene="tRNA-tRNA-Ala"
FT                   /product="transfer RNA-typeAla,AnticodonTGC"
FT   tRNA            435931..436007
FT                   /gene="tRNA-tRNA_Ile"
FT                   /product="transfer RNA-typeIle,AnticodonGAT"
FT   rRNA            436230..439049
FT                   /gene="rRNA-rRNA-23S"
FT                   /product="ribosomal RNA-probable ribosomal RNA-23S
FT                   ribosomal RNA"
FT   rRNA            439267..439382
FT                   /gene="rRNA-rRNA-5S"
FT                   /product="ribosomal RNA-probable ribosomal RNA-5S ribosomal
FT                   RNA"
FT   gene            439871..440938
FT                   /locus_tag="XALC_0389"
FT   CDS_pept        439871..440938
FT                   /transl_table=11
FT                   /locus_tag="XALC_0389"
FT                   /product="putative zinc-containing alcohol dehydrogenase
FT                   superfamily protein"
FT                   /function="metabolism go:0008152; carbon compound
FT                   utilization"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14924"
FT                   /db_xref="GOA:D2UB29"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB29"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14924.1"
FT                   /translation="MSQANGYAALASDQPLIPYAFERRVVGAQDVRIEILYCGVCHSDL
FT                   HTARNEWHNTQYPSVPGHEIVGRVTAVGHQVDGFKVGDLAGVGCMVDSCRHCASCADGE
FT                   EQYCENGFVGTYNGPMFGGENTYGGYSDHIVVDQKYVLHIRHGAQHLAAVAPLLCAGIT
FT                   TYSPLNHWKVGPGKKVGIVGLGGLGHMGVKIAHAMGAHVVLFTTSAGKRDDARRLGADD
FT                   VVISKNAEEMAAHANSFDFILNTVAAPHDLDAFLNLLKRDGTMTLVGAPAESHPSPGVF
FT                   NLIMKRRQLAGSLIGGIRQTQEMLDFCAKHGIVSDIETIEMAQINEAYERMLRGDVKYR
FT                   FVIDMASLPKAKHAA"
FT   gene            complement(441237..441566)
FT                   /locus_tag="XALC_0390"
FT   CDS_pept        complement(441237..441566)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0390"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14925"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB30"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14925.1"
FT                   /translation="MLIEFGSYLDTRSPHVPYARVVLGCSGGIEAGRRASAAYAKRYHT
FT                   PANEYDSTLWKLDGVMEDLQAVYAIGTALGSSGIWPNWYPNNPFKASRDKMIKKSKPAA
FT                   SASGT"
FT   gene            complement(441605..442267)
FT                   /locus_tag="XALC_0391"
FT   CDS_pept        complement(441605..442267)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0391"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14926"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB31"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14926.1"
FT                   /translation="MKRMHPVILLAMALTAGSALAADDISKVNGNITAIAGKQYGNLDI
FT                   VNGNISVEHNAHVGNVETVNGDVRIADNAQTQSLSTVNGGINIGERAQIGGSIKTVNGS
FT                   IFVNSGGRVSGGIESVNGSIGVIAIQLDRGIETVNGDITVGHDAHLGGGITINKPSFSM
FT                   SFNPTRTPRVIVGPHAVIDGPLRFERKVTLYVHRSAKIGPISGATAQSFDTDTAPKN"
FT   gene            442465..443679
FT                   /locus_tag="XALC_0392"
FT   CDS_pept        442465..443679
FT                   /transl_table=11
FT                   /locus_tag="XALC_0392"
FT                   /product="putative peptidase protein"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14927"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB32"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14927.1"
FT                   /translation="MTAAVLLLAVGLVAAQNPRDAERRLEKVRGELKSVAEERHQLEGK
FT                   RGDAARQLRDADEKVAASGRSLAQTQQALRQHQQTLAELEHKRDALRASLTRQRAELAQ
FT                   WLRAAYAIGDNAPLKLLLAQDRVADANRLLTYHRYLQRERAQRIASLTHELQALEQVQR
FT                   DVAQQRQQLSEAQRRQQEQAAALQRDRKQRASVVSELDQRYQDRSEREKALGQDAKALE
FT                   TLLANLRAAAARAEAERRAAARRAAAEQAAQAKAGNNPHGGGKVPPKVVASAPPLKVGG
FT                   LGWPLSGDLLARYGGRLPDGRTSNGVLIAAPAGSTITAVADGTVVFSEWMTGYGMILIV
FT                   DHGNGYMSLYAHNDTLLRDAGDRVKRGDPVAKVGNSGGQGRPALYFELRHNGQPVDPAS
FT                   WLQRR"
FT   gene            443785..445257
FT                   /locus_tag="XALC_0393"
FT   CDS_pept        443785..445257
FT                   /transl_table=11
FT                   /locus_tag="XALC_0393"
FT                   /product="putative periplasmic carboxyl-terminal protease
FT                   precursor signal peptide protein"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14928"
FT                   /db_xref="GOA:D2UB33"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB33"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14928.1"
FT                   /translation="MRVVLSVALLLALAPLPLMAQHAATQTSTAPAASADDPDATESAA
FT                   SKVPLDEIRRYVAVYNAVKEAYVDPVDDKKLMQSAIRGLLLDLDPHSTYFSKEDAEAFD
FT                   EQTSGAYDGIGVELLQLPDNTLKVVSPIDDTPAARAGLRSGDIIIAIDGKPISAIKAME
FT                   PLRGQSGSKVVLTIERDKVNKPFDVTLTRQTIRVASVRSRMLEPGYGYIRISTFQADTG
FT                   ADFRKQLQQLLSKAGGKLRGLVLDLRSNPGGLLTAAVQVADDLLDKGTIVSTRGRISVS
FT                   DSKFDATPGDLLNGAPMVVLVDAGSASASEVLAGALRDNKRARIVGSRTFGKGSVQTVL
FT                   PLDNGDSVKLTTARYYTPSGKSIQASGIVPDVVLHPEGEAEDADKPAAIADYSEATLPG
FT                   HLRGDDEGAEGYSAGDPLPGDAPIAQALAELKQPGAVARAAAAKPLKSKSKPTAAPAHK
FT                   PGTPSTKSAPQTPAHGKTEPEKPEPVAPTPGS"
FT   gene            complement(445312..446295)
FT                   /gene="serA"
FT                   /locus_tag="XALC_0394"
FT   CDS_pept        complement(445312..446295)
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="XALC_0394"
FT                   /product="probable d-3-phosphoglycerate dehydrogenase
FT                   protein"
FT                   /function="metabolism go:0008152; serine go:0006564"
FT                   /EC_number="1.1.1.95"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14929"
FT                   /db_xref="GOA:D2UBE0"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14929.1"
FT                   /translation="MRILVVDDYQDAVRHLSCFHRLLGHRVQVLTAPSPDPDTLVRHAG
FT                   EAEALVLIRERTRIDTALLARLPSLRLISQTGRIGEHIDLAACTARGVAVAEGVGSPVA
FT                   PAELTWALLMAASRRLPAYRDALLTGRWQATGDAGLGRSLEGLTLGVWSYGKIGRRVAA
FT                   YGRAFGMRVQVWGGKDTCAHARADGFEIAASRAALFADSDVLSLHRRLVAATRHQIVLD
FT                   DLLRMKPDALLVNTSRAELLAPGVLLAALAAGHPGQAALDVFEQEPLLDPQHPLLRHPQ
FT                   VLATPHLGYVEQSSYELYFGAAFDNVLAFAAGAPQHLANPEVLTQG"
FT   gene            complement(446300..446641)
FT                   /locus_tag="XALC_0395"
FT   CDS_pept        complement(446300..446641)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0395"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14930"
FT                   /db_xref="InterPro:IPR014949"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14930.1"
FT                   /translation="MASYTAGMFKHLYKVTFLNHGKVYELYAQHVGSSHLWGFTEIGAL
FT                   LFDVHDGLVIDPTEERLREEFGNTKTLHLPMQSIVRIEQVEKKGPSAIREAATGEKVVT
FT                   PFPMPGKPR"
FT   gene            complement(446658..447335)
FT                   /locus_tag="XALC_0396"
FT   CDS_pept        complement(446658..447335)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0396"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14931"
FT                   /db_xref="GOA:D2UBE2"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE2"
FT                   /protein_id="CBA14931.1"
FT                   /translation="MFVSIPTRERTKLRWAAPLLLAAIWLAFLWSINLPNEARVTLWLD
FT                   WGALSTGVSPRDWLATLHDGSVLRLFTALFLHADWSHLLGNLVFLLIFGLPTERVLGPW
FT                   RFLLLFLSGGAISNLAAVFAIDTPDRVIIGASGAVSALIGTYLALFPRAKLGVVLPLGL
FT                   FLEFVRAPASLLIGTWVVLQVVFAYIGPAFGMVAWSAHLTGFAFGIGYGLYVRATPDKR
FT                   NAF"
FT   gene            447584..448924
FT                   /gene="fadL"
FT                   /locus_tag="XALC_0397"
FT   CDS_pept        447584..448924
FT                   /transl_table=11
FT                   /gene="fadL"
FT                   /locus_tag="XALC_0397"
FT                   /product="probable long-chain fatty acid outer membrane
FT                   transporter, fadl protein"
FT                   /function="metabolism go:0008152; fatty acids (fatty acid
FT                   oxidation) go:0019395"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14932"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14932.1"
FT                   /translation="MQNATQFVRFTALAVGIVGALTMGQAHGAAFQLKENSAKGLGRAF
FT                   AGAGSAPDDASIIAVNPAGMRQLDGSVFQADVSAIQFSAKYRGNGGTYANGAPISGGNG
FT                   GDAGMIAPVPAFYLHMPFGADNNMHFGTSLTVPFGFKTQYDRDWVGRYNGVKTELQTID
FT                   LNAAFSYDVNPYVSFGASVFAERLNIDLTNAIDFGTILASRRVPGFTPGSVDGFSRLKG
FT                   DNTAAGFTLGGLFSVDENTHIGFSYRSQVKHKITDGDVDFTVWGNVATVLAVAAPGTFV
FT                   DTKGRATVKLPASATASFTHNVNEQWTVMADVTRTAWKKFDKITVDFASNQPENTLLFS
FT                   YRDTTSVALGTEYRMSDTLTLRGGVAYDQTPTTDQHRDVRVPDQSRKWASLGLTWKPSQ
FT                   QVEYSVGYTHLFINDPRVATTSATGNTLVGHYDLNGNVLAGSVNYKF"
FT   gene            complement(449118..452312)
FT                   /gene="putA"
FT                   /locus_tag="XALC_0398"
FT   CDS_pept        complement(449118..452312)
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="XALC_0398"
FT                   /product="probable bifunctional protein puta [includes:
FT                   proline dehydrogenase and delta-1-pyrroline-5-carboxylate]"
FT                   /function="metabolism go:0008152; proline utilization
FT                   go:0006562"
FT                   /EC_number="1.5.99.8"
FT                   /EC_number="1.5.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14933"
FT                   /db_xref="GOA:D2UBE4"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE4"
FT                   /protein_id="CBA14933.1"
FT                   /translation="MPSALPSPLLAPELPPAAHALRAAITAAWLKDEAEHVRELLEQAR
FT                   LPTADQTKVQALAADLVTRVRARAQHQGAIEAFMRQYDLGSEEGVLLMCVAEALLRIPD
FT                   QDTADKLIRDKLGDADWKKHMGESDSILVNASTWGLMLTGKLVQINDLTRADVAGAFKR
FT                   LIGRVGEPVIRLAVRQAMKIMGHQFVMGRTIGEALARSKKGDNAHYRYSFDMLGEGALT
FT                   MRDAQRYLDAYRQAIHAIGTHFATQRQRDTGKEAVFAAPSISIKLSALYPRYEHAKRAR
FT                   VMAELAPGVLELAQLAKSYGIGYTVDAEEADRLELSLDIIAATFSDPSLDGWEGYGLAV
FT                   QAYQKRTPYTIDFLADLARRVGRRIPVRLVKGAYWDAEIKRAQVEGHSGYPVFTRKQNT
FT                   DVSYLACAKRLFAHSDALYPMFATHNAQTIAAVRAIANGRDYEHQKLHGMGDDLYAEVI
FT                   PADRLGVPCRVYAPVGSHEDLLPYLVRRLLENGANSSFVNRITDENVAIEELIRDPIEA
FT                   VSAFASIPHPKIPLPVDLLRSQHHNRKNSMGVNLANDNDLRALADQLNAALKPWHAVPL
FT                   VPGAVIASESLPVTNPADRREIVGRWQPADAASVEKALANAVNAQPTWNRTPAASRATI
FT                   LEHAADLLEARMPEFMALCVKEAGKTLPDGVAEVREAVDFLRYYAGQARAQFGAPERLP
FT                   GPTGESNELQLHGRGVFVCISPWNFPLAIFLGQVAAALAAGNSVIAKPAEQTNLVGHAA
FT                   VKLLHEAGVPEAVVQFLPGDGATVGAALTRDPRVAGVAFTGSTQTARAINRALAAREAA
FT                   IGVLIAETGGQNAFIADSSSLPEAVVKDAIASAFISAGQRCSAARVLFVQDDIADKVMT
FT                   MLAGAMAELKIGDPGLPSTDVGPVIDADALQLLTEHAARMNREARLIAVTATDDSTAHG
FT                   SFFAPRAYELQSLAQLQREVFGPVLHVIRWKADQLDAVIDQINATGYGLTLGVHSRIDE
FT                   TIERIAARVAVGNVYVNRNQIGAVVGVQPFGGQGLSGTGPKAGGPHYLLRFATEKVVTV
FT                   NTTAAGGNASLLTLGD"
FT   gene            452576..453052
FT                   /locus_tag="XALC_0399"
FT   CDS_pept        452576..453052
FT                   /transl_table=11
FT                   /locus_tag="XALC_0399"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14934"
FT                   /db_xref="GOA:D2UBE5"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14934.1"
FT                   /translation="MIEMFPFSPEGSGAQLRLRPPRALNARQFVLLFAALAGAMWAVAA
FT                   IGWLAGNVFAPVFALLHSMLVALALRWSWRVGEREEDIRVGPACVEVTRPNAGTPAFRA
FT                   HPHWVRLRIEGDDRVVLASSGKQVRVGEFLGPDERRELAQTLQGLLAAATGRNR"
FT   gene            453073..454065
FT                   /locus_tag="XALC_0400"
FT   CDS_pept        453073..454065
FT                   /transl_table=11
FT                   /locus_tag="XALC_0400"
FT                   /product="putative cytochrome c oxidase, subunit II
FT                   protein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14935"
FT                   /db_xref="GOA:D2UBE6"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14935.1"
FT                   /translation="MKQCGRWVQQAIKAGMALVAVVTAPLAWAQAADPKPWQLNMGRGV
FT                   TQSAHNAYAAHMLALWVCVVIGVLVFGAMAYALFTFRKSKGVVPAQFTHNTKAEIVWTV
FT                   IPVLILIVMAWPATAKLIAMYDTRDAEMTVKITGYQWMWRYEYLGENVSFTSRLARSSD
FT                   RMRQSGAVPTVEHDPHYLLDVDNRLVLPVNTKVRFLITADDVIHAWWVPALGWKQDAIP
FT                   GIVNEAWTSIDTPGVYRGQCAVLCGKDHGFMPIVVEAMNKQDFRKWLASRKPAPAAAAP
FT                   ASTPAPVAAPAAPAAVSAPDHAAAPTVPPQAQQSRPRPRPGSHVIVQTT"
FT   gene            454097..455707
FT                   /locus_tag="XALC_0401"
FT   CDS_pept        454097..455707
FT                   /transl_table=11
FT                   /locus_tag="XALC_0401"
FT                   /product="putative cytochrome c oxidase,
FT                   subunitItransmembrane protein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14936"
FT                   /db_xref="GOA:D2UBE7"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14936.1"
FT                   /translation="MAHSAVDHHDEHGHSQSFVARWFFSTNHKDIGTLYLLFSFTMFVI
FT                   GAAMSVVIRAELAQPGLQFVKPEFFNQMTTVHALVMIFGGVMPAFVGLANWMIPLQIGA
FT                   PDMALPRMNNWSFWLLPVAFTLLLLTLFLPGGAPAAGWAMYPPLMLQGGYNVAFSVFAI
FT                   HVAGISSIMGAINIIATVLNMRAPGIYLLKMPIFCWAWLITAFLLIAVMPVLAGAVTML
FT                   LTDKFFGTSFFNAAGGGDPVMYQHIFWFFGHPEVYIMILPAFGVISEIIPTFSRKPLFG
FT                   YQAMVYAIAAIAFLSFIVWAHHMFTVGMPLGGEIYFMFATMLISIPTGVKVFNWISTMW
FT                   RGAMSFESPMLWAVAFVILFTIGGFSGLMLAIVPADFQYHDTYFVVAHFHYVLVTGAVF
FT                   ALIAAVYYWWPKWTGRMYNESWAKFHFWWTMLFVNLLFFPQHFLGLAGMPRRIPDYNVV
FT                   FADWNLVSSIGAFGMFVTPFLMASILLASLRNGAHAQARVWEGARGLEWTVPSPAPAHT
FT                   FTLPPVLKPGDLAHDDIGH"
FT   gene            455707..455838
FT                   /locus_tag="XALC_0402"
FT   CDS_pept        455707..455838
FT                   /transl_table=11
FT                   /locus_tag="XALC_0402"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14937"
FT                   /db_xref="GOA:D2UBE8"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14937.1"
FT                   /translation="MTAQPPLDELVLRRKRAARTALVVGVVALAIYVGFILSGVLGR"
FT   gene            455835..456425
FT                   /locus_tag="XALC_0403"
FT   CDS_pept        455835..456425
FT                   /transl_table=11
FT                   /locus_tag="XALC_0403"
FT                   /product="putative cytochrome c oxidase assembly protein
FT                   ctag/cox11"
FT                   /function="the proton-translocating cytochrome oxidase
FT                   (cox) superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14938"
FT                   /db_xref="GOA:D2UBE9"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBE9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14938.1"
FT                   /translation="MNAPAPHVHSSAGLFKLVGVALAVFVLTFSLVPLYRIACEKVFGI
FT                   RLERGPGEGQQARAPLVDKRTVKVQFDGGVNSKLPWSFHPEQMTMEVIPGQLNQALYYA
FT                   RNESGRAIVGSAVPSVAPARASGYFTKTECFCFTAQTLQAGEQRDMPVRFIVDPNLPRD
FT                   ITTITLSYTFYKNDALSKELQSPRLAGSARAAL"
FT   gene            456447..457322
FT                   /locus_tag="XALC_0404"
FT   CDS_pept        456447..457322
FT                   /transl_table=11
FT                   /locus_tag="XALC_0404"
FT                   /product="putative cytochrome c oxidase, subunit III
FT                   transmembrane protein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14939"
FT                   /db_xref="GOA:D2UBF0"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14939.1"
FT                   /translation="MAQPSTDATAYYVPSQSRWPFIGSIAMFLTMIGVASWLNDAAWGQ
FT                   WTFFAGIAMLLATLFMWFGDVIRESIAGHYNRQVDVSFRMGMVWFIFSEVMFFGAFFGA
FT                   LFYTRTFILPMLGGDSYRVMTNALLWDGYSAAWPTNGPGAIGGHFQTIEAWGLPLINTL
FT                   ILLSSGVTLTIAHHALKAGQRTRLLVFQALTVLLGCTFLYCQGEEYIHAYNELNLTLGS
FT                   GIYGSTFFMLTGFHGAHVLLGTIMLLVMWLRAARGHFSRDHHFAFEAAAWYWHFVDVVW
FT                   LALFLFVYVL"
FT   gene            complement(457548..457766)
FT                   /locus_tag="XALC_0405"
FT   CDS_pept        complement(457548..457766)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0405"
FT                   /product="putative membrane protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14940"
FT                   /db_xref="GOA:D2UB34"
FT                   /db_xref="InterPro:IPR021313"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB34"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14940.1"
FT                   /translation="MNDSLKTLLIVAFLLVILWNLGAGLYYLLVDRGQSKRTVNALTWR
FT                   IGLSVCLILLVILGIYTGTIKPHGLGQ"
FT   gene            457797..458555
FT                   /locus_tag="XALC_0406"
FT   CDS_pept        457797..458555
FT                   /transl_table=11
FT                   /locus_tag="XALC_0406"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14941"
FT                   /db_xref="GOA:D2UB35"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB35"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14941.1"
FT                   /translation="MTLAAASRAGAHRRMPLWLGWSVALALALGFCALGRWQLQRMHEK
FT                   QALLAQAAHVRDRPQALADALRTGRPERLAWVHGAGRFLPGQILLDNQIRQGRSGMKLY
FT                   QPFLPDGVSVPLLVELGWLPLPADRALPSPAPLQGRYVLVGLLGPPPSHGLTLGPALVA
FT                   APSPQRWLAMRIEPAAIGVALGRRDILSQVLRLDPALPLGYPRDLDPLPNTLPPERHLA
FT                   YAVQWFGLALLVLVTTALLSWRRRRGRDGR"
FT   gene            458583..459158
FT                   /locus_tag="XALC_0407"
FT   CDS_pept        458583..459158
FT                   /transl_table=11
FT                   /locus_tag="XALC_0407"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14942"
FT                   /db_xref="GOA:D2UB36"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB36"
FT                   /protein_id="CBA14942.1"
FT                   /translation="MTVSPPIPREAAARGRWPLVALFVLFFGSMLGAGVLRFSGWQPPA
FT                   RRNHGELLTPPADLRVLQPLLADGSGYAWRPQQRLWRIALAPPAECASACDALARELDK
FT                   VWQLFGHDADRVQILWIGTPSPWIRTLPQVRVLRADPALLAALPRVHDAAGVPVYVIDP
FT                   NGFVVLRYAPGFDPAGLHADLAKLLKLL"
FT   gene            459170..460333
FT                   /locus_tag="XALC_0408"
FT   CDS_pept        459170..460333
FT                   /transl_table=11
FT                   /locus_tag="XALC_0408"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14943"
FT                   /db_xref="GOA:D2UB37"
FT                   /db_xref="InterPro:IPR003780"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB37"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14943.1"
FT                   /translation="MSLFAPPALFRHFHRMAWLAALFTASTIMFGAFVRLSDAGMSCPD
FT                   WPTCYGRVTWPQTSAEANTHAASKIRPLETHKAWREQVHRFLAGALGVEVLVLSLLAAR
FT                   RRRLGIVRILAAALLVALSIPLYMSGWPVLAMGLAVSAEGILLLAAWRWSNADLARVAV
FT                   LALTVVIFQALLGMWTVTLLLKPIVVMGHLLGALTMFSLLVWMAWRATHLPITLADAVQ
FT                   LQWLLRIGVGLLVVQIALGGWVSANYAALACGGGSWSADNFPRCVSQWWPPHDFRAGFT
FT                   LWRAIGVDYEGGVLDGAARIAIQMAHRMMALGVSAYLVWLSWRLSRSPGMRGWAVALLV
FT                   LLLAQISLGILNVKLALPLPVAVLHNAGAVALLFVLVSLLARLRAPQ"
FT   gene            460330..461229
FT                   /locus_tag="XALC_0409"
FT   CDS_pept        460330..461229
FT                   /transl_table=11
FT                   /locus_tag="XALC_0409"
FT                   /product="putative cytochrome c oxidase assembly factor
FT                   protein"
FT                   /function="metabolism go:0008152; heme, porphyrin
FT                   go:0006783 go:0006779"
FT                   /EC_number="2.5.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14944"
FT                   /db_xref="GOA:D2UB38"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB38"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14944.1"
FT                   /translation="MSARGVYWRDYWDLTKPKVVALIVFTALVGMCLAIPGVPTWEQVR
FT                   TGLLGFFGIWLAASAAAAINQLLDARIDAQMARTSWRPLVVGKVLPWQVLLFAAVLTAL
FT                   SMTVLVVWVNVITAVLTFASLIGYAVIYTVFLKRTTPQNIVIGGLAGAAPPLLGWAAIT
FT                   GMQGQWDWAYASLLVLIIFVWTPPHFWALAIFRRADYAKAAIPMLPITHGVAHTRKQIL
FT                   LYTLLLVVATLLPVVVGMSGVFYLGGTLVLDAVFLWYAWRMLDPPDEMFSMRMFGYSIV
FT                   YLMALFAFLLVDHWLLPG"
FT   gene            complement(461275..462858)
FT                   /locus_tag="XALC_0410"
FT   CDS_pept        complement(461275..462858)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0410"
FT                   /product="putative disulphide-isomerase precursor
FT                   oxidoreductase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14945"
FT                   /db_xref="GOA:D2UB39"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB39"
FT                   /protein_id="CBA14945.1"
FT                   /translation="MPHMSRMLRRPAILCTSLATLLALSACEKPPAPATPTAAAPAPTK
FT                   DSAGIAWREGDLDDAFAEAREQNKPLLLYWGAAWCPPCNRLKATLFKDPAFIARTRAFV
FT                   AVHLDGDSESAQAWGDRFGIKGYPTIIVLRPDRSEITRLAGDSDTAHLAEALRVAATHT
FT                   SSSTQLLQQALKEPATLSNDDWTILSQYDWSVDGAHLIKSEHTADVLARLAAAVPQPAL
FT                   RRRFGLLALSMDKTGTPTPKQRAANRALLQAVLSDPAEVRANLGALTYSARELVQASAA
FT                   NAAERATLSSALTQALDKVYTDSRLPISDRLETVYADIALARLAQGQPEVETHTPPPLP
FT                   AALVEKIRQRAHWAEQAAHSDAERQSTISSAADLLYLVGDKADAEQLLLAELGRSKTPY
FT                   YYMPELSGMAEERGDKQTALYWLKKAYASAQGPATRVQWGVVYVKGLIRLQPDNTTAIE
FT                   NAAGQVIAELASQPDGYHQRTRQRFDTLGKALKVWSKNHSGSAVLARLQQKMQQNCGHQ
FT                   DTDNCQHWLS"
FT   gene            complement(463038..464231)
FT                   /locus_tag="XALC_0411"
FT   CDS_pept        complement(463038..464231)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0411"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14946"
FT                   /db_xref="GOA:D2UB40"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB40"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14946.1"
FT                   /translation="MEHLLPSILPGRIPHQHDARKFSKQPIGELGKSHHCHSMLESCLR
FT                   SASGLASCVFASYNADPTTPPRAMIRPWLARLRIEPFTLSLLCTVLLASLLPVSGRAAR
FT                   IMDAFTDLAIAALFFLHGARLSREAILAGALHWRLHLTIFAATFMLFPLLGLLLKPLSH
FT                   WMLTPALYIGVLFLCTLPSTVQSSIAFTSMAGGNVSAAVCSASLSSLLGVFLTPLLMGL
FT                   LAGAQSAMANPLEAMGKIMLQLLVPFLAGHLLRPWIGTWVDRRRALLRYTDQGTILLVV
FT                   YTAFSAAVIEGLWRKTPLPALLGVALVGALLLALAMLLITISARRLGFSREDEIPIVFC
FT                   GSKKSLATGVPMAKVLFASGSLGAIVLPVMIYHQIQLIVCAVIAQRYAQTVKSARGQ"
FT   gene            464270..465424
FT                   /locus_tag="XALC_0412"
FT   CDS_pept        464270..465424
FT                   /transl_table=11
FT                   /locus_tag="XALC_0412"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14947"
FT                   /db_xref="GOA:D2UB41"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB41"
FT                   /protein_id="CBA14947.1"
FT                   /translation="MHMRYDPYQTVFALSTLASWISNQIGTAQALQADYQKVLMATLAS
FT                   PPVPQTIGVWELAWGPQVWQAENSNRSDNAMCVVKTRNLGDIAGDVYVVVITATNAFSL
FT                   YDWVVEDFDVAKVVDFSTYDPTASTAPVRLLHPSQTNPVISMGTALGVWHLLNMVSPPS
FT                   GVSPGDTLDGFLKKVTSSGASVIFAGHSLGGALSPTMATWFKNTHRLDECTAVYCYPTA
FT                   GPTPGNAAFAQLCTRVLPPTSGNGYRVWNRVLWNAYDVVPHGWDLAMLEQIKTLYANAP
FT                   MLLINAIVDMAKQYASSSGIAYCQIANQRLSGTLSGIPTTLWEFIEQAETQHTTAYAAL
FT                   IAHRLKPVVPPAKKRQTVEMDMEAEFYALLKRLEALGDVSTTLG"
FT   gene            complement(465560..467296)
FT                   /gene="dnaG"
FT                   /locus_tag="XALC_0413"
FT   CDS_pept        complement(465560..467296)
FT                   /transl_table=11
FT                   /gene="dnaG"
FT                   /locus_tag="XALC_0413"
FT                   /product="probable dna primase protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14948"
FT                   /db_xref="GOA:D2UB42"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013173"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB42"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14948.1"
FT                   /translation="MARIPDAFIDDLLARTDIVEVIGTRVPLKRQGKEYAARCPFHDER
FT                   SASFTVSPTKQFYHCFGCGAHGTAISFLMNYDRLEFLDAVDELAKRAGMEVPRDAQQRG
FT                   AAQAAGEDHRDLYSALEAATKFFQRQLDTSDKARTYLDGRGVDAENRARFQIGYAPDGY
FT                   SALKDALGTDERRHKLLDRAGLFSKNDRGHVYDKFRDRVMFPIFDRRGRVIAFGGRVLD
FT                   KDDGPKYLNSPETALFHKGRELYGLWQVRQSNQKIERLIVVEGYMDVVSLFQFGVTQAV
FT                   ATLGTATTPEHAELLFRNAPDVFFCFDGDAAGRRAGWKALESVLPRMKDGRQAFFLFLP
FT                   EGEDPDTIVRKEGAAAFDTRLAQATPLSQFFFDELSREINLSTLDGKARLAERARPMLA
FT                   QIPDGAFGDLMRQRLTELTGIGAAAPATTSTSRPPLRPARSAHKRSLVREAIARLLQVP
FT                   ALALELTPPYPFAGLRLPGVELLIELLQIVHTRPEITTGALLEHFHEREELAALQKLVV
FT                   QEIPGDTASWRQELLDVMVQLEKQTLQQRLDELQAKQRAQGLDETDKYELRELLKILAT
FT                   LR"
FT   gene            complement(467360..468304)
FT                   /locus_tag="XALC_0414"
FT   CDS_pept        complement(467360..468304)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0414"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14949"
FT                   /db_xref="GOA:D2UB43"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB43"
FT                   /protein_id="CBA14949.1"
FT                   /translation="MFRRRALKVLATMSLSSARLHTHLDRLQQSLPAALARRFTEIDLM
FT                   TQAASLSFYALLSLAPLLVLLLWLTASLYPQAQQALIAQIGQLAGNGARDVAQTVIDNA
FT                   KHQPNIGSLAGLWSTLLLFVGATAVFAQLQNALNLIFRTDKQQLDGFLPWLKKRVFSFG
FT                   VVFALGFLLLISMILTTVLQVAFARMPSLLPAVGYFSTLAIYVLAFAVLYHYLPDRRVE
FT                   WRQAIIGGAITACLFVIGRYAIGVYIATAAPGSAYGSMGAPVILLVWIYYATVVFFVGA
FT                   LITAVIDERQRARRPLDDAGIDPPSAVTAAPPH"
FT   gene            complement(468397..468984)
FT                   /locus_tag="XALC_0415"
FT   CDS_pept        complement(468397..468984)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0415"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14950"
FT                   /db_xref="GOA:D2UB44"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR019004"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042184"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB44"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14950.1"
FT                   /translation="MRFSSLPPPHVAIKPLSPSRLYSHAQRLIPVALPRMPLSFSFTVE
FT                   SVMPLKQQLTDDMKAAMKSGDKHSLGVIRLINAAIKQREVDERVDMDDAAVIAVMDKMV
FT                   KQRKDSVSQYEAAGREDLATVEREEIAVIARYLPAKLGQAEIVAAIQAAIAQTGASGPA
FT                   DIGKLMGALKPMLAGKADMGQVSALVKQQLGG"
FT   gene            complement(469075..469290)
FT                   /gene="rpsU"
FT                   /locus_tag="XALC_0416"
FT   CDS_pept        complement(469075..469290)
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="XALC_0416"
FT                   /product="probable 30s ribosomal protein s21."
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14951"
FT                   /db_xref="GOA:D2UB45"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR018278"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB45"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14951.1"
FT                   /translation="MPSVKVRENEPFEFALRRFKRTCEKAGVLAETRKREFYEKPTQER
FT                   KRKAAAAVKRQLRRTSRDVTKRQRLY"
FT   gene            469412..470560
FT                   /gene="gcp"
FT                   /locus_tag="XALC_0417"
FT   CDS_pept        469412..470560
FT                   /transl_table=11
FT                   /gene="gcp"
FT                   /locus_tag="XALC_0417"
FT                   /product="probable o-sialoglycoprotein endopeptidase"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /EC_number="3.4.24.57"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14952"
FT                   /db_xref="GOA:D2UBF1"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14952.1"
FT                   /translation="MNVLGIESSCDETGVAVYDTARSGAAALRAHGLYSQIALHAEYGG
FT                   VVPELASRDHVRKLLPLIRQTLAEAGLRVRDLDAVAYTAGPGLVGALLVGAGVARALAW
FT                   ALEVPAIGVHHMEGHLLAPLMEDPDPAHGVPAPPFVALLVSGGHTQLIAVEAIGRYRLL
FT                   GETLDDAAGEAFDKTAKMMGLPYPGGPQLAALAAQGTPGRFRFARPMTDRPGLDFSFSG
FT                   LKTQVLLAWRGSDQSDAVRADIARGFEDAVVETLAIKCERALDAAGSHTLVVAGGVGAN
FT                   LRLRARLQAMAQARGGRACFPRPALCTDNGAMIAFAGALRLQAGLHDATAAVQVTPRWD
FT                   MASLPPLVAGLPTQGARTNSPSDVPTVAVAGGESRISGAGNG"
FT   gene            470553..470912
FT                   /gene="folB"
FT                   /locus_tag="XALC_0418"
FT   CDS_pept        470553..470912
FT                   /transl_table=11
FT                   /gene="folB"
FT                   /locus_tag="XALC_0418"
FT                   /product="probable dihydroneopterin aldolase protein"
FT                   /function="metabolism go:0008152; folic acid go:0046656"
FT                   /EC_number="4.1.2.25"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14953"
FT                   /db_xref="GOA:D2UBF2"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF2"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14953.1"
FT                   /translation="MDKVFIEGLEIDALIGIYAWERRIRQTLRFDLEMGFDNRIPAASD
FT                   DIADTLNYKAISKRMVELVEQSDHGLVETLAERCAAMVLDEFAVRWLRLKLSKPGAVRG
FT                   AQAVGVMIERSRPCG"
FT   gene            471360..473537
FT                   /gene="bglX"
FT                   /locus_tag="XALC_0419"
FT   CDS_pept        471360..473537
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="XALC_0419"
FT                   /product="probable beta-glucosidase protein"
FT                   /function="metabolism go:0008152; carbohydrates/carbon
FT                   compounds go:0016052"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14954"
FT                   /db_xref="GOA:D2UBF3"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14954.1"
FT                   /translation="MASDRIESLIARMTVEEKVGQLGVFADMVRPFAPDVNPEVNVSNA
FT                   DEVIQQVRAGRVGSLFNGVGAELGRRIQQVALEESRLGIPVILAADVIHGMRTVFPIPL
FT                   GEAASFEPELAERTARATAIEATAAGLHWTYAPAVDIARDQRWGRGAEGAGEDVVLGCA
FT                   FAAARVRGFQGPDLRAPDALLATPKHFAAYGAVAAGMEYASVDIAPQTLRDVHLPPFQA
FT                   AFGAGALTVMTSFNDINGVPASANQELLTDILRGQWQFPGVVISDYTADMELIAHGYAA
FT                   DERDATKKAFLAGMDMSMQSGFYAAHLPSLVEDGDVPMALLDAAVRRVLALKDAIGLFE
FT                   DPYRSLDPAREADQSHLPAHDALSREAARRSIVLLKNDGPVLPLRKYGQKIALIGPFAQ
FT                   DRDNIEGCWTLFGDKERYVTLEDGVRAALDDAQALAVVPGCALEAPLDGGIDAAVAAAR
FT                   AADVAVLALGEPQRYSGEAQSRTQIVLPPSQQALAEAVAATGTPVVVLLRNGRALALQG
FT                   AVRDAAAIVVTWYLGTQTGPAVADVLFGDYNPSARLPVSFPLDAGQQPYFYNHPRTGRP
FT                   ELPTMREFKARWREVPNAPLYPFGHGLSYTRFAYGTPQLDHVRLGWDDTLTVTTRIDNV
FT                   GEREGEEVVQLYIHDRVASRVRPVRELKAFRKVRLAPGQGMEVVFTLDRHALAFTGRDG
FT                   CCTTEPGQFDLWVCASATSGEPVGFELLAQA"
FT   gene            complement(473629..474975)
FT                   /locus_tag="XALC_0420"
FT   CDS_pept        complement(473629..474975)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0420"
FT                   /product="putative amino acid-polyamine-organocation (apc)
FT                   superfamily transporter protein"
FT                   /function="the amino acid-polyamine-choline (apc) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14955"
FT                   /db_xref="GOA:D2UBF4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF4"
FT                   /protein_id="CBA14955.1"
FT                   /translation="MRSATRALGSSGDRIRAMNRPPTPSLVRAVSRWQIVGLSINDVIG
FT                   SGIYLLPAAAAALLGPLSLWAVLLAGLAVALLVLCYAQAASYFDDPGGSYLYAREAFGR
FT                   FVGFEIGWMIWLTRISSAAALGNGLADAVVRFWPAAAHGGARLSIVVGALGLLTAINVI
FT                   GVKSAARTGVALVIGKLLPLALFVGIGLFYVDPSWVFSGKTPDLHDVGTMGEAALLLLF
FT                   AYAGFENIPAAAGEYRNPRRDVPFALITMIVTVTLIYAAVQVVAQGTLANVAQSATPLA
FT                   DAASGFGGEALALILTIGATISILGTTSNTVMLGPRFLFALAKDGYGPAFLARVHPRFH
FT                   TPAAAILLQGVLSLALALSGSFVRLALLSMVTRLFAYTGTAAAALVLSRRYRDRPGALR
FT                   LPGGPLIPLAALLLALALLLSASWQNLAAAGVALLIGALLYRFPRKTPG"
FT   gene            complement(475195..476298)
FT                   /locus_tag="XALC_0421"
FT   CDS_pept        complement(475195..476298)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0421"
FT                   /product="putative chloromuconate cycloisomerase protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="5.5.1.7"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14956"
FT                   /db_xref="GOA:D2UBF5"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034603"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14956.1"
FT                   /translation="MKITDIRLGMLRVPLHTPFKTALRTVQAIEDVVVMVHTDNGHIGY
FT                   GSAAATPPITGDTHGAIIAAIEHCIAPRLIGEDIADLNRIIGRIQRALAHNNSAKAALD
FT                   IAIHDLWAQSYGAPLYRLLGGGTPTLVTDLTISVNTIDTMVRDAHSAIARGFVALKIKV
FT                   GQDTAEDIARVKAIHDAVGGRAQLRLDANQGWTPKQAVHAMRTLEQAGVVLELLEQPVK
FT                   ADDLDGLKYVTERVQTTVMADESVFAPAQAIALLRQRAADILNIKLMKAGGIANALRIA
FT                   DIAAAYGVPCMIGCMLESSIGVAAAAHLAVARANIITKVDLDSPSLGMFDPVDGGVRFD
FT                   EAQIHISDAPGLGIRAIRGLEPLPRSA"
FT   gene            complement(476295..477767)
FT                   /locus_tag="XALC_0422"
FT   CDS_pept        complement(476295..477767)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0422"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14957"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039439"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14957.1"
FT                   /translation="MTEKIRESKIILGMRQVPTFFPHHQDFMTTMRGLCLLLAAALNST
FT                   VAAHAADALPWQLQTVQLQADHWIARLPASLHPLLDAAQVSAFNAHLLHHDISMHDLAA
FT                   LPVRLSAAQVRAQILSVSATPTHRLYDARGNTLDAKQLQALQSALALQTLPEQVTPRYG
FT                   LVVRHADLRLFPTAQRVFSAPDDHDIDRFQESALAPGSAVAILHVSHDGQWLFVLASNE
FT                   AAWIARDRVAEAERATVLDYIQREPRLLVTGTRVFTVFTPELPDASQVALDMGSTLPLM
FT                   QKWPPWQPVNGQSPLAAYVVQLPLRTPDGHLQLAPALVPRVADARDAPLPATPHVLLQQ
FT                   AFKFLGERYGWGDSHDGHDCSGFVVDVYRSLGILLPRNTDDQARSPSLTTVPYNAGAPL
FT                   PQRQKVLAQLQVGDLVYIHGHVMLVIGHEHGRTWVIHDVAAASDRNAAGQLQRVPLNGV
FT                   SVTPLESLLLADGTPFIDRITRIQRILPIPSQ"
FT   gene            477931..478749
FT                   /gene="ampD"
FT                   /locus_tag="XALC_0423"
FT   CDS_pept        477931..478749
FT                   /transl_table=11
FT                   /gene="ampD"
FT                   /locus_tag="XALC_0423"
FT                   /product="probable n-acetylmuramoyl-l-alanine amidase
FT                   precursor protein"
FT                   /function="metabolism go:0008152; peptidoglycan (murein)
FT                   turnover, recycling go:0000270"
FT                   /EC_number="3.5.1.28"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14958"
FT                   /db_xref="GOA:D2UBF7"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14958.1"
FT                   /translation="MIRRLTVPALLVVHRLSLLVLVALLGACAHAPPHNPLAQWVPSPN
FT                   YNQRRAQLIVIHFTGKNSLQESLDTLRSRNGLGELVSAHYLIGPDGKRYQLVSDQLRAW
FT                   HAGVGRWGTITDVNSASIGIELDNDGKTPFPQAQIDSLLVLLQDLCTRLHIPRTQIVGH
FT                   EDFAPSRKVDPGPLFPWKQLADAGFGRWPAADAPPAPSGFDPWQALALFGYPIGDRAAA
FT                   MRAFHHHYRGNEATAFDAEDLRILYALTQPLLAPQPQSLSSPPPIEHNEF"
FT   gene            478895..479284
FT                   /locus_tag="XALC_0424"
FT   CDS_pept        478895..479284
FT                   /transl_table=11
FT                   /locus_tag="XALC_0424"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14959"
FT                   /db_xref="GOA:D2UBF8"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14959.1"
FT                   /translation="MNLPLHFGLLGSLEAGLIALAVGFLVYALWQRLGRRLRWSEGQRL
FT                   GGACLLAVTASAGIDCWSLFYTSIVRLESPLYARIALASIHDPDELGSRVVLEVGCALA
FT                   GVALAWIVFSSCSKKKAADYGHETR"
FT   gene            479514..479885
FT                   /locus_tag="XALC_0425"
FT   CDS_pept        479514..479885
FT                   /transl_table=11
FT                   /locus_tag="XALC_0425"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14960"
FT                   /db_xref="GOA:D2UBF9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBF9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14960.1"
FT                   /translation="MNIRIRTPLFGSVVLLVAALALPAFAQHPQRSDAVGQAQSYTSTT
FT                   GQRTQSDMSGPGQTWADVDTDRDGAISKQEAQVNAGLSQIFSQADTDHNGKLTPKEYEA
FT                   YVAKHHAGMVGGSNNRDGK"
FT   gene            480054..480938
FT                   /locus_tag="XALC_0426"
FT   CDS_pept        480054..480938
FT                   /transl_table=11
FT                   /locus_tag="XALC_0426"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14961"
FT                   /db_xref="GOA:D2UBG0"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14961.1"
FT                   /translation="MVKAVMGAPGFAELFFAYIDVVSGKNPKTCGSRQGLVKFGTERFV
FT                   MNGNLLRSEVEPPVDCIGRQGHPPPMPSLGRMRPSTASRPMRCIDGGEWLQAVAGLWGA
FT                   DSSCGIRQNRCMSFRLHAAGSLLFVLLLVVGIAAAQDTSVSVSAFAAAAPAEMPASGDV
FT                   WVDRQLLDIDRYAVRYPDSFLDEVARYAQMPRGYAEALLRECHWSARDIYFAGFLATAT
FT                   GRPYREVVRARSATGAQAGWAEVATGLQAPPGSLAYRALRHAIVASYDHWDRPIVLDAL
FT                   LRRQLGGRAAAQP"
FT   gene            481065..482426
FT                   /locus_tag="XALC_0427"
FT   CDS_pept        481065..482426
FT                   /transl_table=11
FT                   /locus_tag="XALC_0427"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14962"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14962.1"
FT                   /translation="MTTAFVSPDAIRSLFAQAMSDMYRAEVPLYGTLMDLVAQVNAQTL
FT                   AADPALEAQLQRNDERARLDQERHGAIRVGTAEELAMLRRLFAVMGMVPVDYYDLSVAG
FT                   VPVHSTAFRPLDAAALARNPFRVFTSLLRLELIEDLALRAQAAQILARRRIFSDGALEL
FT                   IARCERDGGLGEADAHRFVTQVLETFRWHSDATVSLPIYRALSDAHKLVADVVSFHGPH
FT                   INHLTPRTLDIDAAQVQMLHRGIEAKAVIEGPPRRRCPILLRQTSFKALEETVRFPAGA
FT                   GSAEVGTHTARFGEIEQRGLALTPKGRALYDALLERARGADGSAGGDYMARLQAAFADF
FT                   PDDEATLRREGLGYFRYALTDAGRAAGATALAGKPAEALIADGLVSADPIVYEDFLPVS
FT                   AAGIFQSNLGGGEQRGYAAHANRAAFEQALGATVHDAFAIYAGIERDSLQALNR"
FT   gene            complement(482554..483924)
FT                   /locus_tag="XALC_0428"
FT   CDS_pept        complement(482554..483924)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0428"
FT                   /product="putative leucine aminopeptidase protein"
FT                   /function="metabolism go:0008152; leucine degradation
FT                   go:0006552"
FT                   /EC_number="3.4.11.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14963"
FT                   /db_xref="GOA:D2UBS1"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14963.1"
FT                   /translation="MSLPNGFTDASHTPLPLYVLEREHLAEWRAAQSPAWVAWMDTQQF
FT                   MAAPGTVLLLPGPDGVAAAVLGVGDRGDAYAYAHAPFALPAGSTWHLASALDTEALAAL
FT                   HLGWGLGSYRYAGYKQPPRLPASLLATPQAEVLDLLEACVRVRDWVNTPTEHMGPEQLE
FT                   AIARAIAQAHGAQFDSIVGDALLEQNFPTIHAVGRASHRAPRLLVLRWGEDTHPHLALI
FT                   GKGVCFDTGGLDLKPADGMRHMKKDMGGAAHALALAGLVMAQRLPLRLTVLLPAVENAI
FT                   GPNAFRPGDIIATRQGTTVEIDNTDAEGRLVLCDALAYASEQNPDAIMDFATLTGAARI
FT                   ALGPDLPALFCNDDALAQAWIEAGERHRDPVWRMPLWRPYLRYLSSSVADLANAGSRMA
FT                   GAVTAALYLERFVPARQTWAHLDVYAWNDSERPGRPAGGEALALRSAYAMLKARYTR"
FT   gene            complement(483988..484713)
FT                   /locus_tag="XALC_0429"
FT   CDS_pept        complement(483988..484713)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0429"
FT                   /product="putative hydrolase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14964"
FT                   /db_xref="GOA:D2UBS2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14964.1"
FT                   /translation="MTSSPTFPIRAITLDLDDTLWPFAPIGARIEQVLHDWLLQHSPRT
FT                   AACFPIPAMRQLRDTVVAAHPHLRHDMSELRRLTLRQALRESGADETLAEPAYAVFHAA
FT                   RNQVECFPDSLPALQRIAACMPVAALSNGNADLATIGLERYFAFQLSAGEHGAAKPDPS
FT                   IFQAACARLALPCAQVLHVGDHIEIDVVGAMQAGLRGCWINREGQLWDRPTPPDLQFDT
FT                   LTGLADWLETTQPLHTAHA"
FT   gene            complement(484813..485976)
FT                   /locus_tag="XALC_0430"
FT   CDS_pept        complement(484813..485976)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0430"
FT                   /product="putative permease family protein"
FT                   /function="putative uncharacterized transport protein
FT                   go:0005215 go:0006810"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14965"
FT                   /db_xref="GOA:D2UBS3"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14965.1"
FT                   /translation="MSYNAVQGHRNADPMSTVPDSATDDHPATAAPRDALPMPHTARPR
FT                   GPVSLVVLATLAVAYTLWAAQQVILPVLLAAFFALIGNPILRLLRRLYLPRFLAALVVL
FT                   LSGMALAATLTVQLAGPAAVWVQQAPAQMRHIATQVHDLTKPMQLANQAAESFARAAGG
FT                   DGGPRVQVIRTQMDDPYRALVRTPRLAASALAVVLLTFFFMVFGENLQRHAIALLPSRQ
FT                   QQKFTTDILRSIEQEVSRYVLTISVINTLVGLVFAVILILLNITPQEALLWGTVMALLN
FT                   FAPYVGPLIGVVLMLLMGFVAFRDPLSATLPALFYLALHLLEGQVVTPIVLGRRMAISP
FT                   LMLILALMLFGWLWGMIGLLLAVPLLVCIKIVLARVDGMQRWARLLE"
FT   gene            complement(486071..486508)
FT                   /locus_tag="XALC_0431"
FT   CDS_pept        complement(486071..486508)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0431"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14966"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14966.1"
FT                   /translation="MKLDQLQHRVARAEAVLEGRREQMRTHWTTLQQGWREGWTPLRIV
FT                   VVGLGIGFLVGRAEPVAALGKLGGARWLQMLSALYKLLNAATASSNAPERAADTTQAPA
FT                   GTAPHAAPADTSTTARHGDPLDASRPDAPNPTDTATALSEP"
FT   gene            complement(486508..486999)
FT                   /locus_tag="XALC_0432"
FT   CDS_pept        complement(486508..486999)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0432"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14967"
FT                   /db_xref="GOA:D2UBS5"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS5"
FT                   /protein_id="CBA14967.1"
FT                   /translation="MSDAQARAGTPDGATAEPTAATPSLGESLRIFRAAGREGLHASLH
FT                   TGRALRRLVAADLALARVALVRALVWLIVSVAFGASAWILLMSALIALLHRMGWSWLAS
FT                   ITATAGISLFFTALGAWQALRYLEMSKLDATRRQLAKLGIGNSDEDHNDASAPTGKASE
FT                   "
FT   gene            complement(487005..487376)
FT                   /locus_tag="XALC_0433"
FT   CDS_pept        complement(487005..487376)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0433"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14968"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14968.1"
FT                   /translation="MNSSPTNTDHLKDNLSEAGAHLKSAASYAGEAIKGAVGAASDELK
FT                   LGKANVKAELSDSTLSGLAAAEFGGAAAKEQVDALMDKGRDLIDSAADLIRERPLASFG
FT                   VAFAAGWIIAKLARSGGDK"
FT   gene            complement(487539..488975)
FT                   /locus_tag="XALC_0434"
FT   CDS_pept        complement(487539..488975)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0434"
FT                   /product="probable periplasmic protease protein"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14969"
FT                   /db_xref="GOA:D2UBS7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14969.1"
FT                   /translation="MRPLPTLLTLTAAAAFGGFAATAINAQLNNRADAAPTPATRAVAN
FT                   TAALPTSVAGTPLPSLAPMLQTVMPAVVSINTKQVVRVRNPFFNDPFFRRLFPDIPQER
FT                   INESLGSGVIIDAKNGYVLTNHHVVENADDVQVTLADGRSFKAEFIGSDADTDIALVRI
FT                   KADNLTEIRLGDSDKLRVGDFVAAIGNPFGFTQTVTSGIVSAMGRNGIRGLGYQNFIQT
FT                   DASINPGNSGGALVDLRGELVGINTASFNPQGSMAGNIGLGLAIPSNLARAVVDQLLKN
FT                   NGVMIRGTFGIETQNLTAQMAQGLGLPSPRGALVTRVLAGSAAAAAGLQPGDVVTGANG
FT                   ERLDSAEALHNYEGLQPVGSTVTLDVRREGKPLQLKVRLKEQPRAVSGEALDPRLSGAT
FT                   FTDLPESLRQSGVSGVLIGNVARGSRAAHNGLASGDIVVAASAGEFADLASYRANFARK
FT                   PAQLVLRVVRGGVQADLIMQ"
FT   gene            489418..490071
FT                   /locus_tag="XALC_0435"
FT   CDS_pept        489418..490071
FT                   /transl_table=11
FT                   /locus_tag="XALC_0435"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14970"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14970.1"
FT                   /translation="MSNGNGVTATLTQVAENMKETATNMGETIAATASEAVASVKHTAE
FT                   NVQKRVQDQVAKTRKVVKQAEKAVAKRAEKAGKAVKKTVAKARKTLEAARASAKSEAAA
FT                   LKKAVKKKTAKKAAAKKAPAKKAVAKKAPAKKVTAKKAAPKKAVKKVAAKKVAVKKAVK
FT                   KVAAKKVVVKKAVKKAAKAVKKTVARVAKKSATAKKTAVRKSAGKKVAASRAKK"
FT   gene            complement(490117..490845)
FT                   /locus_tag="XALC_0436"
FT   CDS_pept        complement(490117..490845)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0436"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14971"
FT                   /db_xref="GOA:D2UBS9"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBS9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14971.1"
FT                   /translation="MPLQWLLMRFIRGRGAFVLPRLWFTCLRQALRLRVEVIGQPRAAG
FT                   GTLFVGNHLSHFDIVVLGSLLRTRFIAKNDMERWPGMRHIGAMAQTVFISRRRQDAAAV
FT                   ATAVAAQLRPDHDLVLFAEGTTSSGEHVAPFKSSLFSLFLDADTNTPRWTLQPFTMELR
FT                   SVDGQPLAQGGNRDAYAFYGAMQAGAHVMQFLRMSGAVVRVTFHTPIALAPGSDRKALA
FT                   AHLHGIVSSALTAPTRPISP"
FT   gene            complement(491374..491763)
FT                   /locus_tag="XALC_0437"
FT   CDS_pept        complement(491374..491763)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0437"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14972"
FT                   /db_xref="GOA:D2UBT0"
FT                   /db_xref="InterPro:IPR000026"
FT                   /db_xref="InterPro:IPR016191"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14972.1"
FT                   /translation="MSHSIKFALLAALFVSTHVQAYQSPTHCSILPNYIRDASRDMAYC
FT                   LTMPSPIAACGNAQLDVQVFGNNEGRLPKSGNGQTYYEGKARLPQNDQAGTYRLVFLVT
FT                   DGKKKKAIEQRYYSADHYATFCTIQ"
FT   gene            complement(492044..492973)
FT                   /locus_tag="XALC_0438"
FT   CDS_pept        complement(492044..492973)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0438"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14973"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT1"
FT                   /protein_id="CBA14973.1"
FT                   /translation="MHAPPTAIRSRMRQFRHQAGAAAQTGSARFPFRFEAFMKLEALFD
FT                   QLHTLPTIPQVAQDLILQFDSPGTSLDAVARNIERDPVIAAKVLRLANSARFRGARDST
FT                   TVEDAALRLGFNTLRTLVLASSMTGAFKAPPHFDLRGFWLHSFEVAGICRLLARQKGLD
FT                   PETAFTCGMMHNIGELLIQTGAPSYAAQLHPDASSSGRAADETVQLGFGYPEVGAELAR
FT                   RWQLPQVIQAAIAYQARPLQAPQGEPMPRVVAQAALVADALRHYGSATDEARQAVTGPL
FT                   LQEVDLDALFAALPEVIEADRAFTEMLR"
FT   misc_feature    complement(492945..493007)
FT                   /note="XALc_0439"
FT   gene            complement(493163..493636)
FT                   /locus_tag="XALC_0440"
FT   CDS_pept        complement(493163..493636)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0440"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14974"
FT                   /db_xref="InterPro:IPR009921"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14974.1"
FT                   /translation="MLNNDILRSIRYMLDLSDQKIVDIVQLTDPVFPIDKAQIAAWLKK
FT                   EDEAGFVECHDAVLAHFLDGLVFHYRGRDERLPPRPVETHITNNVVLKKLRVTFQLKDL
FT                   DMHQIFYSAGLPVSKPELSALFRQPEHKNFRLCGDQLLRNFLKGLTLRLRPAG"
FT   gene            493893..495401
FT                   /gene="glpD"
FT                   /locus_tag="XALC_0441"
FT   CDS_pept        493893..495401
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="XALC_0441"
FT                   /product="probable glycerol-3-phosphate dehydrogenase
FT                   protein"
FT                   /function="metabolism go:0008152; aerobic respiration
FT                   go:0009060"
FT                   /EC_number="1.1.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14975"
FT                   /db_xref="GOA:D2UB46"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB46"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14975.1"
FT                   /translation="MRETYDVLVIGGGINGVGIARDAVGRGLSVCLCERDDLAAHTSSA
FT                   STKLIHGGLRYLEQYEFALVGKALAEREVLLRLAPHIIWPLRFLLPHQPHLRPAWMLRA
FT                   GLFLYDHLGRGRRTLPGSRRLALRTHPVGAPLREEFRTGFVYSDAWVQDARLVVLNAMD
FT                   AAQRGARILTRTCCVSAQRADGVWRVGLQFADGRSEEVQARALVNAAGPWAVQFLDQVA
FT                   QVGHDHALRLVKGSHLVVPRLFDHDHAYIFQQPDRRIVFAIPYEQDYTLIGTTDVDYRA
FT                   DPDAPRIDAEETHYLCAAANRYFRKQIAPDDVVWSYSGVRPLLDDAQDNAAEVTRDYLL
FT                   ELDARNGAALLNVFGGKLTTYRKLAEEAVDRLTAHVGRKAPAWTAHGAPLPGGERADID
FT                   VLARELRAARPWLSEATAQRLARNYGTRASALLGAATSLQQLGEHFGADLYQAEVDYLC
FT                   EHEWVIEADDLLWRRSKLGLRIDANGCQRLIAYLQQASARLATA"
FT   gene            495571..496389
FT                   /gene="glpF"
FT                   /locus_tag="XALC_0442"
FT   CDS_pept        495571..496389
FT                   /transl_table=11
FT                   /gene="glpF"
FT                   /locus_tag="XALC_0442"
FT                   /product="probable glycerol uptake facilitator protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14976"
FT                   /db_xref="GOA:D2UB47"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB47"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14976.1"
FT                   /translation="MNRQLLGELISEAIAMLIIIAFGCSVACMYVLYDPSPYQHAYWGV
FT                   CIAWGLGVTIAIYVTGSVSGTHANPAVTLALALFRGFPWRKVLPYCAAQVLGAFLGAGI
FT                   VYLLFAPVIDHYNQVQQLTRAGGGAAGVFFTAPGLAITPLHALCDQVILTALLIFGIFA
FT                   ITERYNEAAPGANSGALIIGLLVATIGASMGYLEAWAINPARDLGPRLFAYFAGWDASA
FT                   FPAAGYYWWIPIVGPLIGGVIGGAAYQTLIYPFLPARLREQEEDVAVRRS"
FT   gene            496483..497982
FT                   /gene="glpK"
FT                   /locus_tag="XALC_0443"
FT   CDS_pept        496483..497982
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="XALC_0443"
FT                   /product="probable glycerol kinase protein"
FT                   /function="metabolism go:0008152; galactose degradation
FT                   go:0019388"
FT                   /EC_number="2.7.1.30"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14977"
FT                   /db_xref="GOA:D2UB48"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB48"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14977.1"
FT                   /translation="MEKQFILSIDQGTTSSRAILFDRHGRSVGMAQREFAQIFPQPGWV
FT                   EHNPREIMTSVYTTITELLNTHQLDASAIAGIGITNQRETAVVWDRATGQPIYNAIVWQ
FT                   SRQTKDICEQLKADGHEDMVRAKTGLLIDAYFSGTKIKWILDHVEGARLRAQRGELAFG
FT                   TIDTWLIWNLTGGKVHVTDYTNASRTLLYNIYALCWDEDLLRMLDIPASMLPQVRSSSE
FT                   IYGSTQGQYFYGHGVQIAGIAGDQQAALFGQACFEPGMAKNTYGTGCFMLMHTGEKAVV
FT                   SNNGLLTTIAWGVDGKVEYALEGAIFVAGSVVQWLRDGLRMFGKASDSQAYAERAGDND
FT                   GVYFVPAFVGLGAPYWRSDIRGAVFGLTRGTTKEHFIRAAIESMAYQTRDVLTAMQNDA
FT                   GIKLKELRADGGAIANDFMAQFQSDILDVPVLRPEVAETTALGAAYLAGLATGFWKDRA
FT                   EIAQHWAVDRRFEPTMPAERREALYAGWQQAVEATMGFRIR"
FT   gene            498288..499331
FT                   /locus_tag="XALC_0444"
FT   CDS_pept        498288..499331
FT                   /transl_table=11
FT                   /locus_tag="XALC_0444"
FT                   /product="putative oxidoreductase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14978"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB49"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14978.1"
FT                   /translation="MSAAAVEQETIPVAQRALGRSGVHIATLGFGAAPIGNLYAEVDDA
FT                   VALAAVADAYVAGIRHFDTAPYYGYGLSEQRLGQGLRGVPRASYTLSTKVGRCIYDDAA
FT                   AAIGCEGFAVAGRRAEFDYSRDGVLRAFESSLQRLATDHIDVLLLHDIGGLTHGEAHAA
FT                   MLRQALDEALPTMAELKSQGACRAIGIGVNEEDVAVELLPLFPLDCVMLAGRYTLLEQH
FT                   AAQRIMAQAVQQQVGILVAGPYSSGLLSDASGPGKTYNYAPVDSATLRHAQRLFAACAA
FT                   WGVDVGAAALQFPLAHPAVSSVVAGMRTPAEVSSAATRLRTPIPASLWQDLHDQGLLQG
FT                   PVPTLCE"
FT   gene            499322..500203
FT                   /locus_tag="XALC_0445"
FT   CDS_pept        499322..500203
FT                   /transl_table=11
FT                   /locus_tag="XALC_0445"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14979"
FT                   /db_xref="GOA:D2UB50"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB50"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14979.1"
FT                   /translation="MRMIDAHVHFWSLARGDYVWLTPALGALYRDCGPEHLLDTLDAHG
FT                   VSTVVAVQAAQTEAETRYLLQLARAQPRIVGVVGWVDFEAADAAARIGALCAEGGGLLK
FT                   GLRPMVQDLDDPQWLARPKLDAAFDTVLQHDLAFDALIRPQHLPALLARLQRHPTLRVA
FT                   LDHAAKPMIGGSGFDAWADGLAKLAQYPGVVCKLSGLLTELPADVAADSAGLEPYVAQL
FT                   FANFGPQRVMWGSDWPVLTQRADYGTWITLAQALVAGYAAGHADAVFASTAQRFYRLSD
FT                   PIVSPTTRSTAA"
FT   gene            500235..500981
FT                   /locus_tag="XALC_0446"
FT   CDS_pept        500235..500981
FT                   /transl_table=11
FT                   /locus_tag="XALC_0446"
FT                   /product="putative short-chain dehydrogenase/reductase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14980"
FT                   /db_xref="GOA:D2UB51"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB51"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14980.1"
FT                   /translation="MSGRLQGKRCLMTAAGAGIGRESALACAREGAQVLATDIDSAALQ
FT                   RLAAESSAITTQVLDVTDADAIQALVAAHPTFDVLFNCAGYVHQGSILECDASAWRRSF
FT                   AINVDAMYYLCQAVLPGMLAQGRGSIVNMSSVASSIKGVPNRFVYGATKAAVIGLSKAI
FT                   AADYVAKGVRCNAICPGTIKTPSLGERVKALGGDEQAVWKSFTDRQPMGRLGDPREIAQ
FT                   LVVYLASDESSFTTGQTHIIDGGWSN"
FT   gene            501007..501864
FT                   /locus_tag="XALC_0447"
FT   CDS_pept        501007..501864
FT                   /transl_table=11
FT                   /locus_tag="XALC_0447"
FT                   /product="putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14981"
FT                   /db_xref="GOA:D2UB52"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB52"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14981.1"
FT                   /translation="MKLVRIGSPGQEIPGLIDGEGRIRDLRGVIDDVAGEHLTRAGLDK
FT                   LRALDVATLPIIDGAPRYGAAVGRIGKFICVGLNYADHAAESGMEVPKMPILFMKATTA
FT                   VCGPNDTVIIPRGSVKSDWEVELGVVIGDVARDVSVEQALDHVAGYAVINDLSEREFQL
FT                   EHGGQWVKGKSADTFGPIGPWLVTRDEIPDPQNLSMWLEVNGHRYQNGSTRTMVFGVAE
FT                   LVSHISRYMTLMPGDVISTGTPPGVGLGQKPPVYLKPGDVMELGIEGLGQQRQAVVAHP
FT                   RDAR"
FT   gene            502116..503435
FT                   /locus_tag="XALC_0448"
FT   CDS_pept        502116..503435
FT                   /transl_table=11
FT                   /locus_tag="XALC_0448"
FT                   /product="putative mandelate racemase/muconate lactonizing
FT                   enzyme protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14982"
FT                   /db_xref="GOA:D2UB53"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034610"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB53"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14982.1"
FT                   /translation="MSKIVALETFDVRFPTSRELDGSDAMNPDPDYSAAYLCLRTDADD
FT                   GLAGYGLAFTIGRGNDVQSAAVAALAHHVVGRDVDAVIGDLGGFARSLTDDSQLRWLGP
FT                   EKGVMHMAIGAVVNAAWDMAARRAGKPLWRYIAELSPEQLVAAIDFRYLTDALTPDEAL
FT                   AMLRAAEPSRAARIRTLLEQGYPAYTTSPGWLGYSDEKLVRLAKEAVADGFRTIKLKVG
FT                   ANVQDDIRRCRLARAAIGPDVAMAVDANQRWDVGPAIAWMRQLAEFDIAWIEEPTSPDD
FT                   VLGHAAIRRGIAPVPVSTGEHTQNRVVFKQLLQAGAVDLIQIDAARVGGVNENLAILLL
FT                   AAKFGVRVFPHAGGVGLCELVQHLAMADFVAITGKMEDRAIEFVDHLHQHFVDPVRIVH
FT                   GRYLAPTLPGFSAQMHASSVDQFLYPDGPFWSADLAAQRA"
FT   gene            complement(503619..503987)
FT                   /locus_tag="XALC_0449"
FT   CDS_pept        complement(503619..503987)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0449"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14983"
FT                   /db_xref="GOA:D2UB54"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB54"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14983.1"
FT                   /translation="MPRHCYLLDLHDDPTLIAEYERWHRPDTVWPEIVASLRTAGIREL
FT                   DIHRCGNRLVMLMEVDDDYSPAAKAATDAADPRVQAWEELMWRFQKPLPGSAPGEKWRE
FT                   ALQIFSLQAAVAEQQRQR"
FT   gene            complement(503991..505298)
FT                   /locus_tag="XALC_0450"
FT   CDS_pept        complement(503991..505298)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0450"
FT                   /product="putative l-fucose-proton symporter protein"
FT                   /function="porters (uni-, sym- and antiporters) go:0015293
FT                   go:0015297 go:0015292"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14984"
FT                   /db_xref="GOA:D2UB55"
FT                   /db_xref="InterPro:IPR005275"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB55"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14984.1"
FT                   /translation="MHYSSDTATSAPANPTRTALAPLVLIVSLFFLWGMANNLNDILIK
FT                   QFKKAFELTDLQAGLVQSAFYLGYFVFAIPAAMFMRRYSYKAAVVLGLLLYATGALLFY
FT                   PAAQVHTYGLFLLALFVIASGLAFLETTANPLVTVLGPADGAARRLNLAQAFNPLGSIT
FT                   GVLVGQHFIFSGVEHTPQELATMAPTARAAYFATESTAVQTPYLIIGAVVVLWALLIGL
FT                   TRFPTTRAAAGVVASGKANFGQLWHNRRFVFAVIAQFFYVGAQVGIWSYLIRYLQDSVP
FT                   GTPEKTAANFLTVSLVLFMAGRFIGAALLRYLAPARLLGGFALLNLLLCGVAVALPGWI
FT                   GLYALVASSLFMSVMFPTIFALGLEGLDDDARKLGSSLIVMAIIGGAALTALMGAISDH
FT                   VGIHWAIAVPGLGFAVILGLALYATARRRSAHATGA"
FT   gene            505659..506414
FT                   /locus_tag="XALC_0451"
FT   CDS_pept        505659..506414
FT                   /transl_table=11
FT                   /locus_tag="XALC_0451"
FT                   /product="putative transcriptional regulator, iclr family
FT                   transcription regulator protein"
FT                   /function="transcriptional level go:0006355"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14985"
FT                   /db_xref="GOA:D2UB56"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB56"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14985.1"
FT                   /translation="MIIPPPKYRAPALDKGLDILELLARDARPMTMAEISQGIGRSRGE
FT                   IFRMLQVLEERGYLTKAAGDGGYTLTNRLFMLGMQQPQVQNVTEVALPVMRRLADAIRQ
FT                   PCHLVAPSDDQIVVIAQMDVPSDLGLVVRPGHRRPFAHSSSGLVLFAFQPADVQERLLQ
FT                   RLDAGAVEYDRALFLAAACEVQALGYSIRPSEAVVGVIDLTAPILQHGIARYTLTVPFI
FT                   ERRPQQMDAQVAMQAVCAAAAQISAALCT"
FT   gene            complement(506550..506921)
FT                   /locus_tag="XALC_0452"
FT   CDS_pept        complement(506550..506921)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0452"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14986"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14986.1"
FT                   /translation="MNEILRGSCIGFALVALLAGCKPATTASTTASSTTASTTPTGKCD
FT                   SVPDHTYNLPTGRFDEVSQQLAHATGCMIVYRDPTLAAVQVNAVKGQISIRQAMHQALE
FT                   GTALRIEQEQADTIQVGRR"
FT   gene            complement(507101..508855)
FT                   /gene="glnS"
FT                   /locus_tag="XALC_0453"
FT   CDS_pept        complement(507101..508855)
FT                   /transl_table=11
FT                   /gene="glnS"
FT                   /locus_tag="XALC_0453"
FT                   /product="probable glutaminyl-trna synthetase
FT                   (glutamine--trna ligase)(glnrs) protein"
FT                   /function="information transfer; amino acid-activation
FT                   go:0006418"
FT                   /EC_number="6.1.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14987"
FT                   /db_xref="GOA:D2UBG3"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG3"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14987.1"
FT                   /translation="MSDTPATDASAPAEKKDFIRQIVREDLASGKHASIRTRFPPEPNG
FT                   YLHIGHAKAICLDFGIAAEFAGRCNLRLDDTNPAKEDPEFVAAIQDDVRWLGFQWAELR
FT                   HASDYFEVYYLAAEKLIRDGQAFVCDLSAEQVRDYRGTLTEPGRHSPYRERSIEENLKL
FT                   FRRMRAGEFPDGTCTLRAKIDMASGNINLRDPALYRIKHVEHQNTGNAWPIYPMYDFAH
FT                   ALGDAIEGITHSLCTLEFEDHRPLYDWCVDKVDLAGHPDLLQPLLAKGLPREAGKPRQI
FT                   EFSRLNINYTVMSKRKLTQLVTEGLVDGWDDPRMYTLQGLRRRGYTPAALRLLVERVGI
FT                   SKQNSVIDFAVLEGCLREDLDAHAPRRMAVIDPLKLVLSNLPDDHRETLTFSNHPKDDS
FT                   FGTRAVPFSREVWIEREDFAEVPPKGWKRLVPGGEVRLRGAGIARVDEVIKNAAGDIVE
FT                   LRGWLDPNSRPGMDGANRKVKGTLHWVSAAHAVEAEIRLYDRLFSVEKPDDESDGKSYR
FT                   DHLNPHSKRSVRGYVEPAAAHAAPEQAFQFERSGYFVADRHDHRAETPVFNRSVTLRDT
FT                   WSGGQDGA"
FT   gene            509109..509336
FT                   /locus_tag="XALC_0454"
FT   CDS_pept        509109..509336
FT                   /transl_table=11
FT                   /locus_tag="XALC_0454"
FT                   /product="conserved hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14988"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14988.1"
FT                   /translation="MQIAYRAQHLIDAHLAKHALEDAGITAFVFGEALLGGAGELPFGV
FT                   VQVCVADELLEKAQEVLMALGLGGVVTRAM"
FT   gene            509484..509924
FT                   /locus_tag="XALC_0455"
FT   CDS_pept        509484..509924
FT                   /transl_table=11
FT                   /locus_tag="XALC_0455"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14989"
FT                   /db_xref="GOA:D2UBG5"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR013543"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14989.1"
FT                   /translation="MRVSGQSFQRRASALTAPLRYRRWNAALAQARGDLYARERRAAAD
FT                   RVQNKVRASRAEIEDDFSHFLAAKPRGTINYRQVRRLDDDSAVDAGVYTFTLNNADGSI
FT                   VQVQARYSFVYEKRNGRWLIINHHSSVMPEPVAVATAAPGRT"
FT   gene            509986..510636
FT                   /gene="msrA"
FT                   /locus_tag="XALC_0456"
FT   CDS_pept        509986..510636
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="XALC_0456"
FT                   /product="probable peptide methionine sulfoxide reductase
FT                   msra protein"
FT                   /function="information transfer; turnover, degradation
FT                   go:0006508"
FT                   /EC_number="1.8.4.11"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14990"
FT                   /db_xref="GOA:D2UBG6"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14990.1"
FT                   /translation="MLGIGAFKQRLPRPGESLPGRAEPLPLHNRHFVNGQPLRDVFAGL
FT                   QQVQFGLGCFWGAERAFWSLPDVFTTAVGYAGGETPHPTYREVCSGQTGHTEAVLVVFD
FT                   PHVTSFAQLLQTFWESHDPTQGMRQGNDLGTQYRSAIYCATQEQYAAAIASRDAYQQRL
FT                   HEAGYGAITTEIRLPAPPFYYAEDEHQQYLAKNPGGYCGLGGTGVGCPLGLEV"
FT   gene            complement(510660..511628)
FT                   /gene="tal"
FT                   /locus_tag="XALC_0457"
FT   CDS_pept        complement(510660..511628)
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="XALC_0457"
FT                   /product="probable transaldolase protein"
FT                   /function="metabolism go:0008152; pentose phosphate shunt,
FT                   non-oxidative branch go:0009052"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14991"
FT                   /db_xref="GOA:D2UBG7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004730"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14991.1"
FT                   /translation="MTSSASSKLAQLRELSVVVADTGDYDAIKRLKPVDCTTNPTLVKK
FT                   ALDLPVYADLIDEALAWAHSQNGERATLIDEIADRLTIGVGSRLSTLVPGRVSTEVDAD
FT                   LAHDTAATIAKAHKFIAMYAERGIAKERILIKVAATWEGIEAARQLQKDGIDCNLTLVF
FT                   NRTQALACAEAGAFLHSPFVGRMLDWYVAHGQTPASIDEDPGVQFVRDVYAEFKRRGLQ
FT                   TVVMGASFRSTAQIEALAGCDRLTISPDLLEKLDADYGPLPRKLSPGRADGVSVPPIDA
FT                   QRFAADLAADPMATEKLTSGIDTFAKDLQALRDTIRQKLAG"
FT   gene            complement(511911..512861)
FT                   /gene="oxyR"
FT                   /locus_tag="XALC_0458"
FT   CDS_pept        complement(511911..512861)
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="XALC_0458"
FT                   /product="probable oxydative stress transcriptional
FT                   regulator, lysr family transcription regulator protein"
FT                   /function="transcriptional level go:0006355; activator
FT                   go:0016563"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14992"
FT                   /db_xref="GOA:D2UBG8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14992.1"
FT                   /translation="MNLRDLKYLVALADHKHFGRAAAACFVSQPTLSTQIKKLEDELGV
FT                   PLVERAPRKVMLTPAGREAASRARSIVAEIEQMKEAARRSQDPEAGTVRLGIFPTLGPY
FT                   LLPHVIPKVRARFPHLELLLIEEKSDVLLSRLREGRLDAALLALPLHDEQLHAEFLFEE
FT                   PFVLAVSDPHPLAEQQAPLTLDALHAQRLLLLEDGHCLRDQALDVCHLAGATEKAEFQA
FT                   TSLETLRQMVAANVGVTLLPLLAVQPPVTNPSNIRLLNFDHSCGPSRRIAMLWRRSSAM
FT                   SEFLQQLAQLFKTLPSELFVLPPQTHAAAQQQAVT"
FT   gene            complement(512949..514538)
FT                   /gene="ahpF"
FT                   /locus_tag="XALC_0459"
FT   CDS_pept        complement(512949..514538)
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="XALC_0459"
FT                   /product="probable alkyl hydroperoxide reductase subunit f
FT                   protein"
FT                   /function="metabolism go:0008152; riboflavin (vitamin b2),
FT                   fad, fmn go:0009231 go:0006747 go:0009398"
FT                   /EC_number="1.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14993"
FT                   /db_xref="GOA:D2UBG9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR008255"
FT                   /db_xref="InterPro:IPR012081"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBG9"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA14993.1"
FT                   /translation="MLDADLKTQLKAYLERVVRPIHIAASVDDGAKSREMLDLLEELVL
FT                   LSDKITLDVHRDSDERTPSFALNSPGQDIHLRFAGLPMGHEFTSLVLALLQVGGYPSKA
FT                   TAELIEQVRHLPGEYRFETYFSLSCQNCPDVVQALNLAAVLNPNIQHVAIDGALFQEEV
FT                   ETRQIMSVPTVYLNGEVFDQGRMSLEQIVAKLDTGAAKREAVAIAAKAPFDVLVVGGGP
FT                   AGAAAAIYAARKGIRTGVAAERFGGQVLDTMAIENFISVQETEGPKMAAALEQHVRQYN
FT                   VDIMSLQRAEQLIPAGADGLVEVKLANGASLKSRTVILSTGARWRQMNVPGEDQYRNKG
FT                   VAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSHVTLVEFDSKLRADDVLQRKL
FT                   RSLGNVDIIVNAQSTEVLGDGQKVTGLMYKDRVGDAVHQLALEGIFVQIGLLPNTEWLQ
FT                   GAVALSPRGEIVIDERGQTSQPGVFAAGDATTVPYKQIIIAMGEGSKAALSAFDHLIRH
FT                   SAPVAGGIAEAA"
FT   gene            complement(514715..515281)
FT                   /gene="ahpC"
FT                   /locus_tag="XALC_0460"
FT   CDS_pept        complement(514715..515281)
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="XALC_0460"
FT                   /product="probable alkyl hydroperoxide reductase subunit c
FT                   (thioredoxin peroxidase) protein"
FT                   /function="cell processes go:0009987; detoxification
FT                   (xenobiotic metabolism) go:0006805"
FT                   /EC_number="1.11.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14994"
FT                   /db_xref="GOA:D2UBH0"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017559"
FT                   /db_xref="InterPro:IPR019479"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14994.1"
FT                   /translation="MSSLINTQVQPFKANAYRNGEFIEVTDADLKGKWSVLIFMPAAFT
FT                   FNCPTEVEDAAEHYAEFQKIGAEVYIVTTDTHFSHKVWHETSPAVGKARFPLVGDPTHQ
FT                   LTRAFGVHIEHEGLALRGTFVINPEGVIKTVEIHDNAIARDVTETLRKLKAAQFVASHP
FT                   GEVCPAKWKEGEKTLKPSLDLVGKI"
FT   gene            515523..516356
FT                   /gene="hemK"
FT                   /locus_tag="XALC_0461"
FT   CDS_pept        515523..516356
FT                   /transl_table=11
FT                   /gene="hemK"
FT                   /locus_tag="XALC_0461"
FT                   /product="probable methyltransferase hemk protein"
FT                   /function="dna structure level; methylation go:0006306"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14995"
FT                   /db_xref="GOA:D2UBH1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14995.1"
FT                   /translation="MNAPTPESLLRAACTQVARGDAEVLLIHALQRDRAWLFAHAREPL
FT                   SAETVAVFRGLVARRAQGEPVAYLTGRRGFWTLDLAVGPATLIPRADTERLVELALERL
FT                   DMQPGRRVADLGTGSGAIALALASERPRAQVLATDLSAAALAVAEANMLAHGLHNVAFA
FT                   HGAWLVPLAGQRFDLIASNPPYIAAGDPHLTQGDLRYEPLSALTSGVDGLDDIRQIVAG
FT                   APAHLRAGGWLLLEHGWDQGNAVRALLTAARFIAVETYQDLELRDRVTLGCWPLA"
FT   gene            516484..517425
FT                   /gene="pip"
FT                   /locus_tag="XALC_0462"
FT   CDS_pept        516484..517425
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="XALC_0462"
FT                   /product="probable proline iminopeptidase (pip) protein"
FT                   /function="metabolism go:0008152; 3-phenylpropionate and
FT                   3-(3-hydroxyphenyl)propionate degradation go:0019380
FT                   go:0019622"
FT                   /EC_number="3.4.11.5"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14996"
FT                   /db_xref="GOA:D2UBH2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14996.1"
FT                   /translation="MRTLYPKIEPFDSGLLPVDARHTLYYEQCGNPGGKPVLVLHGGPG
FT                   GGCNAKMRCFHDPAKYRIVLFDQRGSGRSTPHADLVDNTTWDLVADIERLREHLRIDRW
FT                   QVFGGSWGSTLALAYAQTHPQRVAELVLRGIFLLRRWELEWFYQEGASRLFPDAWAHYV
FT                   GAIPPVERADLISAFHRRLISDDQAIRLAAAKAWSVWEGATSFLHVDADFVDSHEDPHF
FT                   ALAFARIENHYFVNGGFLEVEDQLLRDAHRIADIPGVIVHGRYDVVCPLANAWDLAKAW
FT                   PKARLEITPASGHSAFEAENTDALIRATDSFA"
FT   gene            complement(517519..518316)
FT                   /locus_tag="XALC_0463"
FT   CDS_pept        complement(517519..518316)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0463"
FT                   /product="putative n-formylglutamate amidohydrolase
FT                   protein"
FT                   /function="metabolism go:0008152; histidine degradation
FT                   go:0006548"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14997"
FT                   /db_xref="GOA:D2UBH3"
FT                   /db_xref="InterPro:IPR007709"
FT                   /db_xref="InterPro:IPR011227"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14997.1"
FT                   /translation="MVEPAPAQLTPLLGADDPDVFAIHRPQGTSPFVLLADHAGRTVPR
FT                   ALANLDLPQHELDRHIGWDIGIVGVTRALSTLLDAWAIEQTYSRLLIDCNRPLTSPTLI
FT                   AETSDGTVVPGNAGLSAAQRQQRIAAVHTPYHARIAAELDARRASARPTLLVMMHSFTP
FT                   VMHGVSRPWHAGVLYHRDTRFAHPLLQALREAGDLIIGDNAPYAVSDTSDYAVPVHGEG
FT                   RGLLHAELEIRQDLIADDAGQHAWAQRLARILTTLQPQLLAIA"
FT   gene            complement(518309..518878)
FT                   /locus_tag="XALC_0464"
FT   CDS_pept        complement(518309..518878)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0464"
FT                   /product="putative nudix hydrolase family protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14998"
FT                   /db_xref="GOA:D2UBT3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14998.1"
FT                   /translation="MTRELPMNHQNSPPRIVYEGKYQRMVVRGTWEYSERVHAGGLAAI
FT                   IIAVTPDDEVLFVEQFRVPLQARTIEMPAGLVGDIDAGESIEVSAVRELEEETGWTAAH
FT                   AEVLMIGPTSSGASSEKIAFVRATGLRKVGDGGGDANEDITVHTVPRARAAAWLVQKMD
FT                   EGYALDPKLWAGLWMIEHHLDGTARG"
FT   gene            complement(518980..519903)
FT                   /locus_tag="XALC_0465"
FT   CDS_pept        complement(518980..519903)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0465"
FT                   /product="putative exonuclease protein"
FT                   /function="metabolism go:0008152; macromolecule degradation
FT                   go:0009057; dna go:0006308"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBA14999"
FT                   /db_xref="GOA:D2UBT4"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR038969"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA14999.1"
FT                   /translation="MNPATPASRPLYLIDASLYVFRAWHAIPDEFQDAQGWPTNAVHGF
FT                   ARFLLDLLERERPQHIVVAFDEALDTCFRHRLYPAYKANRAPAPDALRRQFAHCQALCA
FT                   ALGLCVLADHHYEADDLIGSALHRARGDGFHGVIVSADKDLSQLLLECDEQWDYGRGQR
FT                   WGAAGVKARYGVHAQQIADYLALSGDAIDNIPGVTGIGTKSAAILLAHFGDLDTLLARV
FT                   DEVAFLRLRGAAQMAVRLREQRQHALLWRQLTTIALDAPLHTATPQFTRGTADTDILLG
FT                   LCETLRFGPLTRRRLLQAAGLETTPN"
FT   gene            complement(519900..520475)
FT                   /locus_tag="XALC_0466"
FT   CDS_pept        complement(519900..520475)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0466"
FT                   /product="putative nitroreductase family protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15000"
FT                   /db_xref="GOA:D2UBT5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15000.1"
FT                   /translation="MHTLHSLQALDARRSVPSMQLGEPGPDAATLLAMLQSAVRVPDHG
FT                   KLVPFRFLRIAGQARLTLGDFLAERSLQRDPAAPAAAVEKDRQRFAHAPVVIAVIACLQ
FT                   RGHKVPEIEQWLTAGSVCFALLQAAQAYGFGAQWLTGWMAYDDAVAARLGLAEHERIAG
FT                   FIHLGTAQIQAPERERPDPRRLLSDWTP"
FT   gene            521007..523283
FT                   /locus_tag="XALC_0467"
FT   CDS_pept        521007..523283
FT                   /transl_table=11
FT                   /locus_tag="XALC_0467"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15001"
FT                   /db_xref="InterPro:IPR012434"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15001.1"
FT                   /translation="MSFSPSPHAYTARDPRLLTQAREGMLSVLDTAFAEALTHFDDVLF
FT                   DHAETAGTSQLLFLDGMRELRRRRQDIAARFHAQLQAAWQALEAGAPLSAEVAMAGYEH
FT                   SLSLVSEHELELRLAVRNLASVLLREWKSVLGRIDLRLGWIAGGLELDADTNPVGPEHI
FT                   GVAVHAAFSNSDLEPEVRLLLIKLCERDLAVGIGQFYQELDDRLAEAGVMPEIPRSPPP
FT                   PKHPAHHEVSSVQADAEGDDDAIYSPAWARRFVKRWAERRGSAPAATRDGTARLPEDAQ
FT                   DVLLEALQDLLQQTRNARDTATSAARTAVGQQRALSPREMMSVLSLLQATPSATQRAVV
FT                   GDESESLAHRLKSEMLSTVAQCGLDPADARLDPVDEDAIDLVGMLFDVMLDERELDGRS
FT                   GELIGRLLVPLVKVALLDRRMFVQKTHPARRLLNSLTEACEGNTGETQNERVLMVKVEE
FT                   IIERLLAEFNENMAIFLTLEEEFREFLAQHRRRVEIAERRAAETQRGQEKLELARQRAE
FT                   AELQARLHNRQLPQALEDFLRRPWQHYLTMVMLREYADSPNVREAIALADGLLEEAAEA
FT                   QRHIVGRPWLQAWQEPLYKIFASVGLHSEAVTAAFDALHDTLRAVAELRPELERRLPEL
FT                   PQLALPQALAQEVQPVEVAAPEAVDDFDSADADRFRAMDTGTWLDFVDRDSNVQAGKLS
FT                   WVSPISSRLLFVNRRGARLCVASPEELALMVRLGRLRNHVDDGAFDSALQCVVERLDAC
FT                   SVTLH"
FT   gene            523460..524542
FT                   /locus_tag="XALC_0468"
FT   CDS_pept        523460..524542
FT                   /transl_table=11
FT                   /locus_tag="XALC_0468"
FT                   /product="putative nad(p) transhydrogenase subunit alpha
FT                   protein"
FT                   /function="metabolism go:0008152; unassigned reversible
FT                   reactions"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15002"
FT                   /db_xref="GOA:D2UBT7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15002.1"
FT                   /translation="MAVQVLVVKESAPGERRVAATPETVKKLCALGAQVRIEPDAGASA
FT                   GFVDAAYLAAGAQHADAESPAQADLVLCVQPLPVQALEQLKEGAGVVGMLQPQADPARA
FT                   AALQARHLVAFPLERLPRTTRAQAMDVLSSQAGMAGYKATLIAAQLAPRFFPMLTTAAG
FT                   TIRPSKVLVVGAGVAGLQAIATAKRLGAQVEGFDVRPETREQIESLGGKFLDLGVSAVG
FT                   EGGYARQLSDAERVEQQQRLAEHLKGIDVVVCTAAVPGQPAPKILSAEMVAGMRPGSVV
FT                   VDLAAETGGNCALTRPGETIEHGGVIVAGPLHLASMGAVHASEMYARNVYNFVALFLKD
FT                   GTITYDWNDELLAKTRWHPA"
FT   gene            complement(524550..525041)
FT                   /locus_tag="XALC_0469"
FT   CDS_pept        complement(524550..525041)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0469"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15003"
FT                   /db_xref="InterPro:IPR021455"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15003.1"
FT                   /translation="MNRPIRFSLALTLLASHVIPAVCATPPTPPAPAVVDAQSGSPLPD
FT                   WEHLSPQQRELLIAPLRQRWNDAPSQRQRMFEHAQRWQSMTPEQRAHAREGARRYEAMT
FT                   PQQREEAQAVFAYMRTLPPEQRKTLRDRLDAMTPAQRTAWIKANLGASAPMPDPARPLP
FT                   "
FT   gene            complement(525047..525448)
FT                   /locus_tag="XALC_0470"
FT   CDS_pept        complement(525047..525448)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0470"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15004"
FT                   /db_xref="GOA:D2UBT9"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBT9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15004.1"
FT                   /translation="MTSDPTRSAAFDARMRALHQAGLRALPASTLARLRAARQQAGHLD
FT                   QAKRSHARRLGWLLAAAPALLGVVLGMQQLLQPRSAPETASATAANATTSTTFAAVTTD
FT                   AEETTPPGMLDENPDLYLWLGSDTALAME"
FT   gene            complement(525445..526023)
FT                   /locus_tag="XALC_0471"
FT   CDS_pept        complement(525445..526023)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0471"
FT                   /product="putative rna polymerase ecf-type sigma factor
FT                   transcription regulator protein"
FT                   /function="transcriptional level go:0006355; sigma factors,
FT                   anti-sigmafactors go:0016987 go:0016989"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15005"
FT                   /db_xref="GOA:D2UBU0"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15005.1"
FT                   /translation="MLVSPPALLPPLPEADDAATRPSPASLEAFLADIGPRAFRFAEAG
FT                   LRQREDALDAVQDAMIKLLSYRARPAQEWTPLFWSILRRRIIDLQRRRNFRLRFWAPAS
FT                   DRDADNFPEWADDSPNPAQQHEQRQTHARLVAALRTLPARQREAFTLRVLEELDVTTTA
FT                   HAMGCSEGSVKTHLSRAREALQKHLEDLR"
FT   gene            526132..526485
FT                   /locus_tag="XALC_0472"
FT   CDS_pept        526132..526485
FT                   /transl_table=11
FT                   /locus_tag="XALC_0472"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15006"
FT                   /db_xref="GOA:D2UBU1"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15006.1"
FT                   /translation="MMRRTGVVPWRANAMNDGFVALYIFMLAAIAGHVIISRVPVILHT
FT                   PLMSGSNFIHGIVLIGAMVVLGHANTPLEKVLGFVAVLLGAGNAAGGYVVTERMLDMFK
FT                   SSKPDPHKTKAQD"
FT   gene            526616..528058
FT                   /locus_tag="XALC_0473"
FT   CDS_pept        526616..528058
FT                   /transl_table=11
FT                   /locus_tag="XALC_0473"
FT                   /product="putative nad(p) transhydrogenase, beta subunit
FT                   protein"
FT                   /function="metabolism go:0008152; unassigned reversible
FT                   reactions"
FT                   /EC_number="1.6.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15007"
FT                   /db_xref="GOA:D2UBU2"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15007.1"
FT                   /translation="MELLPILIKSSYLVAATLFLLGLQRMASPRTARSGIHWAGSGMLL
FT                   ATVATFLLPGLHNLPLIVLAIVLGTGAAWMSAKKVAITDMPQMVALYNGMGGGSAAAIG
FT                   AVELLRYAFLMQRDTTYWSADAIAALAARHPGMITLVLAVVGSAIGAVSLSGSIVAWAK
FT                   LDGRLDKRVVFPAQQPFNLLVLVAMLGVGGWAVVSLSPLAILVFFVLALALGVLMTLPI
FT                   GGADMPVVISLYNAFTGLAVAFEGNVLGNEALIIAGMMVGAAGILLTRLMAKAMNRPIR
FT                   GVLFSHFGGGGQAQAIDGSQKPIEADDVAAMMAYAERVVIVPGYGMAVAQAQHKIWELA
FT                   QRLSERGVKVKFAIHPVAGRMPGHMNVLLAEAGVPYDLIADMDDINPEFASTDVSLVIG
FT                   ANDVVNPVAKTDPASPIYGMPILDVIASKHVIVIKRGKGTGFAGIENALFYADNTRMLY
FT                   GDGAEAAGALVSALKMLDGGGH"
FT   gene            complement(528095..528514)
FT                   /locus_tag="XALC_0474"
FT   CDS_pept        complement(528095..528514)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0474"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15008"
FT                   /db_xref="GOA:D2UBU3"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15008.1"
FT                   /translation="MPPSSTPARPAHWLWPLLLGLGCFTALIAWLVAALSLGHQAGWMA
FT                   VLVALEIAWMLRVGTLPRGTLRAALAVIATVLVIVAANWGIAAAQIGAALGLNVWDSAL
FT                   KMGAQYAWTLTVLANRPGDLLWLCIGVCTAYFSAR"
FT   gene            528621..529172
FT                   /locus_tag="XALC_0475"
FT   CDS_pept        528621..529172
FT                   /transl_table=11
FT                   /locus_tag="XALC_0475"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15009"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR017776"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB57"
FT                   /protein_id="CBA15009.1"
FT                   /translation="MYSRSSEPVQFERDCAAVMVPQGDAVTLPAGSYGYITQALGGSYT
FT                   VFVEGNLFRIAGKDGDAIGKEPPPGLELPEDAGDEQVETLIWQQLRTCFDPEIPFNIVD
FT                   LGLIYDVAMRPREDGKRTVEVKMTLTAPGCGMGEILVDDVRSKLEMIPTVAQADVELVF
FT                   DPPWGRHMMSEAARLETGML"
FT   gene            529301..530380
FT                   /locus_tag="XALC_0476"
FT   CDS_pept        529301..530380
FT                   /transl_table=11
FT                   /locus_tag="XALC_0476"
FT                   /product="putative branched-chain amino acid
FT                   aminotransferase protein"
FT                   /function="metabolism go:0008152; building block
FT                   biosynthesis; amino acids go:0008652"
FT                   /EC_number="2.6.1.42"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15010"
FT                   /db_xref="GOA:D2UB58"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB58"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15010.1"
FT                   /translation="MHFRLIPSTAARSAEERARILAAPGFGHFFTDHMVAIAWSREQGW
FT                   HDAQVRAYGPLALDPAASVLHYGQEIFEGIKAYRHADASIWTFRPEANGKRLQRSAQRL
FT                   ALPELPVELFVESLRQLIAVDAAWVPSAPETSLYFRPFMIADEAFLGVRAAHQASYYVI
FT                   ASPAGAYFAKGVAPVAIWLSTDYARAAKGGTGAAKCGGNYAASLLPQQQAQAQGCSQVL
FT                   FLDPVEGKYLEELGGMNVFLVMRDGSLVTPALSGSILDGITRDSILQLARDRGMPVVER
FT                   QVSIDEWRDGVASAEITEVFACGTAAVVTPIGQLKGTDFSVGDLSAPAGPVTLSLRQEL
FT                   TDIQYGRVADRHGWLVRLD"
FT   gene            complement(530510..530995)
FT                   /locus_tag="XALC_0477"
FT   CDS_pept        complement(530510..530995)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0477"
FT                   /product="putative asparaginase protein"
FT                   /function="metabolism go:0008152; carbon compound
FT                   utilization; amino acids go:0009063"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15011"
FT                   /db_xref="GOA:D2UB59"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB59"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15011.1"
FT                   /translation="MEQLLIVTTGGTIDKIYFDDKSDYQIGDPQIGQILKELGVTFRFS
FT                   VIPILRKDSLHITDADRELIRATVAAQSARHVLITHGTDSMVQTGKALQTLQNKTIVMT
FT                   GALNPARFRGSDAEFNIGCAVGAVQSLPPGVYIAMNGQIWDPQKVRKNVAANRFEAI"
FT   gene            complement(531073..531441)
FT                   /locus_tag="XALC_0478"
FT   CDS_pept        complement(531073..531441)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0478"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15012"
FT                   /db_xref="GOA:D2UB60"
FT                   /db_xref="InterPro:IPR018643"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB60"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15012.1"
FT                   /translation="MNTLRPHLALSAALLALATLFAVWFYDDRQRLAVLVVFALPPLLL
FT                   LIGVLRGAALARFWSGVAALLWFSHGVMIAWSRPTQRGFGWIELLLAVLVVGLSSAPGI
FT                   RARFAHKRAATAHRDKGA"
FT   gene            complement(531438..532034)
FT                   /gene="wrbA"
FT                   /locus_tag="XALC_0479"
FT   CDS_pept        complement(531438..532034)
FT                   /transl_table=11
FT                   /gene="wrbA"
FT                   /locus_tag="XALC_0479"
FT                   /product="probable flavoprotein wrba (trp repressor binding
FT                   protein)"
FT                   /function="metabolism go:0008152; tryptophan go:0000162"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15013"
FT                   /db_xref="GOA:D2UB61"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010089"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB61"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15013.1"
FT                   /translation="MAEILVLYYSRGGSVARLARHIARGVDEVPGMAARLRTVPPVAAV
FT                   TQTSAPPVPDSGAPYVGTNDLHECVGLALGSPTRFGNMAAPIKHFIDGLGAEWASATLA
FT                   GKPAAVFTSTASQHGGQEATLLSMHLPLLHHGCLIVGIPYTEPLLSSTRSGGTPYGASH
FT                   VAGADDDPQPSEEEAHLARALGRRLADIAQRLSGA"
FT   gene            532111..533385
FT                   /locus_tag="XALC_0480"
FT   CDS_pept        532111..533385
FT                   /transl_table=11
FT                   /locus_tag="XALC_0480"
FT                   /product="putative trna-processing ribonuclease bn (rnase
FT                   bn) protein"
FT                   /function="information transfer; rna related go:0016070;
FT                   rna modification go:0009451"
FT                   /EC_number="3.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15014"
FT                   /db_xref="GOA:D2UB62"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB62"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15014.1"
FT                   /translation="MQPLDTVNLWTERVRDHARMRSFAAFLWQRFLDDRLFQAAASLAY
FT                   TTIFALVPLAVVVFGVLSAFPVFNEWSDQLSDYIFSHFVPAAARSVEAYLRQFSASAGQ
FT                   LTTAGVIALMVSLLITLHSIEQTFNQIWRVVSARPQLSRFLVYWTVLTLGALLAAASLA
FT                   VSARFFALPLFKTSQGQWLAQLVLSMAPVLIECVCITLVYRVVPHHTVRLRHALPGALL
FT                   AVVLLELVKCGLSLYLGGFQSYQRIYGTVAFVPIFLLWIYMSWIAILLGASVSSSISAF
FT                   RYQPASMRLPAGYEIYGLLRLLGRFVQARKQGLGLQQERILQLEPMLTDALVQQLLGEL
FT                   ERIRLLSRTEQGDWILARDLAEVPLAELYENCQLRIPIVEAYLPCRDDALGQAACCALD
FT                   QLRLPLRETLKRRVGDLYPEIGDLA"
FT   gene            533382..533987
FT                   /locus_tag="XALC_0481"
FT   CDS_pept        533382..533987
FT                   /transl_table=11
FT                   /locus_tag="XALC_0481"
FT                   /product="putative redoxin protein"
FT                   /function="cell processes go:0009987; other stresses
FT                   (mechanical, nutritional, oxidative) go:0009612 go:0007584
FT                   go:0006979"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15015"
FT                   /db_xref="GOA:D2UB63"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB63"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15015.1"
FT                   /translation="MTALRILFPLFATAALLTGCNRQPAPTRTDDRATSASASPSTAPA
FT                   APPVAGPEVVQQTRAQPRLKMMAVDGHVYDLAAHRGQWVVVNFWATWCAPCLKEMPELS
FT                   ALHVMRDNIKVVGLAYEDIELAQMQAFLKQHPVAYPIVIVDTYKPPADFATPRGLPMTY
FT                   LIGPDGKLVKQFLGPVTARDIEAAIAAAGAPAPGKAAG"
FT   gene            complement(534089..534433)
FT                   /locus_tag="XALC_0482"
FT   CDS_pept        complement(534089..534433)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0482"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15016"
FT                   /db_xref="GOA:D2UB64"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB64"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15016.1"
FT                   /translation="MPLDTTLRLLAKASGMSAADIAAAIPRAGATTVKAWMAGEKMPGR
FT                   TQLNALARTFGVPAGALLGELANQLDPARTRGEHDLLLAFRKLDTRQQAALLEVARSMA
FT                   GTRKRSGGNK"
FT   gene            complement(534447..534965)
FT                   /gene="moaB"
FT                   /locus_tag="XALC_0483"
FT   CDS_pept        complement(534447..534965)
FT                   /transl_table=11
FT                   /gene="moaB"
FT                   /locus_tag="XALC_0483"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   b"
FT                   /function="metabolism go:0008152; molybdenum
FT                   (molybdopterin) go:0006777"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15017"
FT                   /db_xref="GOA:D2UB65"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB65"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15017.1"
FT                   /translation="MSANTNFIPLHVCVLTVSDTRTLAEDSSGNYLVSALGAAGHRLSA
FT                   RELLPDDRYRIRAVVSAWIADPQVDGILVTGGTGFTGRDSTPEALLPLLDKQMPGFGEL
FT                   FRAISVEEIGTSSLQSRAFAGLANATFLFCLPGSTSACRTAWDKIIAAQLDARTRPCNL
FT                   ATLRPRLKE"
FT   gene            complement(535276..537399)
FT                   /locus_tag="XALC_0484"
FT   CDS_pept        complement(535276..537399)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0484"
FT                   /product="putative 1,4-beta-cellobiosidase (exoglucanase)
FT                   protein"
FT                   /function="metabolism go:0008152; polysaccharides
FT                   go:0000272"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15018"
FT                   /db_xref="GOA:D2UB66"
FT                   /db_xref="InterPro:IPR001919"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR016288"
FT                   /db_xref="InterPro:IPR036434"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB66"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15018.1"
FT                   /translation="MKTSKSTGNRLKYKATASLLSVCLLSSLSAHAQSRVDNPFVGATS
FT                   YVNPDYTVDIDSSIAKVSDPALIAKMQTAKTYPTFIWLDSIGAIYGGNRNAGLLGLRDH
FT                   LNSALAQKTAGQTMLVGLVIYDMPGRDCHALSSNGELPLTQDALARYKTEYIDVIAGIL
FT                   ADPQYKDLRIVNVVEPDSLPNLVTNLSTPACGQASSTGIYEAAIKYAINKLHAIPNTYN
FT                   YLDIAHSGWLGWPNNMDKTIPLYTRIFQDTTAGLASIDGFATNTANTTPTTEPNLPNSD
FT                   MNVGGQPLRSSTFYQWNPIFDENHYVQTLYNNFVSAGWSSQIGFLIDTSRNGWGGPNRP
FT                   TSASGNDVNTYVNSGRVDQRLARGNWCNPSGAGMGAPPTTAPLPHVDAFVHIKEPGVSD
FT                   GSSRYIPNDQGKGADGMCDERYTTPDGVLTGALPNSPISGAWFHNQFVMLVQNAYPAIP
FT                   GSTSGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGG
FT                   GSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTGG
FT                   GGSTGGGGSTGGGGSTGGGGSTGGGGSTGGGGSTANPFDVQYTVNSDWGAGYCETISVT
FT                   NKRGSTKAQWNITVPILGKVSSSNINLWSGMWTPNTDASGAVQSLQVSGMDWNRYVDPQ
FT                   QTTTLGFCATRSN"
FT   gene            complement(538238..539947)
FT                   /locus_tag="XALC_0485"
FT   CDS_pept        complement(538238..539947)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0485"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15019"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB67"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15019.1"
FT                   /translation="MSGGDADALRHLRETVRRDPQDFLAWVMLADAELGAGAIAAGEHA
FT                   ALRGLQLRPGHPEALARLGRVRWTQGRHADAAHALRLALHQAPQHPGIALWLGHALEDN
FT                   GEAEDAAHAYAHAYALLPQEPSIVAHLLNWRRKLCDWRDLDALSQQVRAAVRQGHPTIE
FT                   PFAFLNEDAAPAEQLRCARNRAEALAHTLTPLPTTAMRQHGPLRIGFLSNGFGAHPTGL
FT                   LTVALFEHLRAHADLQIHLFALNGEDRSTIRARLQAAAHTWHSVTAQAHRTIAQRIRET
FT                   GIDVLLDLRGWGGGGTPEVLALRPAPVQINWLAYPGTSGAPWMDYVIADGYALPPPLTA
FT                   HYSERVLRLTRAFQPSDTTRHVGTPPSRHDCGLPEAGTVFCCFNNSYKLSPRSMARMLA
FT                   VLRQVPDSVLWLLSGPGQADARLREAACKADLEPTRLRFMPKLAHPEYLSRYRHADLFL
FT                   DTHPYNAHTTASDALWAGCPVLTCPGNTFAARVAGSLNHHLNMDDMNVVDDDAFIATAV
FT                   RLGRDPSALHVLRERLRQRRASSGLFDMQGFAADFAALLRAVAREHGWRHFA"
FT   gene            complement(539970..541055)
FT                   /gene="prfA"
FT                   /locus_tag="XALC_0486"
FT   CDS_pept        complement(539970..541055)
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="XALC_0486"
FT                   /product="probable peptide chain release factor 1 (rf-1)
FT                   protein"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15020"
FT                   /db_xref="GOA:D2UB68"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB68"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15020.1"
FT                   /translation="MTPTLRRKLEALAERREELERLLSDPEVVSDHQRFRDYSREFAQL
FT                   QPVATALAEETAAKANLASAEAMRADPELRELAEEEIAAAQAHLADLDAQLALLLVPRD
FT                   PRDDGNLFLEVRAGTGGDEAAIFAGDLFRMYARYAERQGWKVEVESDNPGEHGGYKEIV
FT                   ARIVGRGAYSKLKFESGTHRVQRVPATESQGRIHTSAATVAIIPEADDVEEIAVNPADL
FT                   KIDTFRSSGAGGQHVNKTESAIRITHVPSGVVVECQTERSQHANRDKALKRLKAQLLDA
FT                   ERNKQAAAEAQDRKLQVGSGDRSQRIRTYNFPQGRITDHRVEGLTLYDLPHVIEGDLDA
FT                   LIERLSHEHQVDALARLSDSA"
FT   gene            complement(541033..542316)
FT                   /gene="hemA"
FT                   /locus_tag="XALC_0487"
FT   CDS_pept        complement(541033..542316)
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="XALC_0487"
FT                   /product="probable glutamyl-trna reductase (glutr) protein"
FT                   /function="metabolism go:0008152; heme, porphyrin
FT                   go:0006783 go:0006779"
FT                   /EC_number="1.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15021"
FT                   /db_xref="GOA:D2UBH4"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH4"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15021.1"
FT                   /translation="MTLWVLGLNHQTAPVDLRERVAFAGDALPHALQSLRALPEVTEAA
FT                   LLSTCNRTELYAIADDAQQLADWLNSHAADLRSHLYQHQDADAVRHLFRVATGLDSMVL
FT                   GEPQILGQVKDAWALAREHGAMGNRLDRLFQQTFAVAKRARTDTRVGANPVSVASTAVR
FT                   LAQDAFARLNESTVLLVGAGETIELTAKHLSEGRVQRLLIANRTLAHAQELASRHGGVA
FT                   LPLSELERHLHEADVVFSATAAPAPVITRVQVEQALRARKHKPMLLFDLAVPRDIATDV
FT                   AELADAYLYTVDDLERAVEDNRRGRREAAQAAEAIIDLQVVRYMETLQASTRQAPLKRL
FT                   RAHGDSTRDDVLAKARQQLAHGKPAEEVLDFLANTLTNRLLHPPTAALRAEALRGDSEL
FT                   ARAAERLFPEKPGYFHPLLKPDDTDPAP"
FT   gene            542383..544053
FT                   /locus_tag="XALC_0488"
FT   CDS_pept        542383..544053
FT                   /transl_table=11
FT                   /locus_tag="XALC_0488"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15022"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15022.1"
FT                   /translation="MPALIRIRTFLLLSVIAVVAAPVGAKPARPEQGVLTPVLAGEFAL
FT                   QAGQLADATRWYLQAANDSPGDVGLAERVTRIAMLANDSKAAAQALALWRQRAPASLAM
FT                   RSAEAALALRGGNLHQARSLLVALLRDKDPRGWRFALMALASGNRDPEVAAKALDQLLD
FT                   ANAIPNQLEAWQEFGRLALRLEQPKLAERIVDQLVKRFPSEPRVALLHATQLQQAGKVE
FT                   QARALLQGVEPKVAMDPELRAALAYAYDAIGDTASAARVLALGPQSTENYGLRASMLSK
FT                   LQDDVALTALYDELRKGANRPDPERRLLLGKIAEFLKRNQEAVDWYRGVPSGPLRSEAR
FT                   LRMADALYGLGQKDAAFAEARALQDDANADDAARRDAYVLEAELRQRSGDDAGELQVFE
FT                   RGLAAYPDDSALLYARGLAWERRDRIDRAEADLRKILVTEPDNVAALNALGYTLADRTK
FT                   RYREALELIDRARTADPDNAAIIDSYGWVLYRLGKTQEALVQLRRAWSLLKDPEIAAHI
FT                   GQLLWEQGKHEEANTYFEAARKLDPNNRALQRAMEKAVP"
FT   gene            544050..544700
FT                   /gene="lolB"
FT                   /locus_tag="XALC_0489"
FT   CDS_pept        544050..544700
FT                   /transl_table=11
FT                   /gene="lolB"
FT                   /locus_tag="XALC_0489"
FT                   /product="probable outer-membrane lipoprotein lolb
FT                   precursor"
FT                   /function="cell structure go:0005575; membrane go:0009274"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15023"
FT                   /db_xref="GOA:D2UBH6"
FT                   /db_xref="InterPro:IPR004565"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15023.1"
FT                   /translation="MKALLCAAWGGLAVLALAGCAGMPSRPPAPVVGAPDMAARQAEKA
FT                   RAQWLQAQPNWSFQGRVAVSNGRNGGSGRIDWAQHGRGYDVQLSAPVTRQSWRLRGDSQ
FT                   SGAGRLDGLEGGVRAGEDAQQVLLQATGWEIPVNLLPDWVRGLVARNARAPERLDDDAQ
FT                   GRPHLLRQMGWDIEFQEWYPPAAGRPPLPRRIEARSGDAKVRLLVDQWDIPAS"
FT   gene            544679..545560
FT                   /gene="ispE"
FT                   /locus_tag="XALC_0490"
FT   CDS_pept        544679..545560
FT                   /transl_table=11
FT                   /gene="ispE"
FT                   /locus_tag="XALC_0490"
FT                   /product="probable
FT                   4-diphosphocytidyl-2-c-methyl-d-erythritol kinase protein"
FT                   /function="metabolism go:0008152; isoprenoid biosynthesis
FT                   go:0008299"
FT                   /EC_number="2.7.1.148"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15024"
FT                   /db_xref="GOA:D2UBH7"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH7"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15024.1"
FT                   /translation="MGHSGVMIQASDGGWSYWPAPAKLNLFLQITGRRADGYHQLQTVF
FT                   RLLDWGDTVSVRPRADGVVVRIGPSVAGVAEADDLLVRAAILLQKEAKIAKGVDIRVEK
FT                   RIPAGGGFGGGSSDAATVLVALNALWGAGLDEDALARLGLSLGADVPVFVRGRDAWAEG
FT                   IGERLTPIALPPAWYVLVDPGVHVPTATLFQSADLTRDAAPAKIADFVSGFLLGNAFEP
FT                   VLLRREPAVQAAFQALARIGTPRLTGSGSGCFVEFADRAAAQRALADLPNGMRAWVAGG
FT                   VARSPLLDALEV"
FT   tRNA            545573..545649
FT                   /gene="tRNA-tRNA_Gln"
FT                   /product="transfer RNA-typeGln,AnticodonTTG"
FT   gene            545788..546747
FT                   /gene="prs"
FT                   /locus_tag="XALC_0492"
FT   CDS_pept        545788..546747
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="XALC_0492"
FT                   /product="probable ribose-phosphate diphosphokinase
FT                   protein"
FT                   /function="metabolism go:0008152; purine ribonucleotide
FT                   biosynthesis go:0009152"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15025"
FT                   /db_xref="GOA:D2UBH8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15025.1"
FT                   /translation="MQDQRNLLVFCGNANKPLAKSICRELGVRAGKAMVSRFSDGEVQV
FT                   EIEENVRRQEVFVLQPTCAPSAENLMELLVLIDALKRASAASVTAVVPYFGYSRQDRRM
FT                   RSSRVPITAKVAAKMFSAVNTDRVLTVDLHADQIQGFFDIPVDNVYASPLLLADIWRAY
FT                   GTDNLIVVSPDVGGVVRARAVAKRLDDADLAIIDKRRPRANVATVMNIIGDVEGKTCVL
FT                   VDDIVDTAGTLCAAAAALKAQGALKVAAYCTHPVLSGPAVSNITNSQLDELVVTDTIPL
FT                   SEAARACGKIRQLSVAELLAETIRRIAFGESVSSLYVD"
FT   gene            546859..547503
FT                   /locus_tag="XALC_0493"
FT   CDS_pept        546859..547503
FT                   /transl_table=11
FT                   /locus_tag="XALC_0493"
FT                   /product="putative 50s ribosomal protein l25"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15026"
FT                   /db_xref="GOA:D2UBH9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020055"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBH9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15026.1"
FT                   /translation="MATTHEIKVQRREVEGKGASRRLRRDGVIPAIVYGGDLKPVNIQL
FT                   DHNEVWLASQNDWFYSSILSLSLNGDVQKVLLRDMQRHPYKQLIMHIDFQRVNDNEVLH
FT                   ASVPLHFLHEDVSPAGKSAEVVVTHELNEIQVVCLPKDLPEFVEVDLSTLSVGDVIHLS
FT                   DLKLPAGVELPQLKLGKEHDVAVVIAKHGRVEEEPEATDAAAAEPAKKDGK"
FT   gene            547561..548145
FT                   /gene="pth"
FT                   /locus_tag="XALC_0494"
FT   CDS_pept        547561..548145
FT                   /transl_table=11
FT                   /gene="pth"
FT                   /locus_tag="XALC_0494"
FT                   /product="probable peptidyl-trna hydrolase (pth) protein"
FT                   /function="information transfer; amino acid-activation
FT                   go:0006418"
FT                   /EC_number="3.1.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15027"
FT                   /db_xref="GOA:D2UBI0"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI0"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15027.1"
FT                   /translation="MTGLRLIVGLGNPGAEHANTRHNAGFRFVDHLLQQAGARWSVEAK
FT                   LFGEIAKVDVAGQSVWLLKPATYMNLSGKSVTAALRYWKIEPAQALLAHDDLDLAPGTV
FT                   RLKFDGGHGGQNGLRDTIRLLGHAGFHRLRIGIGHPGHKDKVVPWVLSRASQADQILID
FT                   RAIDDALAVLPLAVQGDFNEAMKRLHTSRDS"
FT   gene            548223..549314
FT                   /locus_tag="XALC_0495"
FT   CDS_pept        548223..549314
FT                   /transl_table=11
FT                   /locus_tag="XALC_0495"
FT                   /product="putative gtp-binding protein"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15028"
FT                   /db_xref="GOA:D2UBI1"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15028.1"
FT                   /translation="MGIKCGIVGLPNVGKSTLFNALTKAGIAAANFPFCTIEPNVGVVP
FT                   VPDPRLGALAAIIHPQKVVPTAVEFVDIAGLVAGAASGEGLGNKFLAHIREVDAITHVV
FT                   RCFEHGDIIHVNNKVDPVSDIETIDIELALADLDSVEKALNRAERAAKGGDKDAAARKP
FT                   VLAKLQAALADGKPGRSAGLDEEEKTLVRDLFLLTLKPVMYIANVLEDGFENNPHLEAV
FT                   RARAAAEGAQVVPVSAAIEEELSQLDDADRDAFLVDLGLQEPGLNRVIRAAYALLGLQT
FT                   YFTAGVKEVRAWTVKVGATAPQAAAVIHTDFEKGFIRAETIAYDDFIKYKGEAGAREAG
FT                   RLRLEGKEYRVQEGDILHFRFNV"
FT   tRNA            549483..549568
FT                   /gene="tRNA-tRNA_Tyr"
FT                   /product="transfer RNA-typeTyr,AnticodonGTA"
FT   tRNA            549601..549674
FT                   /gene="tRNA-tRNA_Gly"
FT                   /product="transfer RNA-typeGly,AnticodonTCC"
FT   tRNA            549713..549788
FT                   /gene="tRNA-tRNA_Thr"
FT                   /product="transfer RNA-typeThr,AnticodonGGT"
FT   gene            549836..551026
FT                   /gene="tuf"
FT                   /locus_tag="XALC_0499"
FT   CDS_pept        549836..551026
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="XALC_0499"
FT                   /product="probable elongation factor tu (ef-tu) protein"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15029"
FT                   /db_xref="GOA:D2UBI2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15029.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAALTKVGAERFGGEFK
FT                   AYDAIDAAPEEKARGITISTAHVEYESPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPHIVVFLNKADMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIHGSARLALEGDQSEIGVPAILKLVEALDTFIPEPQRDVDKPFLMPVEDVFS
FT                   ISGRGTVVTGRIERGVIKVGDEIEIVGIRATQKTTVTGVEMFRKLLDQGQAGDNAGLLL
FT                   RGTKRDDVERGQVLCKPGTIKPHTQFEAEVYVLSKDEGGRHTPFFPGYRPQLYFRTTDI
FT                   TGEVQLPEGVEMVMPGDNVKMTVTLINPVAMDEGLRFAIREGGRTVGAGVVAKIIK"
FT   tRNA            551192..551267
FT                   /gene="tRNA-tRNA_Trp"
FT                   /product="transfer RNA-typeTrp,AnticodonCCA"
FT   gene            551318..551731
FT                   /locus_tag="XALC_0501"
FT   CDS_pept        551318..551731
FT                   /transl_table=11
FT                   /locus_tag="XALC_0501"
FT                   /product="putative preprotein translocase subunit sece"
FT                   /function="the type ii (general) secretory pathway (iisp)
FT                   family go:0015628 go:0015447"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15030"
FT                   /db_xref="GOA:D2UBU4"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15030.1"
FT                   /translation="MNSKIEHSKSSAASSGGDVVKYGIAALLVVAGLFVWFWFADPSRA
FT                   TQLGNWSGPLRGLAVVAGLVAGGAVFLLTAKGREAREFLSESRFELRKVVWPTRQEAIR
FT                   TTWVVIVVVIILSLLLGGFDFVIQKLMQWFVSR"
FT   gene            551745..552302
FT                   /gene="nusG"
FT                   /locus_tag="XALC_0502"
FT   CDS_pept        551745..552302
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="XALC_0502"
FT                   /product="probable transcription antitermination protein
FT                   nusg"
FT                   /function="information transfer; rna related go:0016070;
FT                   transcription related go:0006350"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15031"
FT                   /db_xref="GOA:D2UBU5"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15031.1"
FT                   /translation="MKRWYVVHAYSGFEKSVAQALRDRIVRDEMQERFGDVLVPTEEVI
FT                   EMRSGQKRRSERKFFPGYVLVQIETHDEGGIPRIDNESWHLVKETPKVMGFIGGTADRP
FT                   LPIRDQEADAILQRVQDGVEKPRPKVLFEPGQMVRVTDGPFNDFNGVVEEVNYEKSRLR
FT                   VAVLIFGRSTPVELEFGQVEKA"
FT   gene            552505..552933
FT                   /gene="rplK"
FT                   /locus_tag="XALC_0503"
FT   CDS_pept        552505..552933
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="XALC_0503"
FT                   /product="probable 50s ribosomal protein l11"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15032"
FT                   /db_xref="GOA:D2UBU6"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15032.1"
FT                   /translation="MAKKVVGYIKLQVKAGQANPSPPVGPALGQRGLNIMEFCKAFNAA
FT                   TQKLEPGLPTPVIITAYSDRTFTFVTKSTPASVLLKKAAGITSGSKRPNTEKVGKVTRK
FT                   QLEDIAKAKEADLTAAELEAAVRTIAGSARSMGLTVEG"
FT   gene            552937..553635
FT                   /gene="rplA"
FT                   /locus_tag="XALC_0504"
FT   CDS_pept        552937..553635
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="XALC_0504"
FT                   /product="probable 50s ribosomal protein l1"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15033"
FT                   /db_xref="GOA:D2UBU7"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15033.1"
FT                   /translation="MAQTKRQKAIRAAVQPGKAYSIDEALKIIKTTSKAKFVEAVDVAV
FT                   RLGVDAKKSDQQVRGSTVLPAGTGKSVRVAVFAPAGAKADEALAAGAEAVGMDDLAEKM
FT                   QGGDLNYDVVIATPDAMRVVGKLGTLLGPRGLMPNPKVGTVSANPAEAVKNAKSGQVRY
FT                   RTDKAGIIHCTIGKASFEDDALKSNLHALLLDLVKAKPATSKGNYLQKISVSSTMGPGV
FT                   TIDQASLSLK"
FT   gene            554123..554659
FT                   /gene="rplJ"
FT                   /locus_tag="XALC_0505"
FT   CDS_pept        554123..554659
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="XALC_0505"
FT                   /product="probable 50s ribosomal protein l10"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15034"
FT                   /db_xref="GOA:D2UBU8"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15034.1"
FT                   /translation="MALNLSQKQEVVAELADVAAKAHSLVAAEYAGITVSQMTAMRKKA
FT                   RETGVYLRVVKNTLAARAVAGTEYECVQDALVGPLLYAFSTEEPGAAGRLIKEFAKGND
FT                   KLQAKVVSLGGQLYPAAHLEVLASLPTREQALAMLARVLAEPASMFARAVKAVGDKQGG
FT                   GDAAPADAQAQVETA"
FT   gene            554723..555091
FT                   /gene="rplL"
FT                   /locus_tag="XALC_0506"
FT   CDS_pept        554723..555091
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="XALC_0506"
FT                   /product="probable 50s ribosomal protein l7/l12"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15035"
FT                   /db_xref="GOA:D2UBU9"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBU9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15035.1"
FT                   /translation="MSLSNEQIVDAIAEKTLMEVMELVKAIEDKFGVSAAAPVAAAGPA
FT                   VAAAPVEEQTEFNVILIDAGAKKVDVIKAVRAITGLGLKEAKDLTEAGGMLKEAVSKED
FT                   AEKFKKDLEAAGAKVEVK"
FT   gene            555376..559527
FT                   /gene="rpoB"
FT                   /locus_tag="XALC_0507"
FT   CDS_pept        555376..559527
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="XALC_0507"
FT                   /product="probable dna-directed rna polymerase, beta
FT                   subunit protein"
FT                   /function="information transfer; rna related go:0016070;
FT                   transcription related go:0006350"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15036"
FT                   /db_xref="GOA:D2UBV0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15036.1"
FT                   /translation="MTSYSFTEKKRIRKDFGKQRSILEVPFLLAIQVDSYREFLQENTD
FT                   PNKRSDHGLHAALKSVFPISSYSGNAALEYVGYKLGDPVFDERECRQRGMSYGAPLRVT
FT                   VRLVIYDRESSTKAIKYVKEQEVYLGEIPLMTDNGTFIVNGTERVIVSQLHRSPGVFFD
FT                   HDRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDALFTRIDRRRKLPVSILLRALGYSN
FT                   EEMLSEFFEINTFHIDPKEGVQLELVAERLRGETLDFDLADGDKVIVEAGKRITARHVK
FT                   QLEASGIAALAVPDEYLVGRILSHDVVDAATGELLANANDEITEEQLNAFRKAGVDAVG
FT                   TLWVNDLDRGPYLSNTLRIDPTKTQLEALVEIYRMMRPGEPPTKDAAQNLFHNLFFTFE
FT                   RYDLSTVGRMKFNRRVGRKEVIGESVLYDKKYFGERSDEESKRLVAERADSSDILDVIK
FT                   VLTEIRNGRGVVDDIDHLGNRRVRSVGEMAENVFRVGLVRVERAVKERLSMAESEGLTP
FT                   QELINAKPVAAAIKEFFGSSQLSQFMDQNNPLSEVTHKRRVSALGPGGLTRERAGFEVR
FT                   DVHPTHYGRVCTTETPEGPNIGLINSLAVFARTNQYGFLETPYRKVVDGQITDEVEYLS
FT                   AIEENEYVIAQANALHDAKNRLTEQFVPCRYQGESLLKPPAEVHFMDVSPMQTVSIAAA
FT                   LVPFLEHDDANRALMGANMQRQAVPTLRAQKPLVGTGIERAVARDSGVTVNARRGGVIE
FT                   QIDAGRIVVKVNEAEIGGGTDAGVDIYNLIKYTRSNQNTCINQRPLVNVGDAIARGDVL
FT                   ADGPSTDIGELALGQNMLIAFMPWNGYNFEDSILLSERVVEEDRYTTIHIEELTCVARD
FT                   TKLGPEEISADIPNVSEQALNRLDESGVVYIGAEVRAGDIMVGKVTPKGESQLTPEEKL
FT                   LRAIFGEKASDVKDSSLRVPPGMDGTVIDVQVFTRDGIEKDKRARQIEENEIKRVKKDF
FT                   DDQFRILESAIYARLRSQLIGKVANGGPNLKKGDTISDAYLDGLKKSEWFALRMKDEDA
FT                   SDAIERAQKQIQAHEQEFERRFADKRGKITAGDDLAPGVLKMVKVFLAVKRRIQPGDKM
FT                   AGRHGNKGVVSMIQPIEDMPYMANGETVDIVLNPLGVPSRMNIGQVLEVHLGWAAKGLG
FT                   RKIQNMLDAQANVADLRKFLTQIYNHDQKLGEDRVDLDQFSDAELLSLSKNLTDGVPMA
FT                   TPVFDGATEAEIKHMLELADLPISGQTQLYDGRTGEAFDRRTTVGYMHMLKLNHLVDDK
FT                   MHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVQGR
FT                   NQMYKNIVDGEHEMVAGMPESFNVLVKEIRSLAINMELED"
FT   gene            559683..563900
FT                   /gene="rpoC"
FT                   /locus_tag="XALC_0508"
FT   CDS_pept        559683..563900
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="XALC_0508"
FT                   /product="probable dna-directed rna polymerase, subunit
FT                   beta-prime protein"
FT                   /function="information transfer; rna related go:0016070;
FT                   transcription related go:0006350"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15037"
FT                   /db_xref="GOA:D2UBV1"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15037.1"
FT                   /translation="MKDLLNLFNQQRQTLDFDAIKIALASPDLIRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCAAIFGPIKDYECLCGKYKRMKHRGVVCEKCGTEVTLAKVRRERMGH
FT                   IDLASPVAHIWFLKSLPSRIGLMLDMTLRDIERVLYFEAYVVTEPGLTALERRQLLTEE
FT                   QYLTARQEHGDDFDAAMGAEAVYELLRTIDLQSEMTRLREEIASTGSETKLKRLTKRIK
FT                   LIEAFIESGNRPEWMVMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLRR
FT                   LLELNAPEIIVRNEKRMLQESVDALLDNGRRGRAITGTNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLRLHECGLPKKMALELFKPFVFAKLQRRGLATTIKAAKK
FT                   LVEREEADVWDILEEVIREHPVLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCTAFN
FT                   ADFDGDQMAVHVPLSLEAQLEARALMMSTNNILSPANGEPIIVPSQDVVLGLYYMSRAL
FT                   ENKKGEGMVFANIAEVKRAYDNRAVELHAKVKVRITETVIDENGGRSKKTSIVDTTIGR
FT                   ALLAEILPEGLPFALANTELTKKNISRLINSSYRQLGLKDSVVFADKLMYTGFAYATRA
FT                   GVSIGIDDMLIPSEKKGILGEAEQEVLEIQEQYQSGLVTAGERYNKVVDIWSRTNERIA
FT                   KAMMDTIGTEKVVNAKGETIDQKSMNSLYIMADSGARGSQAQIRQLAGMRGLMARPDGS
FT                   IIETPIKANFREGLNVQEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDVVITEP
FT                   DCGTTDGLTMTPIVEGGDVVEPLRDRVLGRVVAEDVFLPGNDEDPIVTRNTLLDEQWVA
FT                   KLEEAGVQSVKVRSTITCESPFGVCARCYGRDLARGHLVNIGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASRAAAVDNITVKTTGSIKFNNLKSVEHANGSLVAVSRSGELSVLDGH
FT                   GRERERYKLAYGATITAKDGDAVKAGQSVANWDPHNHPIVSEVAGFIRFIDFIDGVTVI
FT                   EKTDELTGLASREITDPKRRGTQAKDLRPIVRIVDAKGNDLAIPGTDLPAQYLLPPRSI
FT                   VNLQDGAPVGVGDVVAKIPQEASKTRDITGGLPRVADLFEARKPKDPAILAERSGIISF
FT                   GKDTKGKQRLIIKDADGSEHEELIPKYRNITVFEGEHVAKGETVVDGEPSPQDILRLLG
FT                   VEPLAAYLVKEIQDVYRLQGVKINDKHIEVITRQMLRKVEITDQGNSKFLNGEQAERQR
FT                   VIEENSRLAARNELQAKYEPVLLGITKASLATESFISAASFQETTRVLTEAAVRGTSDT
FT                   LRGLKENVIVGRLIPAGTGLAYHSLRRRNSSGLTESEMQTLSGGSAESTVETATSAAAS
FT                   SDD"
FT   gene            564126..564500
FT                   /gene="rpsL"
FT                   /locus_tag="XALC_0509"
FT   CDS_pept        564126..564500
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="XALC_0509"
FT                   /product="probable 30s ribosomal protein s12"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15038"
FT                   /db_xref="GOA:D2UBV2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15038.1"
FT                   /translation="MATINQLVRKPRQATTYKSSSPALDKCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNQEEVISYIGGEGHNLQEHSVVLIRGGRVPDLPGVRYHTVRGSLDA
FT                   AGVAKRRQGRSKYGAKRPKS"
FT   gene            564513..564980
FT                   /gene="rpsG"
FT                   /locus_tag="XALC_0510"
FT   CDS_pept        564513..564980
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="XALC_0510"
FT                   /product="probable 30s ribosomal protein s7"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15039"
FT                   /db_xref="GOA:D2UBV3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15039.1"
FT                   /translation="MSRKGNTPQRTVLPDPKHGSETIARFINMVMLSGKKSVAEKIVYG
FT                   AMDVIGEKNPNAIELVQKALDNVAPAVEVKSRRVGGATYQVPVEVRSSRRMALAMRWLI
FT                   DSARKRGENSMPRKLAAELLDASENRGGAIKKREETHRMAEANKAFAHYRW"
FT   gene            565120..567210
FT                   /gene="fusA"
FT                   /locus_tag="XALC_0511"
FT   CDS_pept        565120..567210
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="XALC_0511"
FT                   /product="probable elongation factor g protein"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15040"
FT                   /db_xref="GOA:D2UBV4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15040.1"
FT                   /translation="MARTTPIERYRNFGIMAHIDAGKTTTSERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWTGMDKSMPQHRFNIIDTPGHVDFTIEVERSLR
FT                   VLDGAVFVLCAVGGVQPQSETVWRQANKYAVPRLAFVNKMDRTGANFDKVVEQLKARLG
FT                   AYPVPMQVPIGAEDGFEGVVDLVKMKAIHWDTASQGTVFEYRDIPAHLVDKATEARAFM
FT                   VEAAAEANEDLMDKYLNEGDLSEAEILGGLRERTLKVEVVPVYCGTAFKNKGVQAMLDG
FT                   VIQLLPSPSDRPPVKGIDEDEKEDSRAATDSAPFSALAFKIMTDPFVGSLTFFRVYSGT
FT                   LNSGDQVYNPVKSKKERVGRILQMHSNNREEIKEVRAGDIAAAVGLKDVTTGDTLCAQS
FT                   DIITLERMVFPEPVISMAVEPKTKSDQEKMGIALSRLAQEDPSFRVNTDEESGQTIIRG
FT                   MGELHLEIIVDRMKREFNVEANVGKPQVAYRETIRKAVKQEGKFVRQSGGKGQYGHVVL
FT                   EIEPQERGKGYTFENAIVGGVVPKEYIPAVDKGIQEAVANGVMAGYPIVDVKVRLIDGS
FT                   YHDVDSSEMAFKIAGSMGFKEGFNKANPVLLEPIMKVEIVTPEDYLGDVMGDVSRRRGI
FT                   LQGQDDSPSGKVINAMVPLGEMFGYATTLRSMSQGRATFSMEFDHYAEAPANIADSVIK
FT                   KN"
FT   gene            567298..568488
FT                   /gene="tuf"
FT                   /locus_tag="XALC_0512"
FT   CDS_pept        567298..568488
FT                   /transl_table=11
FT                   /gene="tuf"
FT                   /locus_tag="XALC_0512"
FT                   /product="probable elongation factor tu protein"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15041"
FT                   /db_xref="GOA:D2UBI2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI2"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15041.1"
FT                   /translation="MAKGKFERTKPHVNVGTIGHVDHGKTTLTAALTKVGAERFGGEFK
FT                   AYDAIDAAPEEKARGITISTAHVEYESPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLSRQVGVPHIVVFLNKADMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIHGSARLALEGDQSEIGVPAILKLVEALDTFIPEPQRDVDKPFLMPVEDVFS
FT                   ISGRGTVVTGRIERGVIKVGDEIEIVGIRATQKTTVTGVEMFRKLLDQGQAGDNAGLLL
FT                   RGTKRDDVERGQVLCKPGTIKPHTQFEAEVYVLSKDEGGRHTPFFPGYRPQLYFRTTDI
FT                   TGEVQLPEGVEMVMPGDNVKMTVTLINPVAMDEGLRFAIREGGRTVGAGVVAKIIK"
FT   gene            568974..569285
FT                   /gene="rpsJ"
FT                   /locus_tag="XALC_0513"
FT   CDS_pept        568974..569285
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="XALC_0513"
FT                   /product="probable 30s ribosomal protein s10"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15042"
FT                   /db_xref="GOA:D2UB69"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB69"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15042.1"
FT                   /translation="MADQKIRIRLKAFDHRLIDRSASEIVETAKRTGAQVRGPIPLPTK
FT                   IERYTILVSPHVDKDARDQYETRTHKRVLDIVDPNDKTVDALMKLELAAGVDVQIKLT"
FT   gene            569297..569947
FT                   /gene="rplC"
FT                   /locus_tag="XALC_0514"
FT   CDS_pept        569297..569947
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="XALC_0514"
FT                   /product="probable 50s ribosomal protein l3"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15043"
FT                   /db_xref="GOA:D2UB70"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB70"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15043.1"
FT                   /translation="MTKKYSLGFVGRKAGMSRVFTEDGRSIPVTLIEATPNRITQLKTV
FT                   ENDGYSAVQITVGTRRVALVNKPAAGHFAKAKVEAGRGLWEFRVEDAQLGDFAIGGEIK
FT                   VDIFAVGQKVDVQGVTKGKGFQGTIKRHNFRMGDATHGNSLSHRVGGSLGQRQTPGRVF
FT                   LGKKMSGHMGAVQQSTQNLEVVKVDVERGLIAIRGAVPGAAGGDVIVRPASKA"
FT   gene            569960..570565
FT                   /gene="rplD"
FT                   /locus_tag="XALC_0515"
FT   CDS_pept        569960..570565
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="XALC_0515"
FT                   /product="probable 50s ribosomal protein l4"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15044"
FT                   /db_xref="GOA:D2UB71"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB71"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15044.1"
FT                   /translation="MELVITGSNNKVSVSDAVFGRDFSEDLVHQVVVAYRNAGRAGTKA
FT                   QKTRSEVNGTTKKSKKQKGGGARHGALTAPIFVGGGVTFAAKPRSFEQKVNRKMYRAAI
FT                   CAIFSELNRQGRLKVVDAFDLEASKTKGLIEKLKGLDVGKRPLIVTEEASEHLYLSARN
FT                   IPYVEVRDVQGLDPVSLVGADTVVITADAVKKVEEWLA"
FT   gene            570562..570861
FT                   /gene="rplW"
FT                   /locus_tag="XALC_0516"
FT   CDS_pept        570562..570861
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="XALC_0516"
FT                   /product="probable 50s ribosomal protein l23"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15045"
FT                   /db_xref="GOA:D2UB72"
FT                   /db_xref="InterPro:IPR001014"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB72"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15045.1"
FT                   /translation="MSSNEKIFSVLRAPRVSEKTARLQELSNQYVFEISSEATKADVKA
FT                   AVEQLFDVKVESVNVLNVKGKNKSFRSRSGRRGDWRKAYVRLAEGQSIDVTAKA"
FT   gene            570872..571699
FT                   /gene="rplB"
FT                   /locus_tag="XALC_0517"
FT   CDS_pept        570872..571699
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="XALC_0517"
FT                   /product="probable 50s ribosomal protein l2"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15046"
FT                   /db_xref="GOA:D2UB73"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB73"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15046.1"
FT                   /translation="MPLMKFKPTSAGRRSAVRVVTPDLHKGAPHAALVEKQSKSGGRNH
FT                   HGRITTRHVGGGHKQHYRIIDFKRNKEGIPARVERIEYDPNRTAHIALLCYADGERRYI
FT                   IAPKGLKAGDQVIAGSDAPIKTGNTLPLRNIPVGTTVHGIELKPGKGAQIARAAGAAVQ
FT                   LVAREGIYATLRLRSGEMRKVPSECRATIGEVGNDEHNLEKLGKAGAKRWRGVCPTVRG
FT                   AAMNPVDHPHGGGEAKAGQGNPHPVTPWGVPTKGYKTRHNKRTEQFIVRDRRG"
FT   gene            571706..571975
FT                   /gene="rpsS"
FT                   /locus_tag="XALC_0518"
FT   CDS_pept        571706..571975
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="XALC_0518"
FT                   /product="probable 30s ribosomal protein s19"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15047"
FT                   /db_xref="GOA:D2UB74"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB74"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15047.1"
FT                   /translation="MARSLKKGPFVDHHLIKKVEAAAGSKRPIKTWSRRSMILPEMVGF
FT                   TIAVHNGKNHVPVLVNENMVGHKLGEFAVTRTFKGHGGDKKSSR"
FT   gene            571982..572323
FT                   /gene="rplV"
FT                   /locus_tag="XALC_0519"
FT   CDS_pept        571982..572323
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="XALC_0519"
FT                   /product="probable 50s ribosomal protein l22"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15048"
FT                   /db_xref="GOA:D2UB75"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB75"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15048.1"
FT                   /translation="MTMEAKAILRTARISPQKARLVADQVRGLSAERAVNLLKFSDKKA
FT                   AHLIKKVVESAIANAENNQGADVDELKVKTIMVDEGPSLKRFMARAKGRGTRILKRTSH
FT                   ITVVVGAAK"
FT   gene            572341..573066
FT                   /gene="rpsC"
FT                   /locus_tag="XALC_0520"
FT   CDS_pept        572341..573066
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="XALC_0520"
FT                   /product="probable 30s ribosomal protein s3"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15049"
FT                   /db_xref="GOA:D2UB76"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB76"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15049.1"
FT                   /translation="MGHKVNPVGIRLGISKDWNSKWYANKGEFAGYLAADLKVREMLRK
FT                   KLAQAGISKILIERPAKTARVTIYTARPGVVIGKRGEDIEKLRKEVSEMMGVPAHINVT
FT                   EVRKPELDAQLVAESIAQQLERRIMFRRAMKRSVGNAMRLGALGIKVSVSGRLNGAEIA
FT                   RSEWYREGRVPLHTLRADIGYGFAEANTTYGTIGVQVTINNGEIFDFSQVGQEKQDDSP
FT                   RNDRNDRGDRPSRPAREAR"
FT   gene            573072..573485
FT                   /gene="rplP"
FT                   /locus_tag="XALC_0521"
FT   CDS_pept        573072..573485
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="XALC_0521"
FT                   /product="probable 50s ribosomal protein l16"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15050"
FT                   /db_xref="GOA:D2UB77"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB77"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15050.1"
FT                   /translation="MLQPKRTKYRKMHKGRNDGLAWSGNAVSFGEYGLKATAHGQLTAR
FT                   QIEAARRSISRYVKRGGKMWIRVFPDKPITKKPIEVRMGSGKGNVEYWVAQIQPGRMIY
FT                   EIEGVGEDIAREAFRLAAAKLSVTTTFVTRTVR"
FT   gene            573485..573670
FT                   /gene="rpmC"
FT                   /locus_tag="XALC_0522"
FT   CDS_pept        573485..573670
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="XALC_0522"
FT                   /product="probable 50s ribosomal protein l29"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15051"
FT                   /db_xref="GOA:D2UB78"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB78"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15051.1"
FT                   /translation="MDIKQLREKSADDLKAHLTDLRKEQFALRMQRVTGQLPKTHETRR
FT                   VRREIARVKHLLGSTK"
FT   gene            573682..573951
FT                   /gene="rpsQ"
FT                   /locus_tag="XALC_0523"
FT   CDS_pept        573682..573951
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="XALC_0523"
FT                   /product="probable 30s ribosomal protein s17"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15052"
FT                   /db_xref="GOA:D2UB79"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB79"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15052.1"
FT                   /translation="MSDNNENKTLRTVEGRVVSNKMDKTVTVLVERQVKHALYGKYIKR
FT                   STKLHAHDADNACNEGDVVRVTEIAPLSKTKNWRVVAIVTRAVE"
FT   gene            573966..574334
FT                   /gene="rplN"
FT                   /locus_tag="XALC_0524"
FT   CDS_pept        573966..574334
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="XALC_0524"
FT                   /product="probable 50s ribosomal protein l14"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15053"
FT                   /db_xref="GOA:D2UB80"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB80"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15053.1"
FT                   /translation="MIQMQSYLDVADNSGAKEVMCIKVLGGSKRRYAHIGDIIKVTVKD
FT                   AIPRGKVKKGEVYDAVVVRTRKGVRRHDGSLIRFDGNAAVLLNNKQEPIGTRIFGPVTR
FT                   ELRSEKFMKIVSLAPEVL"
FT   gene            574350..574667
FT                   /gene="rplX"
FT                   /locus_tag="XALC_0525"
FT   CDS_pept        574350..574667
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="XALC_0525"
FT                   /product="probable 50s ribosomal protein l24"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15054"
FT                   /db_xref="GOA:D2UBI3"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15054.1"
FT                   /translation="MANRIKKGDQVVVTTGKDKGKQGEIVRVDGDRVIVANANIVKRHT
FT                   KPNPQAGVAGGVVEREASIHISNVAILNPVTGKGERVGFKVLEDGRKLRVFRSSGEALD
FT                   A"
FT   gene            574679..575221
FT                   /gene="rplE"
FT                   /locus_tag="XALC_0526"
FT   CDS_pept        574679..575221
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="XALC_0526"
FT                   /product="probable 50s ribosomal protein l5"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15055"
FT                   /db_xref="GOA:D2UBI4"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15055.1"
FT                   /translation="MTSRLEKIYKDEVAPALMKKFGYTNPMEVPKLVKITLNMGVGEAA
FT                   TNKKILENAVADMAKVSGQKPVVTKSRISVASFKIRDGWPIGCKTTLRRAKMYEFLDRL
FT                   IHISLPRVRDFRGVSGRSFDGRGNFNMGVKEQIIFPEIDFDAVDAIRGMDIAITTTAKT
FT                   DAEAKALLEAFKFPFRN"
FT   gene            575287..575592
FT                   /gene="rpsN"
FT                   /locus_tag="XALC_0527"
FT   CDS_pept        575287..575592
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="XALC_0527"
FT                   /product="probable 30s ribosomal protein s14"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15056"
FT                   /db_xref="GOA:D2UBI5"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15056.1"
FT                   /translation="MAKTSMVNRDIKRKKLAKKFADKREALKKIIASGTASYDEKAEAV
FT                   TKLQKLPRDSSPSRQRNRCVLSGRPRGVYSKFGLGRNMLRKATMNGDVPGLRKASW"
FT   gene            575860..576258
FT                   /gene="rpsH"
FT                   /locus_tag="XALC_0528"
FT   CDS_pept        575860..576258
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="XALC_0528"
FT                   /product="probable 30s ribosomal protein s8"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15057"
FT                   /db_xref="GOA:D2UBI6"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15057.1"
FT                   /translation="MSMTDPIADLLVRIKNAAAVGKPTVKMPSSKIKVAIAQVLKAEGY
FT                   ISDLRVNAIENNKSELEIVLKYFEGRPVIDTLKRVSRSGLRQYRGKTELPKVLGGLGVA
FT                   IISTSKGIMTDAQARQAGVGGEVLCFVA"
FT   gene            576275..576802
FT                   /gene="rplF"
FT                   /locus_tag="XALC_0529"
FT   CDS_pept        576275..576802
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="XALC_0529"
FT                   /product="probable 50s ribosomal protein l6"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15058"
FT                   /db_xref="GOA:D2UBI7"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15058.1"
FT                   /translation="MSRVAKKPISLPKGVELTVQPDQVSVKGPKGTLSLPKPAGVEIKQ
FT                   ENGVATLSANADSHIAITGTVRAILANMVHGVSAGFERKLELVGVGYRATMQGKDLSLA
FT                   LGFSHPIVFQAPEGITLAAPTQTEILVQGADKQLVGEVAAKIRGFRPPEPYKGKGVKYA
FT                   GEAIIRKEAKKA"
FT   gene            576898..577257
FT                   /gene="rplR"
FT                   /locus_tag="XALC_0530"
FT   CDS_pept        576898..577257
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="XALC_0530"
FT                   /product="probable 50s ribosomal protein l18"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15059"
FT                   /db_xref="GOA:D2UBI8"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15059.1"
FT                   /translation="MSINKNIARLRRAKSTRAHIRDLGVARLSVLRTGQHLYAQVFTAD
FT                   GAKVLAAANTLQADVKDGLKNGKNSDAAAKVGKLIAERAKAAGIEKVAFDRSGYRYHGR
FT                   IKALAEAAREGGLQF"
FT   gene            577412..577957
FT                   /gene="rpsE"
FT                   /locus_tag="XALC_0531"
FT   CDS_pept        577412..577957
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="XALC_0531"
FT                   /product="probable 30s ribosomal protein s5"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15060"
FT                   /db_xref="GOA:D2UBI9"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBI9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15060.1"
FT                   /translation="MAEEQRAPRGRERDRNREEKVDDGMIEKLVAVNRVSKTVKGGRQF
FT                   TFTALTVVGDGNGKIGFGYGKAREVPVAIQKSMEYARKGMLNIDLNNGTLWHTVKSGHG
FT                   AARVFMMPASEGTGVIAGGAMRAVLEAVGVKNVLAKAVGSRNPINLVRATLRGLEDMQS
FT                   PARIAAKRGKKVEDLTHG"
FT   gene            577950..578141
FT                   /gene="rpmD"
FT                   /locus_tag="XALC_0532"
FT   CDS_pept        577950..578141
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="XALC_0532"
FT                   /product="probable 50s ribosomal protein l30"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15061"
FT                   /db_xref="GOA:D2UBJ0"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15061.1"
FT                   /translation="MADASSKTVKVRLVRGLRGTQSRHRLSVRALGLNKLNDVRELKDS
FT                   PQVRGLINKVQYLVQVEE"
FT   gene            578148..578591
FT                   /gene="rplO"
FT                   /locus_tag="XALC_0533"
FT   CDS_pept        578148..578591
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="XALC_0533"
FT                   /product="probable 50s ribosomal protein l15"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15062"
FT                   /db_xref="GOA:D2UBJ1"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15062.1"
FT                   /translation="MTLHLNDLKPADGARTERTRVGRGIGSGLGKTCGRGHKGSFARKG
FT                   GGKIKAGFEGGQTPMQRRLPKIGFRSKLAKDTAEVLSYQLDNLQEGEIDFAALRAAKLV
FT                   PSTAKKAKVVLKGELTKKFVLKGVAATAGAKAAIEAAGGSVQE"
FT   gene            578599..579969
FT                   /gene="secY"
FT                   /locus_tag="XALC_0534"
FT   CDS_pept        578599..579969
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="XALC_0534"
FT                   /product="probable preprotein translocase subunit secy"
FT                   /function="the type ii (general) secretory pathway (iisp)
FT                   family go:0015628 go:0015447"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15063"
FT                   /db_xref="GOA:D2UBJ2"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15063.1"
FT                   /translation="MAQAGMGQLGGGLGKFTELRQRLLFVIGALIVYRIGCYVPVPGVN
FT                   PEAMLALMQAQGGGIVDMFNMFSGGALHRFSIFALNVMPYISASIVIQLATHIFPSFKA
FT                   MQKEGESGRRKITQYSRIGAVLLAVVQGGSIALALQHQTAPGGAPVVYAPGIGFVLTAV
FT                   IALTAGTIFLMWVGEQVTERGIGNGVSLVIFAGIVAGLPAAAIHTLEAYRDGNMSFISL
FT                   LLIVLTILAFTLFVVFVERGQRRITVNYARRQGGRNAYMNQTSFLPLKLNMAGVIPPIF
FT                   ASSILAFPATLSMWSGQAASNTTFGSMLQRIANALGPGEPVHMMVFAALIIGFAFFYTA
FT                   LVFNSQETADNLKKSGALIPGIRPGKATADYVDSVLTRLTAAGSLYLVIVCLLPEVMRA
FT                   QFGTTFHFGGTSLLIAVVVVMDFIAQIQAHLMSHQYESLLKKANLKGGARGGGFARG"
FT   gene            580309..580665
FT                   /gene="rpsM"
FT                   /locus_tag="XALC_0535"
FT   CDS_pept        580309..580665
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="XALC_0535"
FT                   /product="probable 30s ribosomal protein s13"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15064"
FT                   /db_xref="GOA:D2UBJ3"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ3"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15064.1"
FT                   /translation="MARIAGVNLPAQKHVWVGLQSIYGIGRTRSKKVCEAAGVTSTTKI
FT                   RDLSEPEIERLRLEVGKYIVEGDLRREIGIAIKRLMDLGCYRGLRHRRGLPLRGQRTRT
FT                   NARTRKGPRKAIKK"
FT   gene            580675..581067
FT                   /gene="rpsK"
FT                   /locus_tag="XALC_0536"
FT   CDS_pept        580675..581067
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="XALC_0536"
FT                   /product="probable 30s ribosomal protein s11"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15065"
FT                   /db_xref="GOA:D2UBJ4"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15065.1"
FT                   /translation="MAKPAAAKTKKKIKRVVTDGVAHVHASFNNTIVTITDRQGNALSW
FT                   ATSGGAGFRGSRKSTPFAAQVAAEKAGRAALDYGVKSLEVRIKGPGPGRESAVRSLNNV
FT                   GYKITNIIDVTPIPHNGCRPPKKRRV"
FT   gene            581082..581711
FT                   /gene="rpsD"
FT                   /locus_tag="XALC_0537"
FT   CDS_pept        581082..581711
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="XALC_0537"
FT                   /product="probable 30s ribosomal protein s4"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15066"
FT                   /db_xref="GOA:D2UBV6"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15066.1"
FT                   /translation="MARYIGPTCKLARREGADLSLKSPARALDSKCKLEQKPGQHGATA
FT                   RKGKLSDYATQLREKQKVKRIYCLLERQFRNYYKKASTKKGNTGENLLQLLETRLDNVV
FT                   YRMGFAVTRPAARQLVSHRGVLVNGKSVNLASYQVKAGDAIALSEKAQKQLRVQEALSV
FT                   ADTHDLTPSWVEVDSKKFSGIFKAVPDRADLPADINEALIVELYSK"
FT   gene            581761..582759
FT                   /gene="rpoA"
FT                   /locus_tag="XALC_0538"
FT   CDS_pept        581761..582759
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="XALC_0538"
FT                   /product="probable dna-directed rna polymerase alpha chain
FT                   (rna polymerase alpha subunit) protein"
FT                   /function="information transfer; rna related go:0016070;
FT                   transcription related go:0006350"
FT                   /EC_number="2.7.7.6"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15067"
FT                   /db_xref="GOA:D2UBV7"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15067.1"
FT                   /translation="MTVTANQVLRPRGPQIERLTDNRAKVVIEPLERGYGHTLGNALRR
FT                   VLLSSIPGFAITEVEIDNVLHEYTTVEGLQEDVLEVLLNLKDVAIRMHTGDSATLSLSK
FT                   QGPGTVTATDIKTDHNVEILNSDHVICHLTKDTALNMRLKIERGFGYQPAAARRRPDEE
FT                   TRTIGRLVLDASFSPVRRVAYAVESARVEQRTDLDKLVLDIETNGTIDAEEAVRTAADI
FT                   LSDQLSVFGDFTHRDRGAVKPASNGVDPVLLRPIDDLELTVRSANCLKAESIYYIGDLI
FT                   QKTEVELLKTPNLGKKSLTEIKEVLAQRGLSLGMKLENWPPAGVAQHGMLG"
FT   gene            583052..583435
FT                   /gene="rplQ"
FT                   /locus_tag="XALC_0539"
FT   CDS_pept        583052..583435
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="XALC_0539"
FT                   /product="probable 50s ribosomal protein l17"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15068"
FT                   /db_xref="GOA:D2UBV8"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15068.1"
FT                   /translation="MRHQKSGRKFSRTSAHRQAMFSNMAASLFKHELIKTTLPKAKELR
FT                   RVAEPLITIAKVDGVANRRLAFARLRDKEAVGKLFVELGPRYQSRPGGYLRVLKCGFRA
FT                   GDNAPMAYVELVDRPLVAEAVAE"
FT   gene            583764..584276
FT                   /gene="dsbB"
FT                   /locus_tag="XALC_0540"
FT   CDS_pept        583764..584276
FT                   /transl_table=11
FT                   /gene="dsbB"
FT                   /locus_tag="XALC_0540"
FT                   /product="probable protein-disulfide reductase
FT                   (glutathione)"
FT                   /function="metabolism go:0008152; energy
FT                   production/transport"
FT                   /EC_number="1.8.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15069"
FT                   /db_xref="GOA:D2UBV9"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR022920"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBV9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15069.1"
FT                   /translation="MNLFRWRFRAQFLLGFLSCAALLGYAIFVQLQLGIEPCPLCIFQR
FT                   IAFAALGLLFLIGALHGPVRSGGRKVYGVLAFLAAGVGAGIAAKHVYVQVFPDPMASCG
FT                   PPLSFLRQTLGPFEVMRRVLTGTGDCGNIDWRFLGLSMPMWCLICFVLLGMFALYAGFK
FT                   ARRRSLH"
FT   gene            complement(584483..586603)
FT                   /locus_tag="XALC_0541"
FT   CDS_pept        complement(584483..586603)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0541"
FT                   /product="putative tonb-dependent outer membrane receptor
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; the outer
FT                   membrane receptor (omr) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15070"
FT                   /db_xref="GOA:D2UBW0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15070.1"
FT                   /translation="MTPHALSTAVALVLLASPGLTLAADASNRAIDLDPVTVTAKLEAA
FT                   RNALSPDIGSSQYAITAADIDRLPLGASTPLNQVLLQAPGVVQDSYGGIHVRGDHANLQ
FT                   YRINGVMIPESISGFGQSLDPRTIKNIRLLDGALPAQFGDRTAAVIDITTKNGVELGNG
FT                   GSVGITAGSYGTLNPNASWWGSEGRLSWFGSGNYLQNRIGLENPTNSSNPYHDKTHQGK
FT                   AFADLNYLINESTRLSLMVGYANNRFQIPNNPGQTPAFTYLGNSDFDSSQLNENQRENT
FT                   RFGNLILQGELGTTSYQLSAGQRYSSVAFSPDIAGDLIFNGVASQVQRSNRANTVQADF
FT                   STPWGGSHTLRYGVYGSFEHVIASNNAYVFPANDDGSQSSDVPLFIPDASRFHASTYAV
FT                   YLQDEWQPSDAWTINYGVRGDRYKAFGITEGQLSPRLGVVWHASDTTTLHAGYARYFTP
FT                   PASELISTSDIALYDGTTNQQSAAGGPTTPLSERSNYFDLGISQAVGDHLTLGLDTYYR
FT                   KADRLQDEGQFGAAYVYSTFNYRYGRIRGAEFSADYTNGPVNAYFNAAYSKAMGKRVMT
FT                   SLYNFDPDALAYVYDHWIHLDHDQKLTSSGGLTYALTDDSRIGANYLFGSGLRTDANGV
FT                   PNGGTVASYFQLNLSAGHDFGLGSGHPLHAQLAVLNVLDRHYQLRDGGGIGVFAPQWAP
FT                   RRGIYLSLQQDF"
FT   gene            586815..588212
FT                   /locus_tag="XALC_0542"
FT   CDS_pept        586815..588212
FT                   /transl_table=11
FT                   /locus_tag="XALC_0542"
FT                   /product="putative 3-deoxy-7-phosphoheptulonate synthase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="2.5.1.54"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15071"
FT                   /db_xref="GOA:D2UBW1"
FT                   /db_xref="InterPro:IPR002480"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15071.1"
FT                   /translation="MTLSASAALSESATSPWSPVSWRGKPALQMPVYPDPQALEETLGE
FT                   LRELPPLVTSWEIFALKKQLAEAQEGKRFLLQGGDCAENFSDCESSTISNRLKVLLQMS
FT                   LVLVHGLRLPVVRVGRYAGQYAKPRSADTETRDGVSLPSYRGDVVNAPEFTAQARVPDP
FT                   RRMITAHSRSAMTMNFVRALIDGGFADLHHPEYWNLSWVGCSPLAEEYQKMVASIGDAV
FT                   RFMETLSGAQLYNLNRVDFYTSHEALLLPYEEALTREVPRQWGWFNLSTHYPWIGMRTA
FT                   ALDGAHVEYFRGIRNPIAIKVGPSAQPDQLLRLIDVLNPEDEPGRLTFIHRMGAAQIAE
FT                   KLPSLLDAVRRDGRRVLWVCDAMHGNTESTSNGYKTRRYQNVLDEVEQSFDIHAAAGTR
FT                   LGGVHLELTGEDVTECIGGARELTERDLERAYRSSVDPRLNYEQSLEIALAIVRKQNGR
FT                   SMPSLSV"
FT   gene            complement(588403..588885)
FT                   /locus_tag="XALC_0543"
FT   CDS_pept        complement(588403..588885)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0543"
FT                   /product="hypothetical membrane protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15072"
FT                   /db_xref="GOA:D2UBW2"
FT                   /db_xref="InterPro:IPR021125"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15072.1"
FT                   /translation="MAANKAYNPDPHAHPGLHVIALLEAGKGLLAVLAATGLELLGPLP
FT                   LRAGVDRLIVRFSLDPEHGALPSLLNMISPGAVHLAAAGMLAYGALHIIEAWGLWRAKA
FT                   WASLLGCISAAIYLPFDVYAIVRHPGWASWAVLAINLAVVGILARDLVRRRRRPTT"
FT   gene            complement(588899..590728)
FT                   /gene="typA"
FT                   /locus_tag="XALC_0544"
FT   CDS_pept        complement(588899..590728)
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="XALC_0544"
FT                   /product="probable gtp-binding elongation factor protein"
FT                   /function="information transfer; protein related
FT                   go:0006412; translation go:0006412"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15073"
FT                   /db_xref="GOA:D2UBW3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15073.1"
FT                   /translation="MSIENLRNIAIVAHVDHGKTTLVDCLLKQSGTLSERTVLAERVMD
FT                   SNDQEKERGITILAKNTAITWRGNRINIVDTPGHADFGGEVERVLSMVDTVLILVDAMD
FT                   GPMPQTRFVTQKAFAMGFKPIVVVNKIDRPGARPDWVIDQVFDLFDKLGATNEQLDFPI
FT                   VYTSALNGYAGLEDSVRDGDMTPLYEAIMRHAPKPEVDPDGPFQMRISQLDYNNFVGVI
FT                   GIGRIQRGVLKKNMPVSVIDREGKKRQGKVLQVLGFLGLERIEQDSAQAGDIVAISGIQ
FT                   ELTISDTVCALDTPEALPPLTVDEPTISMTFQVNNSPFAGNKDLSGGKFLTSRQLKDRL
FT                   ERETVHNVALKVQQLEDADKFLVSGRGELHLSVLIENMRREGFELAVSRPEVIIKEIDG
FT                   KLMEPVEQLVVDIEEQHQGGVMEKLGIRKGQLKNMEPDGKGRVRLDYMIPARGLIGFQN
FT                   EFRTLTQGSGLLFHVFDHYGPKEQGAIAKRQNGVMIANAPGATPAYALGPLEERGRLFA
FT                   AEGDNVYEGQLVGIHSKDNDLTVNAIKTKPLTNMRASGKDDTIKLTPAIKYTLEQALDF
FT                   IEDDELVEVTPKEIRLRKKHLTENERKRAGRAG"
FT   gene            590933..591427
FT                   /locus_tag="XALC_0545"
FT   CDS_pept        590933..591427
FT                   /transl_table=11
FT                   /locus_tag="XALC_0545"
FT                   /product="putative peptidyl-prolyl cis-trans isomerase
FT                   protein"
FT                   /function="information transfer; chaperoning, folding
FT                   go:0006457"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15074"
FT                   /db_xref="GOA:D2UBW4"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15074.1"
FT                   /translation="MSLIAHFDTARGTIKIELYPDKAPLTVANFVNLAKRGFYNGLNFH
FT                   RVIADFMIQGGCPEGSGRGGPGYRFEDETDNGVRHERGVLSMANAGPSTNGSQFFITHV
FT                   ATPWLDGKHTVFGKVLEGLEVVDSVAQGDVINTITIEGDAEAVLAAKADRVAEWNRLLS
FT                   A"
FT   gene            591949..592935
FT                   /gene="mdh"
FT                   /locus_tag="XALC_0546"
FT   CDS_pept        591949..592935
FT                   /transl_table=11
FT                   /gene="mdh"
FT                   /locus_tag="XALC_0546"
FT                   /product="probable malate dehydrogenase protein"
FT                   /function="metabolism go:0008152; glycol degradation
FT                   go:0042846"
FT                   /EC_number="1.1.1.37"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15075"
FT                   /db_xref="GOA:D2UBW5"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15075.1"
FT                   /translation="MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELPM
FT                   EKAQAALKGVMMELEDCAFPLLAGMVGTDDAEVAFKDADIALLVGARPRGPGMERKDLL
FT                   LENAKIFTAQGAALNKVAKRNVKVLVVGNPANTNAYIAMKSAPDLNPKNFTAMLRLDHN
FT                   RALSQLSAKLGKPVGGIEKLVVWGNHSPTMYPDYRFATADGASIAEAINDQEWNAGTFI
FT                   PTVGKRGAAIIEARGSSSAASAANAAIDHVRDWVLGSHGKWVTMGVPSDGSYGIPEGVM
FT                   FGFPVTTVNGEYTLVKDLPIDAFSRTYIDKTLAELEEERSGVAHLLG"
FT   gene            593002..595587
FT                   /locus_tag="XALC_0547"
FT   CDS_pept        593002..595587
FT                   /transl_table=11
FT                   /locus_tag="XALC_0547"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15076"
FT                   /db_xref="GOA:D2UBW6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW6"
FT                   /protein_id="CBA15076.1"
FT                   /translation="MQRGDVVGAYRGCELMCYVAGAISEGNRIMLMPLRWIGVLALASA
FT                   LPAVVAHAADGGYRQPPEPLLSVMRAPLNPSPRLDPTGTTLLLVQRQAYPPIARVAEPY
FT                   LKLAGVRVEPRTHSRHDMSSGYGIRACLDGFSLVDVATGRQTAVNLPAGACPAQPVWSP
FT                   DGRRFAFNNTAADRVELWVGEVATGAVHRIDGVQLNPVLGGEIQWLGGSQTLLVLTVPQ
FT                   DLGPAPVKAMVPPGPEVKETIRGKGESSTYEARDTLSSPEDEAQFTYYATSQLMTVDVA
FT                   SGRQRKVAVPALYSAVDGAPDGRHVLVARLQRPYSYVTTYGRFAHDVAVLDLSDGSERV
FT                   LAQLPVADRVPVQGVPTGPRAYSWRANQPATLIWAEALDGGDWKANVPARDKLLTLAAP
FT                   FTGKPREWVRVTQRYAGLSWFAQGGQALLDEYDQNRHWRRTTLLDADHPGSPGRVLFDL
FT                   STDDLYADPGSPVMRLLANGEPVLHEDHGALFLSGNGATPSGDRPFLDRYDLATGKTQR
FT                   LFRSDADVDEIFDGFAGDDTTRLLTWRQSPVDPPNVYLRTLGQAQPTVAAGEMAYASSL
FT                   VPVTHFPDPTPLVRQIKKRLVTYTRKDGVELSFTLYTPPGYKEGTRVPAILYAYPLDYA
FT                   DASKAGQVSGAEARDFTRLHSYQLLLLAGYAIIDDAAFPIVGDPKNAYDTYLQQLVENA
FT                   QAAVDKAVALGVVDRDRIGVTGHSHGALMTVNLLAHTDLFRAGVATSGSYNKTLTPFGF
FT                   QNERRSFWAAPQVYAQASAFFHADKIDEPLLIVHGMDDANPGTETTQAPRLFQAIRGNG
FT                   GTARLVLLPFEPHWYTARESNEDVVAEMLAWFDHYVKHAPPRAAAVKAK"
FT   gene            complement(595803..596411)
FT                   /gene="gst"
FT                   /locus_tag="XALC_0548"
FT   CDS_pept        complement(595803..596411)
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="XALC_0548"
FT                   /product="probable glutathione transferase protein"
FT                   /function="information transfer; posttranslational
FT                   modification go:0006464"
FT                   /EC_number="2.5.1.18"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15077"
FT                   /db_xref="GOA:D2UB81"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB81"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15077.1"
FT                   /translation="MKLYAKPGACSLADHIVLRWAGLPFELQLLDAAAMKAPAYLAINP
FT                   AGAVPALQMDDWVLTQNSAILNYIADLAPDAHLAGDGSPRGRAEVQRWLAFLNADLHMA
FT                   FPPLFGSTRYLDDPAAIARTQEHARERVRTLYARVDAALEQKTWLGSMRRSIADAYLFV
FT                   TMRWARAQQIPLGANLQLHFERMSADPQVQAALQAEGLS"
FT   gene            complement(596539..597000)
FT                   /locus_tag="XALC_0549"
FT   CDS_pept        complement(596539..597000)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0549"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15078"
FT                   /db_xref="GOA:D2UB82"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB82"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15078.1"
FT                   /translation="MKLAWILWLSQLLPQTAADSLCLSTTVYLEARDQTLRGQQAVAEV
FT                   ALRRLDSGLWGDSMCQVVTARKQFAPTLVKPGTELKNTDAWADAVKIAFAAERNWALPQ
FT                   GQRKEIVPGASHFAANAIASPSWRNAYQVATIGDHTFYRVQKLRRRNAS"
FT   gene            complement(597301..598800)
FT                   /locus_tag="XALC_0550"
FT   CDS_pept        complement(597301..598800)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0550"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15079"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB83"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15079.1"
FT                   /translation="MRSVFRPRYLLLALLIAGVSLPLLQRAATAHSPQSATAPSRGAIR
FT                   QPVSADTRQMNAPAPTSSTTSGTVPGPAARDVIAAAQALPSDFQADVLLRIATATDVPV
FT                   DASGNRTAATQRLVQQASILAERAQRRLPGLASVGYIREEHADELHAPFTAGLDRLSLQ
FT                   TRAAQLAPPAQPETLFAALPKPQAGSCDAPYLDDPSPTYALASALLPAQAAARAAALAK
FT                   RVDAAQHETDVAPALKMILASAVLEKAEQAQLADNLARMFDRIRNDDPGFTATELSIAG
FT                   DVPLLLQQLQDPALRERLQRAYRGYVAAHLAQNRCPTSVQGNHWMLEQLYVAELPDERI
FT                   VDAPPAAAPSLDDQAVSLIRQAGHNIRTQLLDPSVHGNDADVEKASMEFLDQLDHGVLQ
FT                   QTASNDDSGRVQRARLRELLRYLEYAPASAARDRGMGILAPLLSGPYYARDHDTWFGDL
FT                   RMVADQLQRWPDRDQRLAQLVEHADPVVKVYAMLMQRRQFP"
FT   gene            complement(598896..600068)
FT                   /locus_tag="XALC_0551"
FT   CDS_pept        complement(598896..600068)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0551"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15080"
FT                   /db_xref="GOA:D2UB84"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB84"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15080.1"
FT                   /translation="MKLLRNSLKTLSLTFGFASLAALPGLASADNDWNPQFILSVMMNP
FT                   YATPESHSPNIVVISHRGVIRRGCPENSICSIINTYRHDVEAIELDVKQNADGQLWLFH
FT                   DQNAGRVVDHNPNFNIFQPATNPVGWDPDIRTMHNEDLDYAYLRDRFFNVTHFHPTSLE
FT                   TALNTVLNGANHMVVVLDLKTLDDVSRAADIIKAFHMENQVVLKFSASLVAATPYGIEN
FT                   YTKGVRFAPTIYARDMDNIADGGYLGLCGSITPNTPFCRVNAWIDEAKGTNNGGFAWLE
FT                   IGNKQPRRGDPTAELLADKQAQRYAIGAFSPVPEYRFRNHDGRHYVRTNGTCCASLDDY
FT                   LSTTKYFGNEIADDRPNFRAQVVSGFTSIITDDPLGVIAANLNRNTSLYH"
FT   gene            complement(600624..601541)
FT                   /locus_tag="XALC_0552"
FT   CDS_pept        complement(600624..601541)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0552"
FT                   /product="putative glycerophosphoryl diester
FT                   phosphodiesterase protein"
FT                   /function="metabolism go:0008152; glycerol metabolism
FT                   go:0006071"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15081"
FT                   /db_xref="GOA:D2UB85"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="InterPro:IPR032160"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB85"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15081.1"
FT                   /translation="MHYRKLLMSAAISLPMLALAATPSLPDRLRDPHGEALVVSHRACW
FT                   KFASENTLDGIAACIARGVDMVEIDVRTTRDGALVLMHDETVDRTTDGHGAVADLDAAQ
FT                   IAALHVRSQGGGSASTLTERHPPTLTQALALAHGHVLVNLDVKAASLDQIMDEVEAAGA
FT                   QRDVLLNVPLDVPEAVLQRAHKADIAVQALYSQRDSALSPQQALRHAAALRPAVVQLMF
FT                   DDPAVLGIAQRELAQHARLFVNTMTSDIASGRPMRLSAHYTDQGALRDPASVWGALRNY
FT                   GVSMIQTDEVLALQHYLHATDTTR"
FT   gene            complement(601544..604042)
FT                   /locus_tag="XALC_0553"
FT   CDS_pept        complement(601544..604042)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0553"
FT                   /product="putative tonb-dependent outer membrane receptor
FT                   protein"
FT                   /function="transport go:0005215 go:0006810; the outer
FT                   membrane receptor (omr) family"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15082"
FT                   /db_xref="GOA:D2UB86"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB86"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15082.1"
FT                   /translation="MRSTHLHPSLLALALASILSAAPAVHAEVSAAPPTDSTTTLDQIV
FT                   VTGTPQGQSQKDAPFAISVLSKERLDRSTPASSVDMLRAVPGFSAEPSGGQGGGQNLYV
FT                   RGLPAGGWYYVQYQEDGMTLFDEPQESFFNVDTLFALDMMTERLEVVRGGTSPLFATNA
FT                   PGGTVNAITRHGTATPEGAVRMTVGSDGLRREDAYSSGPLSENVLYSIGGYHRSDDGLR
FT                   RTGYTADQGGQLRGNLTFLMDDAVLDVDAKYLNDHTAFYNPIPLADPRNPSQSLSALID
FT                   PLDGTLLSDDLRHTTALTFNGNNTLARNLDLADGIHNKVKQLGTHLEWNLTDSVTLNNR
FT                   MRFVDAQVDYTSLFSGAAPYDANAYLATQLGRARNGFGNRVAQAGYVLDRNGAPYDPAT
FT                   ADGLVLESGLWNARTHLRTLSDDLRLSKAFDESALGKHTLTAGINVQHFEYAQDRLQNT
FT                   VLTTLQNNAQRLDVLAYDAAGNVVGSVTQNGFVRYGNGVTRGFANGTYLSPYLWDSVRL
FT                   GRLGLDAGVRYTRYNAGGGVYANTTRNLGDPTTLADDNVGGLSGAFNARTDHRHATQWT
FT                   LGAEFALTPQLQTFARYTESQRLPRLQNVYQTQNAAVTDIDQAEAGLRGSFGDTFSFST
FT                   VGFWSRFNALSISAIVLNDAGAVQNLALVGKTRTVGLESEFTWRPLPLFGITGSVTLQD
FT                   PQTRGLSNATTGISYGNLDGKQISRIPKFMASLSPTLYFDIAGRPLQVSATAYRMGQRY
FT                   VDYTNATALPAYTTYDLGVFAQLSDHLELQLHAANVGNDLGLTEGNARVDTLSGQGTAN
FT                   AIYARPIFGRNYNASLTWRW"
FT   gene            604156..605277
FT                   /locus_tag="XALC_0554"
FT   CDS_pept        604156..605277
FT                   /transl_table=11
FT                   /locus_tag="XALC_0554"
FT                   /product="hypothetical transcriptional regulator, rok
FT                   family transcription regulator protein"
FT                   /function="transcriptional level go:0006355"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15083"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB87"
FT                   /protein_id="CBA15083.1"
FT                   /translation="MLHPDFPPRVSAGGRQLLNRVFKTGVQTQAALSRDLDLSQPTVAR
FT                   LLQGFVQERMVLLSARVAGGPGNPSVDVRLAPDYAYAFGIGLMGDVVALALVDFAGGVR
FT                   SQRRIALADMRRGSVLAHLLRFRAELLAETGVDPRRIVGAGMAISAFFTGRGQQMVGPP
FT                   TLEDWTQVELAPILEEALGYAVIVENDGAAAAVAESLYGVGRDCRDFVYLHLTNGFGGG
FT                   IIADGRLFRGHRGNAGEFGGIWTVGGMAYPNLDALLALVRAAGQDYIGVEQMLGAIDAH
FT                   TPGVDAWLDMAEAPFAQLCAYLAYTLDPQAIVIGGRLPAVIGTRLIERIRIPRAPNRHG
FT                   LSPPLPQVCIARTVGDAVTLGAALMPLQRAFFA"
FT   gene            complement(605368..607413)
FT                   /gene="fadH"
FT                   /locus_tag="XALC_0555"
FT   CDS_pept        complement(605368..607413)
FT                   /transl_table=11
FT                   /gene="fadH"
FT                   /locus_tag="XALC_0555"
FT                   /product="probable 2,4-dienoyl-coa reductase [nadph]
FT                   protein"
FT                   /function="metabolism go:0008152; fatty acid and
FT                   phosphatidic acid go:0006633 go:0006654"
FT                   /EC_number="1.3.1.34"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15084"
FT                   /db_xref="GOA:D2UB88"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB88"
FT                   /inference="ab initio prediction:FrameD"
FT                   /protein_id="CBA15084.1"
FT                   /translation="MSSTSGQPNSPAAYPHLFAPLDLGFTQLRNRVLMGSMHTGLEDRA
FT                   RDFPKLAAYFAERAAGGVGLIVTGGFAPNIVGWLKPFGGKLSWSWEVRPHRQVTTAVHA
FT                   HGAKICLQLLHAGRYAYHPLSVAPSRLKAPITPFTPRALSARGVERQIDAYAHAARLAR
FT                   EAGYDGVEVMGSEGYLINAFLAPRGNRRHDAWGGDAARRMRFAVDIVRRIRAACGPDFI
FT                   IIYRLSLVDLVEDGSDWQEIVSQAKAIEAAGATLINSGIGWHEARIPTIATSVPRAAFA
FT                   AATAKLKPHLRVPLIATNRINMPDVAEHILASGGADMVSLARPLLADPEWVNKARHGQA
FT                   QAINTCIACNQACLDHVFENKTASCLVNPRAAAETELNYVPTRTPKRIAVVGAGPAGLA
FT                   CATVAAERGHRVTLFDSAAEIGGQFNLAKRIPGKEEFHETLRYFRHKLDTTGVELRLHT
FT                   TADAARLAGFDDVVLATGIVPRKVDFPSADHPNVVGYLDVLLGRVQVADKVAIIGAGGI
FT                   GFDVGAFLVHAGASTALDPARWMAEWGVDPQFEGRGALCKPHPEPPVRKVWLLQRSPGR
FT                   PGARLGKTTGWIHRAALKAKGVTMLGGVEYLSMDDTGLRIRVNGTEQLLPVGTVVVCAG
FT                   QEPRRELQTPLLAAGCTPHLIGGADLATELDAKRAIAQGSWLAARL"
FT   gene            complement(607598..608623)
FT                   /locus_tag="XALC_0556"
FT   CDS_pept        complement(607598..608623)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0556"
FT                   /product="putative oxidoreductase protein"
FT                   /function="metabolism go:0008152; electron carrier
FT                   go:0009055"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15085"
FT                   /db_xref="GOA:D2UB89"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014182"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB89"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15085.1"
FT                   /translation="MKAVALTRYLPIDDPQSLQDMDLPMPPPPTGFDLLIRVEAVSVNP
FT                   VDTKVRAPKASLETQPKVLGYDAAGVVEAVGPHAEGFEPGDEVYYAGDITRAGSNAQYQ
FT                   LVDARIVARKPATLDFAQAAALPLTTLTVWELLFQRMPFDFDDARNRGLCLLVIGGAGG
FT                   VGSIAIQLARHAGFDVIATASRPQTRDWCLQLGAHHVIDHRQPLAPQLQALGIAQVDAA
FT                   LNLADTDRYWQILGELIAPQGHVGLIVEPTGPLHIGDPYKAKCIGIHWEMMFARPRFRT
FT                   ADMIEQHRILARTASLVDAGALRTTLTETLTPINAANLRQAHQRLESGSTIGKLALAGW
FT                   G"
FT   gene            609277..610377
FT                   /locus_tag="XALC_0557"
FT   CDS_pept        609277..610377
FT                   /transl_table=11
FT                   /locus_tag="XALC_0557"
FT                   /product="putative ompa family outer membrane protein
FT                   precursor"
FT                   /function="location of gene products go:0005575; outer
FT                   membrane go:0009279"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15086"
FT                   /db_xref="GOA:D2UB90"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB90"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15086.1"
FT                   /translation="MNKKILTAALLGGLAVAQAASAQEFDDRWYLTGAAGFNFQDVHRH
FT                   TNDAPFVTLGLGKFINPNWSLDGELNYQNPNFKANEDLNWSQYGVSVDLRRHFIQEGRG
FT                   WNPYVLFGAGYQRAEESFDTHGPVSPGKRKDGNFAAKVGAGLQTTFDKHIAVRAEVAYR
FT                   ADFDDKSVAAPSRNWFGDALASVGVVIPLGPAPSAPVPPPPPPPVAPSCADKDDDGDGV
FT                   NNCDDKCPDSKPGQTVGPDGCPVPVSIDLKGVNFDFNKSTLRPDAIGLLNEAVGILNSY
FT                   PDLKVQVAGHTDSIGSDKYNQKLSERRARVVYDYLVKHGVDASRLDGPIGYGKTRPIAP
FT                   NTNPDGSDNPEGRAKNRRTELNVENK"
FT   gene            610642..611136
FT                   /locus_tag="XALC_0558"
FT   CDS_pept        610642..611136
FT                   /transl_table=11
FT                   /locus_tag="XALC_0558"
FT                   /product="hypothetical secreted protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15087"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB91"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15087.1"
FT                   /translation="MLRIVTVGLLGLALAPVAHAVPDCSGDLLPKPLALPATVAAPVAA
FT                   ELSSRTMQLGMPSGVLTQSYSSDQSLDRVLLRLRAEGCQSLAKAIAPGGAVNPNDPAAY
FT                   KPTTEFDNTPWRFDMTQNGKRMTAAEFDAWMKARGVHVVKARPAAVPAAATDAPTPVEA
FT                   K"
FT   gene            611182..612009
FT                   /gene="rluB"
FT                   /locus_tag="XALC_0559"
FT   CDS_pept        611182..612009
FT                   /transl_table=11
FT                   /gene="rluB"
FT                   /locus_tag="XALC_0559"
FT                   /product="probable pseudouridylate synthase protein"
FT                   /function="information transfer; rna related go:0016070;
FT                   rna modification go:0009451"
FT                   /EC_number="4.2.1.70"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15088"
FT                   /db_xref="GOA:D2UB92"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:D2UB92"
FT                   /protein_id="CBA15088.1"
FT                   /translation="MVRELKTPRSGRSRSLTSKEALPAVAVGGPRHGLARTLSKLGLCS
FT                   RTEAVRWIAAGRVAVDGRIVTDPEFPILRGRHRLALDGAPLSASERLYLMLNKPRGLVT
FT                   TAQDERGRETVYRCFDGAGLPWLAPVGRLDKASEGLLLFTNDPQWAARVTDPGTGPDKT
FT                   YHVQVDVLPDAALLQRMRAGVMADGEALCAKQVRLLRQGERHAWLEIVLDEGRNRQIRR
FT                   LLAAFGVDVVRLVRVAIGTLVLGELGKGAWRTLSAAEVSALAVATDVSAQAAR"
FT   gene            complement(612214..613416)
FT                   /gene="kbl"
FT                   /locus_tag="XALC_0560"
FT   CDS_pept        complement(612214..613416)
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="XALC_0560"
FT                   /product="probable 2-amino-3-ketobutyrate coenzyme a ligase
FT                   protein"
FT                   /function="metabolism go:0008152; carbon compound
FT                   utilization; amino acids go:0009063"
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15089"
FT                   /db_xref="GOA:D2UBJ5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15089.1"
FT                   /translation="MTDSRLTQHYADELDAIRAQGLFKSERIIVGPQAAEITLADNRRV
FT                   LNFCANNYLGLADHPTLIAAAKDALDTHGFGMASVRFICGTQDLHKRLEAQIAAFFGTE
FT                   DTLLYAACFDANGGLFEPLLGEHDAIISDALNHASIIDGVRLCKAKRFRYANCDMADLE
FT                   AQLQAANAAGCKTKLITSDGVFSMDGFIAPLDEITALAKRYNALVHIDECHATGFLGRS
FT                   GRGSAEVKGVLDRIDLFTGTLGKAMGGALGGFTTGRGEVIELLRQRSRPYLFSNSLPPH
FT                   VVAAGIKAFEMLDAAGDLRERLVENTTYFRARMSSAGFDIKPGTHPICPVMLYDAPLAQ
FT                   RFAERLLEEGIYAIGFFFPVVPKGQARIRTQISAAHTRAHLDQAIDAFTRIGRELNVIG
FT                   T"
FT   gene            complement(613606..614637)
FT                   /gene="tdh"
FT                   /locus_tag="XALC_0561"
FT   CDS_pept        complement(613606..614637)
FT                   /transl_table=11
FT                   /gene="tdh"
FT                   /locus_tag="XALC_0561"
FT                   /product="probable l-threonine 3-dehydrogenase protein"
FT                   /function="metabolism go:0008152; threonine catabolism
FT                   go:0006567"
FT                   /EC_number="1.1.1.103"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15090"
FT                   /db_xref="GOA:D2UBJ6"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15090.1"
FT                   /translation="MAQTMKALVKRDAAKGIWLEQVPVPTPGPNEVLIKLEKTAICGTD
FT                   LHIYLWDEWSQRTIKPGLTIGHEFVGRIAELGAAVSGYQLGQRVSAEGHIVCGHCRNCR
FT                   GGRPHLCPNTLGIGVNVNGAFAEYMVMPVSNLWPIPDPIPSELAAFFDPYGNAAHCALE
FT                   FNVIGEDVLITGAGPIGIIAAGICKHIGARNVVVTDVNDFRLKLAADMGATRVVNVADT
FT                   SLKDVMADLHMEGFDVGLEMSGNPRAFNDMLDCMYHGGKIAMLGIMPRGAGADWDKIIF
FT                   KGLTVQGIYGRKMYETWYKMTQLVLSGFPLGKVLTHQLTIDEFQKGFDLMEEGKAGKVV
FT                   LSW"
FT   gene            614787..616946
FT                   /locus_tag="XALC_0562"
FT   CDS_pept        614787..616946
FT                   /transl_table=11
FT                   /locus_tag="XALC_0562"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15091"
FT                   /db_xref="GOA:D2UBJ7"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR019500"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ7"
FT                   /protein_id="CBA15091.1"
FT                   /translation="MRPTPWAIAAAVVAVLASVSSVHAGEGMWVPQQLPDIAGPLQQAG
FT                   LKLPPQQLADLTGDPMGAVVSLGGCTASFVSPQGLVVTNHHCAYGAIQLNSTPQKNLIR
FT                   DGFNAAIGSAELSAGPNERIYVLDRITDVTTQAKAAMDVAGKDALKRTQALEDFDKAQV
FT                   AACEAEAGYRCTLYSFSGGNTYRLFRNLEIRDVRLVYAPPSGIGKFGGDIDNWMWPRHT
FT                   GDFSFFRAYVGKDGKPAAYAKDNVPYQPKHFLTFADQALGAGDFVMVAGYPGRTNRYAL
FT                   AAEFDAVADWGYPTAARHYRDLIALVERAGKQDPEIQVKYAATMASWNNVAKNYEGQLE
FT                   GFKRIDATAKKREQERAVLEWLKHQGRDGSAALRAHAQLLALSEQAKATRDRDLVLGQL
FT                   RRTGVLGSAVSLYRLAIERAKPDAEREPGYQTRDLPEIEGAMKQMEYRYVPAMDSQLQR
FT                   YWFAQYLKLPKAQHLPALDQWLAGADAQAAATRLAGTRLGSTEERLKWLHADRAAFEAS
FT                   DDPALRYAVALMPALLQIERDQKRRKGEELLARPRYLQAVADYKKSQGESVYPDANSSL
FT                   RITFGNVKGYAPKDGVFYTPFTTLDGVVAKDTGVEPFDSPKALLQAAKAKRYGGLEDKQ
FT                   LGTVPVDFLSDLDITGGNSGSPVMDAHGKLVGLAFDGNWESVSSNWVFDPAMTRMIAVD
FT                   ARYVHWIMQEVAPAPRLLKELKLAK"
FT   gene            617103..617747
FT                   /locus_tag="XALC_0563"
FT   CDS_pept        617103..617747
FT                   /transl_table=11
FT                   /locus_tag="XALC_0563"
FT                   /product="putative phosphoglycerate mutase protein"
FT                   /function="metabolism go:0008152; carbon compound
FT                   utilization"
FT                   /EC_number="5.4.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15092"
FT                   /db_xref="GOA:D2UBJ8"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15092.1"
FT                   /translation="MRILLARHGETPWNAEGRYQGQIDIPLSPVGEAQAQALGTRLREV
FT                   PLSRAVASPLSRAQRTACLALGAEREAMLQTEPDLQEIAHGEWEGLLASEIHDKDPARL
FT                   RAWREEPDTVLMPGGESLRQVLERSWRGLARATEGLGEHDTLLVVAHDAVNRVILCRVL
FT                   GLPIARLWSFRQAPTTLNLLEGPDLDQLEVVRLNDCAHHTPFFGEAKHRAL"
FT   gene            617862..619133
FT                   /gene="folC"
FT                   /locus_tag="XALC_0564"
FT   CDS_pept        617862..619133
FT                   /transl_table=11
FT                   /gene="folC"
FT                   /locus_tag="XALC_0564"
FT                   /product="probable folc bifunctional protein [includes
FT                   folylpolyglutamate synthase and dihydrofolate synthase]"
FT                   /function="metabolism go:0008152; folic acid go:0046656"
FT                   /EC_number="6.3.2.17"
FT                   /EC_number="6.3.2.12"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15093"
FT                   /db_xref="GOA:D2UBJ9"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBJ9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15093.1"
FT                   /translation="MNTSPVTLSDWLTYIEQQHPLAIAMRLERLRAVAACMGLTRPAKR
FT                   VITVGGTNGKGSTVAFIESIARAGGWAVGSYTSPHLLRYNERVRIGGEEASDAQLIAGF
FT                   VAVEAARGDTPLTYFEYSTLVALWLFEQSGLDLAVLEVGLGGRLDAVNVVDADVAVITT
FT                   VDIDHTEWLGSDREAIGTEKVGIARPWKPLVLGEIDPPSSVLRHAYAIGASVLRAGSDF
FT                   FHEPLDAERWRWRDVGTELSLPLPQLRASVQLANAATAIAALRALRKSLPRSAYAEGIA
FT                   AARLGGRLQSCMRDGVEVLVDVGHNPQAARVLAASLQAQPVVGATRVVFAALGDKDAVG
FT                   VVKALEGQVDAWHLAGLSGVRGQSGVQLRERLAGTAAAVAVVAESVVQALQQALQQAHP
FT                   GDRVLVFGSFHTAADALHWLHSAD"
FT   gene            619203..620309
FT                   /locus_tag="XALC_0565"
FT   CDS_pept        619203..620309
FT                   /transl_table=11
FT                   /locus_tag="XALC_0565"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15094"
FT                   /db_xref="GOA:D2UBK0"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK0"
FT                   /protein_id="CBA15094.1"
FT                   /translation="MDTVLKQRLIGALILVALAVIFLPMLVKGPAPDSGVANVPLKAPA
FT                   APADGQFETRELPLVTPGDTPSGGAVGMTQTPATPAAAPAAAPAPVQDNPDAADLATPA
FT                   TGGSTAQPLPPSVAAGNYAVNFGAYATPADADAVVARLKQAHLPGFREATMLGGRQAWR
FT                   VRIGPYADRAQAESVRLQAVKVRNDVNAQVVTLDAAPSQPVPPSAASSVAVAAPSAPAK
FT                   TEALPAPQSKPVVVAKPASPKPEPEPTKPEAPKSEAPKSEAPKSEPAKPAVAAAAKPAP
FT                   SAPAAPAASGTGFAVQLGAFAKSEDADALRDKVRAAGFSAFVEQVRTDKGTLSRVRVGP
FT                   VANRADAEQLRVQVAAKVGISGMVRPHP"
FT   gene            620406..621158
FT                   /gene="cvpA"
FT                   /locus_tag="XALC_0566"
FT   CDS_pept        620406..621158
FT                   /transl_table=11
FT                   /gene="cvpA"
FT                   /locus_tag="XALC_0566"
FT                   /product="probable colicin v production protein"
FT                   /function="cell structure go:0005575; membrane go:0009274"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15095"
FT                   /db_xref="GOA:D2UBK1"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15095.1"
FT                   /translation="MIDIVLLAVILVSALLGALRGFVGIVVGTLSWLLAGWASFRFGGD
FT                   VGRWLADSPHPSMSYYLGGYALTFVTVMAVVGITGMVIRTVVRSTMLSGTDRALGFGLG
FT                   ALRGGFFAAVLILLMSFTPLTREPQWRQSILLPVLSPGVSWMRAQLPDWRMPQLNMSQL
FT                   PQLNMSKMDLGNMPAAGDNATVPPALQASAMQDMMSKALGRSGARSAPAGSDSSRLMPA
FT                   NIDPAQARPAVRDPAWVQSNGQARPPSQ"
FT   gene            621187..622653
FT                   /gene="purF"
FT                   /locus_tag="XALC_0567"
FT   CDS_pept        621187..622653
FT                   /transl_table=11
FT                   /gene="purF"
FT                   /locus_tag="XALC_0567"
FT                   /product="probable amidophosphoribosyltransferase protein"
FT                   /function="metabolism go:0008152; purine biosynthesis
FT                   go:0006164"
FT                   /EC_number="2.4.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15096"
FT                   /db_xref="GOA:D2UBK2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR035584"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15096.1"
FT                   /translation="MCGIVGIVGNQNVAGQLYDGLAVLQHRGQDAAGIATADGTRLRVQ
FT                   KANGLVRDVFDEKRMAVLEGRVGIAHCRYPTAGSEGMDEAQPFYVNSPYGIALAHNGNL
FT                   INTEALRQQVFEADRRNINTDSDSEVLLNVFAYELDAQRMLTPEAAIRAVAGVHRRCKG
FT                   GYAVVSVVLGLGLVAFRDPHGIRPLVLGKRAGVEGDEYIVASESSALDILGFARVRDVR
FT                   PGEALVITGRGELFSEVCALPTQHTPCIFEYVYFARPDSMIDNVSVHKARMRMGMKLGE
FT                   KILRLRPDHDIDTIIPIPDTSRDAALEMSNVLGVKYREGFVKNRYIGRTFIMPGQGERV
FT                   KSVRRKLNPIHLEFRNRVVLLVDDSIVRGTTSRQIVQMAREAGARKVYLASAAPPVRYP
FT                   NIYGIDMPAADELVAHGRSEEEVQEFLGCDWLIYQDLEDLETAVREGNPELKTFDSSCF
FT                   NGHYTTGIEPDYFERIMQLRSDEAKRKRRA"
FT   gene            622688..623554
FT                   /locus_tag="XALC_0568"
FT   CDS_pept        622688..623554
FT                   /transl_table=11
FT                   /locus_tag="XALC_0568"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15097"
FT                   /db_xref="InterPro:IPR007402"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011197"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15097.1"
FT                   /translation="MVPVGLLAPYGEGVVCTCDAVTGDLYRAARVCLDAADPAEKVALT
FT                   QRYAAAWRNGELAISAAAPTPEPMRMPGRPERPLLVHPRALPRRGLGSPEGRAAFVHAI
FT                   AHIELNAIDLAWDAVYRFRGLPTAFYADWVAVADDESRHFVLLRDRLHALGHAYGDFPA
FT                   HNGLWEMCEKTAHDGLARMALVPRVLEARGLDVTPGMIAKLRVLGDEATAQILELILRE
FT                   EVAHVAAGSRWYRWYCERAGIEPRACFAALLREYAGGYLHGPFNLQARLLAGFDEDELL
FT                   ALQHQAD"
FT   gene            complement(623829..624566)
FT                   /gene="lpxH"
FT                   /locus_tag="XALC_0569"
FT   CDS_pept        complement(623829..624566)
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="XALC_0569"
FT                   /product="probable udp-2,3-diacylglucosamine hydrolase
FT                   protein"
FT                   /function="metabolism go:0008152; lipopolysaccharide
FT                   go:0009103; lipid a go:0009245"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15098"
FT                   /db_xref="GOA:D2UBK4"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR010138"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15098.1"
FT                   /translation="MTTLFISDLHLDPARPAITDLCLGFLRSEARQAEALYILGDLFEV
FT                   WIGDDTPSAAADAVAVELRALHDAGVPVFFMHGNRDFLLGADYAQRAGIRLLPEPCVID
FT                   LYGEPTLLLHGDLLCTHDTAYQAFRAQTRDPAFQQQFLAQPLQARIAYAQQARAASQAR
FT                   QTELKQGDHAQFETITDVTPAEVAATFARYGVARMIHGHTHRPAVHALDVDGRACTRIV
FT                   LGDWYEQGSVLHADAQGCRLQHL"
FT   gene            complement(624740..625267)
FT                   /locus_tag="XALC_0570"
FT   CDS_pept        complement(624740..625267)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0570"
FT                   /product="putative membrane protein"
FT                   /function="metabolism go:0008152; phospholipid go:0008654"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15099"
FT                   /db_xref="GOA:D2UBK5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15099.1"
FT                   /translation="MSTRLDTLRGHETRWCRRANHWCRRRSVRHFFSLISRLGDGVFWY
FT                   ALMTLLVCCDGMNGVFASAHMAATGVVALSLYKGLKRWTRRPRPYAADLRIRAWVAPLD
FT                   EFSFPSGHTLHAVSFGIVALAYYPWLAPLLVPFIACVALSRVVLGLHYPSDVLAATGIG
FT                   TLLAGLSLWMVG"
FT   gene            complement(625251..626384)
FT                   /locus_tag="XALC_0571"
FT   CDS_pept        complement(625251..626384)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0571"
FT                   /product="putative glycosyltransferase protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15100"
FT                   /db_xref="GOA:D2UBW7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15100.1"
FT                   /translation="MRYAIVTETYPPEVNGVALTVHGLELGLRARGHTVEVIRPRQAGD
FT                   TDMADLRLVRGAALPRYPGLKFGLPAPRRLTQLWQAARPDAVYIATEGPLGWSALRSAR
FT                   RLGIPVATGFHTRFDEYLPQYGAAWLQSTALRWMRRFHNQAQATLVPTRELLEFLTKQG
FT                   FERVRLLARAVDSKHFEPQRRDAQLRRQWGLQDDDCAVLYVGRIASEKNLPLAVQAFRQ
FT                   LQKIRPSARFVWVGDGPLRERLAQENPDFIFCGVQRGDALARHFASGDLFLFPSRSETF
FT                   GNVTLEAMASGVATVAFDYGAAREYLRDGSNGAAVADDTAFVAATLRLGSDDALRRRLG
FT                   EAACATMRPLRPERVVADFDALLGELADTRRLHVDAA"
FT   gene            complement(626584..628110)
FT                   /gene="ppx"
FT                   /locus_tag="XALC_0572"
FT   CDS_pept        complement(626584..628110)
FT                   /transl_table=11
FT                   /gene="ppx"
FT                   /locus_tag="XALC_0572"
FT                   /product="probable exopolyphosphatase protein"
FT                   /function="metabolism go:0008152; phosphorous metabolism
FT                   go:0006793"
FT                   /EC_number="3.6.1.11"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15101"
FT                   /db_xref="GOA:D2UBW8"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR022371"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15101.1"
FT                   /translation="MPAISPTYPPLRDGDLLAAIDLGSNSFHMVVARYQLGQLRVVDRL
FT                   RETVRMADGLDHKGGLSAEARQRALECLARFGQRIRDLPSLRVRALATNTVRQLRSPQT
FT                   FLIPGETALGHPIEVVSGREEARLIYLGVAHAQPPKSDQRRLVIDIGGGSTEFIIGRGL
FT                   QTMERESLQAGCIASTRRFFPGGKLSRKKWKDALTDIGAEFQQFAVQYRALGWDEAMGS
FT                   SGTHKAIGEICAAMKLTKGGISAEALPQLRDRLLLAKRIEDIDLPGLSADRRPIIAGGV
FT                   LILEAAFQALGLQHLMVSKAAMREGILYDMLGRGGENDPRETAIAALTQRYGIDEAQAA
FT                   RVENTAMALFAQVAGDWALDADDGRMLGWAARLHELGQAIAHSQYHVHGAYVLEHSDIA
FT                   GFSRQEQQVLATLVRAHRRNVPKTAFDALPDRLLLSAKRKTALLRLAVLLHRAHEADPI
FT                   PSLELKANDNTLHLILSQPWLESRPLQRADLIGEVEGMAGLGISFQPFVA"
FT   gene            complement(628165..630261)
FT                   /gene="ppk"
FT                   /locus_tag="XALC_0573"
FT   CDS_pept        complement(628165..630261)
FT                   /transl_table=11
FT                   /gene="ppk"
FT                   /locus_tag="XALC_0573"
FT                   /product="probable polyphosphate kinase; protein"
FT                   /function="metabolism go:0008152; phosphorous metabolism
FT                   go:0006793"
FT                   /EC_number="2.7.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15102"
FT                   /db_xref="GOA:D2UBW9"
FT                   /db_xref="InterPro:IPR003414"
FT                   /db_xref="InterPro:IPR024953"
FT                   /db_xref="InterPro:IPR025198"
FT                   /db_xref="InterPro:IPR025200"
FT                   /db_xref="InterPro:IPR036830"
FT                   /db_xref="InterPro:IPR036832"
FT                   /db_xref="InterPro:IPR041108"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBW9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15102.1"
FT                   /translation="MPRAIALPPTPPPDVPSDPLRDPSLYLNRELSQLDFNFRVLAQAQ
FT                   DPQVPLLERLRFLCISCTNLDEFFEIRAATVRHAQEFGLPPAPDGMSPSAILNAIHDRA
FT                   AQLVDQQYRCWNEVLRPALKDAGIGVLGRHSWNARQKRWLRAYFRNEIMPVLSPLGLDP
FT                   AHPFPKILNKSLNIVVVLKGVDAFGRVGHLAIVRAPRSLPRIIQLPESLADGGQSFVFL
FT                   SSVLSTFVDELFPGMEVTGSYQFRVTRNSELVVDEEEVENLALALRDELVNRGYRPAVR
FT                   LEIAEDCPKSIVRTLLQNFALPENALYRINGPVNLSRVNQVYDLVQRLDLKYPPMNPRT
FT                   LRDNEGIFEIAAAGDILLHHPFDAFTAVLDLIKQAAIDPNVLAIKQTLYRTGKDSAIVD
FT                   ALVLAARNGKDVTVVVELRARFDEEANLGLADRLQEAGVQVVYGVVGYKTHAKMLLIVR
FT                   REGRKLRRYVHLGTGNYHSGTARAYTDLSLITADVDIGNDVHLLFQQLSGLAPKIRLKR
FT                   LLQSPFTLHPGVLHRIERETKLATAGRPGRIIAKMNALNEPQVIRALYAASQAGVKIDL
FT                   IIRGACTLRPGVPGISDNIRVRSIVGRFLEHSRIYWFGNDGAPELFCASADWLERNLLR
FT                   RVETGFPILASDLVKRIQREVLQNYLADNLNAWELDASGNYHKLAPGQDQPPHSAQIAL
FT                   LDGL"
FT   gene            complement(630273..631598)
FT                   /gene="phoR"
FT                   /locus_tag="XALC_0574"
FT   CDS_pept        complement(630273..631598)
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="XALC_0574"
FT                   /product="probable two-component system sensor protein
FT                   phor"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15103"
FT                   /db_xref="GOA:D2UBX0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15103.1"
FT                   /translation="MPRHIRSAWLKTLGTLAALLLSALLVGWIGEHVWMALTLMSLAVM
FT                   AWHYWRLRRVLSRLTARQRWEPPAGTGVWNELDRLMYRGQAEMRTRKRRLLDMLRAYRA
FT                   AAAALPDAVVVIDRNSQRIQWFNEAAGTLLGLHHPSDLGVLVVERLQPMPLTHWLSDGR
FT                   NAEPMLDTPSPIDDRLRLNLRLIPYSEDYWLLVARDVSKLLRLEEVRRDFVANVSHELR
FT                   TPLTVVHGYLDMLDPEDFPNSGQMIAEMRKQSQRMTQLVEDLLTLSRLESQEHANEESI
FT                   AMGPMLATLRREAEAHSQGRHCIEVHDNADCDLIGSNKELHSAFSNLVTNAVRYTAAGG
FT                   TIHIRFAREGDGAVLSVRDSGYGIPAHHLPRITERFYRVSSSRSRESGGTGLGLSIVKH
FT                   VLGLHQARLGIESEVGKGSTFSCHFGAGRVHRRQEHATLFAD"
FT   gene            complement(631665..632354)
FT                   /gene="phoB"
FT                   /locus_tag="XALC_0575"
FT   CDS_pept        complement(631665..632354)
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="XALC_0575"
FT                   /product="probable two-component system regulatory protein
FT                   phob"
FT                   /function="transcriptional level go:0006355; two-component
FT                   regulatory systems (external signal) go:0000155 go:0000156"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15104"
FT                   /db_xref="GOA:D2UBX1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15104.1"
FT                   /translation="MQKRILIVDDEPAIRDMVAFALRKGDFEPVHAGDAREAQSLIADR
FT                   VPDLILLDWMLPGTSGLELARRWRKDAMTREVPIIMLTARGEENDRVGGLEAGVDDYVV
FT                   KPFSARELLARIRAVMRRTREDDEDGSVSVGNLRIDGAAHRVFAGDAPVPIGPTEYRLL
FT                   HFFMTHPERVYSRAQLLDHVWGGSVYVEERTIDVHIRRLRKTLEPFAVENMVQTVRGSG
FT                   YRFSASI"
FT   gene            complement(632438..634081)
FT                   /locus_tag="XALC_0576"
FT   CDS_pept        complement(632438..634081)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0576"
FT                   /product="putative zn-dependent protease protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15105"
FT                   /db_xref="GOA:D2UBX2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR030873"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15105.1"
FT                   /translation="MRLLPLAFAITLAIACAVAPAQESKLPDIGSSAGELLTPARQAEY
FT                   GKMMLAELRSYGYVLEDPLIEDWLQTIGTRLGANSDQPQQKFTFFMLRDRQINAFATLG
FT                   GYVAVNAGLVLIAEREDEVAAVLSHEIAHITQKHVLRGVERAQREQVPILLGMLAAVVA
FT                   AQQAGGRSGGQATQAAIASGLGLMQQRQINFTRSNESEADRLGIRTLARSGYDVDAMAD
FT                   FFDRMSLAMRGNQGGYSTPDFLMTHPVTATRISEAHERAEQMKKNTLTLITSVPGGTLQ
FT                   ERVDPNDVSLSQPLGAPSNPLLPGSLQLPFTSYSHGVSGQFDWARERLRVLSANTPADA
FT                   VREYEGLRQGSKQGLSDAQRYGLALARLRGGGNPQEAAKTLESLLQAHPDNWWLSLAVA
FT                   EAEARNGHPQQAEQHFDALLKRMPNNRAVALSLATVLNEQGGRAAGKRVQAALRPLLGT
FT                   ATEDPVFQRTFARACELAGDDTRAGEAYAEAAYLNGHPEQALIQLNNLKKRGDLDYVAR
FT                   ARIDARIAAITPTVLELRRLGVQDPEMQRH"
FT   gene            634233..634547
FT                   /locus_tag="XALC_0577"
FT   CDS_pept        634233..634547
FT                   /transl_table=11
FT                   /locus_tag="XALC_0577"
FT                   /product="putative glutaredoxin protein"
FT                   /function="metabolism go:0008152; thioredoxin, glutaredoxin
FT                   go:0042964 go:0042965"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15106"
FT                   /db_xref="GOA:D2UBX3"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011900"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15106.1"
FT                   /translation="MDNPTVEAEQAGRPPITVYSTAICPYCVAAKNFLKSKGFSWSEVR
FT                   IDLDPAERDKMVALTGRTSVPQIFVGDVHVGGYDDMMALHRAGKLEPLLAAGLAPGDKV
FT                   "
FT   gene            634544..634942
FT                   /locus_tag="XALC_0578"
FT   CDS_pept        634544..634942
FT                   /transl_table=11
FT                   /locus_tag="XALC_0578"
FT                   /product="putative carboxymuconolactone decarboxylase
FT                   protein"
FT                   /function="metabolism go:0008152"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15107"
FT                   /db_xref="GOA:D2UBX4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15107.1"
FT                   /translation="MSAVGEGGGEERVRAFTEFRQRMNQRILAEPNQVVRRFFALDTQT
FT                   YQAGALDVKTKELLGLVASLVLRCDDCISYHVAQCKDAGVSHEEFFETFSVGLVVGGSI
FT                   VIPHLRRAVDFLDTLDAGAAVPAAHAHD"
FT   gene            635113..636120
FT                   /locus_tag="XALC_0579"
FT   CDS_pept        635113..636120
FT                   /transl_table=11
FT                   /locus_tag="XALC_0579"
FT                   /product="putative isocitrate dehydrogenase protein"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="1.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15108"
FT                   /db_xref="GOA:D2UBX5"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15108.1"
FT                   /translation="MTQTITIIRGDGIGPEIMDATLFVLDALNAGLTYEYADAGLVALE
FT                   KHGELLPAATLESISKNKVALKSPLTTPVGEGFSSINVAMRRQFDLYANVRPAKSFPNT
FT                   KSRFGAGVDLITVRENTEGAYLSEGQEVSADGETALSMAKVTRKGSERIVRYAFDLARA
FT                   TGRKKVTAVHKANIIKSTSGLFLKAAREVAVHYPEIEFQEMIVDNACMQLVMRPEQFDI
FT                   IVTTNLFGDILSDLCAGLVGGLGLAPGANIGVDAAIFEAVHGSAPDIAGQGKANPCALL
FT                   LGAAQLLDHIGQPKNAERLRNAIVATLDAKDGLTPDLGGSGNTMGFAKAIASRL"
FT   gene            complement(636208..636984)
FT                   /locus_tag="XALC_0580"
FT   CDS_pept        complement(636208..636984)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0580"
FT                   /product="hypothetical membrane protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15109"
FT                   /db_xref="GOA:D2UBX6"
FT                   /db_xref="InterPro:IPR010539"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15109.1"
FT                   /translation="MIRSGNPALKESTFLDLGSGAVIARDGGAMTLNGTINKTGALLLL
FT                   TVLTAAFAWSQSLSVDAAGREIVAPGVIGYVLGGAIGGFVLALITTLKKNWSPITAPLY
FT                   ALVEGFFLGSISALYEHRFNGIVLQAVMLTFGTLFALLFAYRSGMIKATENFKLGVVAA
FT                   TGGIALVYLVTAVLGLFHIQIPYIHGSGTVGIVFSLFVVVVAALNLVLDFDLIENGVKQ
FT                   GAPKYMEWYGAFGLMVTLVWLYIEFLRLLSKLQSRN"
FT   tRNA            637139..637215
FT                   /gene="tRNA-tRNA_Pro"
FT                   /product="transfer RNA-typePro,AnticodonTGG"
FT   tRNA            637259..637335
FT                   /gene="tRNA-tRNA_Arg"
FT                   /product="transfer RNA-typeArg,AnticodonTCT"
FT   tRNA            637371..637447
FT                   /gene="tRNA-tRNA_His"
FT                   /product="transfer RNA-typeHis,AnticodonGTG"
FT   tRNA            637524..637599
FT                   /gene="tRNA-tRNA_Lys"
FT                   /product="transfer RNA-typeLys,AnticodonCTT"
FT   tRNA            637692..637776
FT                   /gene="tRNA-tRNA_Leu"
FT                   /product="transfer RNA-typeLeu,AnticodonTAG"
FT   gene            637978..639273
FT                   /gene="tig"
FT                   /locus_tag="XALC_0586"
FT   CDS_pept        637978..639273
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="XALC_0586"
FT                   /product="probable trigger factor (tf) protein"
FT                   /function="information transfer; chaperoning, folding
FT                   go:0006457"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15110"
FT                   /db_xref="GOA:D2UBK6"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15110.1"
FT                   /translation="MQASIETTGTLERRLTFTLPEERLQSHVGGRLREVARTARIKGFR
FT                   PGKIPAKVIEQRFGPQIRAEALDGLLRETFDSAVREHALRLAGNPRIDRADDNALQFVA
FT                   TFEVVPDFGDIDVSALQVIRHTAEVTDADIAQMIENLRLQRRTWQPAGRAAQDGDLVTL
FT                   ETWSQVGDERLPAEGVEKGSSVIGSGVMFPAIEQGLLGLSKDEEKTLEVDFPADWRVPQ
FT                   FAGKRVQVHVKAVEVAAPVLPEVDKEFIKSFGVKSGDPEQFRKDIRVNLERELKGALMN
FT                   RLRREVGEQLIAAYASVEMPPRLVENEARAMLAEQVEQMRRAGRDPGQVPDDAHHGFLD
FT                   AARKRVLVGLLVGEVARRNELRLDPKRVSETLRLIASTYEEPEQVIEMYRNDPQLMGGL
FT                   QSRVMEEQVIDWIAERAQHTEQAMTFQEAIRQ"
FT   gene            639409..640035
FT                   /gene="clpP"
FT                   /locus_tag="XALC_0587"
FT   CDS_pept        639409..640035
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="XALC_0587"
FT                   /product="probable atp-dependent clp protease proteolytic
FT                   subunit protein"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /EC_number="3.4.21.92"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15111"
FT                   /db_xref="GOA:D2UBK7"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15111.1"
FT                   /translation="MDNVTKALNLVPMVVEQTSRGERAYDIYSRLLKERLIFLVGPIDD
FT                   HMANVVVAQLLFLEADNPEKDISLYINSPGGVVTAGMAIYDTMQYIKPDVSTICVGQAA
FT                   SMGALLLASGAAGKRYALPNSRVMIHQPLGGFQGQATDIDIHAREILTLRARLNEVLAK
FT                   HTGQSLETIARDTERDNFKSAIDAQAYGLVDQVLERRPDESIQPA"
FT   gene            640165..641451
FT                   /gene="clpX"
FT                   /locus_tag="XALC_0588"
FT   CDS_pept        640165..641451
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="XALC_0588"
FT                   /product="probable atp-dependent clp protease atp-binding
FT                   subunit protein"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0588"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15112"
FT                   /db_xref="GOA:D2UBK8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15112.1"
FT                   /translation="MSEDRQGRSGDSNKILYCSFCGKSQHEVRKLIAGPSVFICDECVE
FT                   LCNDIIREELEEKAQSARSSLPKPREILEVLDQYVIGQQRAKRTLAVAVYNHYKRIESR
FT                   QKNDEVELAKSNILLVGPTGSGKTLLAETLARLLNVPFTIADATTLTEAGYVGEDVENI
FT                   IQKLLQKCDYDVDKAQHGIVYIDEIDKISRKSENPSITRDVSGEGVQQALLKLIEGTVA
FT                   SVPPQGGRKHPQQEFLQVDTKNILFICGGAFAGLDKVIQQRSNDAGGIGFGAKVKSVER
FT                   KREVGKILAEVEPEDLIKFGLIPEFVGRLPVVATLEELDEPALIKILTEPKNAITKQFK
FT                   KLFEMEGVELEFRQDALLAIAKKALKRKTGARGLRTIVESVLLDTMYELPSQENVSKVV
FT                   VDESVIEHKSEPYLIYQTPPAPAKLASAE"
FT   gene            641622..644096
FT                   /gene="lon"
FT                   /locus_tag="XALC_0589"
FT   CDS_pept        641622..644096
FT                   /transl_table=11
FT                   /gene="lon"
FT                   /locus_tag="XALC_0589"
FT                   /product="probable endopeptidase la protein"
FT                   /function="metabolism go:0008152;
FT                   proteins/peptides/glycopeptides go:0006508 go:0009050"
FT                   /EC_number="3.4.21.53"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15113"
FT                   /db_xref="GOA:D2UBK9"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004815"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027543"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBK9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15113.1"
FT                   /translation="MAQSSSEVLDLPVLPLRDVVVFPHMVIPLFVGRDKSMRALEHAME
FT                   ADKRILLVAQKSAETDDPVAVDLYNVGTLAQVLQLLKLPDGTIKVLVEGLSRVSVNKVV
FT                   ERDGALQGEGREIDAAESREEREVEAIARSLMSLFEQYVKTNRKLPPELLQTLSGIDEP
FT                   GRLADTIAAHIGVRLADKQRLLETLQVGERLEMLVGLVDGEIDVQQLEKRIRGRVKSQM
FT                   EKSQREYYLNEQMKAIQKELGDLDDAPGELEELARKIAEAGMPKPVETKAKAELNKLRQ
FT                   MSPMSAEAAVVRNYLDWLLGVPWKKRSKVRKDLKVAQETLDADHYGLEKVKERILEYLA
FT                   VQSRVKQMKGPILCLVGPPGVGKTSLGQSIAKATNRKFVRMSLGGVRDEAEIRGHRRTY
FT                   VGSMPGRIVQNLNKVGSRNPLFVLDEIDKMSMDFRGDPSSALLEVLDPEQNNAFNDHYL
FT                   EVDLDLSEVMFVATSNSLNIPGPLLDRMEVIRIPGYTEDEKLNIATRYLTPKQLKANGL
FT                   KQDELEIGADAIRDIVRYYTRESGVRNLEREVAKICRKVVKEIALAGPVSAAVAKKTAA
FT                   KKSGARKDKARVSVGSKNLEKYLGVRRFDFGRAEEQNEIGLVTGLAWTEVGGDLLQIES
FT                   TLVPGKGAVILTGQLGDVMKESASAALSVVRSRAERLGIEADFLQKQDVHLHVPDGATP
FT                   KDGPSAGIAMVTSLVSMLTKVPVKADVAMTGEITLRGRVSAIGGLKEKLLAALRGGIRT
FT                   VLIPEENRKDLADIPENVTRDLKIVSVKWIDEVLDLALERPLTPKATTTDGERATAVRR
FT                   KQKASSNARVKH"
FT   gene            644322..644594
FT                   /gene="hupB"
FT                   /locus_tag="XALC_0590"
FT   CDS_pept        644322..644594
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="XALC_0590"
FT                   /product="probable dna-binding protein hu (histone-like
FT                   protein hu)"
FT                   /function="transcriptional level go:0006355"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15114"
FT                   /db_xref="GOA:D2UBL0"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBL0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15114.1"
FT                   /translation="MNKAELNDAIAAAADISKAEAGRAVDAFVSEVTKALKKGDSVTLV
FT                   GFGTFQVRDRAERTGRNPKTGDSIKIAASKNPTFKAGKALKDAVN"
FT   tRNA            644606..644680
FT                   /gene="tRNA-tRNA_Val"
FT                   /product="transfer RNA-typeVal,AnticodonTAC"
FT   tRNA            644708..644784
FT                   /gene="tRNA-tRNA_Asp"
FT                   /product="transfer RNA-typeAsp,AnticodonGTC"
FT   tRNA            644905..644981
FT                   /gene="tRNA-tRNA_Asp"
FT                   /product="transfer RNA-typeAsp,AnticodonGTC"
FT   gene            645167..647152
FT                   /gene="ppiD"
FT                   /locus_tag="XALC_0594"
FT   CDS_pept        645167..647152
FT                   /transl_table=11
FT                   /gene="ppiD"
FT                   /locus_tag="XALC_0594"
FT                   /product="probable peptidylprolyl isomerase (rotamase d)
FT                   protein"
FT                   /function="information transfer; chaperoning, folding
FT                   go:0006457"
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15115"
FT                   /db_xref="GOA:D2UBL1"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBL1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15115.1"
FT                   /translation="MLQTLREKTSGWIATAIIGLLMIPFLFVIDTGYLGGVGANNVAKV
FT                   QAPPSWWLSAPSWWPVSLLWQHHEISTEQFRMGFEQARQQARQQQGEAFDPREFESIDN
FT                   KRKVLDQLIDEQVVKLAAEQAGVVIGDASVRDYIASIPAFQNNGKFDPERYRLALASGT
FT                   PPRTPAMFQQLVRDALQQSVIPTGLMESAFGSKQETERLMKMLGETRDVELAMLPEMPA
FT                   DTAPVSDAQVQQWYDTHTSDFKQPETVSIEYVELNAAKLPASKPADEATLRKRYEEEKA
FT                   RFVEPDQRLASHILISAGKDAASQKAAEAKAVKLAAEAKRPGADFAALARANSDDPGSK
FT                   NAGGDLGWVEKGVMVKPFEDALFAMKPGEIVGPVKSEFGYHVIQLREVKGGKGKSFEQV
FT                   RDQLASEQLQADNEKALSALSGKLVDEVYKNPTELASAAKDVGLPVQTLGPFTRASASG
FT                   IAAQPAVLRAAFSDALVQDGTVSDPINLGPNHSVMIRVTQHQPEQILPLAKVHEQVIAA
FT                   VHADRTAKAAAAKADALLVRLRKGETLQALAGPEKLQINPMPALSRSPMPSPEANRTIF
FT                   SAPRPVAGKPSFGKVALPAAPGAGGKRYALFAVTKVMPGDLSKVPAEQQTTFKQQLAQI
FT                   EGAADAKAYVDAMRKRYKVSVQEAQL"
FT   gene            complement(647427..648623)
FT                   /gene="mltD"
FT                   /locus_tag="XALC_0595"
FT   CDS_pept        complement(647427..648623)
FT                   /transl_table=11
FT                   /gene="mltD"
FT                   /locus_tag="XALC_0595"
FT                   /product="probable membrane-bound murein hydrolase d
FT                   precursor protein"
FT                   /function="metabolism go:0008152; peptidoglycan (murein)
FT                   go:0009252"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0595"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15116"
FT                   /db_xref="GOA:D2UBL2"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBL2"
FT                   /protein_id="CBA15116.1"
FT                   /translation="MTAALTLASALPCTTIATPLGTTLEQTMAGVNALPADPATLPPAT
FT                   TRNGRDILARFRDGLADAHCDASTSDPRWHQQFSHAPARLANADEDVLPLFGYVIDELR
FT                   AANLPTEFALIPFVESGYRPAARSRRNGPAGLWQFIPATARRHDVPVESSYDGRLSAVD
FT                   STRAALRYLQTLHEIFGGDWRLTLMAYNGGESRVLQSMRHAGMDTQGARPDKLPGLASV
FT                   THAYVEKLHALACVLEQAQTHTEWMASLDRDVPILQAQILPAGMALDDWARQQTLPSNQ
FT                   LARLNPALDNRRNHKRGLSVLVPLGMSSGSALAQGRTPTPQDTSTAISVSSNDSVSAMP
FT                   ATGQRTSRPRRHTHTVRDGDTAWTIAKRYGITVQALLTQNGLSAGSLLRPGMVLNYAD"
FT   gene            complement(648635..649414)
FT                   /gene="gloB"
FT                   /locus_tag="XALC_0596"
FT   CDS_pept        complement(648635..649414)
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="XALC_0596"
FT                   /product="probable hydroxyacylglutathione hydrolase
FT                   (glyoxalase II) protein"
FT                   /function="metabolism go:0008152; methylglyoxal metabolism
FT                   go:0009438"
FT                   /EC_number="3.1.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15117"
FT                   /db_xref="GOA:D2UBL3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBL3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15117.1"
FT                   /translation="MRLIALPAFQDNYIWSIAADDGRALLVDPGQAEPVLEAAAQGLQP
FT                   AAILLTHHHDDHIGGVPALRARWPELPVYAPEDPRIDCASHRVGHGDSIQALHWQFDTL
FT                   AVPGHTRSHLAYVGHGYLFSGDTLFSLGCGRMFEGTPSQMLASLHRLSALPGETLVCCG
FT                   HEYTLANAAFAVMVDPTNVALRQRHQEVQAMRHAAHPTVPVTLASEVATNPFLRTASPA
FT                   IRRAVGARLGRAADDATADEDVDVFAELRRWKDDFRA"
FT   gene            649427..650086
FT                   /locus_tag="XALC_0597"
FT   CDS_pept        649427..650086
FT                   /transl_table=11
FT                   /locus_tag="XALC_0597"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15118"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBL4"
FT                   /protein_id="CBA15118.1"
FT                   /translation="MPAVLRPRQANVSSWFDTTGAQALLQAEQPLIQEALLKRPAQPWL
FT                   WLAPVPSMPLSREVPGRGLRLHRSASGYAGDLICRLPLPLPSESVNAIVLQHVLAADAL
FT                   ALLEECERVLMPGGRLWLFALNAMSPYRLRWRRQGLVARPPGSWRGLLEQAGLPCVEQL
FT                   RYLGPVWPTRAGTGAIASTAPLRAVCLLQVEKRTAAGIGPIALRAPLRWRGSIASI"
FT   gene            650104..650562
FT                   /gene="rnhA"
FT                   /locus_tag="XALC_0598"
FT   CDS_pept        650104..650562
FT                   /transl_table=11
FT                   /gene="rnhA"
FT                   /locus_tag="XALC_0598"
FT                   /product="probable ribonuclease h (rnase h) protein"
FT                   /function="metabolism go:0008152; macromolecule degradation
FT                   go:0009057; rna go:0006401"
FT                   /EC_number="3.1.26.4"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15119"
FT                   /db_xref="GOA:D2UBX7"
FT                   /db_xref="InterPro:IPR002156"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022892"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15119.1"
FT                   /translation="MKTVDIHTDGACLGNPGPGGWAALLRYKDQEREVAGAEAHTTNNR
FT                   MELMAAIMALETLNAPCQIVLHTDSQYVRQGITEWMPGWVRRQWKTAGGDPVKNRDLWE
FT                   RLHAAAQRHAIDWRWVKGHNGDPDNERVDQLARDQAVRARAGGGAVAS"
FT   gene            650591..651325
FT                   /gene="dnaQ"
FT                   /locus_tag="XALC_0599"
FT   CDS_pept        650591..651325
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="XALC_0599"
FT                   /product="probable dna polymerase III, epsilon subunit
FT                   protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15120"
FT                   /db_xref="GOA:D2UBX8"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX8"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15120.1"
FT                   /translation="MRQIILDTETTGLEWKKGNRVVEIGAVELLERRPSGRHFHRYLRP
FT                   DCDFEPGAQEVTGLTLEFLADKPEFHEVVDEFLEFIDGAELVIHNASFDLGFLDYELSR
FT                   LGESYGCILDRASVVDTLLLARERFPGQRNSLDALCKRLGVDNAHRQLHGALLDAQILC
FT                   EVYIALTSGQEEIGFALVEETTGKTDAHGVAFDMATLLPRPQVLPTASELEAHQARLDT
FT                   LRKKAGRALWDAIEPLPSELAG"
FT   gene            complement(651412..652116)
FT                   /locus_tag="XALC_0600"
FT   CDS_pept        complement(651412..652116)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0600"
FT                   /product="putative serine/threonine specific protein
FT                   phosphatase"
FT                   /function="metabolism go:0008152"
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15121"
FT                   /db_xref="GOA:D2UBX9"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBX9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15121.1"
FT                   /translation="MIEFGHLTHLGLRRDLNEDTYYGDNELGLWLVADGMGGHACGEVA
FT                   SALAREVIVRQVRGGATLAQAIRIADEEIIHAAQRRNDPLPMGTSVVAARVQGNRFEVA
FT                   WVGDSRAYLWRDGKLAQLSQDHSLVQALIAQGALTAEQARAHPHRNVVTQALGITDPQH
FT                   LNVAVMTGDLRPGVCLLLCSDGLTEHVGEVGIATALGHDDCSAQECVDMLAAAALDDGG
FT                   SDNITVVLVRCH"
FT   tRNA            652328..652418
FT                   /gene="tRNA-tRNA_Ser"
FT                   /product="transfer RNA-typeSer,AnticodonCGA"
FT   gene            652537..652941
FT                   /locus_tag="XALC_0602"
FT   CDS_pept        652537..652941
FT                   /transl_table=11
FT                   /locus_tag="XALC_0602"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15122"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15122.1"
FT                   /translation="MSEILVPVSFGELLDKIAILQIKSERIADPDKLVNVRAELSALEK
FT                   TWMAHPAAGGDVARLRAELKAVNARLWVIEDEIRIKEKAQAFDEEFIKLARSVYYENDE
FT                   RARIKKEINVALGSSYIEEKSYQDYRNTSA"
FT   gene            complement(652959..654008)
FT                   /locus_tag="XALC_0603"
FT   CDS_pept        complement(652959..654008)
FT                   /transl_table=11
FT                   /locus_tag="XALC_0603"
FT                   /product="putative lipopolysaccharide core biosynthesis
FT                   heptosyltransferase protein"
FT                   /function="metabolism go:0008152; lipopolysaccharide
FT                   go:0009103; core region go:0009244"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15123"
FT                   /db_xref="GOA:D2UBY1"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY1"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15123.1"
FT                   /translation="MPAMLPSLCLLRLSALGDVTHVVPLVRTLQHVWPQAPPLHWIIDS
FT                   AGLKLLDGLPGVIFHRYDKRSGLAGMRALRRELPRQGFDALLQMQVALRANVLSACVRA
FT                   RRRIGYDRSRSKDLHGVFINERIPDRPGIHVLDAIGSFCEPLGLRQTEVRWDLPVPDAA
FT                   HAWARAQWPDDGRPALLISPCSSHERRNWYAERYAAVADHAVAQGWRVVLCGGRSALER
FT                   STADAIVAAAHAPLLDLVGRDTLKQLPALLQRAALVMTPDSGPMHIANAMGVKVLGLHA
FT                   ASNPRRSGPYSDIRYCVDKYDAAARKYLGKPAEALKWGSKIEHDGAMALIEVDAAIAAF
FT                   ERYRADHGT"
FT   gene            654029..654778
FT                   /gene="kdkA"
FT                   /locus_tag="XALC_0604"
FT   CDS_pept        654029..654778
FT                   /transl_table=11
FT                   /gene="kdkA"
FT                   /locus_tag="XALC_0604"
FT                   /product="probable 3-deoxy-d-manno-octulosonic acid kinase
FT                   (kdo kinase) protein"
FT                   /function="metabolism go:0008152; lipopolysaccharide
FT                   go:0009103"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15124"
FT                   /db_xref="GOA:D2UBY2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY2"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15124.1"
FT                   /translation="MVAFDATEALTPYRESRGDGAILFDRERLRQPEPALFSATSWAER
FT                   ARPVDAGGRGGTWFVDAPFGACVLRQYRRGGLVAKLSRDRYLWCGAHRTRSFAEFRLMR
FT                   ALIARKLPVPKPLAACYLRQGLRYRAALLMERLEDVRSLADRASIAGHGAPWEETGRLL
FT                   ARFHRAGLDHADLNAHNILFDGNGRGWLIDFDRSVLRIPATGWRERNLKRLHRSLLKLR
FT                   GERGIDAVEKDYARLRRAYDLAWERGC"
FT   gene            654778..655536
FT                   /locus_tag="XALC_0605"
FT   CDS_pept        654778..655536
FT                   /transl_table=11
FT                   /locus_tag="XALC_0605"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15125"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY3"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15125.1"
FT                   /translation="MSAWALRFQGVGNALAVQLGSPMATIERDGRPWLSIDCGGEGLSA
FT                   YQAHYGAMPQALFVTHVHLDHVAGFERLFVDSYFSERCGKVRLYVPATVLPLLHRRVAD
FT                   YPNVLAEGGANFWDAFQLIAVGDAFWHDGVRLEVFPVRHHWPETAYGIRLPGALVWSGD
FT                   TRPIPEMLNRYAGDGELIAHDCGLHGNPSHTGVDDLEREYPAELLRRTMLYHYASTEDA
FT                   EVLRTRGHRVAWPGECVALPAPRLSQVPAG"
FT   gene            655533..656567
FT                   /gene="moaA"
FT                   /locus_tag="XALC_0606"
FT   CDS_pept        655533..656567
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="XALC_0606"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   a"
FT                   /function="metabolism go:0008152; molybdenum
FT                   (molybdopterin) go:0006777"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15126"
FT                   /db_xref="GOA:D2UBY4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY4"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15126.1"
FT                   /translation="MSAALRPPLASATPADRRGRALHDLRLSVIEACNFRCGYCMPADK
FT                   VPDDYGFDAAGRLSFAQIETLARAFVRNGVRKLRLTGGEPLLRRELPELVRRLARIAGV
FT                   EDLAMTTNGVLLATHAQALRDAGLQRVTVSLDAIDPLLFRQLSGGRGEIAQVLAGIDAA
FT                   VAAGLGPVKLNCVVQRGVNDDQVLPLLAHFRGSGHVVRFIEYMDVGTCNAWRRDRVVPA
FT                   ARLRERIAARWPLHALEPHYPGEVAARYVFADGGGEVGFVASVSAPFCGDCHRARVSAD
FT                   GRLYTCLFAAEGADLMPALADGEEALTERVRVLWEQRNDRYSELRGDAPATRGKHVEMF
FT                   LIGG"
FT   gene            656571..656945
FT                   /locus_tag="XALC_0607"
FT   CDS_pept        656571..656945
FT                   /transl_table=11
FT                   /locus_tag="XALC_0607"
FT                   /product="hypothetical protein"
FT                   /function="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15127"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY5"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15127.1"
FT                   /translation="MDAALPRELVGLELALLEPVLRASSERVADLLDDAFLEFGTSGRR
FT                   FDKHAVLHALSVEVSWFADRVFDMDAQLLAPDLAQLRDRSERSGRDEPPRQTLRSSLWQ
FT                   RWDGQWRMLFHQGTPIPGVV"
FT   gene            656977..657495
FT                   /gene="moaC"
FT                   /locus_tag="XALC_0608"
FT   CDS_pept        656977..657495
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="XALC_0608"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   c"
FT                   /function="metabolism go:0008152; molybdenum
FT                   (molybdopterin) go:0006777"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15128"
FT                   /db_xref="GOA:D2UBY6"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY6"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15128.1"
FT                   /translation="MTKKISAKSAGASAPTLTHLDPQGLPAMVDVSAKPATARVAVAEA
FT                   RVRFPAAVAAQLRADALRSAKGGIVDTAVIAGTLAVKRTHELIPFCHPLPIDGCRFVID
FT                   WASLQVLRIQCRVRTVHRTGVEMEALTGASIAALTVYDMCKALTHAMTIGPVRLLGKRG
FT                   GKRDVGSVA"
FT   gene            657492..657737
FT                   /gene="moaD"
FT                   /locus_tag="XALC_0609"
FT   CDS_pept        657492..657737
FT                   /transl_table=11
FT                   /gene="moaD"
FT                   /locus_tag="XALC_0609"
FT                   /product="probable molybdopterin-converting factor chain 1
FT                   protein"
FT                   /function="metabolism go:0008152; molybdenum
FT                   (molybdopterin) go:0006777"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15129"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:D2UBY7"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15129.1"
FT                   /translation="MSASVTVLYFASLREAAGIDREQVRTAVPDLRALYAELDARHGLR
FT                   WPAQRLRVAVDGAFADWGDALRDGTEVVFIPPVSGG"
FT   gene            657741..658166
FT                   /gene="moaE"
FT                   /locus_tag="XALC_0610"
FT   CDS_pept        657741..658166
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="XALC_0610"
FT                   /product="probable molybdopterin-converting factor chain 2
FT                   protein"
FT                   /function="metabolism go:0008152; molybdenum
FT                   (molybdopterin) go:0006777"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15130"
FT                   /db_xref="GOA:D2UCB9"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:D2UCB9"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="CBA15130.1"
FT                   /translation="MSTAPRFHLADDALDPVALRVPLAHAQAGAYASFEGWVRDHNDGR
FT                   AVDGLRYDAYAALAEVEGQRIADEALARFAILDLRCVHRIGDLAIGDLAVWVGVIAAHR
FT                   DTAFGACRYVIDEVKARVPIWKHERYRDGDAGWLHPE"
FT   tRNA            complement(658479..658571)
FT                   /gene="tRNA-tRNA_Ser"
FT                   /product="transfer RNA-typeSer,AnticodonGGA"
FT   gene            658808..660643
FT                   /gene="dnaX"
FT                   /locus_tag="XALC_0612"
FT   CDS_pept        658808..660643
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="XALC_0612"
FT                   /product="probable dna polymerase III tau and gamma
FT                   subunits protein"
FT                   /function="information transfer; dna related go:0006259;
FT                   dna replication go:0006261"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:XALC_0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBA15131"
FT                   /db_xref="GOA:D2UCC0"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:D2UCC0"
FT                   /inference="ab initio
FT                   prediction:AutomaticValidationOfFrameDPredictionUsedWithbla
FT                   stxHitsSPTR"
FT                   /protein_id="