(data stored in ACNUC30630 zone)

EMBL: FP565814

ID   FP565814; SV 1; circular; genomic DNA; STD; PRO; 3619447 BP.
XX
AC   FP565814;
XX
PR   Project:PRJNA48827;
XX
DT   07-APR-2010 (Rel. 104, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 4)
XX
DE   Salinibacter ruber M8 chromosome, complete genome
XX
KW   complete genome.
XX
OS   Salinibacter ruber M8
OC   Bacteria; Bacteroidetes; Bacteroidetes Order II. Incertae sedis;
OC   Rhodothermaceae; Salinibacter.
XX
RN   [1]
RP   1-3619447
RA   Genoscope - CEA;
RT   ;
RL   Submitted (02-APR-2010) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RX   DOI; 10.1038/ismej.2010.6.
RX   PUBMED; 20164864.
RA   Pena A., Teeling H., Huerta-Cepas J., Santos F., Yarza P.,
RA   Brito-Echeverria J., Lucio M., Schmitt-Kopplin P., Meseguer I.,
RA   Schenowitz C., Dossat C., Barbe V., Dopazo J., Rossello-Mora R.,
RA   Schuler M., Glockner F.O., Amann R., Gabaldon T., Anton J.;
RT   "Fine-scale evolution: genomic, phenotypic and ecological differentiation
RT   in two coexisting Salinibacter ruber strains";
RL   ISME J 4(7):882-895(2010).
XX
DR   MD5; ddfb0f7498c1495393f1287531dc2e4d.
DR   BioSample; SAMEA3138292.
DR   EnsemblGenomes-Gn; EBG00001063452.
DR   EnsemblGenomes-Gn; EBG00001063453.
DR   EnsemblGenomes-Gn; EBG00001063454.
DR   EnsemblGenomes-Gn; EBG00001063455.
DR   EnsemblGenomes-Gn; EBG00001063456.
DR   EnsemblGenomes-Gn; EBG00001063457.
DR   EnsemblGenomes-Gn; EBG00001063458.
DR   EnsemblGenomes-Gn; EBG00001063459.
DR   EnsemblGenomes-Gn; EBG00001063461.
DR   EnsemblGenomes-Gn; EBG00001063463.
DR   EnsemblGenomes-Gn; EBG00001063464.
DR   EnsemblGenomes-Gn; EBG00001063465.
DR   EnsemblGenomes-Gn; EBG00001063466.
DR   EnsemblGenomes-Gn; EBG00001063467.
DR   EnsemblGenomes-Gn; EBG00001063468.
DR   EnsemblGenomes-Gn; EBG00001063469.
DR   EnsemblGenomes-Gn; EBG00001063471.
DR   EnsemblGenomes-Gn; EBG00001063472.
DR   EnsemblGenomes-Gn; EBG00001063473.
DR   EnsemblGenomes-Gn; EBG00001063475.
DR   EnsemblGenomes-Gn; EBG00001063477.
DR   EnsemblGenomes-Gn; EBG00001063479.
DR   EnsemblGenomes-Gn; EBG00001063481.
DR   EnsemblGenomes-Gn; EBG00001063482.
DR   EnsemblGenomes-Gn; EBG00001063483.
DR   EnsemblGenomes-Gn; EBG00001063484.
DR   EnsemblGenomes-Gn; EBG00001063485.
DR   EnsemblGenomes-Gn; EBG00001063486.
DR   EnsemblGenomes-Gn; EBG00001063487.
DR   EnsemblGenomes-Gn; EBG00001063488.
DR   EnsemblGenomes-Gn; EBG00001063489.
DR   EnsemblGenomes-Gn; EBG00001063490.
DR   EnsemblGenomes-Gn; EBG00001063491.
DR   EnsemblGenomes-Gn; EBG00001063492.
DR   EnsemblGenomes-Gn; EBG00001063493.
DR   EnsemblGenomes-Gn; EBG00001063494.
DR   EnsemblGenomes-Gn; EBG00001063495.
DR   EnsemblGenomes-Gn; EBG00001063496.
DR   EnsemblGenomes-Gn; EBG00001063497.
DR   EnsemblGenomes-Gn; EBG00001063498.
DR   EnsemblGenomes-Gn; EBG00001063500.
DR   EnsemblGenomes-Gn; EBG00001063501.
DR   EnsemblGenomes-Gn; EBG00001063502.
DR   EnsemblGenomes-Gn; EBG00001063503.
DR   EnsemblGenomes-Gn; EBG00001063504.
DR   EnsemblGenomes-Gn; EBG00001063505.
DR   EnsemblGenomes-Gn; EBG00001063506.
DR   EnsemblGenomes-Gn; EBG00001063507.
DR   EnsemblGenomes-Gn; EBG00001063508.
DR   EnsemblGenomes-Gn; EBG00001063510.
DR   EnsemblGenomes-Gn; EBG00001063511.
DR   EnsemblGenomes-Gn; EBG00001063512.
DR   EnsemblGenomes-Gn; rRNA_1.
DR   EnsemblGenomes-Gn; rRNA_2.
DR   EnsemblGenomes-Gn; tRNA_1.
DR   EnsemblGenomes-Gn; tRNA_10.
DR   EnsemblGenomes-Gn; tRNA_11.
DR   EnsemblGenomes-Gn; tRNA_12.
DR   EnsemblGenomes-Gn; tRNA_13.
DR   EnsemblGenomes-Gn; tRNA_14.
DR   EnsemblGenomes-Gn; tRNA_15.
DR   EnsemblGenomes-Gn; tRNA_16.
DR   EnsemblGenomes-Gn; tRNA_17.
DR   EnsemblGenomes-Gn; tRNA_18.
DR   EnsemblGenomes-Gn; tRNA_19.
DR   EnsemblGenomes-Gn; tRNA_2.
DR   EnsemblGenomes-Gn; tRNA_20.
DR   EnsemblGenomes-Gn; tRNA_21.
DR   EnsemblGenomes-Gn; tRNA_22.
DR   EnsemblGenomes-Gn; tRNA_23.
DR   EnsemblGenomes-Gn; tRNA_24.
DR   EnsemblGenomes-Gn; tRNA_25.
DR   EnsemblGenomes-Gn; tRNA_26.
DR   EnsemblGenomes-Gn; tRNA_27.
DR   EnsemblGenomes-Gn; tRNA_28.
DR   EnsemblGenomes-Gn; tRNA_29.
DR   EnsemblGenomes-Gn; tRNA_3.
DR   EnsemblGenomes-Gn; tRNA_30.
DR   EnsemblGenomes-Gn; tRNA_31.
DR   EnsemblGenomes-Gn; tRNA_32.
DR   EnsemblGenomes-Gn; tRNA_33.
DR   EnsemblGenomes-Gn; tRNA_34.
DR   EnsemblGenomes-Gn; tRNA_35.
DR   EnsemblGenomes-Gn; tRNA_36.
DR   EnsemblGenomes-Gn; tRNA_37.
DR   EnsemblGenomes-Gn; tRNA_38.
DR   EnsemblGenomes-Gn; tRNA_39.
DR   EnsemblGenomes-Gn; tRNA_4.
DR   EnsemblGenomes-Gn; tRNA_40.
DR   EnsemblGenomes-Gn; tRNA_41.
DR   EnsemblGenomes-Gn; tRNA_42.
DR   EnsemblGenomes-Gn; tRNA_43.
DR   EnsemblGenomes-Gn; tRNA_5.
DR   EnsemblGenomes-Gn; tRNA_6.
DR   EnsemblGenomes-Gn; tRNA_7.
DR   EnsemblGenomes-Gn; tRNA_8.
DR   EnsemblGenomes-Gn; tRNA_9.
DR   EnsemblGenomes-Tr; EBT00001666327.
DR   EnsemblGenomes-Tr; EBT00001666328.
DR   EnsemblGenomes-Tr; EBT00001666329.
DR   EnsemblGenomes-Tr; EBT00001666330.
DR   EnsemblGenomes-Tr; EBT00001666331.
DR   EnsemblGenomes-Tr; EBT00001666332.
DR   EnsemblGenomes-Tr; EBT00001666333.
DR   EnsemblGenomes-Tr; EBT00001666334.
DR   EnsemblGenomes-Tr; EBT00001666335.
DR   EnsemblGenomes-Tr; EBT00001666336.
DR   EnsemblGenomes-Tr; EBT00001666337.
DR   EnsemblGenomes-Tr; EBT00001666338.
DR   EnsemblGenomes-Tr; EBT00001666339.
DR   EnsemblGenomes-Tr; EBT00001666340.
DR   EnsemblGenomes-Tr; EBT00001666341.
DR   EnsemblGenomes-Tr; EBT00001666342.
DR   EnsemblGenomes-Tr; EBT00001666343.
DR   EnsemblGenomes-Tr; EBT00001666344.
DR   EnsemblGenomes-Tr; EBT00001666345.
DR   EnsemblGenomes-Tr; EBT00001666346.
DR   EnsemblGenomes-Tr; EBT00001666347.
DR   EnsemblGenomes-Tr; EBT00001666348.
DR   EnsemblGenomes-Tr; EBT00001666349.
DR   EnsemblGenomes-Tr; EBT00001666350.
DR   EnsemblGenomes-Tr; EBT00001666351.
DR   EnsemblGenomes-Tr; EBT00001666352.
DR   EnsemblGenomes-Tr; EBT00001666353.
DR   EnsemblGenomes-Tr; EBT00001666354.
DR   EnsemblGenomes-Tr; EBT00001666355.
DR   EnsemblGenomes-Tr; EBT00001666356.
DR   EnsemblGenomes-Tr; EBT00001666357.
DR   EnsemblGenomes-Tr; EBT00001666358.
DR   EnsemblGenomes-Tr; EBT00001666359.
DR   EnsemblGenomes-Tr; EBT00001666360.
DR   EnsemblGenomes-Tr; EBT00001666361.
DR   EnsemblGenomes-Tr; EBT00001666362.
DR   EnsemblGenomes-Tr; EBT00001666363.
DR   EnsemblGenomes-Tr; EBT00001666364.
DR   EnsemblGenomes-Tr; EBT00001666365.
DR   EnsemblGenomes-Tr; EBT00001666366.
DR   EnsemblGenomes-Tr; EBT00001666367.
DR   EnsemblGenomes-Tr; EBT00001666368.
DR   EnsemblGenomes-Tr; EBT00001666369.
DR   EnsemblGenomes-Tr; EBT00001666370.
DR   EnsemblGenomes-Tr; EBT00001666371.
DR   EnsemblGenomes-Tr; EBT00001666372.
DR   EnsemblGenomes-Tr; EBT00001666373.
DR   EnsemblGenomes-Tr; EBT00001666374.
DR   EnsemblGenomes-Tr; EBT00001666375.
DR   EnsemblGenomes-Tr; EBT00001666376.
DR   EnsemblGenomes-Tr; EBT00001666377.
DR   EnsemblGenomes-Tr; EBT00001666378.
DR   EnsemblGenomes-Tr; rRNA_1-1.
DR   EnsemblGenomes-Tr; rRNA_2-1.
DR   EnsemblGenomes-Tr; tRNA_1-1.
DR   EnsemblGenomes-Tr; tRNA_10-1.
DR   EnsemblGenomes-Tr; tRNA_11-1.
DR   EnsemblGenomes-Tr; tRNA_12-1.
DR   EnsemblGenomes-Tr; tRNA_13-1.
DR   EnsemblGenomes-Tr; tRNA_14-1.
DR   EnsemblGenomes-Tr; tRNA_15-1.
DR   EnsemblGenomes-Tr; tRNA_16-1.
DR   EnsemblGenomes-Tr; tRNA_17-1.
DR   EnsemblGenomes-Tr; tRNA_18-1.
DR   EnsemblGenomes-Tr; tRNA_19-1.
DR   EnsemblGenomes-Tr; tRNA_2-1.
DR   EnsemblGenomes-Tr; tRNA_20-1.
DR   EnsemblGenomes-Tr; tRNA_21-1.
DR   EnsemblGenomes-Tr; tRNA_22-1.
DR   EnsemblGenomes-Tr; tRNA_23-1.
DR   EnsemblGenomes-Tr; tRNA_24-1.
DR   EnsemblGenomes-Tr; tRNA_25-1.
DR   EnsemblGenomes-Tr; tRNA_26-1.
DR   EnsemblGenomes-Tr; tRNA_27-1.
DR   EnsemblGenomes-Tr; tRNA_28-1.
DR   EnsemblGenomes-Tr; tRNA_29-1.
DR   EnsemblGenomes-Tr; tRNA_3-1.
DR   EnsemblGenomes-Tr; tRNA_30-1.
DR   EnsemblGenomes-Tr; tRNA_31-1.
DR   EnsemblGenomes-Tr; tRNA_32-1.
DR   EnsemblGenomes-Tr; tRNA_33-1.
DR   EnsemblGenomes-Tr; tRNA_34-1.
DR   EnsemblGenomes-Tr; tRNA_35-1.
DR   EnsemblGenomes-Tr; tRNA_36-1.
DR   EnsemblGenomes-Tr; tRNA_37-1.
DR   EnsemblGenomes-Tr; tRNA_38-1.
DR   EnsemblGenomes-Tr; tRNA_39-1.
DR   EnsemblGenomes-Tr; tRNA_4-1.
DR   EnsemblGenomes-Tr; tRNA_40-1.
DR   EnsemblGenomes-Tr; tRNA_41-1.
DR   EnsemblGenomes-Tr; tRNA_42-1.
DR   EnsemblGenomes-Tr; tRNA_43-1.
DR   EnsemblGenomes-Tr; tRNA_5-1.
DR   EnsemblGenomes-Tr; tRNA_6-1.
DR   EnsemblGenomes-Tr; tRNA_7-1.
DR   EnsemblGenomes-Tr; tRNA_8-1.
DR   EnsemblGenomes-Tr; tRNA_9-1.
DR   EuropePMC; PMC4644643; 26431969.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FP565814.
DR   SILVA-SSU; FP565814.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3619447
FT                   /organism="Salinibacter ruber M8"
FT                   /strain="M8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:761659"
FT   CDS_pept        25..150
FT                   /transl_table=11
FT                   /locus_tag="SRM_00001"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00001"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22922"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4G7"
FT                   /protein_id="CBH22922.1"
FT                   /translation="MTVVFGALSASFWGPKTFVLEDRPRVGLGTGCLGPHTARGA"
FT   CDS_pept        225..1799
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="SRM_00002"
FT                   /product="Chromosomal replication initiator protein dnaA"
FT                   /function="Plays an important role in the initiation and
FT                   regulation of chromosomal replication. Binds to the origin
FT                   of replication; it binds specifically double-stranded DNA
FT                   at a 9 bp consensus (dnaA box): 5'-TTATC[CA]A[CA]A-3'. DnaA
FT                   binds to ATP and to acidic phospholipids."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00002"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22923"
FT                   /db_xref="GOA:D5H4G8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4G8"
FT                   /protein_id="CBH22923.1"
FT                   /translation="MDQSADRAWNECLDIIRDNVSRQSFTTWFEPLEAHSLEDEDDLRK
FT                   LTIQLPSRFYYEWIEEHYFSLLRKTVTRVLGPHGRLFYDVVIEQDDPEDPDRGASMQLP
FT                   ARPADPESAPPPNAPDEPEAPPSSSEASAPSSEPSAPAPSGDEARPDDAQAGAEGDEKS
FT                   APPVQNPFAIPGLKNAEVDNQLNDSYTFDRFIEGECNRLARSAAHSIATDPGETSFNPF
FT                   LVYGGVGLGKTHLIQAIGNHVAARDASKTVFYVSSERFTTEFVQSIQENQIGEFSTFYR
FT                   QVDVLIVDDVQFFGGKEKTQEEFFHIFNALRQAGNQIVLSADRPPREIDGLEERLLSRF
FT                   QWGLSADLKPPGLDTRISILRRKAEDDGIDLDDDVVEFIAQSIESNIRELEGALIRLLA
FT                   HATLHQLDITLDLAKEVLHDLFQERAATLTVDDIQRIVCEHLGISQEKMRGKTRKRDVT
FT                   RARQIAMYFTKKHTQHSLKDIGLHFGGRDHSTVIHANNAVEDRMADDESFRDTVDAIGQ
FT                   KLERHGQ"
FT   CDS_pept        1796..3064
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="SRM_00003"
FT                   /product="DNA polymerase III, beta chain"
FT                   /function="DNA polymerase III is a complex, multichain
FT                   enzyme responsible for most of the replicative synthesis in
FT                   bacteria. This DNA polymerase also exhibits 3' to 5'
FT                   exonuclease activity. The beta chain is required for
FT                   initiation of replication once it is clamped onto DNA, It
FT                   slides freely (bidirectional and ATP-independent) along
FT                   duplex DNA."
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00003"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22924"
FT                   /db_xref="GOA:D5H4G9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4G9"
FT                   /protein_id="CBH22924.1"
FT                   /translation="MSGGKARSGLNLSSPPSVQVVDAVLHLFIPTQSSSTLPFRNAPTP
FT                   MKFTASSADLLEALNTVKGAVPSKSTMPILECILFERDGDTLRLSATDLEISIIQTVPV
FT                   QFEKNGTPESTPIAVPAQRLIDTLRALPDLPIEFAADSDFEIRMDTDQGHYKMVGHDGS
FT                   DYPELPELEEQHEINVEGGLLGRSIDKTAFAVSQDALRPAMMGVYFQVSEEETSVVATD
FT                   GHRLVKLTLPELRADTSADFIVPEKATKLAGRIVEDDEICTVRVDDSHVSFEFGESRVL
FT                   ARLIDETYPNYQSVIPDGNDRNLVVNREDMLNAVKRVGLYSSSMTNQIRLDITADTVTI
FT                   SAEDVERSSEAEETIHCDYDNEPMEIGFNSEYLTEVLSNVECDEVVFELSSPNRAGIVL
FT                   PREGADDEDILMLIMPVMLNTYA"
FT   CDS_pept        3396..3527
FT                   /transl_table=11
FT                   /locus_tag="SRM_00004"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00004"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22925"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H0"
FT                   /protein_id="CBH22925.1"
FT                   /translation="MSYRGNNPNVEMRAFSKIESASRYRSSAADEASGAALRILALA"
FT   CDS_pept        complement(4396..5031)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00005"
FT                   /product="RNA polymerase sigma-70 factor, ECF subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00005"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22926"
FT                   /db_xref="GOA:D5H4H1"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H1"
FT                   /protein_id="CBH22926.1"
FT                   /translation="MSVPSSELRTVIDRLPFSVDDTDAANESFRRWRDEEDPKAKRHAD
FT                   LWTYCYVCRYFLGKSARGTFDNPSDADELITRAYRKVQENRDGVRNAARYANWVSVVCK
FT                   NTLLNYTRRNQFSESIDGENRFTLTAETTNAVAEVGFVQEALVEAIEGLPNYLQEPARL
FT                   YFLENREFEEISEAVGKPVATIRTYKHKAMKELRTDERLREYVNQTDL"
FT   CDS_pept        5369..6295
FT                   /transl_table=11
FT                   /locus_tag="SRM_00006"
FT                   /product="SCO1/SenC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00006"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22927"
FT                   /db_xref="GOA:D5H4H2"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H2"
FT                   /protein_id="CBH22927.1"
FT                   /translation="MPDTRPAKAGGQPRPFFRLGVVRFGLATALVLFWVGAFASTATGQ
FT                   RTSRTPDQLENVGVDQKLGATIPKDLSFQNEQGEPVRLSQYFDGSTPVMLTLNYHRCPQ
FT                   LCRIQLQKFTKSLSGMSWTAGDKFKVLTVDISPYEGPKMARKAQERYATFLDRPEETVD
FT                   GWHFLTGNQAAIETLTDSVGFRYQPLPEKEKQFAHPTTIIFLSGDGTITRYFTTLDPAP
FT                   GDLRTALVEASDGTVGNVVDKAFLACARFNPDSNSYSASAFKLMQYGSVLTVIVMGAAL
FT                   FVFWRRENEQLETAHEEGLNAMVDEQA"
FT   CDS_pept        complement(6363..7286)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00007"
FT                   /product="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00007"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22928"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H3"
FT                   /protein_id="CBH22928.1"
FT                   /translation="MENPRSDLKDMSGTVCVVTGANSGIGKATAAELARLGARVVMVCR
FT                   DEGRGREAQAELRAEARTAHPSRADTIDLRIADLSVQEEVYHLGETLRADYDRLDVLVN
FT                   NAGVFLESREETVDGVEATFAVNHLAPFLLTHLVLPRLRETAGRAGEARIVTLSSEAHR
FT                   GVSMDFDDLNAETGYNPLQAYAQSKLANILFTHELSRRLQDEGVVANVVHPGIVNTNIW
FT                   RGSGWISRIARLFSWLYKRPEEGARNVVYLAASPDVEGVTGQYFKETEVVNPSPEAYDE
FT                   KAEARLWRISREMTGLAEVDEDGAPE"
FT   CDS_pept        complement(7406..8140)
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="SRM_00008"
FT                   /product="Ribulose-phosphate-3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00008"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22929"
FT                   /db_xref="GOA:D5H4H4"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H4"
FT                   /protein_id="CBH22929.1"
FT                   /translation="MCRLPSAPDRVFFLMPASPTMPTLAPSIIASDSGRFAACADEVLG
FT                   AGPDWLHVDVMDGHFVPNITIGPDVVRTLRPVADEHDAQLDVHLMIEEPQQYVDTFADA
FT                   GADMLTVHVEACPHLHRVAQTIRAAGCEVGVALNPATPLGHLEGILPFVDLVLVMSVNP
FT                   GFSGQSFIPESTAKVQRVRRQLNALGSSAYVEVDGGVTPNNAMELVRAGADVLVSGSAV
FT                   FGGEQSVPQNVEALRNALTLTV"
FT   CDS_pept        8163..8648
FT                   /transl_table=11
FT                   /locus_tag="SRM_00009"
FT                   /product="Conserved hypothetical protein containing DUF156"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00009"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22930"
FT                   /db_xref="GOA:D5H4H5"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H5"
FT                   /protein_id="CBH22930.1"
FT                   /translation="MNKKTNRNLSVKGSMEPSILIPAVSPPYIFSIPPSEKHPFPRGSR
FT                   GGRMLPNTYPVPGPQLAHSLAPTPMPVRDADRDDITDRLSRIEGQIRGLKRMVEEDRYC
FT                   GDILDQIHSVQQALKSVGRAITRNHLETCVTDAIRSGDEQAAQESYDEIIGLLEKEL"
FT   CDS_pept        8702..9325
FT                   /transl_table=11
FT                   /locus_tag="SRM_00010"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00010"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22931"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H6"
FT                   /protein_id="CBH22931.1"
FT                   /translation="MEDLLANRSSPDDGSPSGDGRRGGRTVHVKFKLSKDAMEAKEALA
FT                   AHWDVSEQEGAEMAAQLTVSFLKDEDEDTRHRFVEKARDQPRPRTRTTHAVRRATKSLL
FT                   ETTASNLDLTRDQCLGACLRLAHTIIQFLREDQLERHEAHLSALRTLLDRAQTIEAELQ
FT                   EEATAIDPLKPAITAVRRRIEAIVEDVEDELSRGRPLDRTHDFT"
FT   CDS_pept        complement(9374..10486)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00011"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00011"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22932"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H7"
FT                   /protein_id="CBH22932.1"
FT                   /translation="MMPPTPRLGPTHPPTTITGPMSGPLPSPERIVAALRTAIGAGGEQ
FT                   GPRPTPSRRTTQNDGVPSGFGDDEKPGPLQKEGAEAAKAWVEETVDAFRAAGGEIWTGA
FT                   ADDQAQGVGAADPVPEERPAGAMGPSPASSESEREPAGTSVSGGAVGEETRQSDEGADA
FT                   PDDLALAFRRAFYARRVRRRRPSQTGSSEESPRSAAVPARPASSFLWITGRSEGSTTAI
FT                   GIHSLSGPRARRAGAFLLRGAGKTPYHHLKRIRHHPDPRIFLKPVFWRADADRESPVAD
FT                   HVDGTWTPEATKGTLRALRERAVTINRRIRDAIEEGEARVGTDAERRLLFFVATRTEAF
FT                   SRRRVGGSVVYPRLTPLLERTGREESGRDP"
FT   CDS_pept        10985..11320
FT                   /transl_table=11
FT                   /gene="yajC"
FT                   /locus_tag="SRM_00012"
FT                   /product="Preprotein translocase subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00012"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22933"
FT                   /db_xref="GOA:D5H4H8"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H8"
FT                   /protein_id="CBH22933.1"
FT                   /translation="MLSPLLSALDPILLVGQSGSGSGGIVGLLFPLVLIIGVFYFFIYR
FT                   PQQKREEEHQEMVENLEQGDKIVTVGGVHGTIQKIDEDSVLAQVNSKGTRLRFNKDSIA
FT                   SLANDEE"
FT   CDS_pept        11375..12622
FT                   /transl_table=11
FT                   /gene="ribA"
FT                   /locus_tag="SRM_00013"
FT                   /product="Riboflavin biosynthesis protein ribA"
FT                   /EC_number="3.5.4.25"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00013"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22934"
FT                   /db_xref="GOA:D5H4H9"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4H9"
FT                   /protein_id="CBH22934.1"
FT                   /translation="MSSSPSSSSPSSEKPFDTIEDALATIRDGGLAIVVDDEDRENEGD
FT                   FIGAAEAMTPDLVNFMTKEGRGLLCTAIPPERAEELDLDLMVDANSSLYSTPFTVSVDY
FT                   RQGTSTGISAADRAKTIRALADPDASPYDFARPGHVFPLRARTGGVLRRAGHTEAAVDL
FT                   ARLAGLEPAGALVEIMNEDGSMARVPQLRERAQALDMPLITIQDLIAYRMQNERLIERA
FT                   AEVDLDTAFGTFQVVAYEETLTGDVHLALLKGDWAEDEPVLVRVHSQNVLGDVLAARRE
FT                   SYSEELAEALLQVEHEGTGAILYMMQSNHGQGLLSKLKDLERHQNQDDGAPTDVSLEMD
FT                   HRDYGIGCQILRDLGIRKLRLLTNNPRKRIGLAGYGLELVEQTPIELPTEARDHLSTVA
FT                   ADRLTPLLMELIDAGT"
FT   CDS_pept        12675..12839
FT                   /transl_table=11
FT                   /locus_tag="SRM_00014"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00014"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22935"
FT                   /db_xref="GOA:D5H4I0"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I0"
FT                   /protein_id="CBH22935.1"
FT                   /translation="MSSTQIFQVIYALIAIFGTSLTVIRLQAGDWLAALWPALIAGFCV
FT                   YRLFTVTEE"
FT   CDS_pept        complement(13506..15995)
FT                   /transl_table=11
FT                   /gene="ComEC"
FT                   /locus_tag="SRM_00015"
FT                   /product="DNA internalization-related competence protein
FT                   ComEC/Rec2"
FT                   /function="The comE operon is required for the binding and
FT                   uptake of transforming DNA. ComEC is required for
FT                   internalization but is dispensable for DNA binding."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00015"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22936"
FT                   /db_xref="GOA:D5H4I1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I1"
FT                   /protein_id="CBH22936.1"
FT                   /translation="MEACRAMDPDSSVHWGAYPALYVAVAFALGVFGNSVFEGVPFSFW
FT                   LGGAGAGLALFAGMQWWDRTRLVTLAPLGRVLAAIVVVGCAGGARHSIHQGPSPRGLAP
FT                   AAEASDDAVAVQGIVGNAPERTDEATRFVLAVNTLFGARDTAAVEGRVRVTLKPSPWAN
FT                   TVPSFPRLRQGDVTRLRGSLRRPPGLRNPGGFDYAAYLSRRGICCTLYVDAPDRVAVLG
FT                   DRRGRVQNALVFLRAHVRRQVDRYVPSTGGRAVLRALLLGDRSRITDAQRARFAKTGLM
FT                   HLLAVSGLHVFLVGMVLYALLRPFLLRLRLRWRTAEVVRAALTITVLVFYMLLTGGRPS
FT                   VVRAVIMATLFIGGIFFQRSAHSLNTLGVAALVLLAVRPPMLFDVGFQLSMAAVSGIVT
FT                   LNPRFLEMVPDRYRTSEALDWVLSTGTTSAAAILGTAPVLLYHFGWVSVAGLLLNMVGI
FT                   PCTGLALTSAIATVAVGGLWPMAAASFGSAADVFLQGLLATSRYGAAWFSWAGIRMATP
FT                   DLWELTALGAGLIAVAQWPRPRLRWRWIVIGGLFMTASVWGPVVGGGTAPTLDIVFFDV
FT                   GQGDAALLKTPSDHHVLIDAGPRSPSGATAEFAVLPFLRRWGIRRLDLVVVSHSDEDHL
FT                   GGLPTLLQAVRVDRVVHNGRSVDTDLYSQTRRLLRRNGVSRQAAHRGDTLQTDSSIRAE
FT                   VLSPSGRSTLATENNASVVLRVEYGDVNILLPGDIEKAIEQNLVRTYGEKLLGHVVKVP
FT                   HHGSETSSRPSFVRSASDSTQTHAVVSVGHSSRYGMPDARVIRRWRREAWQVHSTADRG
FT                   AVWMRTDGKEVWRLQWQ"
FT   CDS_pept        16190..16672
FT                   /transl_table=11
FT                   /gene="nusB"
FT                   /locus_tag="SRM_00016"
FT                   /product="N utilization substance protein B homolog"
FT                   /function="nvolved in the transcription termination
FT                   process."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00016"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22937"
FT                   /db_xref="GOA:D5H4I2"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I2"
FT                   /protein_id="CBH22937.1"
FT                   /translation="MSSRRDAREQVMKTLYANEQTDGDAEQALHALVRVPLDEDPSTRD
FT                   FAEHLFRETLKTMEEADEIIEKHADNWEIHRIAAIDRSLLRMATTELLKFEEVPPKVSV
FT                   DEAIEIAKRYSTPRSGTFVNGVIDAILLDLHDQGRLNKTGRGLIGMDTIQERAGSS"
FT   CDS_pept        16725..17387
FT                   /transl_table=11
FT                   /gene="pphA"
FT                   /locus_tag="SRM_00017"
FT                   /product="Serine/threonine protein phosphatase 1"
FT                   /function="Plays a key role in signaling protein misfolding
FT                   via the cpxR/CPXA transducing system. It also modulates the
FT                   phosphorylated status of many phosphoproteins in E.coli,
FT                   some of which acting as major chaperones. Has been shown,
FT                   in vitro, to act on Ser, Thr and Tyr-phosphorylated
FT                   substrates."
FT                   /EC_number="3.1.3.16"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00017"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22938"
FT                   /db_xref="GOA:D5H4I3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I3"
FT                   /protein_id="CBH22938.1"
FT                   /translation="MGLIAVGDIHGCLESLNALLDRLNPSSDDHLLFVGDYIDRGPDSR
FT                   GVIDRLLDLRESISCTFLRGNHEAMMIDYLDSGAFSLWRMNGGVSTLQSYLKGEGSEVH
FT                   IPAAHAEFVRDTKLYHETDDFLFVHAGLRPDLTVEENLDQPDEEVLLWERGHLEASGLA
FT                   WEKTVVCGHTPQPDPISHEKLILIDTGCVYHMKPGMGRLTAVHLPQREFIDVPYADG"
FT   CDS_pept        17473..18567
FT                   /transl_table=11
FT                   /locus_tag="SRM_00018"
FT                   /product="Conserved hypothetical protein containing
FT                   GTP-binding site"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00018"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22939"
FT                   /db_xref="GOA:D5H4I4"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I4"
FT                   /protein_id="CBH22939.1"
FT                   /translation="MSLQCGLVGLPNVGKSTIFNALSSAGAEADNYPFCTVDPNVGVVP
FT                   VPDDRLPRVAELAGSPETIPTSIEFVDIAGLVEGAAEGEGLGNQFLAQIREVDAIIHVV
FT                   RCFEDEEVAHVAGSVDPTRDVEVINTELLLKDLETVEKRLDTVKTAAKKGDQEAAEELE
FT                   VFERLHDHLSEGAWARSFEAGAAEQPLVDELFLVTDKPVLYVANVGENDLPDGNAYVDQ
FT                   LRPIAQNEGTRVVVTSAELEAQLTELDPEERQLFLDDSGLQRAGLERLIHAAYDVLDLI
FT                   TFFTADEKGAYAWAIEEGTRAPQAAGEVHSDFEQGFIKAETIHFSDFDEAGSEAAAREA
FT                   GLLRTEGKDYVVEDGDVMEFRFNV"
FT   CDS_pept        18726..19832
FT                   /transl_table=11
FT                   /locus_tag="SRM_00019"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00019"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22940"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I5"
FT                   /protein_id="CBH22940.1"
FT                   /translation="MLLLPVEEIYFISRFARVSAPLRCARNDSSVPFVCGLPGGRRRGP
FT                   KGGHAFPIQPPEVQDARSAPLRSAPYIDMRPVLPSDTSLVMTCVRSSLLATLLVGGLLW
FT                   AGCASDSASNSEPTVSPTDTIAPETRADSVAYRLLQAHGIDAWASSPYLRFNFGIETPG
FT                   GAQTIARHLWNRDTGAYRMEWSAGPDSSYVALVNVRDPQEGRLSGTVYLNGSELTGAAA
FT                   ETAREEAYGRFVNDTYWLLAPLKAFDPGVNRTYVPDSSTAEHDVIQLTFDDVGRTPGDR
FT                   YWLYVSTETGRLDRWAYHLQGMPEDAPPQFYDWTQYRELSAADGTVRLASRKEAIGAEQ
FT                   ALLTNQLALPESPPEGAFSNPEPMLGGE"
FT   CDS_pept        19908..21167
FT                   /transl_table=11
FT                   /gene="lolC"
FT                   /locus_tag="SRM_00020"
FT                   /product="Lipoprotein releasing system transmembrane
FT                   protein lolC"
FT                   /function="Part of an ATP-dependent transport system lolCDE
FT                   responsible for the release of lipoproteins targeted to the
FT                   outer membrane from the inner membrane. Such a release is
FT                   dependent of the sorting-signal (absence of an Asp at
FT                   position 2 of the mature lipoprotein) and of lolA ."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22941"
FT                   /db_xref="GOA:D5H4I6"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I6"
FT                   /protein_id="CBH22941.1"
FT                   /translation="MDYRFQIARRYLASRREVSLISIITGISTVGVTLGVASLIVVLSV
FT                   MNGFYDVVRDVLVSLDPHVRVVSAQGEGVANVDSLLRVARETRHVTAAAPYVEGKALLM
FT                   SDNTGDANRVVRVRGVEASMMEGAAPTTAMGRFDLSRNADGVPGVVLNQRLGQRAGLVP
FT                   AGRTQSSTAVGLLSAPAVERTLTNIFGSPPVRRFEVRGLFQSQGTSQGQRVFVSLAEAQ
FT                   QLFRTEGRVTGVELRLDNLERAAGVKAALQRKLGTDRYTVQTWYDLQRSLYDVMQLEKW
FT                   GASAILGLIVIVAAFNIVGSLTMVVIEKRADVGALQAMGVSRGDVRRIFLLEGALIGAL
FT                   GTGLGLVLGLGLAFLQQHYGLVPMAQAESFLIDAYPVSVQALDVVLIAVVSFGLCVLAA
FT                   LYPAVRAAAIEPARAVHLDC"
FT   CDS_pept        21282..22103
FT                   /transl_table=11
FT                   /gene="comA"
FT                   /locus_tag="SRM_00021"
FT                   /product="Phosphosulfolactate synthase"
FT                   /function="Catalyzes the addition of sulfite to
FT                   phosphoenolpyruvate (PEP) to yield (2R)-phospho-3-
FT                   sulfolactate (PSL)."
FT                   /EC_number="4.4.1.19"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00021"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22942"
FT                   /db_xref="GOA:D5H4I7"
FT                   /db_xref="InterPro:IPR003830"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036112"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I7"
FT                   /protein_id="CBH22942.1"
FT                   /translation="MTNDAFDLIGLPDRPEKPRERGLTHMLDKGLSAREVENVLNGAAH
FT                   IIDVAKLGWGTAAVTKNLETKLDVYREAGIPFFFGGTLFEAYFLRDQIDDYRRLLDDLD
FT                   VHHVEISAGAVAMAHEDKLDFIELFANDFTVVSEVGSKDSSDVMAPYRWVEFMQAELAA
FT                   GSWKVTAESREAGTAGLFRPNGEVRTGLVDEILSRVDPHDIIFEAPNKKQQAWLIKHQG
FT                   ANVNLGNIHPEEVVPLETLRLGLRGDTLFEFLTPGITPHLPGGSPSGDGHS"
FT   CDS_pept        22033..22533
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="SRM_00022"
FT                   /product="50S Ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00022"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22943"
FT                   /db_xref="GOA:D5H4I8"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I8"
FT                   /protein_id="CBH22943.1"
FT                   /translation="MNFSHRGSRPICPAAPLRGTGIPERAHGYAPRRAGDENSYRNCGV
FT                   FTNKAPQCRLQPCRSDAHKPHARPASFRNDDTSTDTNRPKRCVMARKDDVTGEGPVTGN
FT                   SVSDSNQKTNRRFKRNLHEKRFYIPSEDRHVKLKVSSKTLKTINKKGIQAVLEEARKQG
FT                   YDV"
FT   CDS_pept        22608..22772
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="SRM_00023"
FT                   /product="Ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00023"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22944"
FT                   /db_xref="GOA:D5H4I9"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4I9"
FT                   /protein_id="CBH22944.1"
FT                   /translation="MATGDRVQVILECTEEPGTSRYHTTKNRKNTSDRLELMKYNPVLQ
FT                   KHTLHREKK"
FT   CDS_pept        22776..22925
FT                   /transl_table=11
FT                   /locus_tag="SRM_00024"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00024"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22945"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J0"
FT                   /protein_id="CBH22945.1"
FT                   /translation="MADQSTSASRKMAKLIVAEEKEDGNYGFREKIVPLDDVEEELEEA
FT                   KEFT"
FT   tRNA            22945..23018
FT                   /locus_tag="tRNA_1"
FT   tRNA            23435..23508
FT                   /locus_tag="tRNA_2"
FT   CDS_pept        complement(23685..26309)
FT                   /transl_table=11
FT                   /gene="dnaB"
FT                   /locus_tag="SRM_00025"
FT                   /product="putative replicative DNA helicase,
FT                   intein-containing"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00025"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22946"
FT                   /db_xref="GOA:D5H4J1"
FT                   /db_xref="InterPro:IPR004042"
FT                   /db_xref="InterPro:IPR004860"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR007868"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027434"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="InterPro:IPR036844"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J1"
FT                   /protein_id="CBH22946.1"
FT                   /translation="MAENDDSQRFNIDESSQSSYPLEKMRGGTGEQQREQAQAVHEQSG
FT                   RVPPQAVDVEKSVLGAMLIEREAIPQAIEILPSDAFYESKHQSIYGCIQDLFERGNPVD
FT                   LVTLTEELRRRDKLEEIGGAYYLTELTTQVASAANVEYHARIIAEKSLLRRMIETMTTV
FT                   VQKAYDPGADAFELLDEAESKIFQISDNQLRKAAAPMNEVVKDTLERLETIHGQDGGIT
FT                   GVPSGFPKLDDLTSGWQDSDLIIIAARPSMGKCLGKGTPVMMYDGRTKPVEKVEVGDRL
FT                   MGDDGSPRTVKSLARGREQMYWVRQKRGMDYRVNESHILSLKKSRREGARDRGAIADIS
FT                   VRDYLDQSDKWKDDNKGFKVAAEFPDQPVPLDPYFLGLWLGDGKSDNARIYTTDEEVIT
FT                   GLQEIAEKRGDTISVSDEHRRCPAYLVKSGDRGGAMATRESVQGALRALGVLGDKHIPH
FT                   LYLGNSRGKRLRLLAGLIDSDGHLNDGHGGTYEITQSSEQLARDIKFLCDTLGYRTSLT
FT                   QKTARISSTGYESEVHRVRFNGNVDEIPVRVERKKASPWTDVRDWRMTGIDVEPDGVGD
FT                   YFGFTLDGNGRFLLGDGTVTHNTAFALASAQNAATHPERSTGVAIFSLEMGAQQLAQRM
FT                   LTSEARVDAHRARTGRMKDDDWQRLARAAGALSDADIYIDDTPGLSVLELRAKCRRLKA
FT                   EHELGLVVVDYLQLMQASGANLRSGANREQEIAHISRSLKGLAKELDIPVIALSQLNRA
FT                   VENRGGDKRPQLSDLRESGSIEQDADVVSFIYRAERYGITVDEQGNSTEGIAEIIVGKQ
FT                   RNGPIGSVELAFVDQYARFEPLTTQYDNPGGGPPQGDGSAPMPPDGNAGGGGGNSFEDD
FT                   APF"
FT   CDS_pept        complement(26424..27287)
FT                   /transl_table=11
FT                   /gene="dbh2"
FT                   /locus_tag="SRM_00026"
FT                   /product="DNA polymerase-related
FT                   protein,bacteriophage-type"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00026"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22947"
FT                   /db_xref="GOA:D5H4J2"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J2"
FT                   /protein_id="CBH22947.1"
FT                   /translation="MHDLLRELRAIVEHERALHGDLLPVPPAEDETEAAPSPSPDAPPT
FT                   ETDTPSHAAPDDAGSDPDMPNYDLFGNQVDPAEDPSLPPPERIEALIPDDAPYKDADTL
FT                   EEVEQYFADNVLVPIDEDRENPVFGVGDPEADLVIIGEAPGRNEDEEGEPFVGRAGQLL
FT                   DKILDAINFEREDVYITNILKSRPPRNRNPKSEEIDAHLPVLYKQIALLRPKIILTVGK
FT                   VAGNTLLDRSSSLSNLRDQEHDFYGIPLMATYHPAALLRNSQWKRPTWEDVKLLRTRYD
FT                   QLTDEG"
FT   CDS_pept        complement(27312..28553)
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="SRM_00027"
FT                   /product="Coenzyme A biosynthesis bifunctional protein
FT                   coaBC"
FT                   /function="Catalyzes two steps in the biosynthesis of
FT                   coenzyme A."
FT                   /EC_number="4.1.1.36"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00027"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22948"
FT                   /db_xref="GOA:D5H4J3"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J3"
FT                   /protein_id="CBH22948.1"
FT                   /translation="MPTPLDLSGRCVVLGVTGSIAAYKAAPLVRHLKKAGAEVQVLMTP
FT                   DAERFVTPLTLGTLSEKEVLTDIFPENEEGSWTKHVTLGQWGDLFVVAPATAQTVAKLA
FT                   HGFCDSMLTATALSARCPLLVCPAMDRDMYQHAATQDNLERLREIGYEVMPAAHGELAS
FT                   GLVGQGRMPEPESILKRVAEMLAETEAPRDASRAGHDVLVTAGPTREPIDPARVLTNPS
FT                   TGTMGYALAEAAAARGASVTLVTGPTALSPPPDVEVVSVETAEEMNEAVQARRTDADYV
FT                   FMAAAVADYAPADPSTSKRKKTDDDRVLHLRRTPDILQTLGEHKRPGQVLVGFALETDD
FT                   LLDNARRKRDEKNLDWVVVNDPTEDGAGFGASTNRVTLLRPDGTTENLPRMPKAEVAEA
FT                   LLDRVLAARHEQST"
FT   CDS_pept        complement(28736..29107)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00028"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00028"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22949"
FT                   /db_xref="GOA:D5H4J4"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J4"
FT                   /protein_id="CBH22949.1"
FT                   /translation="MPMRPHTPPAPTAWALTFFRSSPVLLMAIETLDLDKLAEKTGNLY
FT                   ETVAILSKRSRQVASDTRSELDDKLSYFEGFGPEMEDARMQEEQEKVSLEYEKQPEPTE
FT                   VAIDEFLEDKIYYRKPDDE"
FT   CDS_pept        complement(29163..29801)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="SRM_00029"
FT                   /product="Guanylate kinase"
FT                   /function="Essential for recycling GMP and indirectly, cGMP
FT                   ."
FT                   /EC_number="2.7.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00029"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22950"
FT                   /db_xref="GOA:D5H4J5"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J5"
FT                   /protein_id="CBH22950.1"
FT                   /translation="MGAERFARRYAPPSPLHTLPLNATMPDRNIVVLTAPSGAGKTTIA
FT                   HRVLEAMPDMQFSVSATTRAARPDETDGVDYHFLSPEEFRARIDAGDLLEYEEVYPDQF
FT                   YGTLRSEVEDRANDGPVLLDIDVKGALNVKRIFGDDALVLFVAPPSLDELRRRLEGRGT
FT                   EDRESLQDRLDRVEQEMDRADDCDAVVVNDDLDPAVEETLTRIRQFLGL"
FT   CDS_pept        complement(29820..30704)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00030"
FT                   /product="Conserved hypothetical protein containing DUF1735
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22951"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J6"
FT                   /protein_id="CBH22951.1"
FT                   /translation="MIRSMTGFGRGHASTEDASATVEIQSTNKRHLNIFVHLPDPLPEA
FT                   ESDVRMQMKEAFERGQFDVNVSAELKGADTLPVDVDADAAMHHKRRLEQLAAAAQIEAP
FT                   IRIDHLLEFEDIFAGEEEREAAKIQRAWPAVTQALDAAIDDLQAMRREEGDALRDDLER
FT                   RTRAIDEHLDAIEARAPARVEERQAQLRDRLGELLDDEHLDADRLETEMALLADKLDVT
FT                   EECVRLHSHLKMFREALDADEPSGRKLKFITQEIHREANTIGAKADDETISREAVEMKE
FT                   EIEKIKEQIRNVE"
FT   tRNA            30821..30912
FT                   /locus_tag="tRNA_3"
FT   CDS_pept        complement(30978..31547)
FT                   /transl_table=11
FT                   /gene="frr"
FT                   /locus_tag="SRM_00031"
FT                   /product="Ribosome recycling factor"
FT                   /function="Responsible for the release of ribosomes from
FT                   messenger RNA at the termination of protein biosynthesis.
FT                   May increase the efficiency of translation by recycling
FT                   ribosomes from one round of translation to another."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00031"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22952"
FT                   /db_xref="GOA:D5H4J7"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J7"
FT                   /protein_id="CBH22952.1"
FT                   /translation="MPDDPIQDILDEADEEMEESVSYMRSELRTIRAGRASPAMLENVT
FT                   VEYYGSQTPLEQVASVSAPQPDLIVVQPFDRNAIENIERGIMKADLGLNPNNDGEKIRI
FT                   PIPPLSEERRKELVETSRERAEETKISIRNIRRDAKNEIQNVVEAENFSEDVLYGAEED
FT                   LQDITDAHTETVEGLLEQKTEQIMDV"
FT   CDS_pept        complement(31596..32375)
FT                   /transl_table=11
FT                   /gene="pyrH"
FT                   /locus_tag="SRM_00032"
FT                   /product="Uridylate kinase"
FT                   /function="Catalyzes the phosphorylation of UMP to UDP."
FT                   /EC_number="2.7.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00032"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22953"
FT                   /db_xref="GOA:D5H4J8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J8"
FT                   /protein_id="CBH22953.1"
FT                   /translation="MSASPDDESTSSLDHQRVLLKLSGQALLGEREFGIDEAVLRTYAN
FT                   EVKTAVEAGAEVAVVIGGGNIFRGVEHAMEGMTRAHADYMGMLATMINGMALQDAFEQV
FT                   DLVTRLQSSIKMEEIAEPFIRRRAIRHLEKGRVVIFGAGTGNPYFTTDTAAALRGLEID
FT                   ADVILKGTRVDGIFTADPEEDASAERFKQIHGQEVIDRDLRVMDMTALTLCQESKMPIV
FT                   VFNMGTSNNLRRLLEGETVGTHVHWDEAKASTERVPA"
FT   CDS_pept        complement(32560..33390)
FT                   /transl_table=11
FT                   /gene="tsf"
FT                   /locus_tag="SRM_00033"
FT                   /product="Elongation factor Ts"
FT                   /function="Associates with the EF-Tu.GDP complex and
FT                   induces the exchange of GDP to GTP. It remains bound to the
FT                   aminoacyl-tRNA.EF-Tu.GTP complex up to the GTP hydrolysis
FT                   stage on the ribosome."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00033"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22954"
FT                   /db_xref="GOA:D5H4J9"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4J9"
FT                   /protein_id="CBH22954.1"
FT                   /translation="MSVSAKQVKELRDATGVGMMDCKEALQETDGDFDEAVSLLRKKGQ
FT                   EVADDRAAVEADEGLVVTAVSDDGHAGAIVEINCETDFVARNEDFQSFAETAAERVLEE
FT                   TPDDLEALESLPYEDDVTIEEELVALTGRIGEKLTIRRFDVLESEEGQIISYVHPGSKL
FT                   GVLVEVHGDGEAEETGRDVAMQVAALEPIAVTRDEVPDEVKEEEREVAREAAVNEGKPE
FT                   HVIDNIVEGKLERFFEDHVLMEQAFVKDSSVSVKDMLDDADLSVARFTRYALGD"
FT   CDS_pept        complement(33458..34420)
FT                   /transl_table=11
FT                   /gene="rpsB"
FT                   /locus_tag="SRM_00034"
FT                   /product="30S ribosomal protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00034"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22955"
FT                   /db_xref="GOA:D5H4K0"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K0"
FT                   /protein_id="CBH22955.1"
FT                   /translation="MADETTTDTPDVQDEDAPDEDAPQTPDDTASDSTSEAAAADTDAD
FT                   APDENAPDEDAPDAAPQDKDDGDDAPEESSSEEETSHRVTIEELLKAGAHFGHLTSRWN
FT                   PRMEKYIFMERNNIHIIDLMQSQVLLDEAAEAAKRFARRGKKILFAGTKKQAEDIVREH
FT                   AEECGMPHMVDRWLGGTMTNFQTIRKSIRRMEEIERMDRDGTLDKLKKKEKLMRLREHE
FT                   KLEETLGGIRDMANLPSAIYIVDVQREDIAVSEANNLGIPIIAMVDTNGNPKNIDYPIP
FT                   VNDDALSSIELVTSTLTDAVQEGLQERRMKKEEKKKAAA"
FT   CDS_pept        complement(34693..35091)
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="SRM_00035"
FT                   /product="30S ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00035"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22956"
FT                   /db_xref="GOA:D5H4K1"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K1"
FT                   /protein_id="CBH22956.1"
FT                   /translation="MPKMTQYQAIGRRKTSTARVYLRPGDGSSFVVNERDAEDYFPVAW
FT                   RRRTLDQPFDVTDTIGQFNVKVNASGGGLTGQAEAIRLGIARALVEYDEELRAPLRDAG
FT                   YLTRDDRMVERKKYGQPGARKKSQYSKR"
FT   CDS_pept        complement(35146..35592)
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="SRM_00036"
FT                   /product="50S ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00036"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22957"
FT                   /db_xref="GOA:D5H4K2"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K2"
FT                   /protein_id="CBH22957.1"
FT                   /translation="MDTQSFKTFNAKPDEVERDWYVVDATNQVVGRLASQIARVLRGKH
FT                   KPTFTPHVDTGDYVIVVNADKARFTGKKEQQKEYHEYSGYPGGDHSHSPEEMRADKPTY
FT                   IIKEAVEGMLPTGPLGRDTFKKLKVYAGPDHPHEAQQPEPLDNA"
FT   CDS_pept        35956..36477
FT                   /transl_table=11
FT                   /locus_tag="SRM_00037"
FT                   /product="Conserved hypothetical protein containing DUF177"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00037"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22958"
FT                   /db_xref="InterPro:IPR003772"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K3"
FT                   /protein_id="CBH22958.1"
FT                   /translation="MVPLGRMLTIDITSLSTGIHHVEFAPSASQADLDPTTFSDVQVDA
FT                   ELQYHRDRILVKMHATATAELTCDRTLQPYDEALEGQYNVLFGPPSMVGQEGDEFEEVR
FT                   PLDASDREIDLTDMVRDTLLLAIPQRRIAPGAEDEPIEREFGGTDDADEDDSAPVDPRW
FT                   SALEELKDDE"
FT   CDS_pept        36647..36844
FT                   /transl_table=11
FT                   /gene="rpmF"
FT                   /locus_tag="SRM_00038"
FT                   /product="Ribosomal L32p protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00038"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22959"
FT                   /db_xref="GOA:D5H4K4"
FT                   /db_xref="InterPro:IPR002677"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K4"
FT                   /protein_id="CBH22959.1"
FT                   /translation="MAVPKRRHSKSRTRKRRSTYYNELEPPQLMECNNCGNPKVMHRAC
FT                   KHCGHYRGRQVIEPSDELIA"
FT   CDS_pept        37121..38137
FT                   /transl_table=11
FT                   /gene="plsX"
FT                   /locus_tag="SRM_00039"
FT                   /product="Fatty acid/phospholipid synthesis protein plsX"
FT                   /function="Not known, probably involved in fatty acid or
FT                   phospholipid synthesis."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00039"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22960"
FT                   /db_xref="GOA:D5H4K5"
FT                   /db_xref="InterPro:IPR003664"
FT                   /db_xref="InterPro:IPR012281"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K5"
FT                   /protein_id="CBH22960.1"
FT                   /translation="MAASRIAVDAMGGDNAPEAVVEGAIQALHQTESELSVLLVGPEEQ
FT                   LQGLLASRPEAPEERLRIVDAPEAIGMGETPSTAVKQKPNSSIHQGLAAHHDDHADAFV
FT                   SAGNTGAIMAASMFILQRIPGVERPSIAGFFPTLKGSSVVLDIGSNVDCKPAHLLQFAR
FT                   MGTVYARQVLKTDPPSVGLLNIGEEPGKGNEQVKAAHELLRDADDVHFVGNVEGGDLLF
FT                   YAADIIICDGFVGNALLKFGESMSTVLSDMCQQEMERQGLAPDEQKLVAGVLDEVREGF
FT                   DPEALGGAPLLGVNGNVLVGHGRSTADVIAQMIHSARTIATENVAHALEEAFQSSSA"
FT   CDS_pept        38181..39185
FT                   /transl_table=11
FT                   /gene="fabH"
FT                   /locus_tag="SRM_00040"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase III"
FT                   /function="Catalyzes the condensation reaction of fatty
FT                   acid synthesis by the addition to an acyl acceptor of two
FT                   carbons from malonyl-ACP. Catalyzes the first condensation
FT                   reaction which initiates fatty acid synthesis and may
FT                   therefore play a role in governing the total rate of fatty
FT                   acid production. Possesses both acetoacetyl-ACP synthase
FT                   and acetyl transacylase activities. Its substrate
FT                   specificity determines the biosynthesis of branched-chain
FT                   and/or straight-chain of fatty acids."
FT                   /EC_number="2.3.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22961"
FT                   /db_xref="GOA:D5H4K6"
FT                   /db_xref="InterPro:IPR004655"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K6"
FT                   /protein_id="CBH22961.1"
FT                   /translation="MPSPSSASPQAAITSVGHYLPETRLTNGDLEEMVETSDEWIRTRT
FT                   GIQERRILGDDGKATAFMATAAAQEALDSRGIEPDAVDLIVVATVTPDMLFPATACLVQ
FT                   DNLGASNAWGFDLSAACSGFIYALTTGAQFIETGQAETVLVIGADKMSSIVDYTDRTTC
FT                   ILFGDAAGAVVLEADEEAGLHDAVHHVDGEHSELLRMRGGGSLNPPTHETVDAHMHYLQ
FT                   QEGRQVFKLAVNRMANVCREVLDRNGLDAAGVDYLVPHQANQRIIDATAKQLGLSSEQV
FT                   MVNIDRYGNTTAATIPLCLYDWEDELERGDDLIVTAFGGGLTWGAGHLTWAYG"
FT   CDS_pept        39188..40210
FT                   /transl_table=11
FT                   /gene="fabD"
FT                   /locus_tag="SRM_00041"
FT                   /product="Malonyl CoA-acyl carrier protein transacylase"
FT                   /function="It is involved in fatty acid biosynthesis and
FT                   transfers the malonyl moeity from coenzyme A to acyl-
FT                   carrier protein."
FT                   /EC_number="2.3.1.39"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00041"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22962"
FT                   /db_xref="GOA:D5H4K7"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR004410"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR024925"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K7"
FT                   /protein_id="CBH22962.1"
FT                   /translation="MERRPGAPVARPHCDPERTSRTLHFNRDMATAFLFPGQGSQAVGM
FT                   GHELYEQHDEARACFEAANDLLDFDLLSLMFGLGAEADTATEKLKQTEITQPALYTHSL
FT                   AAMAVLDAGGPEPDMVAGHSLGEYSALAAAGALSFEDGLRVVRRRGELMGEAGERRPGR
FT                   MAAVLGADTAHVEEVCEDISANGDGVVRPANYNAPGQIVISGDVEAVEQATEAVEGRAM
FT                   PLPVSGAFHSPLMEYAREGLAEVLDAVPVEAPRCPVYPNVTAEPTTDPDEIRRCLREQL
FT                   LSPVQWAPTLRRMQEDGAARFVEVGTGQVLQGLVGRTLDEEAEAMGAGTPEEIARLTEA
FT                   "
FT   CDS_pept        40272..41117
FT                   /transl_table=11
FT                   /locus_tag="SRM_00042"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00042"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22963"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K8"
FT                   /protein_id="CBH22963.1"
FT                   /translation="MLNAGLRSNRRDPMGAFALPPPRSSLRWLLGACLAAVALVGCGGG
FT                   NTYSVDEGKISQRFLPAERTVDHHPDSVKALTIAAADGKIQFEVERDFESLTEKWSASF
FT                   QNIGTGPSIRDRTYATFWSLELSLMSLQPERGVLSLREEQARDVLDERRKEYAETIHID
FT                   VYWFVGRGRDGIITGPSARTELHVGGNTYRPVQSDHGPLREAFVAGGETALYRRNSLYF
FT                   SRRVEGTDILADASGMKLRVRRTGGGGRQEFAWRWGEGNTARGLEKGVRDAAAGRSSRR
FT                   "
FT   CDS_pept        41301..42050
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="SRM_00043"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="fatty acid biosynthesis."
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00043"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22964"
FT                   /db_xref="GOA:D5H4K9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011284"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4K9"
FT                   /protein_id="CBH22964.1"
FT                   /translation="MQVDLHGSTVLVTGGTRGIGRALVEAFAEAGAHVAFTFRSSTDAA
FT                   AALVESLEEQGTETLSLQGDVADLDAAQAHVNAVTEHFGSLDVLVNNAGITRDGLLLRM
FT                   GEDDWDDVIDTNLKGTFNFCKAAYMPMMRQQSGSIVNISSVVGTTGNAGQTNYAASKAG
FT                   IVGFSKSLAKELGGRNVTVNVVAPGYVQTDMTDELDEETRDSILDAVPLDRLATTEEIA
FT                   EAVLFLAAPASDYITGHVLQVNGGLSM"
FT   CDS_pept        42267..43703
FT                   /transl_table=11
FT                   /gene="deaD"
FT                   /locus_tag="SRM_00044"
FT                   /product="Cold-shock DEAD-box protein A"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00044"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22965"
FT                   /db_xref="GOA:D5H4L0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L0"
FT                   /protein_id="CBH22965.1"
FT                   /translation="MAADISQSKYTNVIDLTSEAQQERRRDEVGSELREPDPPLDEVTV
FT                   DALSGHMEQAVHAAGWTELMDVQRKAIPYTLDGRDLIVQSQTGSGKTGAFLLPLFDLVN
FT                   PDKEEQQVLILTPTRELARQIHEEFEQMKIATPRTNRMEAVLIYGGVGYQPQIDGLKNG
FT                   AQVVIGTPGRILDHIKKDNFDASTLRMLVLDEADEMLSMGFYPDMKDIVEHVPGDRVSY
FT                   MYSATMPPKVRSVAREFLDDPGFLSLSTDKVSVEENEYRYYLVNPMDKDRVMAQLLELE
FT                   EPESALIFANTKREVSYLNKFLSNKGYDIDEMSGDLSQRDREEALDRLREGKLRLLVAT
FT                   DVAARGIDVSDLSHVFIYDVPQDHEYIIHRSGRTARAGEEGTTIVLSTHEDEYELKRMA
FT                   NTYDIELEKAELPADPHSEARELLQERYANAEAPANGEEPGVEDFVPLVKELSDEQPEL
FT                   LASLITELYAEAKTEDEEEK"
FT   CDS_pept        complement(43808..44197)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00045"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00045"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22966"
FT                   /db_xref="GOA:D5H4L1"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L1"
FT                   /protein_id="CBH22966.1"
FT                   /translation="MPTLLLCPTSLTFHSRALYTYARSPFDHLQLVGRLPLSPCPARFT
FT                   IHSFHARTYAPMPDQSLTPGQALGRWILHVVVFLLSGGVAAGASALAYQAIAQTQTPLG
FT                   IYAVIFAAGGFIAYRQTERVLATEA"
FT   CDS_pept        complement(44745..45203)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00047"
FT                   /product="Conserved hypothetical protein containing DoxD
FT                   domain, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00047"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22968"
FT                   /db_xref="GOA:D5H4L3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L3"
FT                   /protein_id="CBH22968.1"
FT                   /translation="MLRSLEAQRDLVLDALRVYLGTGLFFRGLALLMTDGGLQQLLGAT
FT                   EPGLGLTGLSVYVIAAHLVGGAFLAVGLYTRLAALVQVPVLVGAVFLVHWRDGLLSADQ
FT                   SLEFSALVMFLLLLVCTFGSGRWSLDAKWRRPPAPIVPGSPRRPAPQN"
FT   CDS_pept        45202..45939
FT                   /transl_table=11
FT                   /locus_tag="SRM_00046"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00046"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22967"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L2"
FT                   /protein_id="CBH22967.1"
FT                   /translation="MDRRYALTGVANRSVTSVCRGTIRLGLDGGAEPLCRTGACQTNSS
FT                   HTSPCTADPSAMGEHAPPRSLQQLRAEWRERLQSARDRAASQVDDMGLADLRALRATIG
FT                   EEMERVEDRLPDPGPVETKGPMTAEQQAEHVQAALQYHALQVRKQLVAHELRRRALGPA
FT                   AVEQEIEVPPTTRHYATLAWDVMGETDAETTADVYREVARRAEEDVHLTTVEMWLREKN
FT                   PHHPEETDGRWTELRRAVLLASA"
FT   CDS_pept        complement(45980..46231)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00048"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00048"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22969"
FT                   /db_xref="GOA:D5H4L4"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L4"
FT                   /protein_id="CBH22969.1"
FT                   /translation="MRAPFSPLSFFSPRSVHNVAYRLALLISVGGLVLLAMAGPGDDLQ
FT                   TTLGATGLVGAGLLVGLGALLRFLGYIEEGAADRDGSP"
FT   CDS_pept        46355..47587
FT                   /transl_table=11
FT                   /gene="pepB"
FT                   /locus_tag="SRM_00049"
FT                   /product="aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00049"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22970"
FT                   /db_xref="GOA:D5H4L5"
FT                   /db_xref="InterPro:IPR000787"
FT                   /db_xref="InterPro:IPR035097"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L5"
FT                   /protein_id="CBH22970.1"
FT                   /translation="MRVNKTDDRAAGPPKPGRNGFRTRDRPDREPPCVVPFGTSPSQAP
FT                   DCLSPHRIRVMDERIQEHARTLLNWSTDVQRDDDVVIAAGPEAHDLVVALHRELGDRGA
FT                   NPMTLYSSGEASRAHLKAHDGDFSLPEHTLALYEACDVAIHVRSSPNLAALNDVSGTRL
FT                   AERSRAHKPIIEERLSKRWCLTQHPTNAHAQAADLPLGAYRDFVYGAILRDWAAVEEYQ
FT                   EELRRRLEAARTVRVVAGETDIEMSVEHMHAINSAGRHNMPSGEVFTAPVPESVEGTVH
FT                   FDKPLIHQGREMEGVRLRFEGGEVVESAAERNEEALDDLLDTDDGARRLGELGIGTNRE
FT                   IDRFTKNMLFDEKMGETVHLALGRAYDANVGEGQTGNDSAVHVDMILDTSAGRIEFDGE
FT                   VIQEGGQFVWE"
FT   CDS_pept        47827..49350
FT                   /transl_table=11
FT                   /locus_tag="SRM_00050"
FT                   /product="Conserved hypothetical protein containing PKD
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22971"
FT                   /db_xref="GOA:D5H4L6"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L6"
FT                   /protein_id="CBH22971.1"
FT                   /translation="MSGSLLGLPRSRGRTNQPGRVMHLCSLNVPRSRGGRLVLLGVALL
FT                   LSGVVGTAQAQHLDNGFYGKLGAGLSGYTGDLAGPRAGAPQEFGADAIGRLPLVAVGEL
FT                   GYQLSPRWGLALGGQAGSYVSVGNAAPATDSYRRYTSHLLGRYTFGAPDRRVAFYLDAG
FT                   LNVTAGGPTHTGIGPSVGGGIDIRAGRAVSLYVESRLHATVPDDAVDGRGRGAEGWSFD
FT                   TVNQPLGFGLRFSLTTPTAPEIIALDAPTEVEAGTTATFTVTINEEEAARPLDRRWRFG
FT                   DGTEGTGRTVTHTYRRPGTYPVTVSAHNEAGEATASTTIRVTRASAPPSPPEVPWVVSL
FT                   TARPNPVRVGEPVQLRTAVEGEKPFTYQWTVDGTTATRGSAPTYTFDRPGRHTVQVRVS
FT                   NDGGTETRSMTVQAERRTAKRPSPQPAGLWAVGVASMRNPAGAKRMARRYRTRLADAPV
FT                   SVRIVEHMLDQERHFRVVVGRYETRAAAQKARETYRRALPPEAWAVRLE"
FT   tRNA            49492..49565
FT                   /locus_tag="tRNA_4"
FT   tRNA            49645..49719
FT                   /locus_tag="tRNA_5"
FT   CDS_pept        49833..50057
FT                   /transl_table=11
FT                   /gene="rpmH"
FT                   /locus_tag="SRM_00051"
FT                   /product="Ribosomal protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00051"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22972"
FT                   /db_xref="GOA:D5H4L7"
FT                   /db_xref="InterPro:IPR000271"
FT                   /db_xref="InterPro:IPR020939"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L7"
FT                   /protein_id="CBH22972.1"
FT                   /translation="MPPPLDFVAQIFLRIDRVAVMPKRTYQPSQKKRKKKHGFLERMKT
FT                   KEGRKIIKRRRKKGRDKLSVSDEDSGKPV"
FT   CDS_pept        50064..50510
FT                   /transl_table=11
FT                   /locus_tag="SRM_00052"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00052"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22973"
FT                   /db_xref="GOA:D5H4L8"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L8"
FT                   /protein_id="CBH22973.1"
FT                   /translation="MPVSDVPDRVEQRRLTFPPSYRLKRRRLIRSLFDRTRDDVRTVAE
FT                   GCVRLLYRVVDRAVLGHDVPLQVGFAPGPRAESGVERNRIRRLLREVYRVHQYTLVDPF
FT                   VCGPEALIVMILFRGAPEQADDGIGRDLPPALRRAAASFDERAD"
FT   CDS_pept        50689..52653
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="SRM_00053"
FT                   /product="Inner membrane protein oxaA"
FT                   /function="equired for the insertion of integral membrane
FT                   proteins into the membrane. Probably plays an essential
FT                   role in the integration of proteins of the respiratory
FT                   chain complexes. Involved in integration of membrane
FT                   proteins that insert dependently and independently of the
FT                   Sec translocase complex."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00053"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22974"
FT                   /db_xref="GOA:D5H4L9"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4L9"
FT                   /protein_id="CBH22974.1"
FT                   /translation="MASPLRNNPEPEDQRNVIIATILVAVIMFAWIFWFSPSPQQQQSQ
FT                   QAAGPADTTEQTDPSAPAADTGADDAPSDAAPPSTADAGADASQPDADQPEAPAPDSVT
FT                   AAALQGTQRRIVVESDLYTVVLSTKGGTIERFTLKEYKQFNQEDPVQIVDTTAGGTLSL
FT                   SFTTPSRRRVDTRSLYFSADTKADTVRIEDESKTLTFEAQLGDGALRQSYTFHPDDYDL
FT                   GLAIEQERPRSFLTSDGYELTWHGGMPYSEGGEEDELRYTGLFARNGEQIQSLTLSDAD
FT                   QNQKRIEGDVSWMAVKNKYFTAAVMPDRPATALGASLTGRKEGRATSEAAFKDLTGRLQ
FT                   MPLPRETTHVDKFHLYAGPIDYYSLADYGRNLYGMVNYGWDWFEWMTKPLAEYLYIPML
FT                   TYLGTGLPSWLFGGGLPYGVIVILMAVLIKTVVYPLTKSSYRSMAQMRELQPKMQEIKD
FT                   KYDDEPEKQQEEMMQLYRETGVNPLGGCLPMFLQYPILISLYQFIPKSIQLRQESFLWA
FT                   ADLSAPDKILQLPFEIPFYGDYVAGFTLLMGLAMIVTMRVQSTGGGAAGGQAKIFMYAM
FT                   PGVIFFIFNRFASGLSLYYLFYNIVTAAQQKWINMQLEKEKDDDGNLTNGRSDGEAEGE
FT                   KGFFARLMERAEEAQKEQR"
FT   CDS_pept        52718..54103
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="SRM_00054"
FT                   /product="tRNA modification GTPase trmE"
FT                   /function="Exhibits a very high intrinsic GTPase hydrolysis
FT                   rate. Involved in the biosynthesis of the hypermodified
FT                   nucleoside 5-methylaminomethyl-2- thiouridine, which is
FT                   found in the wobble position of some tRNAs."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00054"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22975"
FT                   /db_xref="GOA:D5H4M0"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M0"
FT                   /protein_id="CBH22975.1"
FT                   /translation="MSQSDTIAAIATARGRAALAVVRTSGPAAIEIVDRCFRGDALTDA
FT                   DSHTAHVGVLTDEAGTDIDQVVATVFRAPNSATGEHVVEVSCHGGDLAPKMALQSLLDH
FT                   GARMAEPGEFTERAFLNGKMDLAQAEAVADLIDATSTKAHQASLTHLKGRYSDLLGDLR
FT                   EELLNLCSLVELEIDFSDEDVEFADRERLEDLLDETEEILGDLLDTYPTGEKLKDGVQV
FT                   VIGGRPNAGKSTLLNALVGHDRAIVSETPGTTRDEIEAEAEIEGVLFRFVDTAGLRDTA
FT                   DEIEAEGVRRATESIEEADVLFYLYDLTVGLDSQEIAFLQDLAADGSDVQPVVIGNKAD
FT                   RAPDLPVATLDGLTSLKLSALKAREDADEVQPLLDHLTDTVAEHLSRAEASPVVMNQRH
FT                   RQHLRDALDAVQQAREALDAGVSGDMLTLDLRAALQELGAITGEITNEDVLDQIFSRFC
FT                   IGK"
FT   CDS_pept        54294..55040
FT                   /transl_table=11
FT                   /locus_tag="SRM_00055"
FT                   /product="Acyl-ACP thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00055"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22976"
FT                   /db_xref="GOA:D5H4M1"
FT                   /db_xref="InterPro:IPR002864"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M1"
FT                   /protein_id="CBH22976.1"
FT                   /translation="MTAGIWTDEVRVRSYDVTPQGTASVLTLADYFQEAAGRHAAELGV
FT                   SMTDLRADGQAWVLAFMHMQVERLPHQNESIRIETWPSGLESASAHREFVFHDEEGTVL
FT                   AGGTSRWFVFDVDRRRPVRPPRVLADIEGPDRPGPIDQDLDALSAPAHTDREQTFTARY
FT                   HDLDLNRHVNNVRYLEWALETLPAAVLDERRCLGFAVQFEAETRLGDPVRASAEQIEDG
FT                   GTLRVRHRLAHAESDQTLALVRTTWL"
FT   CDS_pept        55080..55937
FT                   /transl_table=11
FT                   /locus_tag="SRM_00056"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00056"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22977"
FT                   /db_xref="GOA:D5H4M2"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M2"
FT                   /protein_id="CBH22977.1"
FT                   /translation="MSRSFAAGRRTRSKSLRTPEAGPRVAMQEACNVRWQWGRLGNVKR
FT                   CRRRTQVGIRINLCVQGREGLSSPTPTGPIVTSTQPDSRASSLTDDALQWTRLEVAFTA
FT                   GIVGCLLFATWQLGDLLARDWLAGWVGESELREDLVYYGVAFTAALAALGGTTRSLAHA
FT                   GRFRRTVGRSLLWYGALLLISASGMGAIEYLPEVAAGLFGAGVLIAAVYVLQQRYFTRE
FT                   RIRRRRLRNDNCPQCGSDLRPEAHHCSQCGRRVGKDCPECGGYLGRSDRYCADCGRERA
FT                   EGAP"
FT   CDS_pept        56135..56626
FT                   /transl_table=11
FT                   /locus_tag="SRM_00057"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00057"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22978"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M3"
FT                   /protein_id="CBH22978.1"
FT                   /translation="MTRQPEPGNAPEGNAPRSFGLSQSQRWGAASGLLFFLLVVGTDYA
FT                   SGVAAREWSELALDAGIVGGLVLVVFNAFRKSVLVGENEIRKVQPLWNDQSVQISEIRR
FT                   VHVPTIENGLWLYTDPDGNPVLTIGGGLEAPDELEERVIQHAPSDAAVTGLGHRANGSS
FT                   "
FT   CDS_pept        56884..57363
FT                   /transl_table=11
FT                   /locus_tag="SRM_00058"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00058"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22979"
FT                   /db_xref="GOA:D5H4M4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M4"
FT                   /protein_id="CBH22979.1"
FT                   /translation="MPTDPLRRLGRLEEGGFRRLAARLALLRAYARRRDTEGLSDAQAQ
FT                   AAIAEAFDQRTAAVDAWVYDVYESVTARTLRRWAQQFREEGLQGLIDKHGRRSERSYES
FT                   YFGAGSELRKVALHYLADHPDCTSTELLDELAQHVDDDALPTRRTVQRFLRKMGG"
FT   CDS_pept        57874..59868
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="SRM_00059"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme gidA"
FT                   /function="Involved in the 5-carboxymethylaminomethyl
FT                   modification (mnm(5)s(2)U) of the wobble uridine base in
FT                   some tRNAs."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00059"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22980"
FT                   /db_xref="GOA:D5H4M5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M5"
FT                   /protein_id="CBH22980.1"
FT                   /translation="MHQDYFEHDVIVVGGGHSGSEAAAAAANMGADTLLITMKLADIGQ
FT                   MSCNPAIGGIGKGHIAREIDALGGIMGRATDRAGIQFRMLNKSKGPAVWGPRAQCGRRA
FT                   YARAIRQELEAIDNLKMRSDMVKEILTDDAGETVTGVRTNLGKEFCAPCVILTTGTFSN
FT                   GVIHVGEQNFGGGRIGESASHGITGCLHDLGFESGRLKTGTPPRVDGRSIDYSVMEKQP
FT                   GDPDATAFSFLTDDLPSVEAQLSCWLTDTTPETHEVLRTGFDRSPMFTGALDADGPRYC
FT                   PSIEDKIDRFSEKDHHQLFIEPEGRDTHEVYVNGFSSSLPEEVQFEALRTVPGMEEAHM
FT                   HRPGYAIEYDFFPPYQIEYSLETKYVDGLFFAGQINGTTGYEEAAAQGIMAGINAVQKL
FT                   RQADPIVLKRSEAYIGVLIDDLVAKGTDEPYRMFTSRAEHRILLRQDNADQRLTELGHK
FT                   LGLASKERLDRTREKERAIDVTRETLSDTTVSPQQVDDYLQSVGTSTLNQPRPVIELCK
FT                   RPEVDSEDLLRHAGIYDEVVTEAPGMLSAPRLIEIDLKYEGYIDRQKDMVEEMEEKERW
FT                   PIPDDFDYHALDNISIEARQKLSKVEPDNLGQASRVPGVRASDISVLMVLLKNEGVEPM
FT                   PKDRDLNLDAMGGDGQSFGVSRETAVEVG"
FT   CDS_pept        59943..60590
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="SRM_00060"
FT                   /product="Methyltransferase gidB"
FT                   /function="Probable S-adenosyl-L-methionine dependent
FT                   methyltransferase specific for a sterol and/or lipid
FT                   substrate."
FT                   /EC_number="2.1.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22981"
FT                   /db_xref="GOA:D5H4M6"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M6"
FT                   /protein_id="CBH22981.1"
FT                   /translation="MENLAWSPFKSLTAEQREQLDRFREQLLRFNQRVNLISPETEGAF
FT                   RTRHLLHCLTLTARDFPAGCTVVDWGTGGGLPAIPLAICHPEATVVGVDSVGKKSRAVR
FT                   TIARRLGLDNCFTWNGRADEWTGEAHYSVSRATAPLADLWAWHRRVAVSPDDPNGDAWP
FT                   PGLLALKGGDLSDEVAALHAADPDAGVERHSLHDLLGRNGFFGAKEIVAVRS"
FT   CDS_pept        60659..61519
FT                   /transl_table=11
FT                   /locus_tag="SRM_00061"
FT                   /product="conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00061"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22982"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M7"
FT                   /protein_id="CBH22982.1"
FT                   /translation="MRRAMINTALGLAVGYAAIAGLAFAFQDQLLFQPSDRHRATPEDA
FT                   GMPYETVHLNTEDGETLHGWWIPAPDVSRETSPGASAKQTLLFFHGNAGNISGRLESVE
FT                   QFRRLGLNVLIVDYRGYGQSTGTPSEAGLYRDAAACWRHLTETRGLAPQNIVVFGRSMG
FT                   GGPATWIASRNRPGAVILESVFTSVPDVGAHHYPFLPVQTLATNQFDNASRVGAISAPL
FT                   LSIHSRDDRIVPFELGRKVYEAAAAPKQFLEIEGGHNDGFLVSAEEYLRTIGDFLEEHL
FT                   GSGDE"
FT   CDS_pept        complement(61753..65649)
FT                   /transl_table=11
FT                   /gene="mfd"
FT                   /locus_tag="SRM_00062"
FT                   /product="Transcription-repair coupling factor"
FT                   /function="Necessary for strand-specific repair. A lesion
FT                   in the template strand blocks the RNA polymerase complex
FT                   (RNAP). The RNAP-DNA-RNA complex is specifically recognized
FT                   by TRCF which releases RNAP and the truncated transcript;
FT                   the TCRF may replace RNAP at the lesion site and then
FT                   recruit the uvrA/B/C repair system."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00062"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22983"
FT                   /db_xref="GOA:D5H4M8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M8"
FT                   /protein_id="CBH22983.1"
FT                   /translation="MGKTIRDYRPNGESTRGRAHPVSRETCPPFSSPPSTLDRAFHVKH
FT                   LRLFATRCVNAQQRRNLLARLRRWFFRSESTCHPHSGLPPRPSLMLRRRAFGVWGLRMR
FT                   EGARGRDPRDQSVGIALSPTRPLPRGSSLSGTSERSCTLEDDRSLESENPPPVSLTAIA
FT                   NRIETTAAVSRLRAWTAEAQRGDRSPALHVNGAAGSLPAFLLYHLHREPGAPLCVLTPD
FT                   EDAAAYLQSDLEQLVGEPDEAILRVPATQKTPYDPDQIADSTPLIERADALQRLAEGFE
FT                   GILVTSVPAVGELVPPPQAVQRETLTVENGEEIALEALADRLLEQDFSPVEFVEEPGEF
FT                   ARRGGILDVFPYAGTYPIRIDFFGDEVNGLREFDPQTQRSVSRLTTARLVPNLEREEAA
FT                   RGSIALFQYLPDEAVLATLDEAQVREGAQAQFEEAAAAYEERRAELAENDEVEQTPEDL
FT                   TPPDDRFLTGDQMAAALTRHPRLQFGTFSQSSTNGTPTDTLDLEADPQPSFSSDMDLVR
FT                   KRLQKNGDRDLDTFILCDSHGQSSRLRDLLESEIDHGWARLVVESLHQGFEWPGAGLAV
FT                   FTDHQIFNRYHRPSTKQREGHADGMNLRDIKNLTRGDFVVHVDHGIGRFDGMKKITVRD
FT                   NQQEAVRLNFADNDVLYVNVHALHKLNKYTGKEGHQPTLTKLGSEQWEKKKQRTKDQVK
FT                   EVARDLIKLYAKRKASDGYAFSSDTTWQREMEASFEFEDTPDQAEATKAVKRDMEEPVP
FT                   MDRLVCGDVGFGKTEVAVRAAFKAVQDGKQVAMLVPTTILAQQHHDTFSERMERFPVNV
FT                   EVLSRFRSRTEQSKVLEKLEKGQVDILIGTHRITSDDITFDDLGLLVVDEEQRFGVKTK
FT                   EKLRKMREAIDTLTLTATPIPRTLQFSLLGARDLSLIETPPPNRQPINTEIHTFDEDVI
FT                   RDAIVYETSRGGQVFFIHNRVKTIHEVAEMVRAMVPNVRVGVGHGQMSASELEDVMLDF
FT                   VNEKLDVLVSTSIIENGLDISNANTMIINHAGEHFGLSELHQLRGRVGRSQRKAFCHLL
FT                   VPSVHGLTDDARERLKAVEQFSDLGSGFDIAMRDLDIRGAGSLLGAEQSGFIEDVGYET
FT                   YHKILDQAVKELREEEFDDVFDGEAVPPGPETSVDVEEDAYIPESYLRDNTERLNLYRR
FT                   ISDAPDETTLVDLLDEMEDRFGDAPEPVQNLLTGARLRLLGERLRMPKVVYKNERLFLY
FT                   LPSEDADPYFYDEVFHPLLEKLTLLDREYVMKDDVEGGLMRAIVQDVNTLDEALQVTES
FT                   LLLEETKTMATVEA"
FT   CDS_pept        66023..66487
FT                   /transl_table=11
FT                   /locus_tag="SRM_00063"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00063"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22984"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4M9"
FT                   /protein_id="CBH22984.1"
FT                   /translation="MWRICSNRIPGAAGRGERSTVSGHIGAPFCRKERLPRHRAVRAMQ
FT                   VTRTPADVLATLSRRYREHYGDRLVGIYAVPEFPFSDEGPEETEDDDVRAIEILVILQG
FT                   PYDHFEEADPVVDIAMDVTEEYDWWMGIFARHAAHDDDLADWAREKGVEL"
FT   CDS_pept        66484..66843
FT                   /transl_table=11
FT                   /locus_tag="SRM_00064"
FT                   /product="Conserved hypothetical protein containing
FT                   function DUF103"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00064"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22985"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N0"
FT                   /protein_id="CBH22985.1"
FT                   /translation="MSEVQERLQTARRRLDAAQCLHRNEFESDAINRLYFGVLESARAL
FT                   LLLRDLTPKTHKGTGMKLGQHFQNDVEVGLLTKLRQNREEADYDLWNPSSDEVEMWLGR
FT                   ADEFVDASAHIVGRE"
FT   CDS_pept        complement(66855..67781)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00065"
FT                   /product="glucokinase regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00065"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22986"
FT                   /db_xref="GOA:D5H4N1"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005486"
FT                   /db_xref="InterPro:IPR005488"
FT                   /db_xref="InterPro:IPR040190"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N1"
FT                   /protein_id="CBH22986.1"
FT                   /translation="MPDSSSLFDELQDLATEQQNPHSTHIDTASVEEILRVINTEDHKV
FT                   PIAVRRELPHIAEAVEIVVEAFEADGRLFYVGAGTSGRLGVVDASECPPTFGTDPERVQ
FT                   GIIAGGREAVFRSQEGAEDVPERGAQALKSQGVTENDVVCGIASSGRTPFVVGAVEHAR
FT                   DAIGCPTLFVTTIPREELDVAPDVAICPVVGPEVIMGSTRMKSGTAQKLVLNMITTAAM
FT                   VRLGKVYENMMVDLRRTSEKLVERGIRTVMMVTGVDYDAADAVLTRCDGHVKTALVMIL
FT                   ADVEVDEARRRLDATDGFVRPAIEGDE"
FT   CDS_pept        complement(67848..70664)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00066"
FT                   /product="Conserved hypothetical protein containing TPR
FT                   repeat, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00066"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22987"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N2"
FT                   /protein_id="CBH22987.1"
FT                   /translation="MLVVLLATSLLVVPPFSVDAADDLDACLRQAPVQSPPPINWGEGV
FT                   PQMWSSTPPVPRDTVRAYLSQVRAARACFRTLDPSRVERPYLGNIMRTFQVETALLAAL
FT                   RRFADAFEAFEDARSYLNAAPNIPSAEGTRTGWIRALHQDQGFLHFRIGNLSASITHYT
FT                   TALRKTSEHEVGLRVTHLLDVGLLHQYTQDYRSARRYYTRARRLAREHDRTSEEHPSEW
FT                   ARLLYLQANLLLEETLNTEFDRASLRRARDLARKGRSLATSSDRRIDLALALSESLGYL
FT                   GSFDRAYALNAEVRRYAQARDDAQLRAFALLKLGVLHMQTERWTEAESVLNTSLAIAER
FT                   MGNLDQQRRIRRGLGRLHELQQNWATAEDQYRAGVAVIKRYRESLTATQWASTAFAQWR
FT                   DVHRGLVRTLLAQNQPRAALAALDRTRARYLRDLRTRNRVATQLSPATRARFDSLGRAL
FT                   TDVRNRLGTDSLSDATEAALRARKASLMANRQRVLRLDSARTPRPSVDEIAASIAQQDR
FT                   ALVSYFLDAPWPVYDRPPRSAAFVLTGDTLQAVALPGLSQDSIRAHVNTISSLFADRQA
FT                   SRSISAMHFNLRPLRALHDRLYAPVAAHLPDGQPLTVIPDGPMFHVPFSMLATAAPGGR
FT                   YDHEQARFVLHERPTALDLSASLATDTSATRGDAASSSSDLAAFGVSSFDPLRPPPPSL
FT                   PSSRADTTAASSLSLPPLPGVRSEINALDRLFDDAKTFLDEQATEPAFAAASQEADVLH
FT                   LASHALVSPSSSLRNAFLLHPDSSSDGLLFLHELQTRDRALPLAVLSGCNTARGTLRGG
FT                   EGMAGLQYAFRIMGAQSTVSNLWPTADRSSVALMESFYENLRAGQPKDQALRRAKLTYL
FT                   ENHPDNLSPFFWASAVLYGSPRPLQMNASDGSSLRTWGPVALALLVVLLGWSLVRFRSQ
FT                   LGLDAFHQ"
FT   CDS_pept        70772..70918
FT                   /transl_table=11
FT                   /locus_tag="SRM_00067"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00067"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22988"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N3"
FT                   /protein_id="CBH22988.1"
FT                   /translation="MTTATEHLRDAFRRSVRYAGGGADPSSGSGGGGGSGGGGSEEDEE
FT                   LET"
FT   CDS_pept        71724..72962
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="SRM_00068"
FT                   /product="DNA replication and repair protein recF"
FT                   /function="The recF protein is involved in DNA metabolism;
FT                   it is required for DNA replication and normal SOS
FT                   inducibility. RecF binds preferentially to single-
FT                   stranded, linear DNA. It also seems to bind ATP."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00068"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22989"
FT                   /db_xref="GOA:D5H4N4"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N4"
FT                   /protein_id="CBH22989.1"
FT                   /translation="MILHTLRLRSFRAHAESEFDLAPSINLLYGANGAGKTNVLEAVHY
FT                   LCLTKSFTASRDRYAVRKDAPYFEIEGRIGQVREEPMTVRLAYVPGEGKSIFVNGAELD
FT                   RLADIVGTLPVVVFSPEDYDLTAGGPSERRRFVNNILSQARSVYMETLMKYRRARRQRN
FT                   EVLRSYKKRSAPPPDELLAPWTEKLVGLGSRIVHRRQQFLQAFADDLEEAYRRIDAVAE
FT                   RPTIEYDTIADLAPDATPDAIEDAFRAALARKQGQERDRGTTLVGPQRDELVFRLDDLE
FT                   VRRYGSQGQHRTFAMALKLAQYFYLQQRNDTEPLLLLDDAFGKLDAERTGVFLDLLRSD
FT                   AVGQSLVTATRRGPFEPALNAEPASHRALQVRPGGGTAAVAPDPEYARGEATAANGAAS
FT                   APTGADAASTSRD"
FT   CDS_pept        73002..74564
FT                   /transl_table=11
FT                   /locus_tag="SRM_00069"
FT                   /product="conserved hypothetical protein containing
FT                   peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00069"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22990"
FT                   /db_xref="GOA:D5H4N5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N5"
FT                   /protein_id="CBH22990.1"
FT                   /translation="MPTSDSTSPMSRSLTARRAPARRTRPWALVPVLVLLLAVGTGCVS
FT                   TGTNPISGNTRAYGYSWQEEVTMGQKADKQIQSQYGVYDDEELQEYVDGVAQEVLAESH
FT                   MRRPDTPERFRNTEFEFRVLDSPIINAFALPGGYVYVTRGLVAHLNNEAQLAMVLGHEI
FT                   GHVAARHASQQAARQKFTQGLLLSGAVAGQVAFGGNVAENVMGLGGQAAQLLSLSYSRD
FT                   NERESDRLGVEYAVRAGYDGAEGAAFFESLERVRKQGGQSIPTWQSTHPDPGARQQTIP
FT                   ELAQTWRQKVDRPATTIDQDAYYDALEGTVLGKNPRQGFVEEGVFYQPELAFRFSIPSR
FT                   WDVQNQPQQVALVQPDQSAYMIFTFSDAETPDAAARKFAGQDGLSVLDRQSTSVNGNDA
FT                   RRVLAEGKTQQGQVVRLLTYFIAYGDNVYQFQGATSADQYDAYRPDFERTMTSFARLTD
FT                   SEKLNRQPARIAIQAADREGAFRSFVDTDALPPDMTEEDLAIINQLEVDQVVAPDRPLK
FT                   LPN"
FT   CDS_pept        complement(74662..75108)
FT                   /transl_table=11
FT                   /gene="maoC"
FT                   /locus_tag="SRM_00070"
FT                   /product="putative phosphate acetyltransferase/enoyl-CoA
FT                   hydratase fusion protein"
FT                   /EC_number="2.3.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22991"
FT                   /db_xref="GOA:D5H4N6"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N6"
FT                   /protein_id="CBH22991.1"
FT                   /translation="MVNTYESIEIGDSHEWTRVVTAEDVKKFADITGDDNPVHVDPDYA
FT                   EEHSRFGKPIVHGVLLLGLISKVLGRDFPGHGSIAVGISCRFLRPVPVGSEVRVQVKVS
FT                   EKIEDKKHVKLRTYIYRDDQMVVGGEGRVIPPTEEEEDPHRARR"
FT   CDS_pept        75359..77908
FT                   /transl_table=11
FT                   /locus_tag="SRM_00071"
FT                   /product="similar to exporters of the RND superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00071"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22992"
FT                   /db_xref="GOA:D5H4N7"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N7"
FT                   /protein_id="CBH22992.1"
FT                   /translation="MDRLFRALRPFIRRVTQRAGGVLVLAVLATILGGYGASQLSIDTD
FT                   ISNLVPEDYESVQALDTLQRTVGGERDMAVAISSPSFEANKAFAEDFIPRALSLRREAD
FT                   TSATYLTRVEYKREVEFLKDNALYFASDQELRQVEDFLDDQIAEAKRARQDANPFYFEL
FT                   EEEEGGTADTAETTEESGEALEGVYDRLIGKRYPISDDSTTMVLRFYPSGANTNIGYIE
FT                   NLYADTRALVDRMEPASYHSEMEVVLAGRLYRQLVEVETIWSDVTGSFGVGVGTVLLVV
FT                   ILYFLYKAYRVRSGPGFDGRVLLRELVRAPVMGLVIGVPLFMSLAWTGGVAALLFGRLN
FT                   LMTSTLGLVLFGLGIDFGIHFYARYAEERADGHSVVDAVERTFVSTGQAIAVGAFTTAG
FT                   ALYVLVVADFKGFSEFGAIAGTGVLFALVAMTVVMPALLALLERTGLLDLRRGAGMEAA
FT                   PDDAPRRYSAARPVVVGGLVAVLLALALVPRVDFQYDFGALEPEYTEYEQRDRYVDRVS
FT                   TGGSDNRRNPAYIVADSREAVPKIVAAVRKKMRADTTSPTILAVESLQGRFPLRDTAQA
FT                   SKLARIAQIRETATENRYLRDESTDALKRLRRAAQPRAPIPLDQVPRSLRKQFTTKDGE
FT                   LGRFVMIYPSVGLSDGRKSIAFAKDVGTITTADGTTYHAGSTSLVAADMLMLLQREAPW
FT                   MIAGTFVIVALLMLLNFRSLRWAGLALVPLVVGLLWMLLVMEIFGLKVNFYNMIVFPAI
FT                   LGIGNDAGVHMVHRYREEGPGSLWTVLRSTGEHVTMGTLTTMVGFGGLLLSFHPGLNSM
FT                   GTLAVLGLGTTLLAAVGFLPALWQWLEDRGFWGSVER"
FT   CDS_pept        complement(77999..78628)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="SRM_00072"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00072"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22993"
FT                   /db_xref="GOA:D5H4N8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011946"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N8"
FT                   /protein_id="CBH22993.1"
FT                   /translation="MLSREEVRQLFAALSPGPNRLIAHLLYGSGLRLSEALRLRVKELD
FT                   VGTSRLHVRDGKGSTDRTTVLPERLHGPLRRHLKTVKAQHEADCADGVGGVYLPDALAE
FT                   KYPNAATEWRWQYVFPSTTLSEDPRSGAVRRHHRSDSAVQRAVKKAANAADIEKRATCH
FT                   TLRHSFATHLLQDGTDVRTTMQYVHVLEQSGADVMSPLDTLPEDPT"
FT   CDS_pept        complement(78744..78959)
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="SRM_00073"
FT                   /product="phage-related integrase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00073"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22994"
FT                   /db_xref="GOA:D5H4N9"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4N9"
FT                   /protein_id="CBH22994.1"
FT                   /translation="MRQTCRRRQYSYHREKAYVRWAERFACVHDPTHPRRLNEDDIRAF
FT                   LGHLASERNVAASTQNQALNALTEWI"
FT   CDS_pept        79779..80132
FT                   /transl_table=11
FT                   /locus_tag="SRM_00074"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00074"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22995"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P0"
FT                   /protein_id="CBH22995.1"
FT                   /translation="MREKRNFTTKSGNKKERLSEEERKDVSSSVGPKSLIDLIYRKRIK
FT                   SNYDEIDTFHSDDIDAMGIHKSLRKVTSCLNFVHEVYVAPIMGYNWLHGVYTSHPLEYG
FT                   RLDKRMDFIEDIF"
FT   CDS_pept        80398..80790
FT                   /transl_table=11
FT                   /locus_tag="SRM_00075"
FT                   /product="PilT protein, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00075"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22996"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P1"
FT                   /protein_id="CBH22996.1"
FT                   /translation="MKVVIDTSAIIAVVLGEEHRDRIIRQTEGADLIAPETLHWEVGNA
FT                   FSAMFKRDRLGLDAAVEALRRYDEIPIQWVEVALDDALRVSDRHDLYAYDAYMLVAARR
FT                   HQAPLLTLDEGLKEAARESDIDLLEV"
FT   CDS_pept        81268..82014
FT                   /transl_table=11
FT                   /locus_tag="SRM_00076"
FT                   /product="abortive phage resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00076"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22997"
FT                   /db_xref="InterPro:IPR026001"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P2"
FT                   /protein_id="CBH22997.1"
FT                   /translation="MKDEELLEEVEAFQKLLIDYSTGGDVEGKEYKRLRRDLLSNPKVK
FT                   DELPEFIQNCRSLRQFWSFIKSESGNYEGRRRFIWSEFAPVLNKLEGGLESPADDPITE
FT                   ALASLDAGHVDRIWHKALERKEKDPEGAVTAARTLLESVCKTILDEMEIDYDDKADLPK
FT                   LYHQTADELNLAPGQYSEELFRKILGNCQSVVGTLGAIRNAHSDAHGDGKASYKPASRH
FT                   AELAVNLAGSMAMFLVRTWENASESA"
FT   CDS_pept        82204..82449
FT                   /transl_table=11
FT                   /locus_tag="SRM_00077"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00077"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22998"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P3"
FT                   /protein_id="CBH22998.1"
FT                   /translation="MPKTVGAIVGEDGSIQLPDSISLKRDQRVLVTILEETDEANRDLE
FT                   SDSSVGEPALLSEKALAEDWTRDEEDEAWKHLQPDQ"
FT   CDS_pept        82477..82797
FT                   /transl_table=11
FT                   /locus_tag="SRM_00078"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00078"
FT                   /db_xref="EnsemblGenomes-Tr:CBH22999"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P4"
FT                   /protein_id="CBH22999.1"
FT                   /translation="MSESKLRPVVVLAEISRDDFVLCQVTSNPYADPNAVGLTDKEFAE
FT                   GSSKRASYARPGKLVTANLQLFEGEAGALTEKPRTENRPTGRSVAPLRETERQSTSSGL
FT                   RS"
FT   CDS_pept        complement(82956..85088)
FT                   /transl_table=11
FT                   /gene="glgP"
FT                   /locus_tag="SRM_00079"
FT                   /product="Glycogen phosphorylase"
FT                   /function="Phosphorylase is an important allosteric enzyme
FT                   in carbohydrate metabolism. Enzymes from different sources
FT                   differ in their regulatory mechanisms and in their natural
FT                   substrates. However, all known phosphorylases share
FT                   catalytic and structural properties."
FT                   /EC_number="2.4.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00079"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23000"
FT                   /db_xref="GOA:D5H4P5"
FT                   /db_xref="InterPro:IPR000811"
FT                   /db_xref="InterPro:IPR011834"
FT                   /db_xref="InterPro:IPR024517"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P5"
FT                   /protein_id="CBH23000.1"
FT                   /translation="MYMGCLRGSQCIRNTPRLLIVLPSMSFGHMTSRDKLESIATNLWW
FT                   TWTPDARSLFRRLNPEVYRASDDNPRAALATAKDEVLNDSSFQDDVDAVYQRYRDYMER
FT                   TPQVEDAPETAYFCMEYGLHESMPLYSGGLGVLAGDHSKAASDLGLPFTGIGLFLREGY
FT                   FRQSFDADGWQEATYPVLDPAKHPVSLVSEGGGDPLTVTVPIGTHEIAVRAWKVALGHT
FT                   DLYLLDTDFDANPDEYRPLTRRLYQGGDHERIRQEIVLGIGGLRMLRALDVTPDVYHAN
FT                   EGHCAFLMLELLRERLAAGDDVAEAETWVRDRSVFTTHTPVMAGHDHFDPDLFSEAMAG
FT                   FRDEIHLSNHDLLGYGRVHTDDHEETFTMTVLGLKLSRAANGVSELNGHVARQQWEDLY
FT                   PDRPLDEVPIDAITNGVHLPTWTAGPARDFFADHIHVDLTEAQDPDDWAALADLSDETL
FT                   WDFRCSLRERLLNYVAEKVQAQSLPMHPDLDPEALTIGFARRFATYKRAPLLFRDRERA
FT                   RALFSDADRPLQILYAGKAHPDDDAGKEFIRRIYALSQEAGFEGKVVFLENYDMEMGRM
FT                   LTSGCDVWLNNPRRPLEASGTSGQKVAAHGGLNLSVLDGWWPEGYNGNNGWAIGPEPTG
FT                   DYGTADPEVQDEQDAASLYRQLEEGVLPTFYTRNDDGLPTDWIDMMREAMTGVPAPFSA
FT                   KRMVLDYVEEMYRHDG"
FT   CDS_pept        85148..87556
FT                   /transl_table=11
FT                   /locus_tag="SRM_00080"
FT                   /product="two-component system sensor histidine
FT                   kinase/response regulator, hybrid"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00080"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23001"
FT                   /db_xref="GOA:D5H4P6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P6"
FT                   /protein_id="CBH23001.1"
FT                   /translation="MQRARLRHRKPVARTGALTAVNREARESVRGALVKTTYAGARGNE
FT                   GGKKFRFYTAPAPHTVPGRNAWGHAWERTDVDGAARFRRRRIGTRFSLCWRPSPHFSHL
FT                   PALGHTSACRRTAHSRPSPTAVMTASPPADSDGPAVRAWTGPWGMAVGAALFGLGGLVA
FT                   GRLAGAAAVGWGGVLLAGGGIGAMVLLHGRRLRRARRRAAARIDAARDDRNAAREALDT
FT                   ATDRIETLEEMRAAKSQFLEEISHAFRRPLTLTLGPIDTLLEGRHGALGDEVRTQLRLA
FT                   ERNGTRLLWLVNQLLDLAELETGRMSLTPTEGHLPSVVVQGVRSFEGLAERRNVHLHFE
FT                   STLDDPVARFDETKMETMLANLLSSAFQAAGEDGTIQVIVRPCAAPPSAEPETDGLELV
FT                   VEHTGTQGHPPAEDDLWGTRDEPSFQTPDRISTRLGLRLVDELAALHEGALQIDPAADG
FT                   TVRYAVRLPRCPPGREGPTSDANAGASSGDTGIAAPDDDLGQDPLALSREALAGRADAS
FT                   APAPEAPAASPDEDRTTVLVIDDNSVVCTLVRTHLEPEYRVEEAHDGAEGYTLARTLLP
FT                   DLVISDVMMPEVDGFELCRKIKQDPDIDHVPVVFLTARADLEDKVEGLDVGADAYLTKP
FT                   FEPEALIARIENLIATRRTLRESFRNAGTAGGESRHSPDEAGNGAEKAKEALPPTAEAA
FT                   PLRDRIEEAIAERLTDPDFGVSELAAATALSASQLRRRMKAMYDRTPVQLIRHRRLEAG
FT                   ARLLQERADVTIGEVAYAVGFNSQSYFSRSFREAFGVPPSQYRGEGAAA"
FT   CDS_pept        complement(87566..88510)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00081"
FT                   /product="conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00081"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23002"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P7"
FT                   /protein_id="CBH23002.1"
FT                   /translation="MPLRSLPLAPPHRLVIGGALLLVVALGVTGCGTGDSSSSPAANVV
FT                   LEDEVERRVADARNRLSQNEGGQRLLRAIEAHGGLPAWHRAPTSSYTWTYANKGADLRF
FT                   KSFLVVDNRTRRAYHDLLAVGAYDDARPVDARFAWTGERAWIAPASLKRPNPRFWALTG
FT                   FYFQQIPFVLADPGARYEALPDDSIDGTPHDMVRVTFGKNVGDSPDDTYILYLDKETGR
FT                   VDAIRYTVSYGREVGADADLPQTFFDYQDYVTVDGLTVPTRFEGYAYDEDDGPGDALRN
FT                   EAVADSISYRRSFDASKLEPPKNARVVSLPDET"
FT   CDS_pept        complement(88548..89981)
FT                   /transl_table=11
FT                   /gene="merA"
FT                   /locus_tag="SRM_00082"
FT                   /product="Mercuric reductase"
FT                   /function="Resistance to Hg(2+) in bacteria appears to be
FT                   governed by a specialized system which includes mercuric
FT                   reductase. MerA protein is responsible for volatilizing
FT                   mercury as Hg(0)."
FT                   /EC_number="1.16.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00082"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23003"
FT                   /db_xref="GOA:D5H4P8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P8"
FT                   /protein_id="CBH23003.1"
FT                   /translation="MTDPVSYGLIVIGAGQGGGPLAGTVAEAGHDVALLERRHVGGTCV
FT                   NRGCTPTKTMIASARVAHLARRAGDYGVETGDVSVDLETVRQRKRDIVGMFRSGSRSSI
FT                   EEKDTLDLIEGDGRLVDPNTVEVALNGDVDDGGPRALTADRIVINTGTRPAIPPIDGLD
FT                   AVDFLTSTSIMELGAVPGHLLILGGGYIGLEFGQMFRRFGAEVTIIDRGEHVLGREDAD
FT                   VAGALEGILREDGIRLLNETSMTAVEETGGTITAHLEGDDAPARITGDELLVAAGRRPN
FT                   TDALNPGAAGVATTEQGYVQVDARLATTADGIYAIGDVTGGPAFTHVSYDDYRVLQDHW
FT                   LHGGDRTTEDRLIAYTLFTDPQLGRVGLTEKAARSRGLDVTVAQMPMTRVARALEVDET
FT                   RGLMKAVIDSTTNRLLGAAVLGIEGGEVMSVLQTAMMGDLPVGRLRSAPFAHPTLAESL
FT                   NNLFAGLDLGPAAERRTDG"
FT   CDS_pept        complement(90032..91546)
FT                   /transl_table=11
FT                   /gene="zwf"
FT                   /locus_tag="SRM_00083"
FT                   /product="Glucose-6-phosphate dehydrogenase"
FT                   /function="The enzyme catalyses the first step in the
FT                   pentose pathway, i.e. the conversion of glucose-6-
FT                   phosphate to gluconolactone 6-phosphate in the presence of
FT                   NADP, producing NADPH."
FT                   /EC_number="1.1.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00083"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23004"
FT                   /db_xref="GOA:D5H4P9"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4P9"
FT                   /protein_id="CBH23004.1"
FT                   /translation="MSQIDPHLFVIFGATGDLTKRKLIPALYHLMQDEDVARRCVVLGA
FT                   ARSDWTDERFREAARTALREQGYAEETVDAWCTRNLHYQCLGPEGNDYEGLRERIEQLE
FT                   RHRNLTGNRVFYFSLPPSIYTQAIEGLGAVGLNTSSGWSRVVVEKPFGHDLDSAQRLNE
FT                   RVHQHFDEDQVYRIDHYLGKETVQNLMAFRFGNALFESMWNREHIDRVEITVAEPLGVG
FT                   GRAGYYDQSGHVRDMVQNHLTQLLSLVAMEPPASMDADAIRDEKVKVLNAVQQPDPRAD
FT                   VALGQYRAGTMGGEPVPGYRDEPDVPADSDTETFAAMRLNVANWRWQGVPFFLRTGKRL
FT                   PRKLTQIAVRFQSAPVSLFQADGGPCVPRDADCEAAPNELLITLQPDEGFDLRFEVKAP
FT                   GNSDDGSMPLETQQLSFSYQDAFGPVPDAYETLLRDIIVGDPTLFVRADEVEASWQLYT
FT                   PLLETDLPVHSYEAGTWGPDAVDRLLPTWTSTGRTRSHRAEATSSS"
FT   CDS_pept        complement(91622..92533)
FT                   /transl_table=11
FT                   /gene="gnd"
FT                   /locus_tag="SRM_00084"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /EC_number="1.1.1.44"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00084"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23005"
FT                   /db_xref="GOA:D5H4Q0"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q0"
FT                   /protein_id="CBH23005.1"
FT                   /translation="MQLGMIGLGKMGANMGRRLMRDGHEVVGFDLDESAVQALEDDGAT
FT                   GAPALEGLVDELEPPRVCWMMVPAGDAVDATLGDLLPHLDEGDIVVDGGNSNYKDTLRR
FT                   AGRAEEHRVHYVDVGTSGGVWGLEEGYSMMVGGPDAAVDQLRPALTTLAPGPDKGWGHM
FT                   GDVGSGHFVKMVHNGIEYGVMQAYAEGFDIMKSKEKFDLDLQQVAETWRFGSVVRSWLL
FT                   DLTARALEEGQDLSGIEPWVDDSGEGRWTVKEAIDLDVPAPVITDALISRLDSRVEDSY
FT                   THKLLAAMRNQFGGHDVKSSDE"
FT   CDS_pept        complement(92673..95435)
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="SRM_00085"
FT                   /product="Putative Transaldolase Phosphoglucose isomerase"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00085"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23006"
FT                   /db_xref="GOA:D5H4Q1"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR004732"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q1"
FT                   /protein_id="CBH23006.1"
FT                   /translation="MPTAQTADTPTRAVRAEGQSLWLDYIRRSLMESGQLERLVEEDAL
FT                   RGLTSNPAIFEKAIGGSSEYDDAITAFLTEDPSMDAATIYERLAVEDIRRAADTLRPVY
FT                   EETGVDGVVSLEVSPHLAHDTEGTIEEARRLWDAVGRPNLMIKVPATEEGIPAIEQLLS
FT                   EGINVNVTLMFSLGHYEKVAQAYLRGLRRADDPSGIVSVASFFVSRVAREVDTRLDERG
FT                   LTDAVDFDGSDVAIANARMAYRRFEEIFHGDDFADLREQGAFVQRPLWASTSTKDPTRS
FT                   DVLYVESLIGEQTVNTIPPDTLDAFRDHGTVAGQTVTDDLDRAEAVLRRLDEVGIDLDD
FT                   VTETLQARGVEKFATPFDDLMDVLEEKREEITAHLPDPISLHLHEHETAMAERLDAWRE
FT                   DDFACRMWRRDPTLWADEDTPELTNRLGWLDLPESMQEQAAEITAFADSVTGDFDDVVV
FT                   LGMGGSSLAPDVFGRVFDPADGCPDVTVLDSTHPDAVTALADDLALERTLFIVASKSGT
FT                   TTETLSFFHYFWDRVSGLTDTPGDHFVANTDPGSNLEEIAEDRDFRAVFRAPTDVGGRY
FT                   SALTPFGLVPAALMGVDIEQLLDRAWAAEAGSDFCVEAPNNSGLELGAALGELATAGRD
FT                   KVTFVTSPTLEAFPAWQEQLIAESTGKDDTGIVPVADEPLAGPGAYGEDRVFVYFYLHG
FT                   EQDRDTIETLSALDEAGHPVISVRLDDRYDLAREMYRWEMGVAAAGAVLGIHPFNQPNV
FT                   EAAKRLAREAMQAENGTGSDTHTVAADDHDVLEQELADWLDAADETGYLGVQAYLPPSD
FT                   ETTATLTDLVTALRDTTGCATTLGYGPRFLHSTGQLHKGGPPNGLFLQLVDTPDATGPV
FT                   PETDYTFEELIAAQATGDHQALREADRTVLRVRVDDDSLGDLAEAIRAR"
FT   CDS_pept        complement(95550..95750)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00087"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00087"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23008"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q3"
FT                   /protein_id="CBH23008.1"
FT                   /translation="MLLIANAGSDWTVMAAETALREQERGVTLLLGPERKGRSWDDVRQ
FT                   NGHRPGIDTRIWGRTPPVPRT"
FT   CDS_pept        95710..96054
FT                   /transl_table=11
FT                   /locus_tag="SRM_00086"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00086"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23007"
FT                   /db_xref="GOA:D5H4Q2"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q2"
FT                   /protein_id="CBH23007.1"
FT                   /translation="MTVQSEPAFAIKSNGSGVGGIVVIVQQPADAVSQLEDLMPPCLHR
FT                   RRVRGHGSRPGTLGAEGPGRPVRWQAFRFARNEALAHVAAFGPVLPAFLLSGLPYALRL
FT                   PVPRGQRGGY"
FT   CDS_pept        96517..97149
FT                   /transl_table=11
FT                   /locus_tag="SRM_00088"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00088"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23009"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q4"
FT                   /protein_id="CBH23009.1"
FT                   /translation="MQTVTSKLTASIATLALLLGLALPMSSQAQSPIDLGVRGGVTQAT
FT                   FYGDDVNSNDFRPGFTGGVFLNYQVNDAFAVQPEVLYSRRGTKNHNSAAGNDIRVRQDV
FT                   IEIPVLLKLSAPTAPVTPRLYVGPALGFITNSELGNGNDADDRFTDVDFSGVVGGEIAY
FT                   ALNKGPLSEIAVDGRYNLGLANLGDANNFEDVRTSAFTGTLSLRFDI"
FT   CDS_pept        97368..97997
FT                   /transl_table=11
FT                   /locus_tag="SRM_00089"
FT                   /product="transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00089"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23010"
FT                   /db_xref="GOA:D5H4Q5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q5"
FT                   /protein_id="CBH23010.1"
FT                   /translation="MNVHSKPPTRPIEDTQGKRGDILGAGLHLFDEQGFHGTSMSEIAE
FT                   AAGVGAGTIYRYFDGKEDLVDQLYAEARAAAHESIVEMGFDEDASVRDRLRTTWRAVIR
FT                   NYMECPRLYRFILQYESSAYLRRAQRAQPEDLRSPFQEIYRDGVEQGLFPALPQSVYGS
FT                   FFIGTVTHLVQEHLNDGPELDEELIDQSFEMLWAAYTKASVDPGTG"
FT   CDS_pept        97930..100605
FT                   /transl_table=11
FT                   /locus_tag="SRM_00090"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23011"
FT                   /db_xref="GOA:D5H4Q6"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q6"
FT                   /protein_id="CBH23011.1"
FT                   /translation="MTSLSRCSGPPTRRRRWTPEPAKRSAAARECATLKWRGIWCRIFL
FT                   LRHGIPSRVPVSVIANVYCFHMDSSTFAARLCVNRWFADVARRSWAQGLAVALLGGLLG
FT                   MMARPPQPAAAQSAPGEDATVGIVLGDSSQAHRRAANAIRRELRSLMRPERRVQFPEAY
FT                   RRVLDTEGNADLKRLLSGETGPSVVIAVGLSASHRLATTSRPDVPVVAAHVLDPSLQGL
FT                   PRAGDASGAANLTYVTEPDLVRENMALLRSLTPASAPALLVPARMLEAAPALADRMRRR
FT                   LGRQDSSDANWRVVPVRSTAEATLEALPAGTDAAYLATPLPLSSVEQDRLISGLRARQI
FT                   PAAVHRGRELVDRGALTTASAPSVAPVPRRTALHAADVLRGAAAGSLAVALPSPRTPYV
FT                   NEATARRLGLSVPDALRLRVTLTGTPAPAPTDSITYAQAVRRGIGANYGLNARRSGLEA
FT                   AREDVRVERGDLLPQVRVGARARQVDADQAAASFGAQPERTLSGSVSFSQTLFSPREWG
FT                   DLAIAKRQQAADAAEVERSEQDLALQVSRAYVSVLQARALAQVRRSDLALSRENLSLAR
FT                   ARQESGQVGRQQVLRFKTQVAQSRRTVLDAESRVEVARTRLAQVLARSPDELVGVAGLS
FT                   PSDSILTLPESVFAAYGHTSAARQRLTDFLLEEGLSNAPELQALDEQIAAARRGVEAGQ
FT                   QSYWAPTVALEGQLSSRALEGGAGTESLSLPGGPPGGAALPQAPNTTWNVGLSLSLPLF
FT                   TGLKRDGQIERGRARLSQLKAQRREVRSSLEERIRSRTEQATSGYLSLREAEAGRRTAQ
FT                   ETIDLVQDSYTAGAADVLDLLDAQEAVLNARLAEVDARYSFLLRLLQTERAIARIGPLQ
FT                   TADERTAVRERLRAFMDGGR"
FT   CDS_pept        100451..101755
FT                   /transl_table=11
FT                   /locus_tag="SRM_00091"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00091"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23012"
FT                   /db_xref="GOA:D5H4Q7"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q7"
FT                   /protein_id="CBH23012.1"
FT                   /translation="MPVWRRSTPAIRSCSVSCRPSGPSRASGPSRPPTSGRPSASASVP
FT                   SWTGGGRGPARFHCFLHRRHSPSMPTSCFSFSRVSVPSGIGLVLMIGAAVLLSACGAES
FT                   ASAPPLEPPVRPVKMHTVQEAGATPAREYPGTVSAAETATLSFELPGTVVDLPVQEGER
FT                   VEAGQLIARLDGTDAQSRLQSARATRNAARSAYERAKSLYAQGIVSQQQLEARQREYEV
FT                   AQSQLEQAQTQVGDTRITAPFDGRVAKKMVELNENVGPQQPVVTVQDLSRMEVVIDVPE
FT                   QSRMRRALQSESLAVTFSMRPGRRLPATLKEITTTADPRTRTYEATLTIRPPDDAGILP
FT                   GMTARAIVGGGPAPAADGAGTIAIPTSAVFSRSGGTASVWAVRDSSTTVARRSVSLGMM
FT                   RDSTVVVTSGLRAGDRIAATGVHQLNDGQPVRPLE"
FT   CDS_pept        101815..104865
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="SRM_00092"
FT                   /product="putative AcrB, Cation/multidrug efflux pump"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00092"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23013"
FT                   /db_xref="GOA:D5H4Q8"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q8"
FT                   /protein_id="CBH23013.1"
FT                   /translation="MDIAKAAIENRTLTYVTTLLVVVGGVIAFLNLGRLEDPEFTIKRA
FT                   LVVTQYPGATAHEVEAEVSDPIEEAVQAMGKVKEIKSRSSRGRSTLEVEMKSDVIGDAV
FT                   TQAFDDLRDKVNDAQGRLPPGAGPSVVEDDFGDVYGIFMAITGEGYSKQELKDHAEALK
FT                   RELVQVQGVAKVRLFADRQETIYVEPNRDRLSNLGISVDRIAGRLRTQNTVVDAGRVRV
FT                   GDSHISVRPSGATASLDDLRSILIASQGGRQIFLEDIATVRRGYAAPPRALMRYDGEPA
FT                   IGLGVSTVDGGNVVTMGRAVKARLDELKADRPVGIEYNYINFQAEDVSEAVSGFVWNLV
FT                   TAIAIVIVVLLLAMGWRSGLLMGFVLAVTVLGTFILMYATDVVLQRISLGALIIALGML
FT                   VDNAVVIVDGILTRLKEGRERVEAASEIVEQTKWPLFGATAVAILGFAAIGTSSDSSGE
FT                   FLGSLFLVILYSLSLSWVLSVTLAPLLGVDFLKKPDPDEAVESAHDGPVYTVYRRLLQG
FT                   AINYRWVTVAVITVLMGLSIWGSGFVKQSFFPDSTRPQFLVDVWMPQGTHIRDTEDAVK
FT                   EAEQYVQGLDAVTHVSSVVGQGALRFVLPYSPERPNSSYAQLIVDVDDWRTISSLKDSV
FT                   DARLSAMLPRANVYAFPFVFGPGGGTGRIQARISGPNPDSLRAIAQRVEGIFRAHDNTK
FT                   AVRNDWRNRVEVTRPQVAEDAASALGVTRPDVARAVQRTFEGTRMGVYRRGEDLLPIMM
FT                   RAPSEERARASNMKNAQVWSPVAGAYVPIRQVVSGFETGFEDGIVWRYKRAPTVSVYAD
FT                   PISGTATSVFQQVRPTVEKLSLPRGYDIEWGGQYENSNEANASLFSAVPIFFVLMVLIT
FT                   VALFNALRQPLIIWLTVPLALIGVVAGLLATGAAFGFTALLGFLSLSGLLIKNAVVVID
FT                   EIEIWKQDESLYQAIVGASVVRLRPVMMASITTALGMIPLFTDAFFVAMAVTITSGLLF
FT                   ATVLTMIVVPVLYAILFGVERLPYSER"
FT   CDS_pept        105332..107470
FT                   /transl_table=11
FT                   /locus_tag="SRM_00093"
FT                   /product="sensor/response regulator hybrid"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00093"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23014"
FT                   /db_xref="GOA:D5H4Q9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Q9"
FT                   /protein_id="CBH23014.1"
FT                   /translation="MIPRPVLWGLLAVGLLPHWSGVCSADAAPTDSLQYGAPAPIAQVR
FT                   RDVDGDSIPDRVGDTVVVAGRVAAAPGALPLPEEGVGSLQDGTGGIHVRLPEARALSRG
FT                   DSARVWGVLRHEAGLAQIAGIGYERVEAARRTPDPVPLSVPSAASDRHEGQLASVDGTI
FT                   TARSANRGGEYFVLREDESSDAQLTVFVSNQHTERIRLGRFDEGDRVEVTGIISQYDLS
FT                   YQVLPRGEDDLVHIGQAWTYLRWALLGVGGLGLVSIAVILFLRSAVRRRTQELTRREAE
FT                   LKDRQMKVEALYSATDHLLRAASRTEVAGALIDLVREVLGYRGVSVRFAEDGALKAFDV
FT                   AETTFTFMPERPDFNIEGDSAVAEVYRSGTTLAVEDVEEMEMDDPAAHGDLRSVVVVPI
FT                   GEHGTFAVASPEPGAISGFDTHLIEVLGSYATATLDRLDREKALRAAKEEAERARTEAE
FT                   VARDQAEEAARLKSAFLANMSHEIRTPLTSIIGFAEALGDEVGDGNGNTGRFAGLIERS
FT                   GRRLLDTLDGVLNLSKLEAGQMGLETEPVDLVTKARRAAEELRPQATEKGLGLTVETGR
FT                   PEVWARADAGSVQIVLQNLVSNAIKYTEEGGVHVRVFRENGWAVLEVEDTGIGMDPALA
FT                   DDLFKPFRQASEGLGRAYEGSGVGLAVTQKATEEMGGQVDVETEAGAGSCFTVRLPEAT
FT                   SPEAEVAEGGKTEPIGEA"
FT   CDS_pept        complement(107529..109484)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00094"
FT                   /product="HTR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00094"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23015"
FT                   /db_xref="GOA:D5H4R0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R0"
FT                   /protein_id="CBH23015.1"
FT                   /translation="MPASETQGGPPPDDHTDAEPPPPLPEQSDFADAVLAAMPDPVFVF
FT                   GPQNTLAWGNPPLRQAVGHSAAALRGKSLPELFGKGDAAAVEQALDAVRAGRDTATAEV
FT                   ALLPREGPPRPCTFTARPLSGDVGPPNCVVGIARMAPLSTAQDETLRLERDRLAALYTG
FT                   LPSPVVHYEVQGGVAIARGANVAFEEAFGVSRSEVVGHDLDALLAPDERLSQAETLTRR
FT                   AVEEGSVQAEVIRETNEGRRHFRLNSVLFSDSETPEGYAIYTDITEQKEREQTLRDEQA
FT                   ALRSMYRITADQNAPFDDKVRRLIELGCTYLDLPYGFLTRISDGTQHILQATGDHPLLQ
FT                   PGKSCPLSESYCRTTVEQETLLAVQDAAAAGWTGDPAHEKFGLRTYIGSQILVDGTLYG
FT                   TLCFAASDARPTAFTERERTFVELMSRWASYELEHRRATEQLERQNERLDNFAGLVAHD
FT                   LRNPLNVAKGRLELVEDTEDLSHLSAIDRALARMDEIIEDLLAITWGGQKLSNEDLEYC
FT                   DLASLIASCWERVDVPEAGLVADAPPRVRADANRLQRLLENLFRNAIEHGGEDVTLRIG
FT                   ALDDGFFVEDDGPGIPSDQQEEVLKAGYSSDEEGTGLGLSIVKTIVDAHGWSLALTEGR
FT                   DGGARFEVTGAEVDRE"
FT   CDS_pept        complement(109727..112246)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00095"
FT                   /product="Pyridine nucleotide-disulphide oxidoreductase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00095"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23016"
FT                   /db_xref="GOA:D5H4R1"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R1"
FT                   /protein_id="CBH23016.1"
FT                   /translation="MRMSPLRRSPNTRHRVRTGLKGTSHKLVRVFAHRVGSVTPAGSLR
FT                   PLVWGPLVWGPRTLLPPWPSPYRSVAPMLDALARYANWLHLQWPAGKPEKLPKVDDHFR
FT                   TNVDGVYVVGDLAGVPLLKFSVEGGAQAVRDLLTRGIDPVEPTGADGPYDVVIIGAGAS
FT                   GMAAAREAQKSGLSFCVLESQRRFATIKDFQAGKPIYTYPEAMTPASDLEVTAQVKEAL
FT                   VDELEAQTKDLPVRHATAHRIDPAPEGHEVVTTDGDRIRGQRVIVAIGRSGNFRSLDVP
FT                   GEDKDHVQHRLHDPTRCRGDRALVIGGGDSAAEAATALTEAGADVTLSYRRDEFVRPKE
FT                   ENVERLYERATYHEGEGSLTLKMPTDVEEIREDEVVLSDENGDTETVDADHVFATIGRE
FT                   APLDFFRRSGIELRNDWGEVPDSLQEAVSGLSWLTDLRWDRITAFAAFFFFMVAVYSWK
FT                   DGGWVGQWAQATGFFPFGWSPDTSGTGALDILLTSMQKPGFYYTFAYSALVVVFGVKRI
FT                   RRRKTPYIKVQTLTLMGIQVLPLFILPEFVLPYLGANGLLPTGVLDALFPTSEYAVHGR
FT                   QYWRAYGFILAWPLFIWNVFTTDPLWWWLAICFVQTFVLIPGMIYFWGKGAYCGWICTC
FT                   GALAETLGDQHREKMPHGPGWNKLNLAGQVIMGVAFALLVLRIGGWIWPGSWAAEAYRA
FT                   VLYGGSLGLGYSWVVDILLAGMVGFGVYFWLSGRFWCRFFCPLAAIMHIYHRFSRFRIL
FT                   ADKKKCISCNQCTSVCHQGIDVMAYAQKGEPMDDPECVRCSACVETCPTGVLEFGQVQP
FT                   NTGEVIHRDALEASLTRIQEHENGTAA"
FT   CDS_pept        complement(112339..114048)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00096"
FT                   /product="signal-transducing histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00096"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23017"
FT                   /db_xref="GOA:D5H4R2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R2"
FT                   /protein_id="CBH23017.1"
FT                   /translation="MGSPGREHRPPRSVCGLSCRPARSGAQPDVTRIGCVPAPRRLNTF
FT                   RVVASVVFCHTHESMRRTFTPSGLVIALLGFVLTRYTITFAHAEASTAFVVGGIVPLVL
FT                   GLSLSVCGVALAIGSFETWYVRTIAQWTVLGAGVIGLLIVATVYGGPSSFAEDVRTIGL
FT                   FSNVLIGGSVGGALTGVYAAQNKAAQRKLLNRQNRLVILNRLLHDRVMNAVTVIKGSAP
FT                   LLRDGADTGLESVDAILEKAESIEAVMGSVHDLTEPGAGAERQPVDVPEAVETALQQAR
FT                   ERHPDATFVAQSLPSDLLAYANHRLADVVGQLLKNGAEHAGVEAPRVAVALDTTPDTAT
FT                   ISVSDEGPGLPDKNREALENGTTISERGDPTAGLGLYLVRLFVHTFRGSVHTEVTDAGT
FT                   TVSIALERVSESAEGESAAPADSSLVGVTPARLGATALSGLIAGVVMGAYMHVTTGVVP
FT                   VIGALYGTKSLLVGVLTHEFHSLVFALIYAGLLTLLPRWWRTTWIGTAGVGAAWGAVLW
FT                   LVAGGLVMPIWLNLVGIATPVPNLNPNSLLAHLLWGTVLAVGVQVSRRWFVS"
FT   CDS_pept        114367..115563
FT                   /transl_table=11
FT                   /locus_tag="SRM_00097"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00097"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23018"
FT                   /db_xref="InterPro:IPR021516"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R3"
FT                   /protein_id="CBH23018.1"
FT                   /translation="MAADLASCPMTDSPSVQHRLVFVLGLVGLWIVSVAPGARAQSSLP
FT                   PDAPPALQQFDTAYSKHNIDLSTLMSGGPPKDGIPSVDNPSFVSVGEASNWVAPEEPVI
FT                   LLEHKGTARAYPLQILTHREIVNDRVAGTPVAVTFCPLCYSALVFERTLDGEPVEFGVS
FT                   GLLRNSDLVMYDRKTETLWQQLTGKGIVGDLAGRTLKQLPSQIVSFRQFSTTHPDGAVL
FT                   SRDTGHDRPYGRNPYAGYDDIDNKPFAYRGPTDDRLPPMAKVVAVTIGDRYKAYPHSKT
FT                   EEKHVLHDTVAGRPLAVFHAPGAVSALDAAEIAESKETGSTGVFDRRVDGRTLTFSYVD
FT                   DGRFEDEDTGSTWTVTGKAVDGPLEGTQLDRVQHGDYFAFAWFAFRPDAALYGAGGSS"
FT   CDS_pept        115618..116760
FT                   /transl_table=11
FT                   /locus_tag="SRM_00098"
FT                   /product="Conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00098"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23019"
FT                   /db_xref="InterPro:IPR021516"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R4"
FT                   /protein_id="CBH23019.1"
FT                   /translation="MMSPRSTAWLSVGVLAGFLVLAGCDVGSVSDSGNGNSGFNLDSCT
FT                   IPTDRLVDGGVPRDGIPSLDEFTSGDDRLVEKDASSAGYLEDDNRIIGLLFGDQALAVP
FT                   HNILWHHEIVNVDNWAGQTFAVTYCPLTGTSLAFDRSVIDGAEFGVSGLLFNNNLTMFD
FT                   RRDDESLWPQMNREANCGASVGTDLEMLPVMEMTWGKWKELHPDTKVISSETGFSRNYR
FT                   TSGYPYGDPDPESSYERPNNDNLLFDMPIDDRRPPKERVLGIPNGDGGLAVPFGELDDG
FT                   SEARAVEVTVGGTDMVVLWRADAEGAMAYQPRTQSGQSLSLTVENGRFVDGSGRTWTLD
FT                   GRAQNGSARLEPVQTAYVSFWFAWAADSFQPETRIWDGSE"
FT   CDS_pept        116757..117647
FT                   /transl_table=11
FT                   /locus_tag="SRM_00099"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00099"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23020"
FT                   /db_xref="InterPro:IPR025737"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R5"
FT                   /protein_id="CBH23020.1"
FT                   /translation="MTMIRQSVVGTAVLLLLLTATPSHGQWVEAPGTGWVQLQVAHQRT
FT                   QEGFSKDGTVVPLDELDPDAESITTTARLTGALGLFRGLDAWVDLPLHRQAFNGSGSDL
FT                   LTTGLGDPRVFLRAGPSLLGIPELPVAVALRGGVKLTTGTFENDAETISLSQGQRDWSL
FT                   LLEAGTSLHPVPIYVSGWAGHRWREENEQIARDPGNEWVFNTAVGGSLGRFEWKVAVDG
FT                   LFGRPSIDTRTGFEFAARELVQVIPTVGWSVGPGAVQLGARLPVHGQSTRSDRLPASPT
FT                   VTLGYFLSWDDPLWK"
FT   CDS_pept        117889..120675
FT                   /transl_table=11
FT                   /gene="ppc"
FT                   /locus_tag="SRM_00100"
FT                   /product="Phosphoenolpyruvate carboxylase"
FT                   /function="Forms oxaloacetate, a four-carbon dicarboxylic
FT                   acid source for the tricarboxylic acid cycle"
FT                   /EC_number="4.1.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23021"
FT                   /db_xref="GOA:D5H4R6"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018129"
FT                   /db_xref="InterPro:IPR021135"
FT                   /db_xref="InterPro:IPR022805"
FT                   /db_xref="InterPro:IPR033129"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R6"
FT                   /protein_id="CBH23021.1"
FT                   /translation="MLGHIAEEQSGEALFEHVEGLRALCKAAEQEDAPEKREEAAERIA
FT                   ALDQDTLERLLHVYTTFFHLVNQAEQQEIIRINRERARQSGPSEWPLGPGDGPGADGAE
FT                   PRPQSIDAAVADLKAEGYTADEVVAFFRQLDIQPTLTAHPTEARRRSVLRKEQHIADLL
FT                   STLRRPDATPDERAETLDRLYSQVAFLLGTDEVRAERPTVREEVEQGHYFLHGSIWDTI
FT                   PAIHRDVQQALRRHYDATAELPAFLQYRSWIGSDRDGNPNVTADVTRWTVARQRRTTLE
FT                   HYLDEIDELRDDLSISTRQLTVSDALEASLEADAEEIALPDDVRRQYQREPYRLKLCYI
FT                   EERLRGLLDRIDATDVAAMAGAYTADDLLADLDLIAESLQGHGFEDAAQSGQLHRLRSL
FT                   VKTFGFHLAALDVRQHSGVHEDTVAALLDAGDVVDDYGALSEEEKLEVLSRELQNPRPL
FT                   VSRHADLPADAAELMEVFGVLRAMHAVDPDIVGSYVVSMTHTVSDLLEPMLLAKEAGLG
FT                   AVVDGSYRCPLDVVPLFETIEDLDAADDRMKTLFTHPVYAAQLEGRDGFQEIMLGYSDS
FT                   NKDGGYWMANWALHKAIHALGVVCDEHDVDLRLFHGRGGTVGRGGGHTSQAIRALPPVV
FT                   HNGRIRMTEQGEIISFRYALPDIARRHVEQIVNATLTATARAQNTPAPENPLLADKVSM
FT                   ESDVVALMDRLAEEGMSAYRAFIDDPEGWQWYTAATPIEHISRLPIASRPVSRASAGEQ
FT                   VEFENLRAIPWVFAWTQTRYIAPGWYGTGQGLATLLEDEPDARDTLRDLYENWPFFRTV
FT                   LDSAQREMARARLPIAERYDALAEVETSFHAPIVDDYERAESAILEITDQAALFDGNPV
FT                   LKKSIELRNPYTDVLNLIQIELLKRYRASTDDAEQETLREAIFLSINGVAAAMQSTG"
FT   CDS_pept        complement(121373..124693)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00101"
FT                   /product="sensory transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00101"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23022"
FT                   /db_xref="GOA:D5H4R7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R7"
FT                   /protein_id="CBH23022.1"
FT                   /translation="MESDEPFSAPFSRSSFSEPAGWGPDTNAPAAVYADPGADVDPERS
FT                   FGRVLDLATRLFEAPMGIGTLHANGQPRVVAADGLRDAGLQDEGDGIKARLCTRTLRSP
FT                   GATVVTNATDDDRLADHPWVAGDPGIRFYAGTPLVGPQGHRIGSLCVLDTEAQSPPPAD
FT                   VDRLEGLAEMIVNELELHRQADAWDRARQQYEAIFNHTYQFTGLLTPDGILVEANDTAL
FT                   EFGGLEREEVVGTPFWDTHWWQTGPETQQKLRAAVEQAAEGEFVQYEADVQGADETRTI
FT                   DFSIRPVTDGDGSVTMLIPEGRDITDRKRQERQLRKEKQKTEEALQARDALLGSITENI
FT                   SEGIYRSTPDDGLVYANEALADMLRHRSVDALLEADPVHFYADPDQRAQVIQQSNRNDG
FT                   ITGVEVEFRRTDGTTFTGLLSATTVRGPDGAVQYYDGAVTEITEQKRQEQQLRRSRERW
FT                   RRLVEKLEDGLHISVDGEIRYINPAGAAIVGAETPEDIVGRSLQEFVVSERTQQDVVED
FT                   RLRTVYQERASTPPRELEIIGLDGARRVIESYTVPIEFDGEQAGQTVFRDITEQKEMEQ
FT                   ALREREARLRSITENVSDGIYRSTPNEGLVYANRAFADIFGYESVEAILQIDPIELYAN
FT                   PDARSENRRITKEQDHIDAAEAEFRRKDGSTFTGLVSATTVRDENGEVLYYDGAITDIT
FT                   EQKEQARTLRDRQQKLESLYTATRHLLRAETPDAVATRIQDVLQDVFDYPLAGVDFAED
FT                   GRLVPVEGAIASPGQMPTIQSLSAGGDSIGARAYRSGETVVVQNVEALDNDVAYGGLRS
FT                   VACAPMGTHGVVLMGQTSHDAFDAFNLRLVEVLVTYAAVVLDRLGREQKLREAKETAEQ
FT                   VNEMKSAFLANMSHEIRTPLTSIIGFAEAIGDEVSGGDPTVSRFAGLIEKGGRRLLETL
FT                   DAVLNLSKLEAEEMELALAPLNVAEQAADTGALFEQQAEKAGIDLRVDVPSGPLWARAD
FT                   EGALRIVLRNLVSNAVKYTGDGGRVWIRARRAEDQAVLEVEDTGQGMDPAAVSTLFEAF
FT                   KQASEGKGREYEGTGLGLAVTKQAVDQMEGTIDVDTEKGVGSRFVVRLPRPAPDETDA"
FT   CDS_pept        complement(124791..125036)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00102"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00102"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23023"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R8"
FT                   /protein_id="CBH23023.1"
FT                   /translation="MGEFRAPHATGPLGDGVEKGQPRTARSNAERSAAPPTRTTTGRLV
FT                   RAGRFSNAPPAGASTGPEHARGTTFAFLKGKNPSFF"
FT   CDS_pept        125269..126288
FT                   /transl_table=11
FT                   /locus_tag="SRM_00103"
FT                   /product="Conserved hypothetical protein, probable TolB
FT                   periplasmic receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00103"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23024"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4R9"
FT                   /protein_id="CBH23024.1"
FT                   /translation="MRATGCWFVSGLVTFKSENKTRRLVSATHNSRPSMSRVRSWILVV
FT                   GVLVGAVGGCAEPQDGRGPATADSIAATAPGTDVVGAPLDASGDTLRMGRPTPVTTRPG
FT                   YDNQPAFLPDGSGLVWTAIHDGQADVYRKIEDEGGPAPVTDTPESEFSPTPRPGGALTL
FT                   VRVEADGRQRLWRYRADGTPDAPVLPDADSVGYHAWLDSSRVALFVLGAPPTLHVANVK
FT                   SGTDTVVARRIGRSLQSVPGRADVSFVQVGPDSSVAIHRLDGASLTTRRLTEAPTNAPT
FT                   GDHAWTPGGHLLMTTEDSLVAWRRGRADWRPVAALDTMDVSRLAVSPSGDRLAMVVAE"
FT   CDS_pept        126530..127138
FT                   /transl_table=11
FT                   /gene="lemA"
FT                   /locus_tag="SRM_00104"
FT                   /product="LemA protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00104"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23025"
FT                   /db_xref="InterPro:IPR007156"
FT                   /db_xref="InterPro:IPR023353"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S0"
FT                   /protein_id="CBH23025.1"
FT                   /translation="MRSKGAITLVVLVVVLGFVGCGATSSYNSLVQSDEQVREAWSNLQ
FT                   ATYQRRADLIPNLVETVQGAADFEQETLQSVTEARAKATSVQVSAEDLDNPQRLRQFQE
FT                   AQSALGKSLGRLLAVSENYPKLQATQSFSDLQAQLEGTENRITVARRDYNSTVRRYNTQ
FT                   VRSFPTVVFASLMGFEPKTPFEAEAGAEEAPDVDFGSDS"
FT   CDS_pept        127198..128025
FT                   /transl_table=11
FT                   /locus_tag="SRM_00105"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing DUF477"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00105"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23026"
FT                   /db_xref="GOA:D5H4S1"
FT                   /db_xref="InterPro:IPR007621"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S1"
FT                   /protein_id="CBH23026.1"
FT                   /translation="MQRSAVLSRFRSVLLLGAALSLFAAALAPTAAAQRYDFPPKPSGP
FT                   VLDQGNMLSGGEERALARKLAAYEDTSSTAVVVVTLSSLDGAPVDDYAISLGRDWGVGQ
FT                   EGKDNGVVVLVSKNDRKMFIATGYGVEGALPDAIANRIVERVITPAFRNGDFYAGLDRG
FT                   TDAIIRATAGEYTATEEAVASSSDDGGVSTTLIYIFLIFAYFIGSSLWRGGGGNKKGAK
FT                   TSTRRRGDLPIFIWGGGGSHGGGGFGGGGGVGGGGFGGFGGGSFGGGGAGGSW"
FT   CDS_pept        128043..128495
FT                   /transl_table=11
FT                   /locus_tag="SRM_00106"
FT                   /product="Conserved hypothetical protein containing TPR
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00106"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23027"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S2"
FT                   /protein_id="CBH23027.1"
FT                   /translation="MTSFPHASLFTPHSSRITPSLHLPVRLGNATFDTRHRTALTMSAD
FT                   RLEQLKTFHEEDPEDPFTRYALAQEHLKHDNASRALALFEELVETDPDYVGTYYHLGKL
FT                   YERLDRTDDAIDTYAQGIEVAREEGTQKDLSELQDAKLKAEGVGFD"
FT   CDS_pept        128511..129587
FT                   /transl_table=11
FT                   /gene="rlpA"
FT                   /locus_tag="SRM_00107"
FT                   /product="Rare lipoprotein A"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00107"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23028"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S3"
FT                   /protein_id="CBH23028.1"
FT                   /translation="MRSAVLMLGVLLTLAGTAPAGHAQAPSDSTYTVRSGDTLYSIAQR
FT                   AGVSVAALQRWNDLEGTALQIGQTLRLRPPRPEDRTEASADTTEARPDSTAADSPLPDT
FT                   AVSDTAVSDTVVSDTTVSDTVAVGTSDPDSPAVDSVTAPPVYGRHVAADGDSFVTLALR
FT                   LGTTADTLSALNDRTAAPLAAGETLRLPKRFAPPAHVVASGETLYSIAGEYGVSARALR
FT                   TANGLDTTALEPGRRLRLPGREAPEVPPPGDWAAPDSTGAVAVYPDAFAGRLTASGTPY
FT                   DPDALVVSHPSLPYNSVVLLSRPDVGRHTFARVLDRGPIEAGTLLDVSAAVADRLGLDA
FT                   DATPTVELRTVWIEGRAE"
FT   CDS_pept        129676..130497
FT                   /transl_table=11
FT                   /locus_tag="SRM_00108"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing CAAX amino terminal protease domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00108"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23029"
FT                   /db_xref="GOA:D5H4S4"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S4"
FT                   /protein_id="CBH23029.1"
FT                   /translation="MLIYAIRTTQYEMDPPDRRAVPSRNCPPSSPRSSPMPSWHAYHRA
FT                   TRSATYGFLSALPLFVLYETMIVLVNLDATRPVRVEAGVWIKELLMMTGASGGLGLALL
FT                   VVGGGGAAYLLDRHRDIPLRSRYFVGLVGESAAYAVGVALVVSSAVGALFAAIPPADGV
FT                   LWTQLALSIGAGLYEELVFRVLLVGGLFLLFRALMETSTRVYLVAALLGAALFSGAHYV
FT                   GPLGDPFALPSFAFRFLFGLALNALFLARGFGVAAWTHALYDVMVVTGMLG"
FT   CDS_pept        130683..131513
FT                   /transl_table=11
FT                   /gene="htpX"
FT                   /locus_tag="SRM_00109"
FT                   /product="Probable protease htpX homolog"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00109"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23030"
FT                   /db_xref="GOA:D5H4S5"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S5"
FT                   /protein_id="CBH23030.1"
FT                   /translation="MNTFRTTALMAVMIVLFALIGQALGGTGGMLLAFLIAVGMNGVSY
FT                   WYSSSIVLRMYGAEEVSRAEAPELHDLVDRLRRRADLPMPKVCIIPQDQPNAFATGRNP
FT                   DNAVVAVTKGIMDVLDRDELAGVIAHELAHIKNRDMLTSTVAATLAGAITMLSRFALFF
FT                   GGRDNNFLVSLLMMILAPMAAMLIQSAISRSREYAADREGAEIAKNPLGLASALRSMER
FT                   AAEHRPMPANQTTSHMFIVNPFSGGLSGIKRLFSTHPPTEERIARLEEMAGRAQ"
FT   CDS_pept        131518..132408
FT                   /transl_table=11
FT                   /gene="sco1"
FT                   /locus_tag="SRM_00110"
FT                   /product="Protein sco1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23031"
FT                   /db_xref="GOA:D5H4S6"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR021647"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S6"
FT                   /protein_id="CBH23031.1"
FT                   /translation="MIQNRLAVFGGGLFAFFLAAGALLLYLFGTDTYTVDGRVAGIQNE
FT                   GRTLVVEHEKIPGYMPPMIMPLPVADSSMTAPLEKGDAVQFRLAVGDSASIIALRTLPD
FT                   TAVARNPARTTTPIKSAADGGAQMLQQGDRVPAVLTLTNQAGESLQIGDYRGQTLVLTF
FT                   IYTRCPLPTYCPLMSKQFAALQPQLRERYGEEAQLLSISFDPAYDTPQVLREYASKYTD
FT                   RLDTWTFATGDSSQVERATGLFGVHAQKTGSEEITHNLTTALIGPEGHVRRLWRGNDWT
FT                   PEDVRQAVAQVAEAS"
FT   CDS_pept        132545..133153
FT                   /transl_table=11
FT                   /locus_tag="SRM_00111"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00111"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23032"
FT                   /db_xref="GOA:D5H4S7"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S7"
FT                   /protein_id="CBH23032.1"
FT                   /translation="MVAATRIVFWVALVAAAGLGVTLIATLGVKTISIWPPPGRQAWQY
FT                   RLVWTLFAVACVGFLVVGGIDAGSLGLARWVGEAGTIIFGSMLVVGGTALASYAMGRLG
FT                   LRGCLGLNAELVTDGPFAVSRNPGYVGDLILIAGYVLLTDSGLAGIVGGIGAVWFLLAP
FT                   LAEEPWLEEQYGESYRRYRQRCPRFLGGASVRLLSSETA"
FT   CDS_pept        133178..135655
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="SRM_00112"
FT                   /product="Cadmium-exporting ATPase"
FT                   /function="Involved in export of lead, cadmium, zinc and
FT                   mercury."
FT                   /EC_number="3.6.3.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00112"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23033"
FT                   /db_xref="GOA:D5H4S8"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S8"
FT                   /protein_id="CBH23033.1"
FT                   /translation="MHSPSSSAVAEQVQLDLPVALPHVPDAMDACVDRLTDRLRGQPGV
FT                   SRAHVVPATNGAPDRLCVHYDPDTIARSRIRRRVRSVGADLTDRYGHLVWAVEGISRPR
FT                   RARTIAKRLRQINGVVEAEARAAEQVRVEYDRSSTSAEEIRDVLRSMNVRPQGDRLAAQ
FT                   GLAAEAGRGDREEEHDHDHGGIFGEKTELIVAVAAGVCVALGVGLSVVGGTPGWVPWGL
FT                   YVGAYALGGYHTVREAVETLRAGEFEVDFLMLVAAGGAAVLGKWLEGAFLLFLFSLGHA
FT                   LEHYAMRRARRAIESLADLAPDTALVRRDGEEREVSVDQLRVGDTVIVKPNERIPADGF
FT                   VTQGESAVNQAPVTGESVPVDKTPVETPAAARDPTTLDPAHRVYAGTINGSGVLEVRVT
FT                   KRAGESTLSRVVQMVTEAEAEKSPTERFTDRFERVFVPAVLGLVGLLLFAWVPLGEPVA
FT                   DSFYRAMAVLVAASPCALAIATPSAVLSALARAGQGGVLVKGGGPLEHLGRLGAVAFDK
FT                   TGTLTEGAPRVTDVRPHNGTAEEDLLRAAVAAERLSDHPLAEAVVQYGDEHLEGRPPED
FT                   AAEMRDITGRGIRASVGGRPVHVGNAALFDEVGGPPLPDPLRDEVEALEADGRTTMIVR
FT                   RGDTYLGVVGLADAPRPEAAGVVERLRRAGIRRMVMLSGDNQRVVDAAAERLGLDEARG
FT                   DLLPSDKVDTVRALRQDEDVAMVGDGVNDAPAMANATVGVAMGAAGSDAALETADVALM
FT                   ADDLSQLPFAVGLSRQTRRVITQNLWIALGMVAVLVPATIAGLSIGPAVVLHEGSTLLV
FT                   VGNALRLLRYTPS"
FT   CDS_pept        135873..140051
FT                   /transl_table=11
FT                   /locus_tag="SRM_00113"
FT                   /product="two-component system sensor histidine
FT                   kinase/response regulator, hybrid ('one co"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00113"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23034"
FT                   /db_xref="GOA:D5H4S9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011110"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4S9"
FT                   /protein_id="CBH23034.1"
FT                   /translation="MDVSRERGVRSPFGQLLAGRMRQTLLLLVLGAGAWVGIANADSGP
FT                   DRWSTLYDGRSDTRTMALRSPAIREQSPGSPTDPADLYGRTSEYIPKSWTVEDGLPLNM
FT                   VWALEQSRDGTLWVGTAEGLAAFDGSGFTTYDGAETEGLAGNKIRALMEDRAGRLWIGT
FT                   PTGLSIREGDEFRQIERQPHIRAFGKAPTGRVWMIGPSGLYRATSDGVQRVPLPDTVGP
FT                   IGPYAHVAPGPSDSVWVSTGSDLLLYRDGRFRRPEVHPKGDVQALDVGADGRLWIATPE
FT                   EVMAVGPDTTARYHHTGGVVRSLRTDGGGAWVGTSNTGLLRISGGTIRQAYAASVPNGL
FT                   VHALERDEAGQWWVGTGRSGVVRLRPRLVWPIGKEMGTRLSAQGVFADGRGSVWVGSTS
FT                   QGLCAYADTTRTCYGPAEGLPAAQVHSIQDDGTGALWVGTKDGIARRRDQQFETVRRPN
FT                   GRPFRDWAALHGDAAGAVWIASREGLFRHRDDMIERVLPADRMPSLVLSIHRGQEGAVW
FT                   IATRARGLARYEEGTLRWFDRDDGVPYKNVREIYETDDGTIWIGTYGGGIARFEGEGFV
FT                   PVTTEDGLPSGTIHAIREAPRGTFWMTSNDGIFRVPRAQVEAVADGRRDRLYAQMLGPD
FT                   DGMPARECNGAMHPAMTQDRRGRLWFSTVKGVAVVDPYAPALAVPNSIPIRVTGLRTDG
FT                   TAQPLDSLELAPATYRVALDFSATSLRHADDLSFRYRLDGEAWTPAHGRRTAEFTSLDA
FT                   GTHRFEMQATIDGETWYTLDAPLRFTVLPHFYETWWFKLLVGVGLLGLMLGAYRWRTYR
FT                   LRKRQETLEAAVETRTEELARQKEKTERQAERLQELDEAKNRFFAHVSHEFRTPLSLIL
FT                   SPLRDALQRATDGAASLSENQLRRMTTNAERLQRLIGQLLDLATLEAGGMELDRRPGDL
FT                   AALVERTAEAFRSKAEQKGIALKTEMPPERVEMRFDPEKVETIVSNLVGNAVKFTPEGG
FT                   RVVLRLRLTEDTPSGPAADEAPAEGGVRIAVADTGPGIDPAEQARIFDQFERSGTNSTE
FT                   AHEGTGLGLALTSELVELHGGTIEVESTPGAGAEFIVHLPRMPVDTSPNGEADRWAPSE
FT                   LPDRAPILDEARSRTNGDGAAGPPPEETPAETDAATVLVVEDNAGMRAYLREQLSGRWT
FT                   VRTAADGEEGWAAVQDEAPDLVLSDVMMPTVNGTELCEQIKSAEALRHTPVLLLTARAG
FT                   TDAEVEGLKTGADDYVTKPFDAEELRQRIANHLAARDHLRERHRSEVRVEPIAAVVDEE
FT                   DLPFVEEVIEAVRERLSDPGLTVSQIADAVALSRRQLTRRLKDAVGQTPAAFLRERRIE
FT                   RAKELLAEAPETIAEVAYAVGFRSPSSFSKTFREQVGHTPSEYVDQEEA"
FT   CDS_pept        140427..141191
FT                   /transl_table=11
FT                   /locus_tag="SRM_00114"
FT                   /product="Conserved hypothetical protein containing
FT                   helix-turn-helix motif"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00114"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23035"
FT                   /db_xref="GOA:D5H4T0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T0"
FT                   /protein_id="CBH23035.1"
FT                   /translation="MSQASTVVLIVTDPAGFQAALDEDTSYRVLDPDRLEDKTLTDHSA
FT                   TDGPSDPENGPDLVISPLRPADRALALYRRIQSDPQIPAVPALLLAPTASREPSEADLP
FT                   TESVFDLPGVQATTREGLRALVAHRLAVCKPAAGPPLDPDTSFRERVEAVVERNLDVPS
FT                   FAVEELAGALGMSRRHLTRRMKEAFGTAPAAYIRARRLDRAKTLLAGAPPSVAAVAEAV
FT                   GFQSASAFTKAFRRATGQVPTDYVREHDDASS"
FT   CDS_pept        141410..142378
FT                   /transl_table=11
FT                   /gene="nlpC"
FT                   /locus_tag="SRM_00115"
FT                   /product="Probable lipoprotein nlpC homolog [Precursor]"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00115"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23036"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T1"
FT                   /protein_id="CBH23036.1"
FT                   /translation="MLAPRSSWSAVLVSLGTLVLVLGLATGCSSSENTRKAPTPEPESP
FT                   PSQPDRTDREAEDSTDADRRSEAQPEPVKVLRVPRVRRRIEAAAEDWMGVPYEWSGESK
FT                   QGIDCSALVQTLYQEAFNWRLPRVTELQVQAGSTVTRQQLRPGDLVFFQPGGEGNHVGV
FT                   YAGDREFIHASTSEGVTRTRLDDYWQRHYWTSRRVLGPSKVPDTLASQLVAYRYPDATG
FT                   RASDRPVLADRDERGQDADPLPPADDEVSPVPDTTIIATDTEEPPAPGETDDQIRITSR
FT                   SDTTALPSCADPDVQCGTRGGEGAFGDTTFASPDTTERIGW"
FT   CDS_pept        142393..143118
FT                   /transl_table=11
FT                   /locus_tag="SRM_00116"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00116"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23037"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T2"
FT                   /protein_id="CBH23037.1"
FT                   /translation="MQSAGPARDSFARFLPSLALPSLKNYRVMTRSVRSLGLPLALALL
FT                   LLGGTVVPSQAQIGVSAGLNFEEAGDIKNAAGNTDAALSTATGYHFGLSFEFGTDRFRL
FT                   RPGILFRNVGTYDLSPDAGAQDATREFDVSVIEIPLDLRMKALPIPYVNPYIMAGPMVA
FT                   LPRSEGDFSDATRDWSLSGNVGAGLSLSISSVKVQPEVRYQFGLTNYISDSFTVGSETI
FT                   NPADSPEFSAFSARLTFMF"
FT   CDS_pept        complement(143137..143901)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00117"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00117"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23038"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T3"
FT                   /protein_id="CBH23038.1"
FT                   /translation="MLVSVQANKSSAIVESFTADGEAPIVLTSSAPSIYFRLHRPRRAA
FT                   HLVSGPSPRSMDALDSPFRSAIAGLLIVALPLVLASGCGGNPDQNPPERDTSETGDSPD
FT                   SLSQADSLARALASRYLDYSYQGASLRSTHPLNDSLFALTAGSSADGPVVLVDTFSLAP
FT                   GAVTHRDSAQAVRAEVPHARQISKAWRLSDPSATRPFTVRIRNGEVTQAPRLVGWPALQ
FT                   RHIRRVEPDSGDAIVERLRTEWANTTGTRPAV"
FT   CDS_pept        143916..144416
FT                   /transl_table=11
FT                   /locus_tag="SRM_00118"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00118"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23039"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T4"
FT                   /protein_id="CBH23039.1"
FT                   /translation="MIRTLRTFALLSIFALLLSAPAQGQSLRYGTGLQVMGSTAVASVS
FT                   PGFHFRTTLPITQDLSLGGGLGLAGFVFEGQSNAVYAVDPEVSLIVTIPTPSRSATYLL
FT                   GGGGYHVPFGNDPPASGPSFHLGLGRIWALQETTLFLEFTSALYVRDSSAGGLFPIRGG
FT                   VIF"
FT   CDS_pept        144984..145445
FT                   /transl_table=11
FT                   /gene="bor"
FT                   /locus_tag="SRM_00119"
FT                   /product="probable Bor lipoprotein [Precursor]"
FT                   /function="Not known"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00119"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23040"
FT                   /db_xref="InterPro:IPR010438"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T5"
FT                   /protein_id="CBH23040.1"
FT                   /translation="MRTTTAHSMSRIATILVIPIVAFALSGCYSAQVTTDKQPSGQVIE
FT                   KPWATGFIAGLATPGAQVDAAQQCSNGVAKVETQVSFLNQLATFVTLNLYSPMSVTVTC
FT                   AAGGSMSSLMPAPDFTVPEEADDATAHDVFRAAAQQSAQAAAPVRVKVD"
FT   CDS_pept        145574..146026
FT                   /transl_table=11
FT                   /locus_tag="SRM_00120"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23041"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T6"
FT                   /protein_id="CBH23041.1"
FT                   /translation="MERFYRLLPLALLFILPLLLLGCDSSGSNGGDNPLDGDLSYEVDG
FT                   SAQVSITESFFYSTGDGPCQSTQSNVSSSLPIEVDLEPEGVNCDGVSPSEFDGVRVTVS
FT                   QLTGPMDVTLRLLSDGDVVTEATEPESFGGAEAWIVEAGEIPDLTQ"
FT   CDS_pept        146033..152641
FT                   /transl_table=11
FT                   /locus_tag="SRM_00121"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00121"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23042"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T7"
FT                   /protein_id="CBH23042.1"
FT                   /translation="MASPSSLCSVAQMPMGAGATSVPAPDSPHSLRTSLLRYAMPFVTL
FT                   RFSTITRRFASLLNGLAWLRVGTALLLGLAMLGMSTEPVAAQSITSFQPESGNPGTTVR
FT                   IYGSGFDSTPSNNEVKIGGTSATVTAATPTQLTVEVPTGVTGIAEIDVTVGGSTVTAGR
FT                   RFVALKASQGARDYTFATHNFAKTQPGAVAWADFDQDGDQDIVIAGTNRDDKSNPHTQL
FT                   YENTSSGFLERASGIVNVGDPGATLEWGDFDQDGDQDLFVAGKNENLDDSYVAQIYENE
FT                   GGGSFQAVGADLTGVAEAGAAWGDYDNDGDLDLVVTGEKSNGNPLTILYENEGGGTFTP
FT                   AGAGLTNVLASSADWGDVNNDGRLDLVVTGRNSNFDASTTVYWNRDDGTFQSFQTDVVD
FT                   VRGNGEAEFGDYDQDGNLDLAVAGRGNGYNSGIYQGDGTGNFTRINADILDVREGPTVE
FT                   WGDMEGDGDLDLLIAGAWGESRRRETVLYRNVGDTSFVAAEAGLPGVQDADAEWGDMNG
FT                   DGVLDLALLGIDSENNRVTTVYRSDGDGSPVTSPNFNAQGGVNEVVAKWTESPSEDEDV
FT                   TKYNVYRLTSEFPSKDPSGLTPIATVETPATSYTDGSVTAGTEYYYRVTAVDSDGLESQ
FT                   LSDRGLATPRASDLTITSFDTRSGIRGMTLKVHGNGFDTTPSNNSVSIGGTSAPVTAAT
FT                   STELTVEVPAGVTGPAPLSVTVSGVTVTAGRRFLALKATQGARAYTATGGNLVPTQPGA
FT                   IAWADFDQDGDQDIVVAGRDRVATSPKNPPKTRLYENTSSGFFEVGAGLVNVGTKDDFI
FT                   ASPTTFVKWGDFDQDGDPDLFIGGHNDRLPNKTYVSRIYENEGGGEFQEVGADLTPVAN
FT                   GAADWGDYDNDGDLDLIVTGRREGDDAAQTTLYRNDGAGEFTPVDAGLTDVWKSSVDWG
FT                   DVDNDGRLDLVITGQANNFNQSTTIYRNEGGGSFQSLQTSVVDVGGQGAAEFGDYDEDG
FT                   DLDLAIAGNPSDSKRSGAIYQGDGTGTFTKLNVGILDVRGDATVAWGDMEGDGDLDLLV
FT                   AGSDADGGSIKTVLYRNVGDTSFVDTGANLPDLRRVDADWGDTNGDGVLDLALLGLGNN
FT                   GNDVTTIYRSDGDGSPVVASDLGVASELRDVDLTWTASPSEDGDVVGYNVYRDTAPIDS
FT                   SAGPSGMTPVATVDTPATSYTDASAETGTQYHYRVAALDSSDLESGFTAEVTATPIQPL
FT                   VFSGFTPESGAPDTSVTIYGGGFSTTASENTVTFGSATATVTNATQNSLAVTVPAGVVG
FT                   PTTITVEKSGESVTAARRFTALQARTTVRSLTGTDVGLDGLRNGSVALGDLNGDNMIDV
FT                   AMVGEGAGGTPTTRLYENNGNGTYTAMNAGLTGVTDGSVALGDLNGDNRLDVVIAGEKD
FT                   DGTPVTKLYRNDGGGSFTAMNAGLPGLRSGSVALGDLNGNNMIDVAMVGEGAGGTPTTR
FT                   LYSNDGGGSFTAMNAGLTDLTNGSVALGDLNGDNRLDVAVLGEQADGTPTTRLYQNDGG
FT                   GSFSALSSLTGLTSGSIALGDLNGDNMLDVATVGEESGGTPVTRLYSNEGSDSFSALNA
FT                   GLTGVSDGAVALGDLNGNNRIDLAIAGTDADGNGVLDAYRNTPEGWTAVGPGPINVVPQ
FT                   RGGVAFGDAEGDGDLDLVAVGNGVGSESTPGAGVFENVYPTPSGVTASAGTGEAALDWQ
FT                   KTTGSQLATYRLYRSTAPIDSLGDPSGLTPFDSVSAGTTSYTDADLDEGQTYYYRVTAV
FT                   AETGEGSPLSAQNYAFLYPGSVTADVTRSFDDASSTEDYRLVALPGQVDRPLESTLDGE
FT                   AGTEWQAYWDDGSDSDFLRRFDGSEAFTLERGRGFWLTSQSDWTVEDSLETVDLKNDTS
FT                   TTVPLNSGWTIISNPLGKSVDWALVERANGGDLQPLWEFGGTFTQAQSFASASTGTAYY
FT                   FFNDTGKDSLTVPYPGAPQFREVPKTGQAENAMVALSATSARGDAPASTVRVGIAETED
FT                   ARQSVVAPPGRFAETSLRIEAPGEADSKRAGTLMAERRPRGDEPGQTFRLRLTHRADGP
FT                   LQLTAEHLGAIDGRAVALLHRSAGKTYDLREEETVEIEPEAETTELKVAIGTDSYVKDQ
FT                   TDKVLPDEVTLTSYPNPARQQGTVEYALPEKTEVTLRLYDVLGREVATIAQGRKTAGRH
FT                   RVQLEVGRLASGVYFGRLQVGDQTLTQKITVVR"
FT   CDS_pept        152801..153511
FT                   /transl_table=11
FT                   /locus_tag="SRM_00122"
FT                   /product="cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00122"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23043"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T8"
FT                   /protein_id="CBH23043.1"
FT                   /translation="MHLSTRTTTWTRALSTALTTLLTAALMTFAAGCGGAGANGEGDGD
FT                   GDQTVVPAAPTGLEATPTDGEVSLSWDAPDDAESYNVYRATESGVETTDPVAEGRTETS
FT                   YADTDVENGTTYFYVVTAVADEEGDPSSETEGTPFAAPSALAGTSEDSQIQLDWSGGAG
FT                   ADAYNVYRSERSTDGASGDPLASGVSSASYTDESAENGTTYYYRVTSVNPEDAESNASN
FT                   EVEKTPFDDPPDRP"
FT   CDS_pept        153709..154170
FT                   /transl_table=11
FT                   /locus_tag="SRM_00123"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00123"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4T9"
FT                   /protein_id="CBH23044.1"
FT                   /translation="MTRSESLRLLHVVSLSLLVTTGLLAVGCDSGGSNGGGGNLSGAVT
FT                   ATVDGGEAAGALAVNFTYTTGDGACSEVAFTEDFDVPGDREFDPEVISVRCDADANEWD
FT                   EVEVTFNPNDSAGGLTLTLTSGGGEIASASSPTDNGNLVATAGSVNDGS"
FT   CDS_pept        154235..155065
FT                   /transl_table=11
FT                   /locus_tag="SRM_00124"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00124"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23045"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U0"
FT                   /protein_id="CBH23045.1"
FT                   /translation="MISGFLNTRAFTCCCTALVAVLLLAGCGSSKSSMDVSGVQEAEQA
FT                   AVPIITVDQYIDMSDLQDGGSVASGEGGGGLVQRILDSESFDLSPMADLLRERTYGTYS
FT                   ERLPTRVMSEEEVIQADRYKNFTLLDEESRDDRMQRVNRLEVPDGYKQYNVGQGSVFGD
FT                   RQQQMFGAVPETADAILLVSADYEMVEDNPFWYWFLPVSPDRAYIEATVRMEMLDREGN
FT                   EIMEIVQAARSNNHVNTVGGITAEPGKIQPLCTEATEKAVEAIDTATKQELTGT"
FT   CDS_pept        155218..156693
FT                   /transl_table=11
FT                   /locus_tag="SRM_00125"
FT                   /product="conserved hypothetical protein containing
FT                   SCP-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00125"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23046"
FT                   /db_xref="GOA:D5H4U1"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U1"
FT                   /protein_id="CBH23046.1"
FT                   /translation="MLSENNLTPLRKFSKRHAAVPRLALLLLPDRGSISPLVRRAGFLL
FT                   VVLMLPVALISGCSGGGVLTEGGWVFEGDDVIRVQPRRAQTQEEALGRVVRTIEQSPFK
FT                   LDTLSRTSGYARTRAQPLNGTSDRADAPVVRLNVVVTDSATVEVAGQVTALQSPDGEPS
FT                   PSREWARVAWRQGVQTGATPWGVMQDFAQLIGNIQGYEEDPRGLDSFACGGRRCEQGHV
FT                   CQHNVCRDEKWQPTVASDAQPPSADEHATAGTNRPVINQAIIEYSNRERTNRGLAPLTP
FT                   DTTLTRIACRHNQDMIADGYFDHEDSDGREPSDRVNREHRRLIGTVGENIRVGGAVEEG
FT                   SSRRDRREIGKASVEGWMDSPGHRRNILKTRYTHIGACYTDHDRGRGTQLFATVYAYLD
FT                   QPLPRTMTPGDSLSTSVTPTKVPGEAIRYVFVSPDETDQKTLGRAFDEEAALPLDGTLH
FT                   VPKQPGRYELRVFFQIEDGVTFRSGPHVEIGER"
FT   CDS_pept        156840..157217
FT                   /transl_table=11
FT                   /gene="arsR"
FT                   /locus_tag="SRM_00126"
FT                   /product="Bacterial regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00126"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23047"
FT                   /db_xref="GOA:D5H4U2"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U2"
FT                   /protein_id="CBH23047.1"
FT                   /translation="MASDVASEESADAHDGTCGTEAALSASLPTAAVTDATVRLLKGFA
FT                   DQTRLRILCLLRDREVCVHDIVEALDMSQSAISHQLRVLRDARLVSHRREGRHVYYRLA
FT                   DDHVREMLENALSHGAEPDSQ"
FT   CDS_pept        complement(157265..158962)
FT                   /transl_table=11
FT                   /gene="hyuB"
FT                   /locus_tag="SRM_00127"
FT                   /product="N-methylhydantoinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.14"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00127"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23048"
FT                   /db_xref="GOA:D5H4U3"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U3"
FT                   /protein_id="CBH23048.1"
FT                   /translation="MERAEADHVPAPQPRRGAFHAYRSICMPDADPILLELYRHRFEGV
FT                   ADEMGVTLRRTSHSPNIKERLDFSCAVFDGGGALVAQAAHIPVHLGAMPASVDAARAAV
FT                   DTWAEGDVVILNDPYAGGTHLPDVTMVSPVFVGTADAPSFFVASRAHHADVGGMTPGSL
FT                   PLATELVQEGTIIPPVKLVDGGTRNDALLHTLLRNVRTPEERRGDLSAQRAAHTVGAER
FT                   LQALAEAHGANEVTTYARHLQAYSERRTRAALSDWPAGTYAFADDVEVGDADPATIRVA
FT                   ATVQGDTITFDFDGTGDAVDGNLNAVLPITKSACYYVVQGLTRGDIPGNAGSLAPVSVT
FT                   APEGCLVNAETPHAVAGGNVETSQRIVDTVLGALAQALPDRVPAAGQGTMNNLTLGGTR
FT                   PERTEDIASGLRPGGSPFAYYETIGGGMGAHADGDGLSGVHVHMTNTLNTPVEALEQTY
FT                   PFRIVAYRLRPGSGGAGRFRGGDGLVRVYELLVPTTATMLSTRRNRGPWGRNGGKPGAP
FT                   GRTVLIHPDGREEELPAHVSRTLPAGSRVRVETPGGGGFGTPADKDAS"
FT   CDS_pept        complement(159146..159430)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00128"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00128"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23049"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U4"
FT                   /protein_id="CBH23049.1"
FT                   /translation="MNTFNGRYSVPRRVDAHRLTAICDWLSSLPRGSMIDETSSRRRSQ
FT                   EESERSRVVCAVGALTRPTPPRQHLSNASHEAEPEAETLAHEEWGSRGG"
FT   CDS_pept        159765..162554
FT                   /transl_table=11
FT                   /locus_tag="SRM_00129"
FT                   /product="conserved hypothetical protein containing VCBS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00129"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23050"
FT                   /db_xref="InterPro:IPR010221"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR039005"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U5"
FT                   /protein_id="CBH23050.1"
FT                   /translation="MPPAEPRANCARPSAGPQGNARGGHMRSRRRSRFSTPPTTDSIPM
FT                   RCSPVLSRLRTAAVLLVGMFLCAPWLGYGQETPEIEATITVSTDAGGSETLPLGMDPDA
FT                   TAGVDSAFGEAELPPPPPSGVFDARWIDDDVPPSTFGEGLPVDVRQGGASATGTRQHEI
FT                   QFRAEDAATEVVIEWNLPAGVTGTIVDKFDGSVYGPVEMTGNDSLTVSPGSPDALLTID
FT                   YNSAPTLDTNAGTTLDEGGQVTLSTDSLSASDPDHDPSELTFTVTSGPTEGVLRVSGTA
FT                   AMEFTQQDLIDGAVTYDHTADIAPGDTPPDDAFAFNLQDGKGEGPTGNVFSVSVLGTND
FT                   PPTAAADADTTQQGTPISIAAPGVLENDSDPNGNPLSVSAVNGSPSDVGQQISLASGAL
FT                   LTIETNGAYSYAPDGAFDNLSDGETASDSFTYTASDGNGGTNQASVSLTIEGLNGAPVA
FT                   VDDSFATYEDSTLTVDAPGILGNDNDPDADPLTPSVVSDPSNGTVTLSNDGSFEYVPAS
FT                   GFADTDSFTYEVSDENGATDQATVALTVNGTRTLALDDGWNLVSLPYQLEDPTFGSVLP
FT                   SCTSGFGYDPDSGNQSLSGGDTLTVGQGYWANCPSGTAQVTGVKADAQTVSVAAGWNLV
FT                   GPFGDSTDTGAISSDPQGIVASSVYGFDPSDGYTPVSTLAPGEGYWINASASGTLTLGG
FT                   SGDGSSLTAETRLQNAGEDEKTASLHVTDDEGREATLWLRRDRPTSKQQRHMLPPTPPG
FT                   GTFDVRFANGGALAPVASGAGPPSVHDVKLQGVAYPLTLRLQGGSRAGAVRVRKDRGPD
FT                   ADVTTLTAEAPSVTLQDGDGQLQVGLQPAPDQFSLQNSAPNPASGPATIAFSVPEQTHV
FT                   TIDVFDVLGRRVATLADGQREPGRHDVRLDVGSLSSGTYFYRMSADGFSKTRRLEVIR"
FT   CDS_pept        163521..163802
FT                   /transl_table=11
FT                   /locus_tag="SRM_00130"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23051"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U6"
FT                   /protein_id="CBH23051.1"
FT                   /translation="MSPVVHMVPVLRSCLRPFVLFCLVGTVGTDRACAHPNSPGLDTTT
FT                   VQTGWAVQGITEYDRSAVYEDALLHQWTQGSLKAPAPGSAVGASTPGT"
FT   CDS_pept        163771..164085
FT                   /transl_table=11
FT                   /locus_tag="SRM_00131"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00131"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23052"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U7"
FT                   /protein_id="CBH23052.1"
FT                   /translation="MQSVRPRPERDRALGGAVTGAGLLGRRAAAARYVRAAADAPDLIV
FT                   FDAGMLLDGQDGDWYWGRFGPDWGAKPGISSAHPPFTDGRAPAQSRVSEGALTQTRSGP
FT                   "
FT   CDS_pept        complement(164060..165403)
FT                   /transl_table=11
FT                   /gene="gcdH"
FT                   /locus_tag="SRM_00132"
FT                   /product="Glutaryl-CoA dehydrogenase"
FT                   /function="Catalyzes the oxidative decarboxylation of
FT                   glutaryl-CoA to crotonyl-CoA and CO(2) in the degradative
FT                   pathway of L-lysine, L-hydroxylysine, and L-tryptophan
FT                   metabolism."
FT                   /EC_number="1.3.99.7"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00132"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23053"
FT                   /db_xref="GOA:D5H4U8"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U8"
FT                   /protein_id="CBH23053.1"
FT                   /translation="MPNDLATADIDRDVLARLSEKADVDQLLGALSDLDEDELDRLADG
FT                   ARPQKPQRPSPTPPVNADVYEVFEGLTDAQEATRETVRSFMQAEVEPVANDMWEDGTFP
FT                   KDLIPKAGALFDEVVGRDAYTFPSDDPIRTNLISFEMSRVEPSFCTFWGVHTLLSMGSV
FT                   ALFGSEAQKERFLEPMAAFDMIGSWALTEPDHGSDVSQGLATTARREGDTWVLDGAKKW
FT                   AGNATFADVTVVWARDEADGCIKGFLVEQERPGYHVEQIGGKIAKRGVENGLIELDGVE
FT                   LPEANRLPGVSHFGDVSAQLATCRASVAWEAAGLATGAYEKALAYCNERTQFGKPTSSF
FT                   QMVQDKLVTMLGKVTALQTFVMQLGRLEAGAGAIGNERSSLAKVWACDTMREVVSIARG
FT                   IMGGNGILLDHDVARLFADAEGVYSYEGSREMNALIVGRAITGQSAFV"
FT   CDS_pept        165824..168418
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00133"
FT                   /product="ferrienterobactin-like protein containing TonB
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00133"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23054"
FT                   /db_xref="GOA:D5H4U9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4U9"
FT                   /protein_id="CBH23054.1"
FT                   /translation="MAPRRLVSRFVSRFRLNAPGTLGELPLALALVLGGFALCWVPTQT
FT                   SFSQDVRTGAVVGTVGVPSGSAAGANVVLRDADDAPAAAGQSRLGDAVGDGGRFRIAGV
FT                   PPGRYVLRVTLVGYERAEQPVQVRRGDTTSVDVELRRDRARLGEVTVRGGGSLTQQSTE
FT                   AAAEQVRQVPGGANLVSLQDRELRPIATVASALEDEPGVVVQEFFGGNDQPRISIRGAG
FT                   LQSNPQSRGLLLMHNGFPLNFADGSFVTGLVEPRMARHAEVYRGGNALGPGGATLGGAI
FT                   DFVAPTGRSADGPQLKLTGGSYRTASGHAQYGWAGANTDVFVMGTGHRHDGFRQTNDEG
FT                   ERLTGHANVGYRWDDNLETRVYGTVATLGFNIPGPLNKQQLDADPTAVSRGVTPPRSLG
FT                   PNVPLDRPRRETELYRAATRTTWRTGASASGHEVSVRAGAAYQYVEDDFRFPVGTGVRS
FT                   TRSHDVTLNLDARRAGAVLGGEGTSVLGVSATLGDMDRGYFANERGRTGRRFADNEMQA
FT                   STVRAFARQRVQFGTRLAATASISGILARREIDEALSSTSQRARYVAPKDKYVSFASSP
FT                   ATLDETYRGLRPAVGLQYAAAPALDLFAGVTRSYEPPTFNTLLSPSGGNPKKGPGQFQP
FT                   RVLDAQSGTTVEVGTRRTRGRLQWDVVAYRTWLKNELLTTAALFGGAGSTSNAPVRTIH
FT                   QGLETHVDLRLLDGMLADGSGAPDQLALEATYNLNDFYFDTDARNQLAGVPRHRLHAQL
FT                   TYDHPVGLSVTPDLTWMPQRTPTDHANTIYQSPYALLGARAHYTVGPGWLDAGQLAVFV
FT                   EAENLTGTTYASSYLVRDQVPNPPPAPLTSADVTSFIPGQGRTLQIGVTVGW"
FT   CDS_pept        169572..170222
FT                   /transl_table=11
FT                   /locus_tag="SRM_00134"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00134"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23055"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V0"
FT                   /protein_id="CBH23055.1"
FT                   /translation="MLRQEVDIELADMADQLGVTLRRLMAGLRAGRFAEHVTEDDLVYS
FT                   DKGDPLFFRIERSRGYAICGEDLPDVEQDMSTVERMSTSAETEEGTTEERGVSATAGWP
FT                   GIGTVAGAVALIKTAFRGGVALLGRLFSGLGRLLEKWPSSERPSRRELPGRRLGAIYQE
FT                   GWNARLEGNRSNPYLDDPPARNAYRQGWWDADEEMKRLLASHFEVECRTSARG"
FT   CDS_pept        complement(170868..171740)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00135"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00135"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23056"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V1"
FT                   /protein_id="CBH23056.1"
FT                   /translation="MNATGMPVDIERREAVLSRLPQKAVRALEDGDTWETERPEEGSRI
FT                   ANISVPLRHEASDTWERRSIESRVTVTNGALVERFYSVDEHGAQALRRAPKWGSDRHRS
FT                   VRERFSPEKRRKRWAQYWEWVAETGRDPIGEFSVPETARCGWRLLCQEKTEDVVVHYAR
FT                   RCPTRGRSSENAGPSGSTGSLGRSTDYVPRDKVPRGLRDHCRLKEGRIHPGGVQSRADL
FT                   ARRFRRRGTGRIAGRQILDSELRRVPDDAPGPLHALPRVFFVDVAIEEPISPSRQRDIL
FT                   RARAREKLG"
FT   CDS_pept        172175..173002
FT                   /transl_table=11
FT                   /locus_tag="SRM_00136"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00136"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23057"
FT                   /db_xref="GOA:D5H4V2"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V2"
FT                   /protein_id="CBH23057.1"
FT                   /translation="MHAAFGIYSLVSTAPSFTRLLEIGPDSAQRLPAFFLGPVFPAGGR
FT                   ALLQCKAKLLPVVAWRRTPARPSRGAPAQLLLSLFSTQTGPMQLQTGPVQIILVSLLLL
FT                   AALLGASVLVVSPVTEPVQTPDRGGSSVVPDAGSTSQEPVDSPTVALDIETRGGTSLTK
FT                   AKASLVVLPGTTEGGGTKLSLLTVSTSPDSAFDAERLSLVFANGERETQDLKQIVAENE
FT                   GGAAVRLHWMGLSDARLRRIAGSRALRLEGGGAVLDLSGSSIPAQARALLKTR"
FT   CDS_pept        173174..173647
FT                   /transl_table=11
FT                   /locus_tag="SRM_00137"
FT                   /product="Conserved hypothetical protein containing
FT                   DUF1334, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00137"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23058"
FT                   /db_xref="GOA:D5H4V3"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V3"
FT                   /protein_id="CBH23058.1"
FT                   /translation="MNALLQSLVRGIGLMASLGLFLLALVVTAYAFIEGGSVVAEILQF
FT                   SDPEYSVIYNAMKVVDLFLLGFSVLIASVGIYELFVGVLPNMPDWLRMEDLDALKGVLV
FT                   KTIIVVLGISFMGRAVTWEGEEGLLSYGIAIGAVVVALSVFLSVKSETSPTPS"
FT   CDS_pept        175917..176132
FT                   /transl_table=11
FT                   /locus_tag="SRM_00138"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00138"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23059"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V4"
FT                   /protein_id="CBH23059.1"
FT                   /translation="MFDEEHFPREYECEGCSTTATVTHEDVQDVPSFLAATTVAEAVEY
FT                   VMTERRRWSLQSFEGAFCPACMEETD"
FT   CDS_pept        176380..177234
FT                   /transl_table=11
FT                   /locus_tag="SRM_00139"
FT                   /product="Conserved hypothetical protein, secreted or
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00139"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V5"
FT                   /protein_id="CBH23060.1"
FT                   /translation="MTLAFCPMHRHRSSQSRGSRIRLLLASLLVLGAGALLTATPAAGQ
FT                   GELAPPPAADSVPAVSGQVNLRGTVGIPRGGLRNNISGVGGGLHGYIGGWIGRRPLLVG
FT                   LDLGILNYGRTTDQVPFSRTVGPRVPVEVSTNNNVVETHLSLRLQPRTGRLRPYVEGLA
FT                   GFKYLFTRTTVGDDDFGNDELGDDIAESTNYDDFALSGGAGAGIDVRVYQQREPGKTLR
FT                   AVDVHLGVQYLLGQEAEYLAEGDLTDENENGQLDRSELDVRRSRTTFLQPQFGVTFRLA
FT                   DTD"
FT   CDS_pept        177274..178041
FT                   /transl_table=11
FT                   /locus_tag="SRM_00140"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23061"
FT                   /db_xref="GOA:D5H4V6"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V6"
FT                   /protein_id="CBH23061.1"
FT                   /translation="MGPGGSRPYVDRCVCRSRRLLPLWARHPSKRRRGRGATSSAGARE
FT                   QGRRRRGGRPLCRTHRSARARPRGVAGRSNNSTGPTKTASRAMSADEMPATYRTSRLQR
FT                   GLSVLSVGALLLLAVLEATDEGPLLELSLVNVLLTGATLLAAAGYGLRATVRVSETAVR
FT                   KTRPLWTDNVLRFEDIQRLHLPVTTEALWLYTEPNGSPDLSIEAQSFERFGSLARRVLR
FT                   RLPQHTEIQDPAGRVEHYRRGGDAAGENQTDDG"
FT   CDS_pept        178060..178152
FT                   /transl_table=11
FT                   /locus_tag="SRM_00141"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00141"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V7"
FT                   /protein_id="CBH23062.1"
FT                   /translation="MGGEEDTDREEDADGLIGWPATPVSSVLPR"
FT   CDS_pept        complement(178267..178407)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00142"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00142"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V8"
FT                   /protein_id="CBH23063.1"
FT                   /translation="MREAFDSGWHAFREDQPPPDECQFDGPEEIEAWLEGYLMTEDHEG
FT                   R"
FT   CDS_pept        complement(178639..178788)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00143"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00143"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23064"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4V9"
FT                   /protein_id="CBH23064.1"
FT                   /translation="MIYGSGALRGASSPLQAACRSAHPNTAHAPSLRKAPTLSEENMNA
FT                   PKRR"
FT   CDS_pept        complement(178885..180078)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00144"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00144"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23065"
FT                   /db_xref="GOA:D5H4W0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W0"
FT                   /protein_id="CBH23065.1"
FT                   /translation="MWPAPSVPRPPSTLAATVLLCAAVLLGGCTSPASDAETVSEELEQ
FT                   LASSYEVRLADGLETGLPVRDDGFAYAVDLGNTMSAAVALGNRSLFDRAYGMIRAHFLR
FT                   VDTGDPRARHTVLWRYKPGTAPDASGSKETGLLADALWEAYERWGNPEHRRMATKVLDA
FT                   YLRHGYWETDRRFVVKNYYNYGTQTLSENTWVLNQMPHTVRKIACGTQDASLFRRANAM
FT                   ARFAEGAYLKKGFSREMYDKGIETVFDGADGYYSPNGLLKLQSSLEIAKALLPFTLAPA
FT                   REVIGFIRASYPDVSSAYYYNPRSKAIAPLAETSEQTYGLSEKALVLLLATRVRDSPGE
FT                   AFLQDFVDREIVPELKRRRDESSSPFYFDVPLMLEAAQRYLRPDQVPAPPGESECTL"
FT   CDS_pept        complement(180177..180341)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00145"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00145"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W1"
FT                   /protein_id="CBH23066.1"
FT                   /translation="MDGFLSRFTPKLRKMRSIKSQWHMWKPARRQSVRTAHEAPADGRK
FT                   EDENAAAEK"
FT   CDS_pept        complement(180528..180833)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00146"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00146"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23067"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W2"
FT                   /protein_id="CBH23067.1"
FT                   /translation="MLISKPRQSPPSASRPSRPEASRSRPAYMSEFLGGLSLSLRALSP
FT                   RQALSPSAPAPETVHSIERRWRSGTPGGQGSGGITPPQKSRGDTTSRRRRARDGSA"
FT   CDS_pept        180943..182586
FT                   /transl_table=11
FT                   /locus_tag="SRM_00147"
FT                   /product="Retinal pigment epithelial membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00147"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23068"
FT                   /db_xref="GOA:D5H4W3"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W3"
FT                   /protein_id="CBH23068.1"
FT                   /translation="MRKGLSGPELPRDPRSLVAFSVCCASSMGACDSGGGCPPQAVSSA
FT                   APRRGAGAGRSPANPSRGLPLQNTPCLCPRPCCRPPMSDYRRGFESLRQELHEPSLPVE
FT                   GEWPDWLEGTLIRNGPAQFEVGDEDYNHWFDGHAMLHAFRMRDGTVSYRNRFVRSQSRT
FT                   EALEQGRIARSEFATDPCMSLFGRVMSVFNPNPTDNASINVARLDDQYVALTATPLPVA
FT                   FDPETLETAGVVEYDDDVDVDMSTPHPQVEPGTGRMLFHTLSFGRQCQYGVYGTEAEGK
FT                   TRRPVATLDVDRPSYMHSFGMSERYVILSEWPLVVNPTDLLLRGRPFIENFEWQPERGT
FT                   RFRVLRKADGAEVATCEAEAAFGFHHVNAFERDGAVVCDVVTYPDASVVEELSLDRLRS
FT                   DAPSRGSGHLRRYRLPLDGGAAASTLRGEERIELPRIHDGPATGRPYQYVYGVGTRAAG
FT                   QFTDQLVKTDVPAGTAQTWHEEGTYPGEPVFVAAPDGAREDDGVVLSVVLDPDAQQSFL
FT                   LVLDAPSFTERARAAVPHPIPFGFHGQFFD"
FT   CDS_pept        182614..183465
FT                   /transl_table=11
FT                   /locus_tag="SRM_00148"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00148"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23069"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W4"
FT                   /protein_id="CBH23069.1"
FT                   /translation="MRRRTPRWNRPWGRRGRRVLGEPIPAPCRFPPVLVSVATNLSPAP
FT                   MADPPDTLKYFHKEPAVLEPVVSGRDPDARRRQERSDVPPDEAILHGDPFETERNESAT
FT                   VYRGYLAGTNHAQGRVGLTALRRPVEAFVGPILEALGGPWWGRSGPDEQVEALSPDTAR
FT                   RVLQEPGGTRVLVTADAPVPDDVIAEAAVQEPDRARPALSALLEAAQVALFPASAHDGH
FT                   DWRLWSAAPMRRRLTGAFRDRPVSGTRRFVIPAAKARSESKFYFDMWRPADADLPGYVE
FT                   EV"
FT   CDS_pept        183612..183830
FT                   /transl_table=11
FT                   /locus_tag="SRM_00149"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00149"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23070"
FT                   /db_xref="GOA:D5H4W5"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W5"
FT                   /protein_id="CBH23070.1"
FT                   /translation="MEDATPAPSSIEFALTLFFAIVTAVAIGVQTRPLLGGTVTQDLTR
FT                   MCLSGVAGGLIAWFLWRYRKGDYTPDR"
FT   CDS_pept        complement(183955..185310)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00150"
FT                   /product="Putative light-and oxygen-sensing transcription
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23071"
FT                   /db_xref="GOA:D5H4W6"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W6"
FT                   /protein_id="CBH23071.1"
FT                   /translation="MPDGETQRPSREDASPEGPSVFRRMYRITADGEATFEEKTRRLID
FT                   LGRRHLDLPFGFLSRIEGANTAAHGGRDASPASSEEGSGPEEATQKILYASGDHPLLQS
FT                   GKTCPLSEAYCQRTIRREELLSIQNAPTDGRAAEPAYDRFGLGAYIGSRIEVEGELYGT
FT                   FCFASRTPRAQPFSDEEEALVELLTRWARYELERQRSRERTEQFAELVTHDLRNPLNAA
FT                   QMNLHMAQRLLGDEGSLAGASPGAGGEEAGEDGAGAEKSASEKLQRHLRISRRALDRME
FT                   GIITDTLALAHGAQNLGPDDLTAIRFGDAVRASWEQAGTAEATLRVENTAETEAGSSTQ
FT                   CASAFLAHEGRLQQLLENLLRNAIDHAGSAATVTAGRTEDGFFVADDGPGIPPDRRETI
FT                   FEAGHSTRDGGTGLGLVIVQEVAKAHGWSLSVSESESGGARFEVTGVDTAGS"
FT   CDS_pept        complement(185477..186403)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00151"
FT                   /product="Conserved hypothetical protein containing GumN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00151"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23072"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W7"
FT                   /protein_id="CBH23072.1"
FT                   /translation="MSTSTRSRYGLRHVFGLLLAAVLAAPALAQPACAQGTSATPHMLW
FT                   RVASEANGTEGYLVGSVHVMKKEAYPLDSVFREAFSEADVLVLEANLDSMQVKAKTLVR
FT                   ELALYPPGKTLKKELPDETYAMLEKRAEKIGLNLAQMQRMEPWMVSIMIPTRQMQKAGY
FT                   SQNQGLDRHFFDKAKKAGTSVRALETAEEQMRFFDDLPPEKQEAYLRQSLKKADRTVEN
FT                   FDKIVRYWRTGNASGIEEMMVEQMKNDAPALYERLITERNATWMPRLTEILESEALPMI
FT                   VVGAGHVVGANGLVELLREKGYRVEQL"
FT   CDS_pept        complement(186597..186740)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00152"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00152"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23073"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W8"
FT                   /protein_id="CBH23073.1"
FT                   /translation="MQGQTPGRTPPIDGMTTVANAPDPSPDSSFVPVRARAVSFRPRLP
FT                   LA"
FT   CDS_pept        187437..188411
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="SRM_00153"
FT                   /product="Ribonucleoside-diphosphate reductase beta
FT                   subunit"
FT                   /function="Provides the precursors necessary for DNA
FT                   synthesis. Catalyzes the biosynthesis of
FT                   deoxyribonucleotides from the corresponding
FT                   ribonucleotides."
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00153"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23074"
FT                   /db_xref="GOA:D5H4W9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4W9"
FT                   /protein_id="CBH23074.1"
FT                   /translation="MSIFDERVNLKPYEYPHLLEFKTAIRQSYWVHDEFSFEGDVQDFR
FT                   VNCTDAERSVIKKTMLAIAQVEVAVKTFWADIYDRLPVPEVGAVGMTFAESEVRHLDAY
FT                   SHLLELLGLNDAFERIEEIPALIDRVEYLNSALEGTGSRDERAFAHSILLFSIFIEHVS
FT                   LFSQFLIMLSFDKHEKRFKGVANAVEATSKEEQIHGLFGVELMNIIREEHPEWFGPAFE
FT                   QEVRAACEEAYDAEQKVLDWIFADGELDFLPRPVVDAFLRDKFNESLKNVDVDPIFEVD
FT                   PEHLGETRWFYEEILLTKGNDFFSKRSTSYSKMTQSVSGDDLF"
FT   CDS_pept        188515..190197
FT                   /transl_table=11
FT                   /gene="nrdA"
FT                   /locus_tag="SRM_00154"
FT                   /product="Ribonucleoside-diphosphate reductase large chain"
FT                   /function="Provides the precursors necessary for DNA
FT                   synthesis. Catalyzes the biosynthesis of
FT                   deoxyribonucleotides from the corresponding
FT                   ribonucleotides."
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00154"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23075"
FT                   /db_xref="GOA:D5H4X0"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013350"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X0"
FT                   /protein_id="CBH23075.1"
FT                   /translation="MSTTTRSRSSTSADFGWLNDEARTFLRRGYLLEGTGPEDRVREIA
FT                   EHAEGLLEMDGFADRFYEYMARGYYSLASPVWANFGLDRGLPISCFGSYIDDSMEAILD
FT                   THAEVGMMTKVGGGTSGYFGDVRPRGASITNNGTSNGTYPFAQLFDKIINVVSQGETRR
FT                   GHFAGYIDIEHPDVEEWLNIQTEGDAIQTMMYGVVVGDDWMEAMIDGDSDKRALWAKVV
FT                   ESRMNLGIPYILFRGNVQDGRPQVYKDKGYDVHASNLCSEVLLPSGPDESFVCCLSSMN
FT                   ALHYDDWKDTDAVETLTQFLDAVMQEFIDGAKGMAHMDRAVRFAERHRAIGIGILGWHS
FT                   YLQSNRIPFESAEASLTGAEIAKTIKERSYAASAELADRFGEPPVLEGYGRRNATTMAV
FT                   APTKSSSFILGQVSPSIEPIKSNYFVQDRAKMKVTYKNPHLKALLQEKGRDTDAVWDEI
FT                   ALRDGSVQHLDFLSDEEKDVFKTFSEISQMAIIDQAAGRQKHIDQSQSLNLAIDPGSTP
FT                   VKDINRLYVEAWKKGVKSLYYQHGVNAAQSFSRDLLACKVCEA"
FT   CDS_pept        190242..190688
FT                   /transl_table=11
FT                   /gene="ykhA"
FT                   /locus_tag="SRM_00155"
FT                   /product="Putative acyl-CoA thioester hydrolase ykhA"
FT                   /EC_number="3.1.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00155"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23076"
FT                   /db_xref="GOA:D5H4X1"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X1"
FT                   /protein_id="CBH23076.1"
FT                   /translation="MAPSPSPDSRPAAVLDEAAETRIVHAVFPGDTNHYHTLFGGTALE
FT                   WMDQAAFICATRWCRTKVVTVRTSEIDYKHPVPEGTIVELIARIADTGTTSLTVRVDMF
FT                   IEPMDEHDRTLACTGQFTLVALDDQDNPTPVPGPASATQDEPQA"
FT   CDS_pept        complement(190767..191930)
FT                   /transl_table=11
FT                   /gene="cynX"
FT                   /locus_tag="SRM_00156"
FT                   /product="Cyanate transport protein cynX"
FT                   /function="This protein is part of an active transport
FT                   system that transports exogenous cyanate into Escherichia
FT                   coli cells."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00156"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23077"
FT                   /db_xref="GOA:D5H4X2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X2"
FT                   /protein_id="CBH23077.1"
FT                   /translation="MQRGLLILGILLISLNLRPALASVGPLVESIRGATGLSNAALGLL
FT                   TTLPLLAFGLVSALTPLATRRLGTEGALAAALSLVAVGTLARAAPSTAPLFGGTVLFGV
FT                   GIALGNVLLPSLVKRDFPEHSGVMTSLYSSGIGAGAAIGAGTTVPLAGALGWRGALGAW
FT                   AVPAVAALLVWLPQLRAGAPARASYDIGDSLRALARSSLAWQVALFMGLQSLTFYIALA
FT                   WLPGFLQARGFDPAAAGGLLALSQVMGVAGSAVVPTWAARRADQRRTICLLALVEGTAL
FT                   AGLAWPGAPLASLWVSVLGFVLGGTFGLALLLLVLRAADAETATELSGMAQSVGYLVAA
FT                   AGPAVFGLLHDLTGGWAAPLALLAFALVAKTAVGLRAGRPGQIRPGR"
FT   CDS_pept        193752..195455
FT                   /transl_table=11
FT                   /locus_tag="SRM_00157"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00157"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23078"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X3"
FT                   /protein_id="CBH23078.1"
FT                   /translation="MHTDMFTFSRAFAALLLAGLLVLAGCDSSDSGMDDQQTQEPSVER
FT                   SVTFNTQALDLTAGDTELRLANVTASEGDTLVVTTDNGDGAFGDETVVATRPVTSDLDG
FT                   DEVLVDVGQDAGPVDHAAHVSTDGTISGVEASSQTAAVYAINQFQWADEAYDGPVGAVT
FT                   VDAIEVLYQGNVGAKTLSIDLHTGNSSSGQVGAFIGISERDLAVNEVHENVALDVLEPV
FT                   DPNDDSPQQVFDTIEETGDFFAMIHRGPAGLAPNPNLAGPGAAAGTPPFLGDADGYRVP
FT                   AQQPALATTTGPGTGGDFANVEVNVPDVRLSDLPTTTYEATIEGSQITDDARGSAPGAI
FT                   PTSETSTGSGTAELEFVVRDGEIQLDYTITLQGLNFDKVLRGSKNANASSQDLNKLIGL
FT                   HLHTNVRGRLGPVSFAVVGQGDPQTTVTRGVELSNGDLVNTSHLIASNVPASRPNRAIG
FT                   FNPGIAAEGLTGDSDRTLTYDSANNELTIEGTWTREEGDAEGLSSARAPAGDASIEPAG
FT                   GIEFVTTPAQMAQRIVDQNIQPGGDTPFSLNHHTAENLNGEMRGQIVATQ"
FT   CDS_pept        195498..196205
FT                   /transl_table=11
FT                   /locus_tag="SRM_00158"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00158"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23079"
FT                   /db_xref="GOA:D5H4X4"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X4"
FT                   /protein_id="CBH23079.1"
FT                   /translation="MPSAHAKKAPIGTRPVGGFSERSFLESSFQKGGTPQPIALDTSSW
FT                   ARPQGSPTLLFTQTTKLMSITRSTVVKTWGLAVLIGWVGSQVITSLSSTFSNVPFAITA
FT                   LWLVGALLPITVSFFWDRPEPSDQTLSLLWPALGVTGILINFGVSLGAIPAGETIEVLA
FT                   YGVLWFAGPGIGFAATAALTAGPNASVYGWAAVANFAGAVAALVAPMALLPAYFLGAAV
FT                   LQATPMLYDGFSG"
FT   CDS_pept        196262..196969
FT                   /transl_table=11
FT                   /gene="hmp"
FT                   /locus_tag="SRM_00159"
FT                   /product="Putative phenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00159"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23080"
FT                   /db_xref="GOA:D5H4X5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR001834"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X5"
FT                   /protein_id="CBH23080.1"
FT                   /translation="MASDTLETTLTSIHEMTPRVKQFVLEANGHTFSYEPGQHIVIEFE
FT                   QDGDTVQRPYTPVNLPGTGALALGIKRYEDGTASTWMHDRSVGEEITITKPSGNLHLRD
FT                   LDRDVVFLSTGTGITPMIAMLKQYLSEGSGRAAFLYGERTQEDIMYRETLDHLSAGRDN
FT                   LEVLYSLSDEDWDGPTGHVQTHLGDVVDERFEDPHYYICGIPPMVVDSEEMLQEEGVDD
FT                   GRIFTEGWESDAV"
FT   CDS_pept        197411..198076
FT                   /transl_table=11
FT                   /locus_tag="SRM_00160"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23081"
FT                   /db_xref="GOA:D5H4X6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X6"
FT                   /protein_id="CBH23081.1"
FT                   /translation="MSFTSDQPSMDEPPLLQALLGGTRRQIVQLLRPEDRTVRELADHL
FT                   GLTRNAVRAQLSNLKSDGIVEVTGRRPTERKPEHVYGLTRKAEDLFPKPYDTLLNTLLS
FT                   VLQKTEWVNADPILEETGRRLGQMEKPDVLVSEASVRVGHARDVLEEMGGLPQVHEEGQ
FT                   QYRLEGSSCPLSASVRAHGEVACDLARAMIEELTELPVERRCDADGECPQCEFVVDAT"
FT   CDS_pept        198752..199222
FT                   /transl_table=11
FT                   /locus_tag="SRM_00161"
FT                   /product="Conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00161"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X7"
FT                   /protein_id="CBH23082.1"
FT                   /translation="MGQQQLLLLALSAVIVGLSVVAGIEAFGEGQRQATQDALAQRSVS
FT                   IGTDIVVAHKKPSQLGGIDVSHPYPSDEAVASAVAPESSGQYGSGILAIGAGETATCDI
FT                   DHSDGGTVVYVDCGSEQTGQGYPDGQIVKAKVEPGAEDPVKVVDTDADGHSN"
FT   CDS_pept        199320..199565
FT                   /transl_table=11
FT                   /locus_tag="SRM_00162"
FT                   /product="Conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00162"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23083"
FT                   /db_xref="GOA:D5H4X8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X8"
FT                   /protein_id="CBH23083.1"
FT                   /translation="MWAEIAIALVVIAAAGTAFLVLRGGASPRPSSRNRQIETHRRRRR
FT                   QARTKDAGQDDGIGEANPTEDRRPGTDAISRWSDSA"
FT   CDS_pept        complement(199738..200160)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00163"
FT                   /product="Conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00163"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23084"
FT                   /db_xref="GOA:D5H4X9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4X9"
FT                   /protein_id="CBH23084.1"
FT                   /translation="MFGTSGVLFGSVVVWGAAAIWAAGTLTLLISSFAPTEHEGPTRLP
FT                   AWDGPPPRVSGPYRTASGTGPHNADGPVGPPGASSRRSGLLGPHSQLGSMDRPRPLVRS
FT                   LRAHLDQRPHLDRRHGASPPGTRPLHWLPFRSPRPW"
FT   CDS_pept        200928..201971
FT                   /transl_table=11
FT                   /locus_tag="SRM_00164"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00164"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23085"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y0"
FT                   /protein_id="CBH23085.1"
FT                   /translation="MDNVELPSVIENDSDLQVPPLPWALPEVLGPLHESGFAGAEAVSA
FT                   AVDCDPRLESGILRRINSHLRRPIGELGPAVQMIGPVTAAGLVVELSMRRWRPLRDGPA
FT                   GPQLTRLIYHSEATAALTQRLLRGSSGGGEPPDGDDPSKGAPDPSRDHPPRDQPEPSAE
FT                   EASPTQSAPMWASFEWKGFAQGLICDLGKLVLLHSYPEKAAALYSQDRTDRGYGNADPQ
FT                   VMEQAAFGCDHVEAAAWAAETLHLPEPLADAATQRRGSTVGENQGVHAARVANLLTKTM
FT                   APELAGISATSATRDWETCAEHPAWRAWVEDASRPSLEAVTEEFSKETVLYTRFLLDLP
FT                   VAESFSD"
FT   CDS_pept        complement(202070..203662)
FT                   /transl_table=11
FT                   /gene="mcpA"
FT                   /locus_tag="SRM_00165"
FT                   /product="methyl-accepting chemotaxis protein McpA"
FT                   /function="Responsible for detecting glucose and alpha-
FT                   methylglucoside."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00165"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23086"
FT                   /db_xref="GOA:D5H4Y1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y1"
FT                   /protein_id="CBH23086.1"
FT                   /translation="MLTQLFGSGDSTRTDAQSPVGNAGHDADGSPIQDDEGSSGVTEAA
FT                   LIEGVHRSMGVIEFRPDGTVEAANENFLDLIGYELGEIKGEHHRIFVEDEYARSEEYRA
FT                   FWEKLRRGEPHEGRLKRVDKDGRVLWLQGTYVPVFGEGEEVRRIVKIANDITDRVEAEN
FT                   KRDTLTEQVEILLGAMDRFADGDLTVRIDAEADGDIGRLYDGFNRSVDNLQRMVEQIRE
FT                   VAQSTMASAGQISSSSDQMAASTEEQSAQAEEVAAAVEELNQTIDENARSVQSVAEAAE
FT                   AGGQKAREGGEVVEKTTEKMEEIVSAAQETASVIEGLATSSEKIGRVVDQIDEIANQTN
FT                   LLALNAAIEAARAGEDGAGTGQGFAVVAEEVRELAEEADTATDEIAEMIEQVQRETSGA
FT                   VEAARRSSQKAEEGMELADRTGGAIEEVITSIGTVEEQAEEIATASEQQSATSEQIAQS
FT                   VQSISTAAQESAAGVTQVADSADELDVFTERLRGAVQRFDLDKEAESPRKGPGRSAPQN
FT                   HGGDGHRSGQVSL"
FT   CDS_pept        204127..204606
FT                   /transl_table=11
FT                   /locus_tag="SRM_00166"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00166"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23087"
FT                   /db_xref="GOA:D5H4Y2"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y2"
FT                   /protein_id="CBH23087.1"
FT                   /translation="MDEPIKDEPKNMDETLNAEVRQTDLILTLVSGAIVGLAVGGFGSW
FT                   LLFIPDMGVVEFLAATFVIGGVGVSPFLGVMYMNRRGFVPTEVWAEEDRLVVQSPSEWW
FT                   FKPEKQFHLEVESAEQAEAGLVITGTLSRWWDWGRHEVRVEPEEADALDAWLGTV"
FT   CDS_pept        complement(204978..206015)
FT                   /transl_table=11
FT                   /gene="usp"
FT                   /locus_tag="SRM_00167"
FT                   /product="universal stress protein Usp"
FT                   /function="Required for resistance to DNA-damaging agents."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00167"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23088"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y3"
FT                   /protein_id="CBH23088.1"
FT                   /translation="MQAPQGRRRGPRDPPLFSVVTASEPVFQTLLVAHDFSPSSSRALA
FT                   HAVDLAARTGAALHLMYVDRTAEGVLFEGGKAPPDDELQDRFEERCHASLAPHDRSPAE
FT                   DRVVCHAVRGVSPAPLLVEKAEEIDADLIVTGTEGRRGARRLIVGSVAEEVLRTAPCPV
FT                   LTVRQREAGGASGSTGEADDASGSADEAPSSAVEQIVAPVDFSDLTEVALRHVAQLAPL
FT                   YDVPVTLVHVVEDPTMPSVYEVNASAVRARAAEQRAEEALQSLGAPIEETGVSVSYLVH
FT                   RGQTTSTVVEATGHRDTLTVMGTKGLSGLRRVMLGSVTEAVIRASDGPVLAVPASAQEA
FT                   SPADE"
FT   CDS_pept        206279..206617
FT                   /transl_table=11
FT                   /locus_tag="SRM_00168"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00168"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23089"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y4"
FT                   /protein_id="CBH23089.1"
FT                   /translation="MPVQHPAAPERKAGRRGRGLAQGVPGALPACRACSPVRFSCPGLV
FT                   LVQRAFKNDSCRTDPLPSRGGDDGVPTVAGRSLSHDYCTYDGSTFSVTVFSKRRCPLRG
FT                   ATSRAHGV"
FT   CDS_pept        206748..208937
FT                   /transl_table=11
FT                   /gene="ark"
FT                   /locus_tag="SRM_00169"
FT                   /product="Adaptive-response sensory-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00169"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23090"
FT                   /db_xref="GOA:D5H4Y5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y5"
FT                   /protein_id="CBH23090.1"
FT                   /translation="MSDLAWPPFSILRPEGEELSGEQQSDVQAYRLLGLLGAVVVPVFG
FT                   VLLVAPDPQATDPMWARLGLSALLVGLVGASYASGAVRRRFAVWARGACYILMAWYCSV
FT                   ATLNGFAGSYDMGLLLLYGILPFAVAIGARSMRPVWWFLGSGLLAGTVGAAFGPVRAAE
FT                   ALPTVGGLATVAFVEGVVIWNQLDARERLERQNDLFRRAQKLANIGAWEYEVSSGEVFW
FT                   TRQVREIHGLPQGYEPTAEEAIAAYHPEDQPVIQGMIERAVEEEVPFDRELRLGGEALP
FT                   VGHEQKEGRWVRARGTPQIEAGEVTSVRGTFQDITERKAREHVLENEREALRSMYRITA
FT                   DREAGFEEKARRLIDLGREHLGLPYGFLTRIMDETQEIVFASGTHPLLQPGESCPLSRS
FT                   YCRNTIQEERSLVVQDAVAEGWAGDPAHQTFELGAYVGAQIIVEGELYGTFCFAAEEPR
FT                   EQAFAGRERVFVELMAQWASYELGQRRAKAQLKRQNARLDSFAGLVAHDLRNPLNVATG
FT                   RLRLAREERAPEETRSHLAAVDRSLGRMDEIIEDVLTLTWGGQDIGPEELSTHGLAAMA
FT                   EASWDQVGTDQIGTDQVGTDQDGADKGSAEGATLQFEGACRLRCSAERVRRLLENLFRN
FT                   AIEHGGDTVTVRVGALSDGFYVEDDGAGFSGDDPEAVFEAGYSSSDEGTGLGLSIVESI
FT                   AKAHGWSLSATQSEAGGARFEVTGVDVEAVGSAHS"
FT   CDS_pept        209202..214208
FT                   /transl_table=11
FT                   /locus_tag="SRM_00170"
FT                   /product="Putative redox sensing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23091"
FT                   /db_xref="GOA:D5H4Y6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR031621"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y6"
FT                   /protein_id="CBH23091.1"
FT                   /translation="MFMWPPPLGKPVYLIYISVFGGAALSCLLGAWRAQRIAGSDVRRG
FT                   LVALLSTSGLWAVAHVGMLLAPGLQWKTVFYEAGLVVGFGTVWAWGWLCSAYSGRRLHR
FT                   RRMVQGIALVVFGAVTLTKVTNAWHGLYFAAGWHTTPFAHLQIDHRTLYWITAALSYTL
FT                   AAVGFFMVAEPLRRVQVGAGQLAGLFGLTALPLIANGLGYLSPALLDVSHEPVGVAAFA
FT                   IGVLFVYQDRFEETGRTGTQANPALVLSKGGRLRNYNEAAATLFPALAEESAVGRRLSD
FT                   LLPEVAEAIAEGAEPLQVDESGTARYFRLSQSRYGRGTGRQVVLKDVTERVLRRRVREQ
FT                   EHRFLAEAVGQAREAVLVTEAGPLDEPGPRIVYANEAFEAMTGYREAEVLGRTPRVLQG
FT                   PETDEAVLGSLRAALEAGEHWQGETVNYRKDGTPYVVQWNVAPVTGEGGEIQHWVSVQR
FT                   DVTEEREQEEQLRRQKGLLEQTQRLAGAWEVDVETGEGTGSEAFYQILEMEGEPALTTE
FT                   KGFQFFAPEARPQVREAFERCVETGTPYDLELPVVTAEGHRRWVRTVGGPSETSEGEVT
FT                   KVAGALQDITPRKETEEKLRRSREQLSMAVEGGNVGTWNWDLETDEVIFNRRWAEMLGY
FT                   SREELDFDFSTWEALVHPEDLPRALQMLETYIEGDAGTYDPEIRMRTKSGGWKWIQTIG
FT                   RVVERDGEGAVTRAAGIHLDIDERKRAEAELQRSRERYRSLFEDSSSAILVHDLEGRIQ
FT                   EANPQAESLFGRSTGALEGLSVRDLHPSGESEVATEKRAALRDGAAYQAVARYERADGS
FT                   AFWGEVSASVTEIGGRAVARTLIRDVTERVRSRKKLEHYREYTDRLLDAIDDLFLVFDE
FT                   EARLTRWNDRVAAVTGYADEALGGMEALSFVPEEERERVASQIADGFMTGHAKMDIPLR
FT                   RADGTTVPYEIVGNLVDRPGEGFRVACIGRDITARRRRKQRLERQNDLFERAQEIANVG
FT                   AWEYDVRKEKSTLTDQACRIHGISPDRDLTPERSLAFYHPDDRDAVAAAFRRAVEEGVP
FT                   YDIEVRLMTQEGEERWVRTRGEPQLDTSAAEAANGDASKGQDSSQGEIVRVRGTVQDIT
FT                   ERRERRRELEQADTMFRGAQDALFLIDVDHAGGEPSFAIEKLNPAYEEATGMSAASVRG
FT                   KTPVAAIGDEAGRFREAQYQKCLDQEKPLEYEEEIPLEGEMTYWETRITPVLVDGTVEK
FT                   IVGSTREITGRKQQEQLRRQRRQKVEALYEATNQLLRAEGKEAVGALLVDLIDDTFDYA
FT                   GTAVRFAKDGRLVPTSVSPALQAHMPERQPYDFDEETPVAEAYRTGQTQVYHDLREGDS
FT                   AVKWGDIRAAAYVPMGRHGTLSVGSLQIGEIESFDRHLIEVIADYATLVLGRVDREAVL
FT                   RGAKEEAERARREAEAASQAKSVFLANMSHEIRTPLTSILGFAEAIGEEVGGDNQTGKT
FT                   DRSDLDLPALRQFAALIESSGERLMNTLTGVLNLSKLEAGEMNLAPEPVDLAAEAEKAV
FT                   QEFAPQARDAGVDLAAEGGQDAVWARADEGGVQIVLRNLLSNAVKYTGEGGTVRVSART
FT                   DGKQDAVLEVVDTGIGMDPARVEDLFEPFRQESEGLAREYEGTGLGLAVTWKALQQMEG
FT                   SVEVETAKEEGTCFTVRLPAARVENGLDEP"
FT   CDS_pept        complement(214335..216467)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00171"
FT                   /product="Putative methyl-accepting chemotaxis protein"
FT                   /function="Respond to changes in the concentration of
FT                   attractants and repellents in the environment, and
FT                   transduce a signal from the outside to the inside of the
FT                   cell"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00171"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23092"
FT                   /db_xref="GOA:D5H4Y7"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y7"
FT                   /protein_id="CBH23092.1"
FT                   /translation="MYLPSQRRPGTSIWGWDDVGAGPRSGLKGGVRRFLPRVLRAVAQF
FT                   LLPKCYRFCPPSYCFPGPMCPFDQESALNQQMRRRAGRSLSRSAGDGPGGGKSGTRLAS
FT                   RLLLAFGATALLSAAAVTGACLAGSVWAAGGSLLVGGLLAAVLSAHVARTAGQAGAHRE
FT                   ENRPRKTHAGNEGERMQALTQLMSRTSGEDDLESAFRTFLAEVREVTEAKYAALSIFND
FT                   DGDIAEFFTLGLTEEQKERIGGLPEGEGLLGYIHEQQGMLHLDDMTQHSESVGFPDGHP
FT                   PMQSLLAAPITYQGRPLGNLYLSDKEEVITFSGADAQFVESASEAAAVLINEKEFRIEN
FT                   QRVRQRLRHETEAIASVLDRLADGDLSVDIPQDSEDEDIARVWDRLQGTVDNLRKMVGQ
FT                   VREAAESTSASASQISASSDQMAASAEEQSAQAEEVAAAVEELNQTINENAKSVQRTAE
FT                   AAETGGKEARRGGEVFDKTAEKMEEIAEVVDRAASTIERLGDSSEEIGRVVDQIDEIAD
FT                   QTNLLALNAAIEASRAGEEGKGFAVVAEEVRELAEEADAATDEVAGIIEQVQSEAQEAV
FT                   ERVRQGTERVDEGLKLTDQAGDALEAIVDSIEEVEERAEEIAAASEEQSTTSEEIARSI
FT                   QSISTAARESAAGVTQVSGSADELDALTERLRRGVRQFNLETEAGSGQTQPPGPTPQER
FT                   APSHGGNGHHSTTASS"
FT   CDS_pept        216861..217070
FT                   /transl_table=11
FT                   /locus_tag="SRM_00172"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00172"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23093"
FT                   /db_xref="GOA:D5H4Y8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y8"
FT                   /protein_id="CBH23093.1"
FT                   /translation="MTIALIVVLGGIVAVLFFLVMIARLSTEEEKRAPRKRDEGILREA
FT                   LTGFVVGIALPAIVFLSFFLFFAG"
FT   CDS_pept        complement(217251..218870)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00173"
FT                   /product="putative membrane protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00173"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23094"
FT                   /db_xref="GOA:D5H4Y9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Y9"
FT                   /protein_id="CBH23094.1"
FT                   /translation="MSSALRAWLHTALSDLRTRLRDRRLLMMVAACVYLGHLVLAGRIE
FT                   LTLVDRSYRGAANAAWMGTVLSLTAAFLLTLFGFYLVRGALSRERQGRTAPLVAASPVR
FT                   SVTYLLGKWTSGTLFLLVLAGSMAVSLAVLFVLRGEGLPAPAPLLTPFLLFVVPTAAVV
FT                   TAVALAFECLPGLGGTVGGILYFFGAVAATVAPVLGAAPVDLLGMGVIHDSMSQAVLAQ
FT                   YPEADPGAMFSFGYYRAPAEQLKTVQWDGVAVTADLLARRAGLVLAGGALAAGAALPFD
FT                   RFDPSPSWRATLRSALPGPNTSTPKTEATSTEPPATAGPPTAGHPSGPEGRPDAPAPAE
FT                   SAPWSLLGSLSAPVALRPFGLFAVECRRALRRRSGTWQVGALVLVGAGLWVPGSTGLLV
FT                   VAWLWPLPLWSDLGARETATRTAPLVASSPYPRAQRVAAWAVGAAVPLALLAGPLLLGG
FT                   HWRALVGVLFVPALGLAAGRLSGTPRLFEIVYLVLWYVGLASRQAALDFGGVAHAPPGT
FT                   LVGYGLAAAVLLVGAVTGSRTA"
FT   CDS_pept        complement(218867..219745)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00174"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="Responsible for energy coupling to the transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00174"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23095"
FT                   /db_xref="GOA:D5H4Z0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z0"
FT                   /protein_id="CBH23095.1"
FT                   /translation="MELQIDDVSKTYGDGTEAVRGVSLTVSEGLIGLLGPNGAGKSTLM
FT                   RLIATITTPTAGTLRWNGTDIVDRPVAMRRSLGYLPQDFGVYPELTAEEFLHYMAALKG
FT                   VPGGAARPRIDTLLETARLEEARGRRLGGFSGGMIQRVGIACALLNDPDLLVADEPTVG
FT                   LDPEERARFRALLTDLAEERVVLLSTHIVSDVEATASRLAIMHDGRLAATAAPEALIDR
FT                   VRDRVWEWVVGHDELGRVRDAYQVTKATRGPGGIRVHAVAEQPPSAGATPAEPTLEDAY
FT                   LSLLSGPTSPR"
FT   CDS_pept        complement(219814..220734)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00175"
FT                   /product="Conserved hypothetical protein containing CAAX
FT                   amino terminal protease domain, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00175"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23096"
FT                   /db_xref="GOA:D5H4Z1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="InterPro:IPR042150"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z1"
FT                   /protein_id="CBH23096.1"
FT                   /translation="MPTGYPGLPDVLLSLFHTLQHLMPETIRSNVRRFPTATFFILTFL
FT                   FSWGYLGLTFGLIGTGASGPVQVPFAWGPLFGGLLTVWLLGESVSGWLGQVGRWRAGLR
FT                   WYLLGIGILVVGKEMPNLVAWLLGADVSLVAGTEVPIVGYLVSMGITLFVAGALEEFGW
FT                   RGFAQVRLQKQYGAVAASLFVGGMWALWHLPFLLLGVGGFDSFYVYVPEVMAFSVLLGW
FT                   LYNATKGALPVVMITHAAHNRPDLLGVSGQMPPLAQSVPWDGVFYVLVMAVVIWQVGAR
FT                   TLSGDGRLPEIPGKAPASASQAPAE"
FT   CDS_pept        221793..222266
FT                   /transl_table=11
FT                   /locus_tag="SRM_00176"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00176"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23097"
FT                   /db_xref="GOA:D5H4Z2"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z2"
FT                   /protein_id="CBH23097.1"
FT                   /translation="MNEQETTLRRAWSWASRIGGAALMLSLIGVLAWVFAPPGGGWLPA
FT                   GGAAIGGLIGWKSPTSGSDVTSGLGRIDAGLTYAVRGAALGLLVLFLYQSVRMSPPKEP
FT                   DGQEPERETLAPTRPLPSTESARPLGAGRGLTETDSVGPGPSLKEIRLGGASD"
FT   CDS_pept        complement(222296..223258)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00177"
FT                   /product="Vitamin B12-dependent methionine synthase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00177"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23098"
FT                   /db_xref="GOA:D5H4Z3"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR017226"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z3"
FT                   /protein_id="CBH23098.1"
FT                   /translation="MRDLSTRLSGGPVLLDGGLGQELIRRGMPGTEPSLWSANALTEAP
FT                   DLVQEVHEEYLRAGADVITTNTYATPPERLSEAGLDGRAEALNREAGRLAERARAAVGR
FT                   DALIAGSLPPIRGSYRPDLVGEAGEIEPQYREQAGYLAPHVDLFLCETMSTPGEAQAAA
FT                   RGAASTGLPVLVSYTIADPSSPEDAEPRLRNGESLEEAVEALSGLPVEGVLLNCSHPES
FT                   ISAAVPVLRQLTDRAVGAYANAFTHIPDGFDERADALDSDARPDRREDFAPEAYGRHVE
FT                   DWLSAGADIVGGCCEVRPGHIAHLRTTVDGAADARRAAE"
FT   CDS_pept        complement(224069..225697)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00178"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00178"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23099"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z4"
FT                   /protein_id="CBH23099.1"
FT                   /translation="MRGSSGLAPVGCYTLFLETEGCNGISTREGGALSGSDSFTPAAIA
FT                   IQCAIRCSAGRPGDGSRYEQLSWGPVPWPSPPGRAGRARLPIPPHEGRPPAHARQVVDL
FT                   FSAPFWGPFRVDVFPPVRSGPSRAAGTQHFTGEENAGRHASCQLGGPQAGIKTQKALND
FT                   DMIRDEDIPLRNPSVEAHRVTGGAVLHDLGRDQVFAVTALAREVWEHCDGNTPLQKIDR
FT                   RVSDRADIPSPTSPDGLRQVVSHLSDQDLLFVHRPDPTADGGAAVGRGDQADGPGATTL
FT                   NVVFGNHQVKVKTTTPRLERAVRRLFHGLIGRETGAETVDVLTAEEAGDGVSVRSPQAR
FT                   GGEASPLTAAVQRLKRTVLLRFMEARRDLIWLHAGAAARNGTAVLVAGPSGGGKSTTIA
FT                   DLCRSGWTHVSDDLTPYDPDTGRVVPLPVTIAYRQPGEKQSLEEGPSGLPKTHVDLEAG
FT                   RLQDAPVRPEAIFFPAFEADRPAGVEEQAAPEAAVSLVESCQNASRHRGEAVRELSRLA
FT                   GRVSSFRLRHDGQTDIGELLAPVLG"
FT   CDS_pept        complement(226322..226696)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00179"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00179"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23100"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z5"
FT                   /protein_id="CBH23100.1"
FT                   /translation="MCTCNPCGLLCKRSDQFTRSSARVDARIADEAHGHTSREIVAAGR
FT                   PAGLARGLTPGRPSPSSIYFCFGTELGAGPAPPKGPRQEDPQKIAESRPTSEAPETKRE
FT                   LAVRGAEVAVRYGRLLEGGA"
FT   CDS_pept        226733..226963
FT                   /transl_table=11
FT                   /locus_tag="SRM_00180"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23101"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z6"
FT                   /protein_id="CBH23101.1"
FT                   /translation="MRRPSFTSLLVTALVAIVLTAGCDLTGGQEDENPPDDGTPSPSPS
FT                   LSGEQPVPFRNGERVPVADSVIPLSTPSRAG"
FT   CDS_pept        227089..227844
FT                   /transl_table=11
FT                   /locus_tag="SRM_00181"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00181"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23102"
FT                   /db_xref="GOA:D5H4Z7"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z7"
FT                   /protein_id="CBH23102.1"
FT                   /translation="MPPGGTRGGVRVSTRRAVRGRWASDSGAIHCADSQFESAMSQLEY
FT                   LVALISIIVGLGLTDLAQSVRELIRPGYTVKWDGLPLAWSVFVFLMTILLWWQGFAALK
FT                   EPDIGGGAGPFFLSFLLYFLILYLCCAFALPDPDWERASVGSGPAGATNPAGPAERGVD
FT                   LEAFYFSTGHRRWFFGLLIGFWVALMVADQLTFESGGPAQRLRSVLPVLGLCAITAIPI
FT                   LTDRRWAHWVVVTVLGGLIGAQAVRDILL"
FT   CDS_pept        complement(228033..228827)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00182"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00182"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23103"
FT                   /db_xref="GOA:D5H4Z8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z8"
FT                   /protein_id="CBH23103.1"
FT                   /translation="MPSSGSFMLSPAPAPCPSGRRFCRAQLTHLPAMGNANASQSPETD
FT                   AGKEAGANREADADRKARAAGEEETQGGTGPRPGSPPGPDSSSGPAPNSGSDPNSGPGS
FT                   SHGGAGRQTEASLPGTGRAGEKEESASSARARPTGTQPARRQRDWDAFAFQHEKLKHLT
FT                   TVGLVLSGGIITLFQSEMMEPSPLALIALVLPVVSSMLTLAAQVSLGNEASTTEPMAAE
FT                   RTRDSFGVPVAVHWVGLAALFLLASSLGWLASFFFRDTGLLP"
FT   CDS_pept        complement(228989..229819)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00183"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00183"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23104"
FT                   /db_xref="GOA:D5H4Z9"
FT                   /db_xref="InterPro:IPR001969"
FT                   /db_xref="InterPro:IPR021109"
FT                   /db_xref="UniProtKB/TrEMBL:D5H4Z9"
FT                   /protein_id="CBH23104.1"
FT                   /translation="MTTEGDSLRMLTDTGGGTAVVLSSSAVRRTGRPIIDTLQGRRPMQ
FT                   VVPVPAFRTEGPVPQTRAERAIIALSRRAQLVGYDDGRLGMHWFAGRIWTFDYGDETLR
FT                   LHDTADELSFAPDHTVDLAFRTDSTGTRVGHHPRVEASIDGTTRSFLFDTGATAVLTDS
FT                   AQGRLDAPRRIASGFIRASLFERWTNKHPDWTVVEGASPALGGSPLIRVPEVEIAGHTA
FT                   GPVWFERRPDRTIQKTLAGSMDRRVAGALGGSLFRHFRITVDYPNARAYFQRLD"
FT   CDS_pept        complement(229829..230173)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00184"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00184"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23105"
FT                   /db_xref="UniProtKB/TrEMBL:D5H500"
FT                   /protein_id="CBH23105.1"
FT                   /translation="MRTGRSSTHRGRPSIRGQPDLCRSIQGTAMPNRGSRCRGSFPRRR
FT                   ASRTALHDRTLLIALIHATVRCFSVSFPRRPVAILAFGLLAGLLGAKTSFAQSPPGGRV
FT                   LPADFVQHRI"
FT   CDS_pept        230509..231087
FT                   /transl_table=11
FT                   /gene="dsbE"
FT                   /locus_tag="SRM_00185"
FT                   /product="Thiol:disulfide interchange protein dsbE"
FT                   /function="Thiol-disulfide oxidoreductase which is required
FT                   in disulfide reduction during c-type cytochrome synthesis.
FT                   May accept reducing equivalents from ccdA, leading to
FT                   breakage of disulfide bonds in apocytochrome c; following
FT                   this reduction heme can be covalently attached"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00185"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23106"
FT                   /db_xref="GOA:D5H501"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5H501"
FT                   /protein_id="CBH23106.1"
FT                   /translation="MPNPSVPHCYLKARVLVLAVSAASLLGLSAGAARAQPGPAEIGKQ
FT                   VPGFEIEALRDSGRAITPSDFEGRYVLLNLWATWCAPCIEKLPALREARRRYSPERLAI
FT                   LNVSFDRSRPKATAFLEKREMPGRHAHASGGLMGEFGDKFARMPTESASMQMRGLPNMT
FT                   LIGPKGKVADIAAGESADLLEMLSERLGR"
FT   CDS_pept        complement(231210..231848)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00186"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00186"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23107"
FT                   /db_xref="UniProtKB/TrEMBL:D5H502"
FT                   /protein_id="CBH23107.1"
FT                   /translation="MRYAHSTCFCLLLVAAFLPGQAAQGQSVQARPIHGPPIHGQPTGP
FT                   TDRDTASRPAAHPQPEPHRPVPPQKAAATSPKRPGRAVALSLGGTLLLAPAYGAGLFVG
FT                   PAFGHFYAENHSQAWVGIGIRTGTALVAISAAESAQNQQGVSEAPNFDGLEWLLIGAAA
FT                   VLGSGIYDTATAGRAAREYNRTHGLRARVTPTAGGPRGEQVGLSVTLQF"
FT   CDS_pept        231884..232225
FT                   /transl_table=11
FT                   /locus_tag="SRM_00187"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00187"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23108"
FT                   /db_xref="UniProtKB/TrEMBL:D5H503"
FT                   /protein_id="CBH23108.1"
FT                   /translation="MRSHDRTRPGGKTGHGSGERGLVRSVRGTCPLSCEGRADVDPEAF
FT                   DTAATPDRRVPSCLKAWARQNRLHEAMRGTAQVPPAVRRPGLATWTWAAGLPAGGNAPA
FT                   LLRQATRPT"
FT   CDS_pept        232306..233904
FT                   /transl_table=11
FT                   /locus_tag="SRM_00188"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /function="Chemotactic-signal transducers respond to
FT                   changes in the concentration of attractants and repellents
FT                   in the environment, transduce a signal from the outside to
FT                   the inside of the cell, and facilitate sensory adaptation
FT                   through the variation of the level of methylation."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00188"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23109"
FT                   /db_xref="GOA:D5H504"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:D5H504"
FT                   /protein_id="CBH23109.1"
FT                   /translation="MSSTTASRGKEEGVVSKALYSVGALATALETATPDFLRRRFGLRV
FT                   LLAGPLCSVIGFPFAAAYLIENAHLAFVVAGGGVAVTGFMVYAEMYWLLRKMNEKVIEI
FT                   EGGAHDISFDYERLDSIGVIFETFEGVARDLGDSIEEANAAQRRAEKEAEQAREAEQKA
FT                   AERKERLQDGVDTMLKATDRLAEGDLTTRLPEGQGGAIGRLFEGFNEAAETMGQAMGEV
FT                   RRATKSVASATEEISSSSDQMAASAEEQSAQAEEVAAAVEELNQTIGENARSVQSVADS
FT                   ASDGSQQAQDGQDVVLEATAKMEEIAEEVQETADRIERLQASSEEISQVVETIDDIAGQ
FT                   TNLLALNAAIEAARAGGEGEGTGQGFGVVAEEVRELAEDTDQATSEIGEIIGEVQSEIK
FT                   EAVESARRSRSNAEDGIDLARRASGRLEEIVRSIEAVEAKADEIAAASEEQSTTSEEIA
FT                   RSVQSISTAAQQSAEGVTDVSDVSERLREVTSTLQRRVRAFEIERETRQGPSSPSPASG
FT                   PVPHQQGDGARNEKR"
FT   CDS_pept        233971..235806
FT                   /transl_table=11
FT                   /locus_tag="SRM_00189"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00189"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23110"
FT                   /db_xref="GOA:D5H505"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:D5H505"
FT                   /protein_id="CBH23110.1"
FT                   /translation="MATLVNFFLPDSLSEGSSERDLGYQAIMMTLIIMAAAISYSIAYI
FT                   RWEFYVGIAVLWGNTAALSLVPVTIKNGAPPSVGAKITSTVMLVLISLLVAFDGGITSI
FT                   TTPWFAVAPLVALLLTEKWFAGLITGVTVVEIVLVYTLQVTGAVSFPSGIAEVMVGEAR
FT                   VTSYAGFVLVIFGVAVVFKNRQMRAMKKAKSATEEAKAQKEETEEMAERLKRQKDSVEE
FT                   QVEEATQELQAQKDALSKHVSQMLEAMSRFADGDLSVRVRTDRDDEIGDLFDGFNQAVG
FT                   SVQQILSDVKEATRQTASTADQISSSSDQMAASAEEQSAQSEEVAAAVEELNQTIGENA
FT                   KCVQSVADAASDGTRQAEKGQEVVSEATAKIKEIADDVQDTAETIGRLQDSSEQISTVV
FT                   ETIDEIAGQTNLLALNAAIEAARAGGDKAGSETGQGFAVVAEEVRELADETDQATSEIS
FT                   SIIGEVQSEIEEAVQAARRSSSNAEEGIDLSEKASETLGEIVSSIERVEQKADEIAAAS
FT                   EEQSTTSEEIAQSVQSISTAAQQSAAGVTQVSDVAGELESVTGKLQRRLQRFTVDEEGS
FT                   GAGEAETGETAGPAGSGRTGAVSGGRPLGDGAQAA"
FT   CDS_pept        236046..236303
FT                   /transl_table=11
FT                   /locus_tag="SRM_00190"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23111"
FT                   /db_xref="UniProtKB/TrEMBL:D5H506"
FT                   /protein_id="CBH23111.1"
FT                   /translation="MPLRCVSLKWPDCREKASARAPAHLQGPPAHVHVPGTDALCGRVE
FT                   PGASLFPAAGGRDLPTAVPATAVTLTSQFHWTRPCSDHDR"
FT   CDS_pept        236293..236610
FT                   /transl_table=11
FT                   /locus_tag="SRM_00191"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00191"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23112"
FT                   /db_xref="UniProtKB/TrEMBL:D5H507"
FT                   /protein_id="CBH23112.1"
FT                   /translation="MTVEVYHRQHSPTGTGYNVFEERPDVAWSDRQHEYERSATVEVEA
FT                   PDRRDALRRTFRLMRHKPSTTDSGAVVKLYRDSVRRSSIGDVLVVDGAAYEVQDGGFER
FT                   I"
FT   CDS_pept        complement(236675..237289)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00192"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00192"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23113"
FT                   /db_xref="GOA:D5H508"
FT                   /db_xref="UniProtKB/TrEMBL:D5H508"
FT                   /protein_id="CBH23113.1"
FT                   /translation="MSQLEYLVALVSIIVGLGLTDLAQSVRELIRPGYAVKWDGLPLAW
FT                   SAFVFLFTILLWWNGFSVLESASSAGEAGPRFLSYLLFFFLLYLCCAFALPDPDWEMSV
FT                   AGSGDGSAPAVDLEAFYFSAGHRRWFFGLLTGLFVALGVDNQISFAWGSMQDRLVSALA
FT                   IGGLATASAVPMVTDQRWAHWTAVAMTLGLIGWRAARRILF"
FT   CDS_pept        complement(237780..238166)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00193"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00193"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23114"
FT                   /db_xref="UniProtKB/TrEMBL:D5H509"
FT                   /protein_id="CBH23114.1"
FT                   /translation="MPDYMRGSCVSLAIALHDITRWRLVKIVDEQNARRHTGGPRAPGG
FT                   PALHWAVEHPSGHLLDWEGLRGKDEVVSAYAPRAQPGTSVRWRYATREDAVDERRQTGA
FT                   CTVEEAKEDAHALADEFLPAGTAP"
FT   CDS_pept        complement(239448..240029)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00194"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00194"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23115"
FT                   /db_xref="GOA:D5H510"
FT                   /db_xref="UniProtKB/TrEMBL:D5H510"
FT                   /protein_id="CBH23115.1"
FT                   /translation="MYLPKAPAEAGRHRKAYLAAFAFAVLLAAPAHSQSRPAPDTSRAS
FT                   APHAPEAPGAEPQRKDPKRAVWYSVGGTVLGAPLFGAGLLLGPAAGHFYADNNRRAWVG
FT                   IGIRTGGALLPILATAGRSGYAGLGAFLVTAPIGGAVILVSAIYDIVVADNAARQHNRA
FT                   HGLRVSDVRVVPTAGGPMGNQVGLTVEVGL"
FT   CDS_pept        complement(240443..241006)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00195"
FT                   /product="Putative PKD repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00195"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23116"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:D5H511"
FT                   /protein_id="CBH23116.1"
FT                   /translation="MSDPPSDSGVPTAPGRGRPTLHIGGATVPEETVVISVSGGTILEY
FT                   ELSDEAQDPALTDGSRIEARFPSYGTYNVTAYVDDGSGTGESVDAILSKPVCIAPCPHL
FT                   NISPSGTVPTGAPVTFDAGASAGDATGYEWTIDGPEPARGTGETLSVSFSVPGDYSATL
FT                   EVEGRNGAAARTQAGFTVAATVSA"
FT   CDS_pept        complement(241091..241978)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00196"
FT                   /product="Conserved hypothetical protein containing
FT                   hydrolase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00196"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23117"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H512"
FT                   /protein_id="CBH23117.1"
FT                   /translation="MGCVSWPHCFSGLRSLMPVSPHALVLDADNTLWDTNATFRRARSA
FT                   MIQVLQGADGEEARPDGEKRLETTDVLYRLSQHLPSSGGEGPDLEQLARAAAFYMSGLR
FT                   GGPEAGIQTSRLRWASEQVRAGRQPPGCDRSRARKAAEAFRSALSAPPPLLDGAASLLR
FT                   GVRAWRTARPDRRTSVLFSEGAPDRLEVAFDAHGIGGGQYFDDIVLREKTPDTFRDVCH
FT                   AIGNAVDLPEPQAAEVVVIGDSLQRDIRPANATGCTTLYCPGDLWGRETPEEASEQPDY
FT                   TLGTLDEALRILDL"
FT   CDS_pept        complement(242109..243080)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00197"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00197"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23118"
FT                   /db_xref="InterPro:IPR025345"
FT                   /db_xref="UniProtKB/TrEMBL:D5H513"
FT                   /protein_id="CBH23118.1"
FT                   /translation="MRRLLLFAIFGLAALVGCDTAALETESQVVVEAYLEAGEPMDSVR
FT                   LTRTARASAEYTPERTAVQGADVQVQRLNDSGGVAATVPYTETDSTDGLYIPETPATVE
FT                   PQGTYRLRAAPPEGPVVTAETTVPAPVEAVRTQNDTTTYPDPDDENSDPPQFELTVRPG
FT                   PSALERQNVYVLTSRSLLDLQSIPASPPDSVAGRLLTPFYLEQYDADSDTLASFRVNSS
FT                   GLLNEANFTSNDDGTVSITLPWLAVAFYGPNQIRASVVDDNLYDFLRTQSAQQMSLAPG
FT                   EIPNIDEDIENGTGIFGSFAEASGKVLIRPPDLTVDDIPLRP"
FT   CDS_pept        complement(243151..245460)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00198"
FT                   /product="Conserved hypothetical protein containing
FT                   TonB-dependent receptor domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00198"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23119"
FT                   /db_xref="GOA:D5H514"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H514"
FT                   /protein_id="CBH23119.1"
FT                   /translation="MTEHSRSVFTLAGLCAALLLTLGATPAGAQESASLSGYVRDAETG
FT                   ETLIQASALVKGTSRGAATNSEGYYTIQDLSAGTYTIVFSYIGYQNRVEKITLSAGEAR
FT                   RLDVELQPAGVAGEEVVVTGEAADEEGSVSMDQVETALIKELPTAFQPDVFRTLKLLPG
FT                   IKTASDYSSNLYIRGGGPGQNLILLDGTTVYNPTHFFGFFSTFNPDAIKDVELYKGAYP
FT                   VEYGGRLGGVVDIRNKDGNRRETSGGLSVGLLASRAYIEGPYGGSGDSADGSYMVAVRR
FT                   STLEPVLAGLRRTDTDGIPDAFAFYDVNAKVNYDAGPDDKLSLSLYGGQDRLDLQFQTA
FT                   GRFDIDYGNQTISADWTHLFGSQAFSTLQVTGSRYRSTPVANIANTEFEQTNGVDDLSV
FT                   NADIEYTPGSNHTLKGGAQWSLLSFQLQESFDGSVTFDQDLRSQQAALYVQDTYKPTGD
FT                   WTLKAGLRGSYFQKGSFWRLSPRLSAEYSLSPSVQLQAAYGRYHQYITLETSQLFTGFD
FT                   TWLMSDEGVPPSSGDQLALGLTTQFGDGWQAEVEGYGRTMPGLFREDPFSSGTAGVPYA
FT                   ERFQIGDGRAYGLEALLRRETGDFTGFLSYTLGRTERRFPNINETQAGGAQYYTPKYDR
FT                   THDLTLVANYRLTRGWRLTSTFSYSTGQPYTRPERQFSTVDSPFQSATDERTVLISPFN
FT                   NARLPPYHRLDVGATRSGRFFGIADYEFKIQLINAYARRNVWFYQYERQDDGSLERTEI
FT                   PQIPVPIPNLSFTLTF"
FT   CDS_pept        complement(245921..246952)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00199"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00199"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23120"
FT                   /db_xref="UniProtKB/TrEMBL:D5H515"
FT                   /protein_id="CBH23120.1"
FT                   /translation="MRNRLRSAALLLAFTLVGAGLLGCDQGGTSPPMTAEEARRQIIES
FT                   ASGLQGAAATFEQTPLARLSEAMMTSGSEGRTVSPWGKALTSGLGAVLDTTGGDFNYDA
FT                   STGVYVWTSDTQAWRQERPADSLILRFPESKGAPSNNATFTLSRYETRSVTVGGSTEQV
FT                   PTEIGASLALENEGEIFSVDLRDVGFTFLGIPQSFSLDVTANPLAFTTSLEPGQNGTFQ
FT                   YEDRFRNDGQPVTATTATVDLSPDDAEGDESTPVRVEGTTQVGQDLAIEYAADVGALSA
FT                   LEDASADEISDRVSVDVLLQGNQVATLRYDGSAEQIIVKYTDGTTEPLSDLLREIGVSG
FT                   GAS"
FT   CDS_pept        247775..249556
FT                   /transl_table=11
FT                   /locus_tag="SRM_00200"
FT                   /product="sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23121"
FT                   /db_xref="GOA:D5H516"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H516"
FT                   /protein_id="CBH23121.1"
FT                   /translation="MVPILLALALPYVGWRLLQSPSGAPYLPDVAKYALVGSLGLGLLA
FT                   GLVVGVQVLQEEIKPAVIVLQLTTVGGIAGLCVGYSTAQLKEATRDAHDDRNRLENLLD
FT                   GLPVPVVHGRVEGETLNILAANAAFERAFGHDPEESIGENLYDLIRPGDTQRGTGRINH
FT                   QALDEGVAEAEVQYETPDGQRKFQLRVAQALDSGASETYSVYTDITKRKRREERLQTLY
FT                   ARLQLALDVSDTGTFDWEIQADEVIWDETSERLFGYEPGGFPGTFAAWAQRVHPDDLPG
FT                   VREDIEQAIDAQEEFRTEFRAQIPGGQQRWIEGRGIVEYDDRGEPIRMLGIHTDITERK
FT                   KREQTLREAKERAEEAARLKSAMLANMSHEIRTPLTSITGFSEVLEQNLSGQHGDFATK
FT                   IRKSSERLQRTLESVLHLSKLESSVHKLEREEVSLRAVVEDVTAALRDDLTEKSLALQT
FT                   EIPDSPVSGISNEDALHRICRNLLENAIKFTPAGGCVGIRLLDEGRSATLEIEDSGIGM
FT                   DPENVPGLFQAFRQESEGMAREYEGSGLGLSIVKRLTDELGGEVDVETEKGEGTCFAVT
FT                   LPLTDDAHERSDETVGG"
FT   CDS_pept        complement(249570..250220)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00201"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00201"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23122"
FT                   /db_xref="GOA:D5H517"
FT                   /db_xref="UniProtKB/TrEMBL:D5H517"
FT                   /protein_id="CBH23122.1"
FT                   /translation="MSQPEYIAALLSIIVGLGLTDLAQSLRELVRPRRTVNWHWLPLLW
FT                   AATAFLLTVQFWWNSFSFLKGATSEFFLPYLVAFLLLYLTCAFALPDPGWEPPGSETGG
FT                   GFSIESLGTRAPLDLRAFHFSTAHRRWFFGVFIAFILTSQISSQIASLFAERSVNPQEI
FT                   PGNLILVALLGTLVWTGRKWAHAVISVLCFLGIGWATLATILGWTQFGELLGL"
FT   CDS_pept        complement(250520..250738)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00202"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00202"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23123"
FT                   /db_xref="UniProtKB/TrEMBL:D5H518"
FT                   /protein_id="CBH23123.1"
FT                   /translation="MASCRSRRPFSRRSEARRSGEGLLPGPAGLRAGPRRGTGTVSGRE
FT                   GDLQAATGGVHEGMPPVQVSVKTEAPP"
FT   CDS_pept        complement(250870..251151)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00203"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00203"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23124"
FT                   /db_xref="UniProtKB/TrEMBL:D5H519"
FT                   /protein_id="CBH23124.1"
FT                   /translation="MLDKENEGALPEGETFPRRSRFYVCLPHVRTFCMCGSASAHMLGL
FT                   KTPLGGPVHATSGPAGATDGPSSPDDLLVSGACSSRGLSFRGPALGGI"
FT   CDS_pept        251167..251304
FT                   /transl_table=11
FT                   /locus_tag="SRM_00204"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00204"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23125"
FT                   /db_xref="GOA:D5H520"
FT                   /db_xref="UniProtKB/TrEMBL:D5H520"
FT                   /protein_id="CBH23125.1"
FT                   /translation="MQTARRSQTTDRPRKRHDRKRDASNFDDYMLAVVSVALVGFLIAL
FT                   "
FT   CDS_pept        251539..252435
FT                   /transl_table=11
FT                   /locus_tag="SRM_00205"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /function="Responsible for energy coupling to the transport
FT                   system"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00205"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23126"
FT                   /db_xref="GOA:D5H521"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H521"
FT                   /protein_id="CBH23126.1"
FT                   /translation="MTLTIENVSKTYPNGTRALDDVSLTIPPGMFGLLGPNGAGKSTLM
FT                   RTVAALQEPDTGSVHLGDINALEEKQTLRRRLGYLPQEVGVYDNVSAETLLDHFATLKG
FT                   ITDRSERRRVVDALLNRVNLDGARDQNLGGYSGGMKRRFGIAVALIGDPDLIIVDEPTA
FT                   GLDPAERVRFLNLLSEIGEDSVVLLSTHIVADVRELCTQMAIIREGEIIFEGAPEAAIA
FT                   DLEGQIWRKTVTKETLPEHEETCNVVSTKLVAGRPVIRVHASARPGPDFEAADPDLEDV
FT                   YFTQMRTGAREDAPVVA"
FT   CDS_pept        252561..256328
FT                   /transl_table=11
FT                   /locus_tag="SRM_00206"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00206"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23127"
FT                   /db_xref="GOA:D5H522"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:D5H522"
FT                   /protein_id="CBH23127.1"
FT                   /translation="MLPHVRAVPCPEHDVLVAPAPTQELLLNLSDSMFASLLAQEVRHR
FT                   LRQLSTHVYFGIFFGVSFLLMNALGGAFADANITIFGMGPNTNANSPFAINATTLFVSL
FT                   LGLMITAPFMGQSVYRDYDSGIHPLVFSTPVSKAKYLGSRFLGAVLVHLYLYAGLTAGL
FT                   VLGAAAPWVDPSQLGAFRPMAYLQPYLLYLLPNLLWVGGLFVALPAFTRRMLPNYIGGV
FT                   LLFMGYNIAAVLLGGDALRNSTVASVVDPFGLIPTQQLTRYWTAAEQNAQLVPLEGVVL
FT                   LNRVLWLGVGLAVVAGLYAGFRFAHLPGQQSGDDDETGAEGPSLAEVTPTSLIHAVDLP
FT                   GAALSEHWGARLRQFTSIVRRSFLYVVRDVYFYAIVGASIIFLVVAASQSGQINGTPVQ
FT                   PVTYHIVGQLGSQFSLFMVILITFYAGQLVWRERDVGVQQVHDTLPLPTSVTLSAKGTA
FT                   LGLVCATLMLVVLATGVATQLSYGFTDLNLGLYLTELYGVQLVDYLLYAALALTVHAVV
FT                   NHKYLGHFIVVAFFLGLAFSSQLGIEHTLWRYGSDPGLPYSAMNEYGHFAGAFAWHKLL
FT                   WAAVALAMATVARLAWVRGEESTLSVRLRQARRRLSPAVWGTLGVAGVVAFGTGTFIYV
FT                   NTTVWNSFRTSSEQTDLRAQYEKTYEQYATKPQPRIDAADLNIDLYPDRRDARLAGTYV
FT                   LVNDQSTAVDTVFIDTPADANVDRLSFGRAAETVRRDETYGVRLVDLAEPLAPGDSTSL
FT                   TFDTWVRNDGFTTGGSQTSIVHNGTFIGSGELPRIGYDAGAELSDRSQRDDHGLDPEPR
FT                   MRPQSDTSARMRPYVARDATWLDYEATVSTSADQVPLATGTRDSSWTTGGRRHMRFRTS
FT                   APTAGFFSFLSARYEEASGTWTPPDSSLNRGRPVDIEVFHHPTHDYNTGRMIDAVKQSL
FT                   TYYTRHFGPYQSREVRIAEFPRYAGFAQSFLGTIPYSESVGFIARVDPETDIDYPYYIT
FT                   AHEMGHQWWGHQVVSGPVWGATMLVESLAQYSALMVMEETYGRDKMKRFLEYELDEYLS
FT                   GRSLESREERPLMTAAASQGYIHYEKGSLVMYALKEYLGEETVNRVLREFLRANQYQSP
FT                   PFVTSEALVERFEAAAPDSVKGFVGDLFRKITLYDNRATGATYRETADGRYRVTLTVEA
FT                   RKQQADSIGASPTEAPMDLPVEIGVFAEERDVGAEDQRTLYRQTHRLTSGTQEITVTVD
FT                   EKPARAGVDPFTLLIDRETEDNVTAVTRAD"
FT   CDS_pept        complement(256919..258010)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00207"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00207"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23128"
FT                   /db_xref="GOA:D5H523"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:D5H523"
FT                   /protein_id="CBH23128.1"
FT                   /translation="MVGKRRCVFSPTDQGKLMGSQTAYIGLDVHSETCTMSWMDGDGVI
FT                   QGTESFETSEQNLIEKVGEIESQTKKITLEESPLAFWTARTLTGEVDEVIVCDPRENHL
FT                   ISRSIRKGDEPDAQALARLLRMGELKEVYQPENDRRALYKQACSHYMDLRDRQRVLKQK
FT                   IKSRLKRWGHLHIPGAKVFSQSGREVYLDELSHDRIRSQVESQYRLLDQTHTEKKAARR
FT                   QFLELGRQYPETQEFQEIPGIGPISAHTFDAYIQTPCRFATKQKLWRYCKLGVRKHSSG
FT                   GTQVRREKLDPAGHGELKALSHRAVREALGGEDENEVQASYRASLQRTGDETHARLNTQ
FT                   RKIPLGDVGALEERDRLQPEVIL"
FT   CDS_pept        258043..258396
FT                   /transl_table=11
FT                   /locus_tag="SRM_00208"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00208"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23129"
FT                   /db_xref="GOA:D5H524"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H524"
FT                   /protein_id="CBH23129.1"
FT                   /translation="MDVSSLSNQQVLTMPRTRPPYPQKFRDQIVELARNGRTPSDLAEE
FT                   FEPTATTTSGWLNQADRDEGKSAEGLSSDEREELRELRKKLRELKQERDILAKATAWFA
FT                   REKGDVPPKSSGS"
FT   CDS_pept        258514..259281
FT                   /transl_table=11
FT                   /locus_tag="SRM_00209"
FT                   /product="Putative Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00209"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23130"
FT                   /db_xref="GOA:D5H525"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D5H525"
FT                   /protein_id="CBH23130.1"
FT                   /translation="MLTKRIRQIHENSRGTYGSPRVHAALQAEGVRVAKKRVARLMKEA
FT                   GLRGVSRRKRPSTTVSGDTGRPVPDLVDRDFTASGPGELWVADITYVPTQEGYLCLAVV
FT                   IDAYSRKVVGWEMAGHLRSELVLEALNMATGQREPEETVHHSDQGSQYTAIAFGERCKA
FT                   EGVRPSMGSRGDCYDNAMCESFFATLECELIERDTLASQSEARLSVFEFIEGWYNPERL
FT                   RSGIGYQSPNHYEEEYHSRDHSHSAEPHSLVAA"
FT   CDS_pept        complement(259563..259898)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00210"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23131"
FT                   /db_xref="UniProtKB/TrEMBL:D5H526"
FT                   /protein_id="CBH23131.1"
FT                   /translation="MPRRCDTSCQRAPDRPGPRPPWSTALIQKGRSWPFGGGLLAVPTQ
FT                   TPTVTALRQQLFDFLKLAADQFDVSERVIGLFFGARQVMHGTLSPSKDLLKTVPDLSQP
FT                   PATGQDC"
FT   CDS_pept        complement(260443..260736)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00211"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00211"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23132"
FT                   /db_xref="UniProtKB/TrEMBL:D5H527"
FT                   /protein_id="CBH23132.1"
FT                   /translation="MFPPGSSLMAARFLLFLSDAVFRKVLLLEYLDGVEEVQVMFLYIR
FT                   LSLPVVPVEFHRAWRNIQPVECQWIGKDSDVCTSICVHKPFPENQVLGRDSF"
FT   CDS_pept        260945..261211
FT                   /transl_table=11
FT                   /locus_tag="SRM_00212"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00212"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23133"
FT                   /db_xref="UniProtKB/TrEMBL:D5H528"
FT                   /protein_id="CBH23133.1"
FT                   /translation="MVEIDPDAHLFGGKWFENAVLMGVSAERSVPQSASMRTFSSFLSW
FT                   WQGYQSRINKVIECTCRFRSTNVEAPVGPAWGRLSERLPCREF"
FT   CDS_pept        261351..261650
FT                   /transl_table=11
FT                   /locus_tag="SRM_00213"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00213"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23134"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:D5H529"
FT                   /protein_id="CBH23134.1"
FT                   /translation="MKCRMSESEFTKSTTVVAAEHTTSAEVEDETVILDLQEGLYYELN
FT                   STGSHIWKEIKEPIPIGRVVSTLTEEYEIGSEECLEEVISLLQDMEKNGLIEVE"
FT   CDS_pept        261647..262606
FT                   /transl_table=11
FT                   /locus_tag="SRM_00214"
FT                   /product="Conserved hypothetical protein containing
FT                   putative HPr kinase/phosphorylase (HPrK/P) (HPr(Ser)
FT                   kinase/phosphorylase) domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00214"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23135"
FT                   /db_xref="UniProtKB/TrEMBL:D5H530"
FT                   /protein_id="CBH23135.1"
FT                   /translation="MTRHLRTNTHHKVAKRINSYKAHGLRIDSEIGMPMFRVWERETGD
FT                   TADLEILEARLTEEEKVEELSDYVFSVDGNTVTYGAPDVGFVKVVGGKKILVDTGARPV
FT                   GRPVRLVVAGIGLATALHHRGYAVLHSSAVSVGGKAVLFTGHKQAGKSTMAAAFATRGY
FT                   PIVADDIVSVSVEGACTVYPGTTTPKLWQDSMSALGEQSFSAERVHPDIDKFFVSGLEA
FT                   GERERYNIGGVLSIRESENTYIEEVSFASSVRAIVEGSYISEEILSARGELESNFERCS
FT                   KVAKSSLVCELGRPKDYSEIDEVVDTVQKHIDKYDASA"
FT   CDS_pept        262603..264672
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="SRM_00215"
FT                   /product="Asparagine synthetase B [glutamine-hydrolyzing]"
FT                   /function="ATP + L-aspartate + L-glutamine + H2O = AMP +
FT                   diphosphate + L-asparagine + L-glutamate"
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00215"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23136"
FT                   /db_xref="GOA:D5H531"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D5H531"
FT                   /protein_id="CBH23136.1"
FT                   /translation="MSGISGIVSRSRNPSIRAHIDMMTRSLDHRGPDGSGVWVNEARNV
FT                   ALGHVLLATTPESKAERQPLSDMPGGVALTADLRIDNRESIHRSLRLESSPSDPLTSPK
FT                   LLARAYRKWGAECTDHLFGDYAYAIWDGQSGHLLCVRDPMGVKPLYYVRTDSIFAFASE
FT                   IRSLLTLPGVSDQINRRQVLTFLSGGYTPREETFFESIKCLEPGHLMHVFPDLSTSSER
FT                   YWSPARQIEKLSLRKDSEYERKFRKVLEQAVGANLRSIGEVGILLSGGMDSSSVASVAD
FT                   AHERSSSAPLHTFSYTFPSLTERKRRFVDEREYIDAVLESGEFDPHFLDAGTLSPLHQL
FT                   EDMVEVWGQPFNIRGLYTVSKILENARGNGVRVLLDGAEGDSVIGYGYDLLTQLGREDD
FT                   WERFAEIARQHSENYQEGRRKYPPEKVFWNHGFGVIVEHLRRGRLRRFYRSANAVSKHL
FT                   GIPRYLILKRSAYWVWPSHWRKKLRFMRNEERDLVPSEKFKRLGVSREDRSALGDLPSD
FT                   EPLHVQRSLALQENRALTNALEAMDPIFAAHHVEARHPLYDRRVIELCLSLPADQRFKG
FT                   GWTRSILRRSLRNVLPDKIRRRLGKVTLEGVIAHNLRRFEKDRLSDFILDDALRPFVDR
FT                   EVATEMLDRFRESGEPDSACTRSLLRMAVVSVWLRKRRHGNLKGPPQTVSLPKE"
FT   CDS_pept        265685..266023
FT                   /transl_table=11
FT                   /locus_tag="SRM_00216"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00216"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23137"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D5H532"
FT                   /protein_id="CBH23137.1"
FT                   /translation="MNQVSVPPPPRTAPQGAPKRPEGDRAYDADWIRQWCADKGIKSAI
FT                   PVRRNMRDGLRRLPTLGDQRYRDRNTVERCARHLKERRLVVRYEKKASHSEATASKPWC
FT                   SGRPTRNT"
FT   CDS_pept        266127..266660
FT                   /transl_table=11
FT                   /locus_tag="SRM_00217"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00217"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23138"
FT                   /db_xref="GOA:D5H533"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D5H533"
FT                   /protein_id="CBH23138.1"
FT                   /translation="MSSRYPSDLTDAEWKRIEPIFDRFRFSGLDPRELINAVFYLVKSG
FT                   RQWRMLPDEFPPWQTVYYHFRKWRRLNLLQRPLGRIRRATRMAEGRDPSPSAAVIDTQS
FT                   ARAERQGGPGRGRDPNKKVTGQKRHVIVLAEGLLLAVMLHPANKNDAQSAPPVLKQLLG
FT                   QSRSPEGHLCRQRI"
FT   CDS_pept        266629..266895
FT                   /transl_table=11
FT                   /locus_tag="SRM_00218"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00218"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23139"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D5H534"
FT                   /protein_id="CBH23139.1"
FT                   /translation="MKVIFADSGYEGLPGGLLWRCFHWLISVVEPDEDRSGFDPLPKRW
FT                   VIERTFGWFGGYRRLIRDYERRPEMSEAMFRAAMIRLMIPRTT"
FT   CDS_pept        complement(266979..268442)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00219"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00219"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23140"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="InterPro:IPR039365"
FT                   /db_xref="UniProtKB/TrEMBL:D5H535"
FT                   /protein_id="CBH23140.1"
FT                   /translation="MRDMPCNQVEVQQFLSKYQSAFTRRADGSSWPKWERTWRHATEYF
FT                   QGLLRPGKGKSVVDIADQTGADQEQLERFVRESPWEHQNVESHLREEVPDEVQGPDAAL
FT                   IVDGMAIPKSGEKSVGVARQWCGATGKVDNCQVTVNCTLARAGEQHNSDQVTWPLGARL
FT                   YLPKKWTGEDDSVYETNREREKYAHLSEEAGIPEEVSYQPKYEIAVDLIDQAMTAGPEH
FT                   ACVVGDTGFGKYPAFRKKLRARNEPYVLEVETSKFVVVPEETTVLEPGSTSGRGRPRKH
FT                   PAYPEETDAETPEQIAARLEKQGGEKQDGWREVTWNEGTKGGLSGEFYRTPVRVVKDRS
FT                   NRWLADETGWLLLKRPSGEEGEGELKAWICWGLDKASLEELASWGQLRWTVERFHQDTG
FT                   RELGADKYQGRTWRGFHHHLSAVMLAHAFVAERRLEEGQDREDLASFAEVVRQIVRESA
FT                   VQRLMENHGFDRAKAREVAVDMLREYSDW"
FT   CDS_pept        complement(268640..269347)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00220"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23141"
FT                   /db_xref="GOA:D5H536"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5H536"
FT                   /protein_id="CBH23141.1"
FT                   /translation="MLLAARFACLSTLPKLSGERQALMAALAHRRRALPVCWQVRRRTG
FT                   VSDAGQQRGLLEALSRRINDARDAEDPCGEIPEVIVIGDGAFHSTDLMSYLSDKGWSYR
FT                   LRLHSDTYVQLSNGKWTQVGDLAPEEGGENRYFDEVYVTKGDPYGPVSIAICHAEEEDD
FT                   PWFICTDQPEADYLTLRTYSRRMWIEELFGDLEDGGFRLNRSRLYQPERLSRLVMALAW
FT                   TYVWPGACRRVGR"
FT   CDS_pept        269844..270233
FT                   /transl_table=11
FT                   /locus_tag="SRM_00221"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00221"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23142"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:D5H537"
FT                   /protein_id="CBH23142.1"
FT                   /translation="MPRRRYELTDEQYECIEHLLPEVEGRGCPYNDHREVINGIFWILR
FT                   SGAPWRDMPERYGNWKTVYDRFRRWAEDGTLESIVRHLQGELDAEGRIDWSQFNVDSTI
FT                   VQAARAAAGGPNDSKKGTEPSETKE"
FT   CDS_pept        complement(270775..273645)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00222"
FT                   /product="Conserved hypothetical protein containing
FT                   TonB-dependent receptor domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00222"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23143"
FT                   /db_xref="GOA:D5H538"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="UniProtKB/TrEMBL:D5H538"
FT                   /protein_id="CBH23143.1"
FT                   /translation="MHSAPAAMTAPGATPNAPHSLPATALLVVLLLGGPLLFGGRAVAQ
FT                   PSTGEPAALGIQDAPLEQALEQMATATGISLVYDASLVSGRRASCVTDTSPPEALLRCL
FT                   LAEHPVDYVRTSRGTYVLRSPVRRPPRVGRLAGIVRDGKAGRLLPGAHVRLPEAQEVRG
FT                   TVTDSTGRFHVSGLLPGPHTVVVSHLGYRRHEATVYVPPNDTARHEAVLAPSPIAADSL
FT                   FIDADRYGLPSARREADRVPAAPLRAGGAAEVPDVLGAAGSVLGVTASAPYADLHIQGG
FT                   PPGGHTLRLDGMPVRNPASAGRLLGAFSPLALEGLTARKAGFGALRGNALSGTLELTHD
FT                   LPAPSDPVGQYGTVRADSRSLGARLQGSATLGDTPVSAMVAGRTSVWDVYQDAGLHDLI
FT                   DRWSTLDPMLAAAQVSPDTSLAGGSLGARTQPSAGFYDLHGALRFDLGPATRLDLSAYH
FT                   GRSTLGADLVLGQPIGTDLGQTGEEGDGFSLDSSPFKLPTRDEQDWSNTVAQARYQAPV
FT                   SGRTTATLQAGVSHYRGTAASEVGEVQFTSSSSLRSGAGVAAARQAARGQEGTSAVTDV
FT                   LLEGEVDVALGPRWGLVWSGGLTHQRSRVRIGNAFAPQLQHRAYTSRLTTAAEMTIGLG
FT                   AHLQLDGGLRLTSRPGQGTVFAEPRGALRYDRPVGGLGTVGLSVRGGFYRQFTTQFDLI
FT                   RDGATAVVPTTRMWLPLTDPLTPPRTYHLAADLTWAPAPRWQIDVEGYRKWQPHLLAID
FT                   YPALRGAPTAPAAPTDPSRFIAPSHGFAHGGGLEVAYEGTPLTGSLRYAYSRAERTFPG
FT                   RFGGRQTPVPWADPHRLALTAEVPFGAGLALEATGEGVWGRRWGYRRAYYAYLTPDDLG
FT                   AAWDEHQLDRPETHRLPPRYTLDAGVRFSRSWAGVGVEGRIGVANVLGRRNVADWGLEP
FT                   HPDGSVSRWTRSLPGRRATVSVRIRY"
FT   CDS_pept        complement(273702..274808)
FT                   /transl_table=11
FT                   /gene="fecR"
FT                   /locus_tag="SRM_00223"
FT                   /product="Putative anti-sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00223"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23144"
FT                   /db_xref="GOA:D5H539"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D5H539"
FT                   /protein_id="CBH23144.1"
FT                   /translation="MSNDTPSLPDFLEERLQEESPEGRSSLGAVWELLGGADAPATEEA
FT                   DPDAAWDALTEAHPELDATPANGTASGTAPRAKQTEAAPKSRRRQRPARRSRRAHSWRV
FT                   AMGLAVATLVLAGGLWLWRQPVTITAPPGQQRTAALPDGSTAHLNSGTTLTYRRGFQSW
FT                   PFVDAARRAVELGGEAFFEVEDGDRPFLIETASAEVAVTGTRFNVRARPGNARPENADR
FT                   DDARSADPAAATEVTLVAGRVEVAARTRPERRVVLSEPGARSQVAGPDATPTPPERAAP
FT                   KYALAWRNGGFAAQARPLTSVLQDLERRFDATLRLHDSVEETRAPVSLYYPEAPDLETI
FT                   LHDLCAARNLNYRPTSRGFELFAAPAGR"
FT   CDS_pept        complement(274798..275382)
FT                   /transl_table=11
FT                   /gene="rpoE"
FT                   /locus_tag="SRM_00224"
FT                   /product="RNA polymerase sigma factor"
FT                   /function="Sigma factors are initiation factors that
FT                   promote the attachment of RNA polymerase to specific
FT                   initiation sites and are then released. This sigma factor
FT                   is involved in heat shock and oxidative stress response; it
FT                   is believed to control protein processing in the
FT                   extracytoplasmic compartment"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00224"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23145"
FT                   /db_xref="GOA:D5H540"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014327"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D5H540"
FT                   /protein_id="CBH23145.1"
FT                   /translation="MPDTPPFEEWCRRLKASDREAYAALFDAMYEPVFRYVRSITSSAE
FT                   AAQDVAQDTFIRLWEARESLSPSQSLEAYLYRIARNRAYNHERNRRTRDEKEPAVRDKT
FT                   AAQPASPARPDDQADADQLEDRLWQWIGELTGRQREALVLTRFEGLSHEEAADVMGISP
FT                   RTVNNHIVRALKHLRGRVNDYEPDLLGRDEQ"
FT   CDS_pept        complement(275541..277580)
FT                   /transl_table=11
FT                   /gene="hyuA"
FT                   /locus_tag="SRM_00225"
FT                   /product="5-oxoprolinase"
FT                   /function="yuA and hyuB convert D- and L-substituted
FT                   hydantoins to corresponding N-carbamyl-amino acids"
FT                   /EC_number="3.5.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00225"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23146"
FT                   /db_xref="GOA:D5H541"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:D5H541"
FT                   /protein_id="CBH23146.1"
FT                   /translation="MPASGASDTDGPSEVGVDVGGTFTDFVVATGTGLEVRKVPTTDPQ
FT                   HEAVGTGLSRLDVPPAAPIAHGTTTATNALLERQGAKAALVTTEGFADVLAIGRQDRPD
FT                   LYDLTPTRPNPLVPAARRHEVPERISAEGDILTPLDEAAVRRVARVLEEQDVQSVALAF
FT                   LFSYRNPEHEKRAAELLRDELPEEVPVTRSSALLPEHREYERTATTVANAYVRPRVERY
FT                   LTRLGGELGERPVRVMQSSGGTIGPGPAGEQAARLALSGPAGGVVGALGVARRALGEAP
FT                   RVMTLDMGGTSADVALCDGAVPRATEHTIAGLPLRLPATDIHTVGAGGGSIAHVDAGGS
FT                   LRVGPESAGAEPGPVCYGRGGTRPTVTDAHLTLGRLDPDRVLGGTDALDMAPEAARSAV
FT                   GRLGETLGRSLEETALGVLRVANATMERALRRVSVERGHDPRDYTLVPFGGAGPLHAAA
FT                   LAEALGMPRVLVPPAPGALSALGLLMADVTHDASRALLTPIGALQGDPASIQRAASALT
FT                   EKVESALEGHGTPEVAFELDLRYVGQSYEVTVPLASPVTAPALGGAAEAFHDRHRRRYG
FT                   HAAPEAPVEAVALRARGTVPVSPPPLPREPETDLPLRDAEIGTRPVWFSPGGPAETTAY
FT                   ARTALHHGHTLEGPAVLHQYDTTIVVPPGWRARVDAYRNVWIER"
FT   CDS_pept        complement(277734..278222)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00226"
FT                   /product="Conserved hypothetical protein containinig PIN
FT                   domain (putative nucleic acid-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00226"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23147"
FT                   /db_xref="InterPro:IPR021799"
FT                   /db_xref="UniProtKB/TrEMBL:D5H542"
FT                   /protein_id="CBH23147.1"
FT                   /translation="MLTVSNTSPLLNLAIIGRLGLVRSQFGSVLVPPAVVKEFHLEEGR
FT                   PGSSALRQAIEGGWIVEKEPSDDPLVRTLRQDLDQGESEAIALAVEEEAGLILLDEREG
FT                   RRRARNVGLEMTGALGILAQADRRGNLDSISSALDRIESEAGFWIGPALREQILGGSE"
FT   CDS_pept        complement(278624..278920)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00227"
FT                   /product="Conserved hypothetical protein containing DUF0175
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00227"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23148"
FT                   /db_xref="InterPro:IPR005368"
FT                   /db_xref="UniProtKB/TrEMBL:D5H543"
FT                   /protein_id="CBH23148.1"
FT                   /translation="MTPSKDVQLSIPRSVADALALPEGRQKEELQRELAISLYREDMLS
FT                   FGKARELAEMSKHAFGRLLGERGVERHYGPDELAEDLRYARGEVSSHDEGAAD"
FT   CDS_pept        complement(280077..280514)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00228"
FT                   /product="Conserved hypothetical protein containing PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00228"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23149"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H544"
FT                   /protein_id="CBH23149.1"
FT                   /translation="MLGQLLLQSHEKALVRGPAPRGANPVRWTFRPAGGWVACKHRFNS
FT                   TPDSHTVIVLCGLAWVRDSAYDASDEEVARAIDQVLRTRHLQVQNRDQVRAAPPRYKGS
FT                   GADFPDCLVGQLCLRAGSDETVTFDHAAARLSHWRELEWWP"
FT   CDS_pept        complement(280643..281056)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00229"
FT                   /product="Conserved hypothetical protein containing PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00229"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23150"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H545"
FT                   /protein_id="CBH23150.1"
FT                   /translation="MTVLLDTNVLIDAAVVSRSYHGTAVRLIAAAERDTIDGLVAPTSI
FT                   ATCWYVAHEREDTDPRPLFDLLADVMRLAPMGRSPLRKALQNPGTDDFEDSYLAAAGTS
FT                   ASASAIATRNESDFVSTTLTPYHPLDLVEMLDE"
FT   CDS_pept        complement(281098..282297)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00230"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23151"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H546"
FT                   /protein_id="CBH23151.1"
FT                   /translation="MYLTRKFHIEGTEQLERLSRSSADLWNSVCKWYWRTVDRQDHWIS
FT                   KTAMRRWHCKGHDVLPSQTAQEVAGQFYEAIGSWHDNDRKGNPPKRCDKTYNVLRWTYQ
FT                   GVTLREDGVLRLSTKRGEDSILIDWPVDEEPRTVEIGKASDGFVVRAQYDREPVDRTTG
FT                   DKVAGVDLGEKHLAAVFTGDDAFTINGGELRALRHYQNSLKAKLDAKIDRKERGSNRWK
FT                   KLVETKRKQLDHIDNKIMDLLHKLSRKVVEMLLERRVSAVGIGDVRGIRDRIDYGTKMN
FT                   QRLHQWVYGEFARMIEYKAELAGITVERIDEAYTSQECPKCGHRKKPSGREYTCSECSF
FT                   HGHRDVAGAANIRRKYVGQEPTGSKTRLPGVMASPLGVRFRPHLSCSSRSGRKTSRQSV
FT                   "
FT   CDS_pept        complement(282882..283181)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00231"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00231"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23152"
FT                   /db_xref="GOA:D5H547"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="UniProtKB/TrEMBL:D5H547"
FT                   /protein_id="CBH23152.1"
FT                   /translation="MKSKLTLRLDDGLKERAKQLAEERGTSVSKIVEDYFRLLLHDPSG
FT                   GDSRAESASGKNAVPDDLPPRTRQMVDALGPAKTDLDLDEDTEAWVDAMHEKHK"
FT   CDS_pept        complement(283417..283794)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00232"
FT                   /product="Conserved hypothetical protein containing
FT                   nucleotidyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00232"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23153"
FT                   /db_xref="GOA:D5H548"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D5H548"
FT                   /protein_id="CBH23153.1"
FT                   /translation="MNVYALKIIVVCSLMPTSSPFSTPVRRALSDAESALGEIYGDRLK
FT                   KLIVYGSQARGEARPDSDVDLMIVLGGRVYPDEEAQRTSQLVIRLASEYGVALSPLHLS
FT                   EENFERDRPLPRAARREGVVL"
FT   CDS_pept        283944..284204
FT                   /transl_table=11
FT                   /locus_tag="SRM_00233"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00233"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23154"
FT                   /db_xref="UniProtKB/TrEMBL:D5H549"
FT                   /protein_id="CBH23154.1"
FT                   /translation="MSVLNLSVLNLSVLNLSVLNLSVLNLSVLNLSVLNLSVLNLSVRR
FT                   PSRGTQSKSNSRIQWVAAASDNQAAVCFCRWGRAAPNRPGK"
FT   CDS_pept        complement(284619..284864)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00234"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00234"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23155"
FT                   /db_xref="UniProtKB/TrEMBL:D5H550"
FT                   /protein_id="CBH23155.1"
FT                   /translation="MIKGDEPTSYAGILSRFSHHFVRTGRTSEGIREVLARAETDRNRA
FT                   DYDAFSVFEVQAAEDPVSDVSQFTKVAHRAIENHRE"
FT   CDS_pept        complement(284884..285291)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00235"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00235"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23156"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H551"
FT                   /protein_id="CBH23156.1"
FT                   /translation="MEAEDLPDGWDRHPPSSRSQRIGDRWVSREESAVLRVPSVAVPYS
FT                   YNYLLNPLHEAFDDIEIGQAEPFPVDERLIPPDTPTRQVSNRRLGEEGQARSRPGSPFP
FT                   ASGCAAQLTIKLAQKQTRRYGPRRGRPLDHV"
FT   CDS_pept        complement(285307..285528)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00236"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00236"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23157"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H552"
FT                   /protein_id="CBH23157.1"
FT                   /translation="MADLTVWRPVEEQYSGSAFSGEGARQYGGRFNSPGIPVVYTAGSL
FT                   PLALVETMTGLERYDQLRRYVFFRVGIP"
FT   CDS_pept        complement(285581..286039)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00237"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00237"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23158"
FT                   /db_xref="InterPro:IPR011979"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:D5H553"
FT                   /protein_id="CBH23158.1"
FT                   /translation="MTNCKPVFLPMPTPSTPPRPVESFEDLQAAGLSGLLESIDEGLPA
FT                   RLIGEIQERLGVDPEEMATLLGISPRTLKRRGESGTLTPVESERLYRIARLFRKSTSVF
FT                   ESEEEARSWLKRPQMRLGGEVPLEIARLEPGAREVERLLGRIEHGVPA"
FT   CDS_pept        286055..286441
FT                   /transl_table=11
FT                   /locus_tag="SRM_00238"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00238"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23159"
FT                   /db_xref="UniProtKB/TrEMBL:D5H554"
FT                   /protein_id="CBH23159.1"
FT                   /translation="MSSGRAIPYKREGGSVTVAPACSPETGGLWTGHSQNGLSYRCKSC
FT                   VFLRASPSRNGRSENMEQTRRDGRFSLSKSIGVICAPNTSAVPTGNRREKIAELARKGR
FT                   TPKELAEEFELTQTITVGWLKQAD"
FT   CDS_pept        complement(286504..286725)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00239"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00239"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23160"
FT                   /db_xref="UniProtKB/TrEMBL:D5H555"
FT                   /protein_id="CBH23160.1"
FT                   /translation="MDRISLGSDEGFWSVSRITEASSLPALRTVFDERLICYNQDRRHS
FT                   SIGQIPPREHLGQTLSACESEPQIAAAS"
FT   CDS_pept        287207..287530
FT                   /transl_table=11
FT                   /locus_tag="SRM_00240"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23161"
FT                   /db_xref="GOA:D5H556"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H556"
FT                   /protein_id="CBH23161.1"
FT                   /translation="MAIHIAQSKKLIAMEVEIDDYGRIVIPKEVRDHLGIDSGTALKIS
FT                   VEPEEGDGGAITLRPKEQRPPLRRKGELLVHSGELTEKNFDVTEQLRAQRTDRARLHAG
FT                   IDK"
FT   CDS_pept        287615..287806
FT                   /transl_table=11
FT                   /locus_tag="SRM_00241"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00241"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23162"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H557"
FT                   /protein_id="CBH23162.1"
FT                   /translation="MKVLLDTSVLIPALIPTLPQHEKAAPHLESVHRGETALILTSPLD
FT                   SSRGFFLTEKTSCFAGPA"
FT   CDS_pept        287934..288362
FT                   /transl_table=11
FT                   /locus_tag="SRM_00242"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00242"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23163"
FT                   /db_xref="UniProtKB/TrEMBL:D5H558"
FT                   /protein_id="CBH23163.1"
FT                   /translation="MASQGKLIVPLRLTRESVYLPDKSGSFTALLRSLNTISSHALAEC
FT                   YSSLTALPVSPAVTPGQARRLVEENIVEAAERVVELGRTEYLNALQRAADRGLESGAVY
FT                   DVLHVLCAEKASADELRTFNGRDFRRMPPEEPTTLEVL"
FT   CDS_pept        complement(288542..289804)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00243"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00243"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23164"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H559"
FT                   /protein_id="CBH23164.1"
FT                   /translation="MYLTRKLKLGKTDQLDRLARRAGKLWSTVAKWHWRFVDRQGYWLS
FT                   KGQAQKMYCKGFDGLHSQSAQAVADSFYDSLQSWRKKRQNGNYEGLRPPYKQKRHFKVQ
FT                   WKSSAIRLRDDGVLRLSSGRGNDPVLIDWPSGQEPKRVEIGWDGDQYELRCQYEVEEDQ
FT                   EPKGTKKAGVDLGERHLATVYVENGENISVHGGRLRSLRRQHNRMLSTLRSKIDRKEKG
FT                   SRRWKRLARAKDRQLRKIRNQIEDFLHKVTTRLVNVLHERRTGTVVVGDLTGIRERIKY
FT                   GDRMNQRLHQWAYSKFEHMLTYKAQLRGMTVERASEAYTSQTCPNCEHRHKPNGRDFNC
FT                   PQCSFEAHRDVVGARNILNERYPGATQVAGEMASPTGVRYRPHMRTEPTSSESQRCNPA
FT                   TAGKTCTEPKGSCGQAGRPVG"
FT   CDS_pept        290114..290614
FT                   /transl_table=11
FT                   /locus_tag="SRM_00244"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00244"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23165"
FT                   /db_xref="GOA:D5H560"
FT                   /db_xref="UniProtKB/TrEMBL:D5H560"
FT                   /protein_id="CBH23165.1"
FT                   /translation="MREAGRRVDSTHACGGRVPVARWNGSCGVRENTNPNSLHDSGRHA
FT                   MFSVGQTIVLGLAGFIYVVGAAFLLGGRAVLNSREQRPSGGDGGQVVRPGTINGAPHFV
FT                   PALNIPVSGNGTASPNARSATGGTASKEALSPGGRMHPARGRAHSGTANGAPTSLRAPL
FT                   CLN"
FT   CDS_pept        291028..293496
FT                   /transl_table=11
FT                   /gene="wzc"
FT                   /locus_tag="SRM_00245"
FT                   /product="Tyrosine-protein kinase"
FT                   /function="Required for the extracellular polysaccharide
FT                   colanic acid synthesis"
FT                   /EC_number="2.7.10.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00245"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23166"
FT                   /db_xref="GOA:D5H561"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D5H561"
FT                   /protein_id="CBH23166.1"
FT                   /translation="MAHLQRRDPDQNGQGDIVRSWEGGTNGAAGPSSGRQGIKGQIEEL
FT                   LDLLRRRKWLIVLVCLATVAGAALYTYTQVPVYRTSSLVLVEKGQQSGTESAIGAQAQA
FT                   QGSGLLPSSSSLRNELMFLRNSQALRERVAERLLEQGEARRVLSSQGVSPFGRLMDRAW
FT                   AWAGQGTGGAEGGASGDDPSPVDTTQLSPASVAPALAGRVRFSRAGAETNVIQIVAQDE
FT                   TPAVARRLANLFTEAYIELTQKSSRERVKASRTFLEQRSQELERELETIEQRIQRFQRS
FT                   EDAVSLDQRQGSLTSRIAETESSLEQARIELRMEQSSLESLREELESIQPGQLSDQLAS
FT                   TVDQEISSLQSEIAKLELSKQQLELQSGAPTPADSAQAAQIDRRIQKLRARIQRLSDRY
FT                   VEELMGGGLSPKQGAQRINELKRRIAEKKIQITGLNSRIDVLSERLSEYEQELNAIPGK
FT                   SMTLAQLRRDQKYAEQMYGFVTKQLQQVRVREKSELGYATQISEAGMPGIPVRPQPRRN
FT                   LILGLMLGLLGGGGLALLRDQMDNRLYKPDQIRDMGYHGIGVIPNLTPLIEDQMGGQAT
FT                   VERDGHQLETGLVAALKPYSAATEAYRKVWTNLQLGRPDGESGTVLVTSPGSGDGKSLT
FT                   AANLAAITAQAGHATLLVDGDLRRPRLHEIFDVSRAPGLTETLQNDLEEHAMKRPLDEN
FT                   LCVLPAGTEVESPAKVLGSARFREFLGEAQQYFDHIIVDSSPVLATADGPMLSDLCDTT
FT                   LCVARAGATTEDELHDALEVLGEVGADVAGVIFNGFDISMAYGYKYRYRHYGRYGPYDQ
FT                   YRSLPEDATA"
FT   CDS_pept        293574..294071
FT                   /transl_table=11
FT                   /locus_tag="SRM_00246"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00246"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23167"
FT                   /db_xref="UniProtKB/TrEMBL:D5H562"
FT                   /protein_id="CBH23167.1"
FT                   /translation="MRPLRLRYATGLALCLMLVAGPAWAQQQGTGGMQAGGTAYYTFAR
FT                   PGQNTIEVLVLGGGRSGVYEIGENVTLGKLMALAGGGGGGGNAKVTVNLFRLENGERDR
FT                   VLKERLSAFAERPQYPPLQDGDVVRIQVRQREPFGWRDVLRITTAVTSLTFTVLRIFDI
FT                   GQ"
FT   CDS_pept        294304..295419
FT                   /transl_table=11
FT                   /gene="wcaG"
FT                   /locus_tag="SRM_00247"
FT                   /product="Nucleoside-diphosphate-sugar epimerase"
FT                   /function="Cell envelope biogenesis, outer membrane /
FT                   Carbohydrate transport and metabolism"
FT                   /EC_number="5.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00247"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23168"
FT                   /db_xref="GOA:D5H563"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H563"
FT                   /protein_id="CBH23168.1"
FT                   /translation="METRTNGRKGPRTDLLSPDPTERIAAEPVYQGDVDTGKTVVVCGA
FT                   GGFIGGHLTADLLRQGYDQVRAVDIKPPNQWFQKFPQADNRSLDLREKENCYRALEGAD
FT                   QAYNLAADMGGMGFIENNKALCMLSVRINTHLLMAARDMDIGRYFYSSSACVYNQELQS
FT                   SADVEPLSEEDAYPALAEDGYGWEKLFSERMCRHFREDFDVTTRVARYHNVYGPFGTYD
FT                   GGREKAPAALTRKAIETKLSGSGDIVIWGDGTQTRSFMYVDDCVKGTQKIMHSDITEPI
FT                   NLGSDELVTINELVDVIEKAVEVDLGREYDRTKPQGVDGRNSDNTKILQELGWEPPTAL
FT                   RDGMEVTAEWIEEQIRRHAEEETTSRFAVAH"
FT   CDS_pept        295469..296770
FT                   /transl_table=11
FT                   /gene="wcaI"
FT                   /locus_tag="SRM_00248"
FT                   /product="Putative colanic acid biosynthesis glycosyl
FT                   transferase wcaI"
FT                   /EC_number="2.4.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00248"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23169"
FT                   /db_xref="GOA:D5H564"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H564"
FT                   /protein_id="CBH23169.1"
FT                   /translation="MTFAEADDAPSILFINQHYWPDLASTAQHLTDLAEYLAEQGVDVH
FT                   VLCSRGHYLSGAMEVPAEETRNGVHIHRVRATAFGRNTILGRITDYASFYSSTLARVLA
FT                   GPAYDYIVTLTTPPLLPLVGTIARRVRGQAYGVWSMDLHPDAEVATGMLEDDGVPARLL
FT                   HALNDVGYRNADFVVDLGTYMKRRIRRKNVPDDRLHTIPVWNKKEEIAPIEHDENPLRS
FT                   ELGLNDKFVVMYSGNAGRAHRFEEVLATMKRLDGHPDIEFVFVGEGPQKDRIETFADRH
FT                   GLSNFRYLPYFPREDLKYSLPMADVHLMTLREEMAGIAVPGKLYGIMAAGRPALMVGPE
FT                   ASESGETIQNANAGRVVDPVQDTDPTQKLHDILLSLYRDDALRTELGRNGREAFLEHFE
FT                   REVCCRKWASLFGRRLNGGAEVGASPQKEAVVGS"
FT   CDS_pept        296760..297017
FT                   /transl_table=11
FT                   /locus_tag="SRM_00249"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00249"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23170"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D5H565"
FT                   /protein_id="CBH23170.1"
FT                   /translation="MDREKGRGMAACSRRTAAYKRPGNATIRWGAAMAYKFEDLEVWTR
FT                   ALDYSDQVHDIAEQRPKHERYNLADQMTRAANSIALNVAV"
FT   CDS_pept        297089..297301
FT                   /transl_table=11
FT                   /locus_tag="SRM_00250"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23171"
FT                   /db_xref="UniProtKB/TrEMBL:D5H566"
FT                   /protein_id="CBH23171.1"
FT                   /translation="MRIAVRSLLETVACLHLINRRDYLDDLGPLREAYHDSETLFAKLQ
FT                   AFRASLDTDSSVREPSVEYDDEAPF"
FT   CDS_pept        297405..299207
FT                   /transl_table=11
FT                   /locus_tag="SRM_00251"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00251"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23172"
FT                   /db_xref="GOA:D5H567"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D5H567"
FT                   /protein_id="CBH23172.1"
FT                   /translation="MNTFSDLLKYLRIYRRYLGRRMYLIFALTVATALASSFGITLLLP
FT                   LLRASQTGGGQAEDMGIAERYLQAMLETLGIADSMVGILAFIAVVFVAKGGLAFAKGSY
FT                   KGYLQAQLLRELKTQLFDAYSGMDHRHYIRENTGHFINVINGQVNRFFGSFDSFVSFLT
FT                   QIVNAAGYFAFAFAVTWKFASLALGIGLLLLFFFKYLNAYVRTLSRRQSDEMSELNTLL
FT                   VQGLQSLKYIVSTNQIAHLRSGVVDSVKRLTGYIFRQNVASAFTNALKEPASVLLIVGL
FT                   IALQVAVFNDPVAPIFVALLLFHRGMQALMAVQGHWQRTMNKIGSVEMVDDEFDTVLSH
FT                   QEDRDGQVLHAFSDGIEFENVHFAYDEDDGDVLHDINVAVPANETVALVGESGAGKSTL
FT                   VDMMTLMLRPRTGTIRVDGVPHDEIDLAAWRDQIGYVSQETVVFDDTVANNIHLWQGDI
FT                   EADPALREQVMHAAERAHAHHFIEDLPNGYQTKVGDRGVRLSGGQQQRLFVARELFKQP
FT                   SVLLLDEATSDLDTASEQHIQNSVDALQGEVTVVIIAHRLSTVKNADCVYVLDEGRVIE
FT                   SGTYHELRHREEGTFREMVEMQSL"
FT   CDS_pept        299362..300378
FT                   /transl_table=11
FT                   /gene="wcaA"
FT                   /locus_tag="SRM_00252"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00252"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23173"
FT                   /db_xref="GOA:D5H568"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H568"
FT                   /protein_id="CBH23173.1"
FT                   /translation="MGNGVTLALCTYNGRNELYETLKHIDHQEDVGEVEWELLVVDNNS
FT                   TDGTADYIRELWPDEKESHLRIVQEKRQGIAFARKRALREAKYEYLSFVDDDNWISENW
FT                   IRRIYGLFESHPNVGIISCPSEAHLKTEPPDYFEIIKGWLAVGEQCEEEGFVEERPVSF
FT                   WTAGCSFRVAPFRRLAASDYESCLTGRTKDETLGGEDHEFCLALTLMGWDVYFTKDISI
FT                   KHNITEDQCSREYILDLVENGGKSRPILDIYRNEYRDRLIENSHLSVVYYLKEYLDKAL
FT                   RHWLKKCRSANGKLLYNQISHALARGRLKGYWMCRDQFARAKENLRILKAIRDERSA"
FT   CDS_pept        300362..301237
FT                   /transl_table=11
FT                   /locus_tag="SRM_00253"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00253"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23174"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H569"
FT                   /protein_id="CBH23174.1"
FT                   /translation="MKEVLKRKIKNFVDDPRRSIRNARSRWLGSWRQWTSTVNPEPILV
FT                   LGNQKSGTSAITALLGEATGLSYTIDVFCFFGDAEQKLLVGDMDFETFVEKARYRFSKD
FT                   IVKEPSFIAFYEELASRFPDARFVFVVRHPVANIRSILDRLGLPGDRACLSASHWEQVA
FT                   EESQNWEMILRGRQYGHEGDTYIQTLARRWKMSARLYLSNSDRFKKITYEAFTQDKDVR
FT                   IYELARRLRLDVSNDISDKVDVQYQPKGQKTADPQSFFGERNLEKISEVCQPEMKSLGY
FT                   ESLISTRTRS"
FT   CDS_pept        complement(301654..302022)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00254"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00254"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23175"
FT                   /db_xref="UniProtKB/TrEMBL:D5H570"
FT                   /protein_id="CBH23175.1"
FT                   /translation="MVLKLMAADPSRYSIPLRTISDKSERGLGDLLLYQSECLNERYRM
FT                   FLWDHPPQEYDAGSGLFTFLPGKRLHPFQVYPKSYDADFFGRRPFQYQQSANMVGCDHE
FT                   GIGVPKYFMERRTVRRVT"
FT   CDS_pept        complement(302539..302757)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00255"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00255"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23176"
FT                   /db_xref="UniProtKB/TrEMBL:D5H571"
FT                   /protein_id="CBH23176.1"
FT                   /translation="MNTRFFSPIILFGILPVSSAIYTKICFLFPFSIFFKYSSFRLLFS
FT                   NLLLKTSTTTSIPLLFNSSKILSLDNL"
FT   CDS_pept        303526..304527
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00256"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00256"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23177"
FT                   /db_xref="GOA:D5H572"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5H572"
FT                   /protein_id="CBH23177.1"
FT                   /translation="MKIYENRHLISNFLQNIGFYVKRTGDKLGVDSDARKALHQKVFVF
FT                   PSSVQGIDVLLSRYFFPIRVLNSVPLVYHHGFPTNQYVGVSSTEQRREAIRDRNQLYRN
FT                   TAYTLFSTRESIRRFSEVAPKDVQKKVVYAPYFLPKLEPIQTDSLEKKFSDYRPVRVLF
FT                   VGSDGTLKGVHNLVEALNRICDQYPDVRDNLKATIITRDELPTCDFEVDKHEYLNRDEV
FT                   LEAFRQSHIFCMPTLKDSYGLVYIEAMASGCAVVADDSPVRREILNDGDAGLMSDPQDP
FT                   DDIADKLISIIQSPGYGETLARRARNRFKKNYHWKPVGKKYIDVLESAAQKV"
FT   CDS_pept        305869..306819
FT                   /transl_table=11
FT                   /gene="wcaA"
FT                   /locus_tag="SRM_00257"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00257"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23178"
FT                   /db_xref="GOA:D5H573"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H573"
FT                   /protein_id="CBH23178.1"
FT                   /translation="MTSVIIPCYNDEEYVRKAIHSALAQTYPNIEVIIIDDGSTDDSPE
FT                   IIQSFGGQVRWEQQANQGAPTARNRGLELAEGKYVKFLDADDVLVENCIKRQVQQSERL
FT                   PKDKKAVVFGDAIWVDEEGNELDGYDDLRGRKRDEDPVTHLLHSNPLTSCPLHRREYLQ
FT                   EVGGFDPSLPRSQEHDLHLRLALAGVEFVYEPGPTYYFRQHEGADRISGRSYAEQGLMT
FT                   HYELVEHHAQLIEKHRGSLSSEIRQALGQLLWRHGRAILREGHEDVAQAYFDEAMRLAD
FT                   GRSCVVGSKPYRLLYQVGGPVVAERAMSVVKRVLP"
FT   CDS_pept        306844..308124
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00258"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00258"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23179"
FT                   /db_xref="GOA:D5H574"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H574"
FT                   /protein_id="CBH23179.1"
FT                   /translation="MNVIYDISPIGSDPDRRAGLARVAESMAERLVDDLGPEQISFSAT
FT                   GSIWATLQTEEVLERRANWRSALPHVPWWIRRVHETNQTLSTVAGEKEGPVRMGGKLGT
FT                   LLLTQVLRAVNVLRQPVDDDALQRANIYHSSYARIPRQVRRALPGRHILTVHDLTPLVL
FT                   DSKYVPSGQVGVTRRIIDSVRVDDWVITVSESTRDDLCERRPIPQKRVFVVPNAASPDL
FT                   FYPVDDDEQIRRVRRKYDLPDQSYLLTLHSMAPHKNIPRLIASFNRMVRQQRISDLSLV
FT                   LAGGLGRSLDDVLADLDVEREDLENVHFTGFVADEDLAALYSGAEAFVFPSLYEGFGLP
FT                   VLEAMQCGCPVIASNTSSIPEIAGDAAVLVDPYDEESLSASMWRIHTEPKKREKMSERG
FT                   IEEAKQYSWSKRADMIFNVYDQISSLQ"
FT   CDS_pept        308140..309048
FT                   /transl_table=11
FT                   /locus_tag="SRM_00259"
FT                   /product="Putative sulfotransferase"
FT                   /EC_number="2.8.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00259"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23180"
FT                   /db_xref="GOA:D5H575"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:D5H575"
FT                   /protein_id="CBH23180.1"
FT                   /translation="MERIYERMQPNFFIIGAPKCGTTSLADLLAQHDDVFFCPEKEPRF
FT                   FSHEETYKRGFGDYEALFGEANDEKRIGEGSTTYSEAWLDRYEKSARRIHDYCPSARLI
FT                   YCVRHPLRRIQSNWLDIIWALDNDLMQGTELHQSDELSVSGDFNDDVLANDGLVQTSNY
FT                   WRVIQEYRQYFSDEQIQIVFLKDLKSSPDAVLRECCTFLDVGPGFDFTDPDEARNTSAS
FT                   KGLATTFGRIARSIPGYRTLAGGAPSFLKALVRPLIKDSFTGKPDWRPTVKEKVVSRLE
FT                   GDTNRFLNYTGRPRDYWILDA"
FT   CDS_pept        309023..309943
FT                   /transl_table=11
FT                   /locus_tag="SRM_00260"
FT                   /product="Sulfotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23181"
FT                   /db_xref="GOA:D5H576"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:D5H576"
FT                   /protein_id="CBH23181.1"
FT                   /translation="MTTGSWTHDGPTFLGIGSQRCATSYLNQVLEAHPRAQVAPKERNF
FT                   FNHHVREEGLDWYIQHFEGDREDTQARGEISPNYAVMRRREIELVRDLFPHLSLVLIVR
FT                   HPVDRMWSALRRHWTYSYLDDVADVGKDVSSMLDYADQRLVDAFGDYRAIYRNWSSVFD
FT                   EDRILLLRFDSMKDEPDHTVARVLDFVGVEPDIDWIRSYRENTDIRNQSRVDVDMPAYV
FT                   RYYLCRRYLDRTKVFNEMTGGLVQDWVDDMEATVSEAPSLWEARYQFRSTAWYRPVQWV
FT                   HRLTDPVRTWWKVRRARQNLPEIGA"
FT   CDS_pept        309947..310822
FT                   /transl_table=11
FT                   /locus_tag="SRM_00261"
FT                   /product="Putative sulfotransferase"
FT                   /EC_number="2.8.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00261"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23182"
FT                   /db_xref="GOA:D5H577"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037359"
FT                   /db_xref="UniProtKB/TrEMBL:D5H577"
FT                   /protein_id="CBH23182.1"
FT                   /translation="MKMRSPDFIIIGAMKCGTTSLKSDLSTHSQVYVAPKEPRFFHSDR
FT                   YHKQGLKQYFSHFEGRNESIVGESSGFYAWDSWCEETAERMRRDVPDAKLLYIIRNPVE
FT                   RVVSHWAWGISNGQPWGPINEAVQSVDRLVEMSLYWRQISRYREHFPDDQIKMLFLEDL
FT                   KADPRSLFRHCGQFLGVDPSGFDFEKAATPKNQTADKRTDTRLAQRLRQWSGFWTLKEI
FT                   IPDSIVQLGEQVLRRDGKIEPDWDPEVRRQVEERLAPDAARMLDYCGRSRDFWTFETRS
FT                   LQDVEPTPVA"
FT   CDS_pept        310819..311958
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00262"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00262"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23183"
FT                   /db_xref="GOA:D5H578"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H578"
FT                   /protein_id="CBH23183.1"
FT                   /translation="MSDPVNLLSFVHPVRTYQPCSGVGRHANNVLLRLAQREGIRQELF
FT                   FAEEWIEQDGKLSRETPLRQLPTRTFPTPENLTERCWKIVGRPRMDRWVPDGTDLIYAP
FT                   VETYLPVEDTPVAITIHDIQAFETELPWSGTWAHRWFRWKWSTWVYGALEDCAVVFTVS
FT                   EFSKSRMVELLGADPDDIAVVGNGVDARFFEMAEQPRDKLNRPCEDPYLFMIGGLRKKK
FT                   GADAMLAVARELERQGSDVQIVVAGPNGDTYEAETAGLDNVHLLGWVDDEDVPRLLRGG
FT                   LALMFLSPYEGFGLPAVEAMAAGIPAIVADRASLPEVVGDAGIVVEPNDTERIVDCVRS
FT                   LRHDQSFRLKYVHAGNERAQRFRWDRCVNRLIRAFNSIV"
FT   CDS_pept        311936..313108
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00263"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00263"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23184"
FT                   /db_xref="GOA:D5H579"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H579"
FT                   /protein_id="CBH23184.1"
FT                   /translation="MHSIQLCRRCMGSTSERNRPLRVVFAWPTISGYMSACWRALVEHL
FT                   GIDPFVVAFEAGQSTAFNDGLMSGIPSRLLDEEERHNAGLVRDLVAAQNPDVVVLSGWF
FT                   HPPYRRLPFRWALRDSRFVMGMDTPWRGTGRQQVGRWLLRPFVDRMDRVVVTGERCWQY
FT                   ARRLGVPPRAITRGLYGVDVAGLAPVWDRRRENGWPQSFLFVGRFADEKAVDVLVEGYA
FT                   RHREQVDDPWPLVTCGKGPMSDRLDRQAGIDNRGFVQPDDMDDVWAGAGAFVLPSRFDP
FT                   WPLALVEAAASGLPIVCSDACGSAVEVVRHNYNGLRVPDEDPGALARAFAQIQRRYDEL
FT                   PEWGRRAQRFAVPHSAERWADRWVRLLRDVDGKPPSATLEDQYALSLSST"
FT   CDS_pept        313145..314455
FT                   /transl_table=11
FT                   /locus_tag="SRM_00264"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00264"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23185"
FT                   /db_xref="GOA:D5H580"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:D5H580"
FT                   /protein_id="CBH23185.1"
FT                   /translation="MRYWHLLLGTVFIYLAAHVKLGVPGPVASLGRWVLLAGAAAVSVW
FT                   LLSFSRQAEPLPNRTGGIGAAVLVFCVLTLSTALAGFQVRLSVLKWILLSIQLFIFVYA
FT                   ANRLVPVRHWAWLVGGLFVLFAVPTMLTFMGAVTGYSPIVTFFGIYHQGRLAVLGNPNS
FT                   VGMVALASGVTALWVQEAPFVRERWARRAVPLGVVVASALVVLWTASRSALGGLAVGGG
FT                   IWAIATGKGARSIGLGALAVLALWVWSLDFSALDSLGMVVERLQGGRLLDTRESVWEAS
FT                   LRNWKEYPWFGHGYGVTEGGYDLEGLSGSVGSVRDGSGYFGVLESVGGVGLGGILVLYT
FT                   AVARNVWHLWQLSVVHNGLRTQVEWLLGAMGGSLFFGFAVNAVGEPWLVGPGSFPHLVF
FT                   WCALGIHVAGTARVRTQMTEKSRHRSPVGSAAPSRVS"
FT   CDS_pept        314478..315605
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00265"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00265"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23186"
FT                   /db_xref="GOA:D5H581"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5H581"
FT                   /protein_id="CBH23186.1"
FT                   /translation="MDIQFFTLAPSPHLVGVLDELHRRPSVNLRVVYERKWLDERSWGL
FT                   HSGEGPHVYLGSWDVTGYGQHVSLRLRSAMQGAAPDVAVVNTSYVSLNTYALICLLSRR
FT                   DIPFVFWAERVSRLSHPLVKWVRRPFLQWVLERAAGFVGSTEATVQFYRSSFSYEGPAT
FT                   WVPYHRDLTPFLDLTSATNPDGRVCFLVLGSLTRGKGIDTVVRALSNVERPSEVLIVGD
FT                   GPKREALERMAEAQCTHHRIRFLGRVSYDRVPALMQEAEVLLFPSRHDGFGMVTMEALA
FT                   AGRPVVASRAVMSARQYVRPGANGWLLPAEDASAWSEQMEAILDARDQLPRWGQAARDT
FT                   IRSRYCVKEDVSRLLRFLDNLSSVQMSVPAADLPG"
FT   CDS_pept        315623..316795
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00266"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00266"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23187"
FT                   /db_xref="GOA:D5H582"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H582"
FT                   /protein_id="CBH23187.1"
FT                   /translation="MHIVLTISSLDRTAGGTSSAVAAMARHLAGRDPDVSVVSLESDQP
FT                   LLDEAGTEEGTPTVTLVRRDDSPWKVWQNPSRFGRALHKEIEARSNVVVHDNGLWLPVN
FT                   HRVATTTHSLACPRVVSPHGMLEPWSLGQGAWKKKAAWWLYQKRDLQSAEVVVATAEQE
FT                   AQNIRALGVDGPIAVVPNGVDRPDSLPSVDNDTSGGGEQRRLLFLSRIHKKKGLLNLVE
FT                   AWDRLRPDGWEVIIAGPDENGHEAEVRERISQCGVKGDFVFTGPVKGMEKWKMYQSADL
FT                   FVLPTHSENFGIVVAEALSCGVPVITTRGAPWSDLVDHDCGWWIEIGVDPLVEALVQAT
FT                   RMSAADRVAMGRRGRELVDRKYTWPQVAAALESVYAWVLGEQRHPECVIT"
FT   CDS_pept        complement(318929..319240)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00267"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00267"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H583"
FT                   /protein_id="CBH23188.1"
FT                   /translation="MKVMRVRFHPSKFGSNRPIRLEAVFWPANTFMFAFPFTQTLKVYE
FT                   TLFATGIPEDRKVIVPLASSLYASLPPSGSEIPAVTVVFPFSSLHAFDVKSKKLSLGK"
FT   CDS_pept        320152..321651
FT                   /transl_table=11
FT                   /gene="wcaA"
FT                   /locus_tag="SRM_00268"
FT                   /product="Glycosyl transferase, family 2"
FT                   /function="Involved in cell wall biogenesis"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00268"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23189"
FT                   /db_xref="GOA:D5H584"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H584"
FT                   /protein_id="CBH23189.1"
FT                   /translation="MLPDFALMWFRSPSCVERHEHGRRRARHCRQPVGPEVRRRRARPP
FT                   GAVGRWRRPVSMDAAPALRRAERAAASLRGRGGLQRPHSPPRHNLLPLEPVGWRLELGR
FT                   GGGPHLQPRADRDWRAGDDLPAGTPLRRYARRERSRHAPPKAADCRRRPGLGVCRRVRR
FT                   ARGDRRGWGRRWGAGRGGYGRRAVDDRRRKPGPSPQRTHPRPRRILMISVLVLTLNEEV
FT                   NIADCLDSVAWADDVLVLDSGSEDRTVEIARSKGARVLHRDFDNFASQRNYGLEEGGLR
FT                   HDWVLHLDADERVTPALRQALRDKADRGAHRAYRVPSKLMFQGRWLKHAGMYPTYQIRF
FT                   GRREALTFTQVGHGQRGALPADQVGTLDEPLLHYAFSKGITDWVRRHNRYSSDEAEHAR
FT                   ETQLGDVDWSALMTGDAQARRRALKDLSYALPFRPLLRFLYVYVGRLGLLDGRPGFDYA
FT                   VLLAFYEYLIGLKQREHRRGGGRTNGEESADSPLETEARKA"
FT   CDS_pept        322219..323394
FT                   /transl_table=11
FT                   /locus_tag="SRM_00269"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00269"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23190"
FT                   /db_xref="InterPro:IPR039498"
FT                   /db_xref="UniProtKB/TrEMBL:D5H585"
FT                   /protein_id="CBH23190.1"
FT                   /translation="MAARPLSPSAKDTILEIPLSSGTQDIARTEMSDSDAYAFVRTCLS
FT                   YRPDPARREAVQSFVEAGVDWEAVQRKARYHRVLPLFFRALEDLLGPQCPPPMREQSRK
FT                   HRRGVRIQNTFVVQELGRIHRRFEEAGLPLLAMKGPVLAQASYGDIALRQSVDADVAIP
FT                   GDQFADADRLLRELGYEYAPKRKGMSGGRATLSRYLDGQWEFTRGNTFTLDVHTRLMPP
FT                   GYSFSSDFHTFWKRARPVRLADDAVVQGFSPEDRLLVLVHHGIKNQWRALRHVADVAAT
FT                   VQGEDIDWNGVGERAEAMNATRALGLGLHMAHDLLDVGLPDHVEDRFLDNSTENVSASM
FT                   KSYLQSCPQQSALPFTERMRLQMATKDTVMDQVRYGMHSALQHLWSSLLKP"
FT   CDS_pept        323425..323715
FT                   /transl_table=11
FT                   /locus_tag="SRM_00270"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23191"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:D5H586"
FT                   /protein_id="CBH23191.1"
FT                   /translation="METTMIDESSVVVAADHQTSTEVDGESVILDLEEGVYYGLNPMGA
FT                   RIWSKIQEPTAVEEITGAITAEYDVSAERCREDVLSLLRDLKENELIEIAE"
FT   CDS_pept        323751..325796
FT                   /transl_table=11
FT                   /locus_tag="SRM_00271"
FT                   /product="Asparagine synthetase B (glutamine-hydrolyzing)"
FT                   /function="Amino-acid biosynthesis; L-asparagine
FT                   biosynthesis; L-asparagine from L-aspartate (L-glutamine
FT                   route)."
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00271"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23192"
FT                   /db_xref="GOA:D5H587"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D5H587"
FT                   /protein_id="CBH23192.1"
FT                   /translation="MSGIAGIYYLDGRPVEEEIGRMVDVMKHRGPDEQSTWTNGSAGLG
FT                   HCMLHTTPESLHASLPRESAQSGCVITADARIDNRDVLIRDLQLSPSTGQVIPDSTLIL
FT                   RAYEEWGQDCVDHLLGAFSFAVWDPRRDSLFCAVDHLGVKQFHYTRTPPQCFAFGSEIK
FT                   ALLLLDKVRCTIDEEKLGEALAWISRAPDSTVFEDVERLPPAHALRVGNDGVRMWQYWE
FT                   VEPSREARSLTEQECTRRFKELFTEAVRCRLRSAFPVGAELSGGLDSSFVTCMADTLLP
FT                   EGDDPIRTFSLIYDKVPSCDEREYIEEVVKNKNTKPHYVCGDKIGPISSAQEMYEFVDD
FT                   GRIGAGNSFLRWNVYAKAEKADVRVVLTGTDGDSTVSHGTERFAELAADEDWEVLHEIA
FT                   QKYVKNLDRERGKYAIHGEDDDSVEGVIQKAGFPYLDYWATTGQWQTFLRSAHKISSLC
FT                   DISLLEIYRRFWKKLLAPEFVVRARVRSAVKQERRKVPPVVDSDFAAAIGLPEKLSSYR
FT                   DDIQETPSVRKNQIEKFRSGLIGTELQHYDTHASAHSIEARHPFMDIRLLQFCMGMPSK
FT                   MSFQSGWTRAIMREAMEGIVPEKIRWRVAKTNMSDVFEHGLFDVDGDLAQSLLSDLDLM
FT                   TKFSDKAHMREVLAKQERRHEFDFTLLASVLSKEIWIEKLHEKEYC"
FT   CDS_pept        complement(325872..326117)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00272"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00272"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23193"
FT                   /db_xref="UniProtKB/TrEMBL:D5H588"
FT                   /protein_id="CBH23193.1"
FT                   /translation="MLAQAAFKISFESVRNSKPSKCFGFHSSAFFLNDAERTLAFVASF
FT                   LVHIINVGRIDSGGKFSHRSMRCKLGSLVIHGAPAM"
FT   CDS_pept        327044..328957
FT                   /transl_table=11
FT                   /locus_tag="SRM_00273"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00273"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23194"
FT                   /db_xref="GOA:D5H589"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D5H589"
FT                   /protein_id="CBH23194.1"
FT                   /translation="MSRRGNLGFTAALRDIQTLLAYVVRALKLVWQAASPWMVAWGTLL
FT                   VLQGLLPGASVYLTKWVLDAASQAIGQGLAWENVQIIVVPGALMGLVLLLQQVTKAVNG
FT                   WIQTAQSQHVEDYIQKLIHDQAGSLDLAFYESSEYYDTLNQASNRASSKSLEVLQQVGG
FT                   LLQNGITLVTIAAILVPYGLWIPLVLIFSTLPALYVVVKHNRKYHDWWERRTMDQRRAR
FT                   YYDMMLTYDFAAQEIRAFDLGDHFAEAYSDVREWLRGERIELEKNKSLATIGAGLTALA
FT                   AMAAVMGVMAWRAMRGLATIGDLGLFYRSFREGQSLMRNLLQNAGKLYTNAMFLEHLFD
FT                   FLAFEPTIQDPEEPREEDPLPEDAITFEEVSFRYPETEEYVLEDFDLTLPARKVTAIVG
FT                   ENGAGKTTLSKLLGRLYDPQDGRILIDGVDVREYRTQDLRDQITTLFQRPMRYQATVAQ
FT                   NIIMGNVHREHERDGLEEAARKALIHDTIQDLPKGYDTQLGHWFEGGTDLSGGQWQRIA
FT                   LARAYYRDAPIVILDEPTSAMDSWAENEWLQSFGRLVDEGRTAFIITHRFTTAMHADII
FT                   HVMDDGEVIESGTHEELLEQEGHYAESWRNQVEHGWRASADPDAENTPVSPPVSSGNPL
FT                   QS"
FT   CDS_pept        329016..329309
FT                   /transl_table=11
FT                   /locus_tag="SRM_00274"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00274"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23195"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="InterPro:IPR041881"
FT                   /db_xref="UniProtKB/TrEMBL:D5H590"
FT                   /protein_id="CBH23195.1"
FT                   /translation="MASLDDSIAATDSFASAEVDDERILLDPETGTYYGLNPVGDHVLR
FT                   MVEDADTERVSIRSVVDALHDTFPDEDYDRLSEDVLTFVDEMEDFDLLLVHD"
FT   CDS_pept        329355..329978
FT                   /transl_table=11
FT                   /locus_tag="SRM_00275"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00275"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23196"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:D5H591"
FT                   /protein_id="CBH23196.1"
FT                   /translation="MKARTVTDEPLFLDAATIDKNSPSGAARSGFPSLLPMPSLRRGLQ
FT                   KLWRHPWRNWWMLFRASVLTVAVRAGLSLWPLGRVTRGLRHAAQWRSPRSTSTPLYRRR
FT                   AAWAAHAVGRRFLPERPCLTQALVLQYLLLRRGDDEAELHIGVAKNEDGFQAHAWVERN
FT                   GQVLIGGANSPQEYERFGDLARKVRSNESAGRSDSIPSPGSSRP"
FT   CDS_pept        329975..331873
FT                   /transl_table=11
FT                   /gene="asnB"
FT                   /locus_tag="SRM_00276"
FT                   /product="Asparagine synthetase B [glutamine-hydrolyzing]"
FT                   /function="Catalyse the conversion of aspartate to
FT                   asparagine."
FT                   /EC_number="6.3.5.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00276"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23197"
FT                   /db_xref="GOA:D5H592"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:D5H592"
FT                   /protein_id="CBH23197.1"
FT                   /translation="MSGLCGCIHWTKRPGHAQTAARMADAAAYRGPDGIEVWSGARASL
FT                   THLALNVTAADEREPQPLVENGLVLVADSRIDDRSTLQSNVRRQLRTESPTDADLILAA
FT                   YRRWGTDCPAHLIGDFAFAIWDPEERRLFAARDPMGMRPLHYRVDDHERLLFGSDVKQL
FT                   LAAPEVPARISETMVAAYLQNRFEPLGWTFYEDIFQLKPAHALLARPGGSPETWRYWDV
FT                   DPDKRIRYDDERDYVEHFREVFAKAVRARLRSAQPVGLFLSGGVDSGSIASMAGHLKET
FT                   EGLGCPALRTYSWAFKTLTQCDERDVSSRITDCYNFPATPIDAESVRLIGPPHGVPDRD
FT                   SPLMSHYQALLAKGLRRAREHGVHCMLSGQNGDLLVGSWIFDNITLLRKGKLKTLREEL
FT                   QAQHKTLGLSFRDLIWRTLYRPIRAHIWPEDTLPCLREPLRRLWRTMRPAQSSAPPPPW
FT                   MSEHLRNSVDLPSVHRKVPLGIRRFAWRRRYETIRSSFQRRIGAWSERLFARHHITYAD
FT                   PWADRRLIEYVMAIPQYQIFRRGKNKSIAREAMRDLVPEEVRSNLQKVSPKPLYENALE
FT                   DESSNQVCSYISCSDEYSDAEALLEYYEKRLTNRKGEDFRFWLALCLRMWVYHHDL"
FT   CDS_pept        331904..332104
FT                   /transl_table=11
FT                   /locus_tag="SRM_00277"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00277"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23198"
FT                   /db_xref="UniProtKB/TrEMBL:D5H593"
FT                   /protein_id="CBH23198.1"
FT                   /translation="MSNTSDSNAEYRAPSVKRWGTVLDLTSGADTGGSGDIYDANADND
FT                   HSNWLPDQSNGGNGKGTGDGS"
FT   CDS_pept        332972..334258
FT                   /transl_table=11
FT                   /locus_tag="SRM_00278"
FT                   /product="Conserved hypothetical protein containing serine
FT                   kinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00278"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23199"
FT                   /db_xref="UniProtKB/TrEMBL:D5H594"
FT                   /protein_id="CBH23199.1"
FT                   /translation="MEQIHLSESPPLLSRFNRLPLGPSGQVPLFFSAKSATTQSLPIQR
FT                   PTSASNSAARLLPCGTRSLSTAPSAIRWALSARHTPSAKRPYAPTSSTLPNSSRCTTCC
FT                   TSPMALSPNAASTLSRVGVYGVTVATDLDLIPSLPPRSDTPDLHVVAASEPIEFADQDL
FT                   FYSSPTRDPDSVPAIRLYRVEDRFVARFVDAATFSIGSERIEYLLHDDTYAYALELWLL
FT                   GTVLAFWLEWRGVPALHASAVALGDGAVGFLASKQGGKTTLAMSLLQQGHPLLTDDLLP
FT                   LGVEGDAIRGQPGYPQMRMWPAHVRHFVDNSDSLRRAHPYTDKRRVPIGTDGLGTFCDD
FT                   VRPLQALYLPERTDKTSIQIQPVAPTEALKAALRHSFLPRLVEAASWQARRLNVLSQLV
FT                   EQIPVWQLTYPEGIEHLPRVADAILDAEA"
FT   CDS_pept        complement(334445..334630)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00279"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00279"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23200"
FT                   /db_xref="UniProtKB/TrEMBL:D5H595"
FT                   /protein_id="CBH23200.1"
FT                   /translation="MVTRFTKLRVYFRSETQVDHGLKALDMSEGPAPSGFTELPLMVGL
FT                   EPVDLQLLHGGKSSAT"
FT   CDS_pept        complement(334882..335217)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00281"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00281"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23202"
FT                   /db_xref="InterPro:IPR008792"
FT                   /db_xref="UniProtKB/TrEMBL:D5H597"
FT                   /protein_id="CBH23202.1"
FT                   /translation="MQGDVSQAPIAPMHSYRPRSQVVSTTIEEDESVLLHLEAQQYYSL
FT                   NETGHRIWQLLARGRAPGAIAAVLAEEWAISEAGALRHVRSFLQELDEADLIEEMSGEE
FT                   MSGDKTV"
FT   CDS_pept        335212..336072
FT                   /transl_table=11
FT                   /locus_tag="SRM_00280"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23201"
FT                   /db_xref="GOA:D5H596"
FT                   /db_xref="UniProtKB/TrEMBL:D5H596"
FT                   /protein_id="CBH23201.1"
FT                   /translation="MQLKARLRGRKNASRRRDRRGSCSCCPTTISTAFVCTPLVGPLRF
FT                   ESNCGGFCATRAPNQPGRTLGATFGSRLTYGRRSNRHRTRRDTSARAPGVGSRSGTPRS
FT                   GQGKTTIALSLLRHGWAALSDDTVLLCATGNGVRAHAFRRPLCVDPGAANRFPELDGPG
FT                   WPASLSDASKWQVDIDRLYPGQSESTSTPRLLVLPTIADAPTSRIEPIGAKPALEQLLA
FT                   QSAFFLSSRPEVADRHLSVLRRLVDQTRTHRLHSGRDVLNEPHTAHALLAPLLTGGPAP
FT                   NAVSG"
FT   CDS_pept        complement(336283..338280)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00282"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00282"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23203"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D5H598"
FT                   /protein_id="CBH23203.1"
FT                   /translation="MRRATCLFVLGLLCGGAHAQSDFVVEQAAPAHGAAGVPLADTVAF
FT                   SFAQEVSVSTDWDSRFVEAPRASLSIDGVSLCLNFAGPCGGDGDVPRHVRFRVSHQPDV
FT                   DYTWLVYAVESAGGTPMAEPYALRYTTAPDAGDGTIAGSVSAPVPAQKSVSAPASDVRP
FT                   TLRTLAQGLQRRGRGRPVFDADRTDAAMDEAHSSPSGRPQAHVRTIGPKAAGSSPFTQV
FT                   LLLDEFSIEETDWAIRGGDALIGSSGDYGVEFVRPGTYVPIAVRYTDGSNTTIDALGFY
FT                   DPDGDGSPDAVEVDGDEQTGVDLQLFEFPRTTARASPNLPVARDSAAHYAPDPQLRWVQ
FT                   AETGLRPDGTAYAWTYRFYSPPQDLETTVTIDPLGAHVDTTSGPGLLPEMAPIPEGFID
FT                   SDEALQIALNDGGQDLVDSYPPDRLTTLLSGGNLFWTDAPIPSEEFWQARLIGRTSSST
FT                   ETFERYLNIETGDVLPVELTRFGASTTDDAVRLRWHTASETNNAGFAVQHTPGDSTVAA
FT                   DWRTLQFVEGAGTTQRPQTYRFRTPTLPPGTHRFRLKQRDLDGTESLSDVVAVTLGLDG
FT                   PLRLTPPSPNPARRAATLQFGVQAVSTATATVAVYDVLGRKVATLHDGPPPTGWMETVH
FT                   LDASQLPSGTYFVRLTTADRTRVQKLTVVE"
FT   CDS_pept        complement(338309..338476)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00283"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00283"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23204"
FT                   /db_xref="UniProtKB/TrEMBL:D5H599"
FT                   /protein_id="CBH23204.1"
FT                   /translation="MPSDTPSSDAESSSQPNKADASDPPRKPFVEPELRHETDLIRGTG
FT                   DRHFFESTAS"
FT   CDS_pept        complement(338547..341315)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00284"
FT                   /product="Hypothetical protein containing PKD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00284"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23205"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR025965"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A0"
FT                   /protein_id="CBH23205.1"
FT                   /translation="MWPLRPAGRALFLSLLFALSPLPAQAQTPNAWINEIHYDNAGGDT
FT                   DEVVEVVIEDAGSVALDRFQVLHYNGADGNSDAAAPVPLDAFAPGATAGGFSLYSYNYT
FT                   NNGETLQNGTEALALCFDGNDDGTFETLVSSGGTDQFLSYEGTLTGTSGDGCAGGETST
FT                   PIGADESTPPPVGESVQLEGSSTAYTDFTWTGPLASTTGTPSAGQTLSGSVTITVDDDG
FT                   PADYASIQTAIDAAGPGATIQVLEGFYAESVTVDKHLTLEGPNAGTPGDATRSSEATIE
FT                   GQVVISASDVVFDGFDVAPPPATSNATAEALRVGTAPDDVVVTNTVVRDFEESGLPPWE
FT                   GLGGIVAFGGNSGDAIDDVTIADNKVQNLDGRDTKGGAAGISVQGHVDGATVTGNTVAN
FT                   VGMDATTWAFGIVVRGTDNHGQTPTGVDASGNDVSAVQSAPATSTVGVGFGFEDGAAGT
FT                   TTVAGNSFSNTELQVEDKTAALDLDALLADNTFDRAVVVRNANGNVKDESGVQRIYSPI
FT                   SPAVAAAAPGETVEVHGGTYAETVTVDKALTLQDASTPTVDAFEVAADNVTIDGFTITG
FT                   GTVGGKTAGIFVQSNTSGHTVSANNLGGPGSGTGLRVRSGVSGTEITENNISGWAVGVA
FT                   ADTPGQNVQVADNCISGNTTAGVQSSGGQILTATGNYWGASSGPSGDYPGTGDAVVGAV
FT                   TVDFSPEPVGACSEGDPTPECTATTLGESVTPPEDGSPGVVTATFTNTDGLEEIEYTKL
FT                   ENFTVTGEPSGFTRSGDTWAADDPQSPPTTAVFDLTQTTIGDPSTYFAIAASTCPTKDD
FT                   GQLEVNFDPVHELSPTAPAAARFAGNAPNPFGERTTIKFALPEQTDVTLTVYDTMGRRV
FT                   ATLVDGPVRAGTHRIPWAGRTRDGQALASGVYLLRLTAGDQAFTRRMTLVR"
FT   CDS_pept        complement(341762..343489)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00285"
FT                   /product="Conserved hypothetical protein containing PKD
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00285"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23206"
FT                   /db_xref="GOA:D5H5A1"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A1"
FT                   /protein_id="CBH23206.1"
FT                   /translation="MKRLSLGLGSPPMTSRPTRDTRSSDDAHLPQSFMSFPTSSPTAQA
FT                   LLPSGRPDGSWKGFYGLLLTAVLFGLAFSPPAQAQSPAQAQSKRAGDTFYIKLGGGLSD
FT                   YAGDNDGTLSIDQTTELREFFDTRKFTDREAFPYVLVGELGYQFSPGFGLGLGYQFGQY
FT                   PFADGVPFTTTPSAPGQGGNLGQSRHTVQLLARYMVRASTWTFSPYVDAGLNVSLGGFS
FT                   PGVGPLVGIGMDASVSDRVSLFLEGRLNFTFADDAVDGITSATRADALSALPAVGLKYT
FT                   FDRPAVPPRILELNGPAEVAAGESAAFAARVNEEEATRPLSYEWEFGDGRTATGLTPSH
FT                   VYNEPGTYTVAFTARNEAGVARDSLTVGVVPPPRPPRIVSLGATPDPASPGEPVQFEST
FT                   VEGAEPLTLEWDFGDGRSGMGPAPTHTYDAPGEYTVRLVASNEDGTATDSLTLPVERAL
FT                   PAVCTTVQELNTVYFARRASSLDSAARQKLQENAEVLRTCPNLSVRVEGFAAPDEPTPL
FT                   LLSRDRARAVAEFYEDNGIAPGRITTSGEGAVGDPGGKKGADEQNRRADSIPQRDGDL"
FT   CDS_pept        complement(343865..344353)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00286"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00286"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23207"
FT                   /db_xref="InterPro:IPR032708"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A2"
FT                   /protein_id="CBH23207.1"
FT                   /translation="MKALARTIRKLWRHPWQNWGLLLHAAALTACIRGGLSATSLSRMT
FT                   QALRRVATGLPQWSAATPRYRLRAAWAAHAVGRRFLPERPCLTQALVLQYLLLRRGDDA
FT                   AELHIGVTKDENTGLQAHAWVEHSGQVLIGGTGAPDTYERFEDLGAKLEAANTPRQAS"
FT   CDS_pept        complement(345370..345612)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00287"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00287"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23208"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A3"
FT                   /protein_id="CBH23208.1"
FT                   /translation="MNQIAVTEPNCRTGLEGLRISASHPGVLGAPGRSGTMPSRKGQCP
FT                   PARDSDFFQGTVLFLRDSALLRGEVHIRLEAPISI"
FT   CDS_pept        complement(345837..347711)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00288"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00288"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23209"
FT                   /db_xref="InterPro:IPR025048"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A4"
FT                   /protein_id="CBH23209.1"
FT                   /translation="MTTSSENPFFSDTSQPQGPPDTFIPPPALESAADYDEDSSSFGGT
FT                   DSSGDASSSGELESLRQGYLSRRILELLPELLAEPAFRIGQRGDLRKRDVFLTGALPVW
FT                   AGALPNVRFRYGGTGVSPNLYSAVVAPPASGKSALRHARKYGRPSSSTSSGGTSPEIGT
FT                   SSENRTVLESRTSPKSGASLESGAYPEGRASPQGSSTGQEGPEEEPPGRERPGVRAGRR
FT                   QLFLAADSSAAALKRRLEEIPHGVIFETEFQALSRALGSSWGSFTDVLLKGLQNEAIRM
FT                   SRSSKGAVTIPHPAPSIALAGTPAALGGFMSGSGSTPGTGNGLFSRFLFYRFDREFEWS
FT                   PQFRSPQSESTQSEGPQSEGPQSEDLQSGERRGSLEESLRGAGQKFREARRQLGARETP
FT                   LWVSVPGALQEAHTRAFRSLTKKWREDESVPRSMQASLTRAGLQAVKIAVVLRGVRLAD
FT                   SGVPPASTQSIELGPEDMEAGIRLSLTYLLHAIEVGARLQGDDGPQDTCLQEKALQEKA
FT                   GSQAKLNERKRDLTERQREYLEALPEEPFSTAEAKDLASGFGASKRGVQRWLKSWRKAG
FT                   LLRKPKRGMWAKRRPERKDSPRTEGLPGAESVISVIDGIPALAGGRAP"
FT   CDS_pept        complement(347877..348212)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00289"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00289"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23210"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A5"
FT                   /protein_id="CBH23210.1"
FT                   /translation="MRVFVHYSFFAAPDIPSLPSAAALPRLLLAYTSLPMARVSTVGRL
FT                   VLAWVYSRLGAWENLSKSDILSESDILKDRLSAGTGLRDAGRRASFDERCRQHPPAETF
FT                   GWRLSDR"
FT   CDS_pept        348847..349620
FT                   /transl_table=11
FT                   /locus_tag="SRM_00290"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23211"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A6"
FT                   /protein_id="CBH23211.1"
FT                   /translation="MCRPMNTPTENDESSTPPNGGGPNGSSNKSDLEKENDSGKERSPR
FT                   EQGAGPGAKEVASGAGGLAAEREVTSREWRRLRAPFSREAYVVGSRATGRTAANLPLGA
FT                   YSEESQPNESQSGSGGGSPNETRNQAVVDLWLRAEAIRDRLDLVLGPGRYGYRLEAGPE
FT                   AGGTFSMRCHLRIGPGRRTGIGTGRSLQQAGKVALASAAEAFGMGASGKIAGPLVADSE
FT                   SWHQLPGPVLERLERREELSSWAPGSSGSEDKGQA"
FT   CDS_pept        350266..350784
FT                   /transl_table=11
FT                   /locus_tag="SRM_00291"
FT                   /product="Conserved hypothetical protein containing DUF820"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00291"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23212"
FT                   /db_xref="InterPro:IPR008538"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A7"
FT                   /protein_id="CBH23212.1"
FT                   /translation="MPTTARAADHQERWHEIISDPGLRELPYTVETNHRGQIVLSPRKN
FT                   RHSVAQEQIQGLLDEHAPNGLQPTEFAIATAGGVKVADVIWMSPGRWEHMQETGDPSTL
FT                   APEICVEVMPKSNDWESNDWDEMHSKRILYLEAGAEEVWVVTEEGAVRFFADEETEASG
FT                   VLPGFPEHV"
FT   CDS_pept        351889..352617
FT                   /transl_table=11
FT                   /locus_tag="SRM_00292"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00292"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23213"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A8"
FT                   /protein_id="CBH23213.1"
FT                   /translation="MARDQGLKNHIAAGGLKKGATKHLSAKPPLATWTLFLHLFGSTCS
FT                   SASAGTCRFGGRLAAAAQRQSNNSDPEFTDEEVLTIYVFGPVEKRSTISEIHEYVEDHF
FT                   SGWFLDLPMQKSYNRRLNRMSAVFAPLAREALSMIDSKNTRGKALRIADSMPTCVAKGQ
FT                   RSSQAEVASDRLASVGYCSSKCVSFHGAGAPPCRRPQVRAASRSGAGWADAGKRKRPPR
FT                   SSARVVDDRRWSPLWGQGLL"
FT   CDS_pept        352442..353077
FT                   /transl_table=11
FT                   /locus_tag="SRM_00293"
FT                   /product="ISSru4, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00293"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23214"
FT                   /db_xref="GOA:D5H5A9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5A9"
FT                   /protein_id="CBH23214.1"
FT                   /translation="MSPFTARELHLVVDHRSEQLPVPERAGLTPGSENDLRALRRVLST
FT                   IEGGVLCGDKAYCDGPLKERLAEDQDLDLLTPVKKEKGQKTLSAADKLYSEAVSRLRQP
FT                   IESLFNWIDEKTGIQRASKVRSYQGLLVHAFGRLAAAMLLCSQPLIRITRPAETNHRPG
FT                   RYVLLAVRNNTFCKAKLPNANLYAHDSGPDDNSEADSGGSWSPARRSR"
FT   CDS_pept        353089..353670
FT                   /transl_table=11
FT                   /locus_tag="SRM_00294"
FT                   /product="Conserved hypothetical protein, containing PIN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00294"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23215"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B0"
FT                   /protein_id="CBH23215.1"
FT                   /translation="MATGCFSAAQERISQPSTACWTVRDKNPSPLGRWTMQSERPSAKA
FT                   PAPPEPELRQRQRTTMTGIDTNVLVRYITRDHPEQYKAAKRHLESNCTQEDPGYVNVIV
FT                   LCELAWVLTTAYDAASEEVARVIDQLLRTRQLQIQCRDQVRSALAEHRDGRAGFPDCLI
FT                   GHLNREEGAGETVTFDQDAAQMGRWRELEW"
FT   CDS_pept        complement(354085..354309)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00295"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00295"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23216"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B1"
FT                   /protein_id="CBH23216.1"
FT                   /translation="MMGMWYGQDLSIGLSAVVPGPIPVTITPAWVSVLSTHTFGDRVAL
FT                   SVGMSLQLPRRCSSLKSTRPPAASSWKTC"
FT   CDS_pept        354424..355689
FT                   /transl_table=11
FT                   /locus_tag="SRM_00296"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00296"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23217"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B2"
FT                   /protein_id="CBH23217.1"
FT                   /translation="MKLTATTHVAVNAVAQKKDFKYRFYPTEEQEAVLAKVFGHTRYVW
FT                   NWALELRTDAYYEEGESLSYTDTAKRLTDLKKEKTWLREVSSVALQQKLRDLDQAFQNF
FT                   FDGRCGYPNFKSKHDKQAARFASNAFTLHGKKLSVAKVPGSLNVRWSRDLPDEAKPTSV
FT                   TLTKDPAGRYFVSITSAVPDPEPKPTATDEKGDRKSVGIDLGVADIVVTSDGWKSGNPR
FT                   HLENDLYRLRKAQRRLSRKEKNGSDGPSENWKKQKRRVAKIHAEIKDKREDFLHKLSRR
FT                   VVDENQVIALESLSVKGMQQNRSLARPISDTGWSTLVRMIEYKAKEAGRTVVKIDRWFP
FT                   STKRCSECGYVTESKPLSVRSWDCPRCDTTHDRDINAAKNIRTAGLAGAFQKANDSGGH
FT                   SKTRDAFRIERFGANAHGPVNE"
FT   CDS_pept        355732..357450
FT                   /transl_table=11
FT                   /gene="groL"
FT                   /locus_tag="SRM_00297"
FT                   /product="60 kDa chaperonin"
FT                   /function="Prevents misfolding and promotes the refolding
FT                   and proper assembly of unfolded polypeptides generated
FT                   under stress conditions"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00297"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23218"
FT                   /db_xref="GOA:D5H5B3"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B3"
FT                   /protein_id="CBH23218.1"
FT                   /translation="MSKNPPDLSGGEVKAKQIRFDSDARSALQEGVDQMAKAVKVTLGP
FT                   KGRNVVLEKSFGAPTITKDGVTVAKEIELEERLPNIGAQVLKEAASKTNDDAGDGTTTA
FT                   TVLAQSVINAGLKSVTSGANPMDVKRGIATAAEHVVEHLRNQSDPVEGKDRISQVATIS
FT                   ANNDDSVGSLIADAFERVGQDGVITVEEARGIETYLDVVEGMQFDRGYLSPYFVTDSEE
FT                   MEAVLEDAYILIYDDEVGNMQDLLPILEKVSQTSNPLLIIAEDVEGEALATLVVNKMRG
FT                   TLKVSAVKAPGFGDRQQSMLEDIAVLTGGTVISEEKGYRLENATLDYLGQADRVTITED
FT                   DTTIVGGEGSEEEIEARVNQIRQQIANSTSDYDQEKLQERLAKLAGGVAVLNVGAATEP
FT                   EMKAQKALVEDALSATRAAVDEGVLPGGGVAYLRALESIEEVEVENEDQEIGVSIVREA
FT                   LEAPLRQIAENTGHEGSIVVQKVKDGEGDFGFNARTEEYGDLLDQGVLDPTKVTRSALE
FT                   NAASVGGMLLTTESVVADLESEEEDDDGGGGGAGGGMPAGGAGGMGGMGGMGGMM"
FT   CDS_pept        358110..359732
FT                   /transl_table=11
FT                   /gene="phoA"
FT                   /locus_tag="SRM_00298"
FT                   /product="Alkaline phosphatase"
FT                   /function="act as non-specific phosphomonoesterases to
FT                   hydrolyse phosphate esters, optimally at high pH."
FT                   /EC_number="3.1.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00298"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23219"
FT                   /db_xref="GOA:D5H5B4"
FT                   /db_xref="InterPro:IPR001952"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR018299"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B4"
FT                   /protein_id="CBH23219.1"
FT                   /translation="MSHRDPPLPPGASCSPGAVCVWGLFLVNFAGLLECKLVRQHANFR
FT                   YMPVRSSTFHLLPASRLVSAVRPFFAALVLCLLLAGPAPAQTVPDAPAPEEAPNVILMI
FT                   PDGFGPASVTMARDYLRWRDGQKELPYDSLQVGSIRTYASDSYITDSAAGGTALATGKK
FT                   TYNGAVAVDTSRQAVATLLEGAERRGMSTGLVVTSRLTHATPAVFSSHVPDRGQENRIA
FT                   RQQLNKDIEVMLGGGRRHFLPQSAEGSAREDDLDLLQAAQDRGYEVVQTASELSRAGEG
FT                   QTQENRLLGLFSPGHMAYEIDRDHTQQPSLAAMTETAIDRLSGNGEGYFLMVEGSRIDH
FT                   AGHGNDAASHLRDILAFNRAAKSALEAAQEDDNTLVVIVSDHETGGLTLGRNRDGEGIY
FT                   SWRPETLAAVEASSGAIADSIRSIRSTGASEAAKRKRIAGTLTRLTGVQDVPTEIVSNL
FT                   MAVEGPYAVGQAVSPLVNRQALVGWTSHAHTAVDVNLYAYGPGANAFVGHHDNTTIAQK
FT                   LANLMDVDLESLTGTLRAGRDAR"
FT   CDS_pept        complement(360111..360425)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00299"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00299"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23220"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B5"
FT                   /protein_id="CBH23220.1"
FT                   /translation="MDRSLSPTRPSKAAFRIWHARREKAPATLWAPSSSTTSEIAIGPK
FT                   VACLWSCCAPLGESPFRLAPAHLLPKGTRRHNPKALNLARNIEEVLVSRNQDLCTCRDG
FT                   "
FT   CDS_pept        complement(361108..361335)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00300"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23221"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B6"
FT                   /protein_id="CBH23221.1"
FT                   /translation="MNRLPESAAPTLLFGPGIPLMTLFADGDTAGARLATHTPALRPPS
FT                   PDVSRPLMSWLVSAYFDSAFVDKEARVHFP"
FT   CDS_pept        complement(361332..362084)
FT                   /transl_table=11
FT                   /gene="lytT"
FT                   /locus_tag="SRM_00301"
FT                   /product="Sensory transduction protein lytT"
FT                   /function="Member of the two-component regulatory system
FT                   lytS/lytT that probably regulates genes involved in cell
FT                   wall metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00301"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23222"
FT                   /db_xref="GOA:D5H5B7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B7"
FT                   /protein_id="CBH23222.1"
FT                   /translation="MPETLRALIVDDERRARQSVRSALADQPDVEVVGEASTVDEAADH
FT                   VRRSAPDVIFLDVQMRTENGFDLLKRVDRPMQVIFVTAYDEYAARAFEVNALDYLLKPI
FT                   GPDRLTEALNRARASASSLPQQQSSAASNAFRYDDVFLCDEGHRPRFVRIQDIVYIQAD
FT                   GNYTELHLLDGDTVLTLTALHTWEQRLPDAHFARIHRSTIVQIGCVDRMERTPNATYEA
FT                   HVPTRDTPLAVSRRRGAALKEHLSPPSG"
FT   CDS_pept        complement(362077..362748)
FT                   /transl_table=11
FT                   /gene="lytS"
FT                   /locus_tag="SRM_00302"
FT                   /product="Sensor protein lytS"
FT                   /function="Member of the two-component regulatory system
FT                   lytS/lytT that probably regulates genes involved in cell
FT                   wall metabolism."
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00302"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23223"
FT                   /db_xref="GOA:D5H5B8"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B8"
FT                   /protein_id="CBH23223.1"
FT                   /translation="MAAERARLRMLRYQLNPHFFFNALNTIGALAENAPGQVQTAVREL
FT                   SGFLRYTLLDSTESPETSAVQVVPLQDELEAARHYLTVEKIRFEEDLQWTVDLDEESAA
FT                   QRIPAFLVLPLVENAIKHGQRTSPSPLRVAIRGQMTTAAPSAPSQLVVEVTNTGHLRSE
FT                   GHLRSGGKGGTGTGLDNVRARLDARYADHSRFALTEKDGRVRARIEIDADALDKPSTTD
FT                   A"
FT   CDS_pept        complement(362815..363120)
FT                   /transl_table=11
FT                   /gene="insB"
FT                   /locus_tag="SRM_00303"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00303"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23224"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5B9"
FT                   /protein_id="CBH23224.1"
FT                   /translation="MIGDRSAKTCARLWSRIPEGYRKGRSFSDFWKSYRPVFEDDSSHR
FT                   QVGKSSGELAHVERFFGRLRQKLARYVRRTRAASQSERMLHLTTKLFVEWYNEAIT"
FT   CDS_pept        complement(363255..363533)
FT                   /transl_table=11
FT                   /gene="insA"
FT                   /locus_tag="SRM_00304"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00304"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23225"
FT                   /db_xref="GOA:D5H5C0"
FT                   /db_xref="InterPro:IPR007889"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C0"
FT                   /protein_id="CBH23225.1"
FT                   /translation="MIKETHECRECGSSNIIKNGHSASGSQQYHCKDCGAHKVLDPEPR
FT                   GYSEEEKEKILRAYRERGSKRAISRIFGISRNTLNRWLEKRDTKPTQ"
FT   CDS_pept        complement(363514..364311)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00306"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00306"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23227"
FT                   /db_xref="GOA:D5H5C2"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C2"
FT                   /protein_id="CBH23227.1"
FT                   /translation="MNCERSHLRKVPGVGGLRVEKTEYSPSFRSTCDSQSPFPACQSGV
FT                   LILRLCLHYRVPKTLPPTRLRARFPLAMATTSIPSLAGIEAPDREDPVLSFRTALPLGL
FT                   QLLFWTVYGVVFYGTLLRYLPFPPIAQHLALWAAGSGLAISSFMGFGLHLLLDTTLHPI
FT                   GKTAGVLGTVAGSGAGWGGLYYWGAEAFNPFAGPVLNLTATLPGQGALLTWPLAFPLLL
FT                   LLWSGLALGVRHLVAAQHVVELSVLMMSLLAHQSIQSDDQRDP"
FT   CDS_pept        364291..364872
FT                   /transl_table=11
FT                   /locus_tag="SRM_00305"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00305"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23226"
FT                   /db_xref="InterPro:IPR025091"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C1"
FT                   /protein_id="CBH23226.1"
FT                   /translation="MGPFAIHLVRSVQQGLALLMNLAFFMNAASPFPKKARWALLVIAA
FT                   AVLVTGAAPTRAQSPDTTESGASSQNAMVKRAKAEAKRWLGFIDRGEYEASWTEASDYL
FT                   QSGTTAEQWAARVRGAHASLDSLHDRTLVAARHTTTHPELREGSDAVVVQYRSTYETSR
FT                   GVRSWLETVTVYKGREGWGVVKYLIRPEQQ"
FT   CDS_pept        364948..366108
FT                   /transl_table=11
FT                   /gene="ampC"
FT                   /locus_tag="SRM_00307"
FT                   /product="Beta-lactamase [Precursor]"
FT                   /function="This protein is a serine beta-lactamase with a
FT                   substrate specificity for cephalosporins catalyses the
FT                   opening and hydrolysis of the beta-lactam ring of beta-
FT                   lactam antibiotics such as penicillins and cephalosporins."
FT                   /EC_number="3.5.2.6"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00307"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23228"
FT                   /db_xref="GOA:D5H5C3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C3"
FT                   /protein_id="CBH23228.1"
FT                   /translation="MISSSFRYRSVLILAAGLLLLGCDLLESEGAGQGDPTRGDTTTVA
FT                   SLVQERHNEQPAGTGVVVGIVDGSDQQTLARGVTRAEGDSVDTHTVFEIGSITKTFTAL
FT                   ALADRVEQGAVRLGAPVAASLPDSVDVPGRDGTSITLKQLVTHTAGMPRLPPNFGKEPE
FT                   FESTDPYAAYSVPELYRGLEGTTLLHPPGTAYQYSNFGVGLLGHLLARRSDTTYRVLIR
FT                   DRISARLGMEETWVDLPEGPNQRLATGHRPNGSAMPHWHWRESMAGAGVLRSSARDMVT
FT                   YLKAQLGQAGAPSPLRRAIERSHTTLYDREGAGPIAYGWHVREQNGHTVFWHNGETGGF
FT                   KSLIGFNPEQNAGVVVLSNVAQGGSTEMGFALLDTVLTSTEEDGQG"
FT   CDS_pept        366803..367333
FT                   /transl_table=11
FT                   /locus_tag="SRM_00308"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00308"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23229"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C4"
FT                   /protein_id="CBH23229.1"
FT                   /translation="MSKDSSYAQLCVIMKWGFRYRFAFLVGLVALSFAGGAFAQSSDQP
FT                   EPVPRELAAAPIGSGFGGESTDFFVGTLPSGLPDDFTLPEDAQVLGGGVDRWLWVPTES
FT                   FWVVLTAGAADHRCGRPLAVQFREGEARQYACRSGMEPNDFCALKSASLPATPVFLYSP
FT                   VLPRGHGPPSLYI"
FT   CDS_pept        367923..369299
FT                   /transl_table=11
FT                   /locus_tag="SRM_00309"
FT                   /product="Putative amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00309"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23230"
FT                   /db_xref="GOA:D5H5C5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C5"
FT                   /protein_id="CBH23230.1"
FT                   /translation="MTLQLTPRFSLLLVALLVLPLGSTAQPTPDSTHQLLLADARLVDP
FT                   ETQTVERGAFRIEGERIAAVLEEAPANFDGHILDLDGKWVLPGLVDAHVHSWGNAGPTF
FT                   QEQQMLQTTGTAKMMLYSGVSAFLDLASPEDYILNLRNRQRSRGFLGADIYAAGGPLTH
FT                   PNGHGTQYPGSSARTATSPREARQRMDSLAARQPDVAKLIYNPNNDRYPSMDCATMEAG
FT                   IEAAQTHGLTTVVHVETWAAAHQVVTAGADAITHAPPAPLPDSTLAAMRQQGTAWIPTL
FT                   AVHTELSNLIQRPRLLKKDLLRAVADSVLLAAYRDTSGLPDQIRSWIDRQDEYQTTRLD
FT                   AVRKAANAGVPILAGTDAGNPGLFQGYSLHRELVLLTQAGLSNWDALAAATTAAGRFLD
FT                   APFGLQRGDRANLLVLDASPLENVRHTQNIHRVIYRGQIVNRSDFLNEAATSVPTVPTH
FT                   "
FT   CDS_pept        369410..370240
FT                   /transl_table=11
FT                   /locus_tag="SRM_00310"
FT                   /product="TPR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23231"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C6"
FT                   /protein_id="CBH23231.1"
FT                   /translation="MPPTASLSRKTTLLLTASLLVFSLVACGSSTPMAPASSASSALES
FT                   AATDSLLRQVKTQIREATDKGSLDSLKQARALAKQATGGDRAALAHYYAALADYRMSNR
FT                   LPEEDEARRERVIEDAIGHLKRATEINGTMADAWALLSGCYGQMMGMNPMQAMSLGPKS
FT                   DEAMEKAKEHGPNNPRVWLIDGTSDFYTPGMFGGDKEKALTKFEKAARLAEQGSPDDPL
FT                   MPSWGHAEAHAWVGVAHMEAERYDPARTAFETALDLNPDYGWVEKVLLPKLEEK"
FT   CDS_pept        370524..371183
FT                   /transl_table=11
FT                   /locus_tag="SRM_00311"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing protease domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00311"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23232"
FT                   /db_xref="GOA:D5H5C7"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C7"
FT                   /protein_id="CBH23232.1"
FT                   /translation="MRDLLSRLADIPPVTAGNLALSLLALPLIALLEERVVEIGPIAEL
FT                   AVQWGLVAAVVGVAVSGEDQSFAEIGFRRPTWGDLGYTLATAVAALLVFAGTDPVVEAL
FT                   GLPVAGDAGTMTAGVGVGVALARVVTTGIVEEILFRGYPIERLVAYTGSPLVAGGLTWG
FT                   VFTFAHAAVWPAGNLLQVAAVAAVLTAVYLRRRTLFPVIGAHVLVWALSVMGQYYG"
FT   CDS_pept        371364..371669
FT                   /transl_table=11
FT                   /locus_tag="SRM_00312"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00312"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23233"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C8"
FT                   /protein_id="CBH23233.1"
FT                   /translation="MTERNGQSNSKRTEVHGEGHASERISIDGTHFEDCSFEACTLAYR
FT                   GGVPPNLVQCDFAAPRFVFEEATQDTVQPVSAIYSGIGERIIEKTFDEIRKGFANR"
FT   CDS_pept        complement(371690..372826)
FT                   /transl_table=11
FT                   /gene="lplA"
FT                   /locus_tag="SRM_00313"
FT                   /product="Lipoate-protein ligase A"
FT                   /function="Catalyzes both the ATP-dependent activation of
FT                   exogenously supplied lipoate to lipoyl-AMP and the transfer
FT                   of the activated lipoyl on the lipoate-dependent enzymes.
FT                   Creates an amide linkage that joins the free carboxyl group
FT                   of lipoic acid to the epsilon-amino group of a specific
FT                   lysine residue in lipoyl domain of apoproteins"
FT                   /EC_number="6.3.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00313"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23234"
FT                   /db_xref="GOA:D5H5C9"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004562"
FT                   /db_xref="InterPro:IPR019491"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5C9"
FT                   /protein_id="CBH23234.1"
FT                   /translation="MLPGPLLGGSRIRSCPSPMSSSLPAPELSAPDAPPPSPDDARAAP
FT                   LVLIDNEGVTDPTLNLALEEWTLRNLDPQYRYLLFYVNEPSIIIGRNQNTLEEINRAYV
FT                   EDRNVRVVRRMSGGGAVYHDEGNLNFSFMTDYKPGRLHNFNRFTRPLRRVLASMGVEAE
FT                   LEGRNDLVAGDGRKISGNAQFSTPRRMFSHGTLMFNTDRKALARALDVTPDKIDSKAHQ
FT                   SVRKRVANISEVGGRVYDVPTFRRLLVDGLFPQDETPVYTLRSDEWDAVEDLAERRYRR
FT                   WAWNVGASPPFDVRRRERFEEGEVDVRLGIEDGKIDRIQIYGDFLGTWGTTAPLEHHLR
FT                   GTPYAPEALRTKLAGVDVSPLLGGLANDDFLALLYEEG"
FT   CDS_pept        complement(372827..373282)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00314"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00314"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23235"
FT                   /db_xref="GOA:D5H5D0"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D0"
FT                   /protein_id="CBH23235.1"
FT                   /translation="MSSTTTEDRANESPPSLWDWGLKVAASVGLAGMLCCVAPAVLFAV
FT                   GLMGGIYAISFADLFYAPDGSAGLGAWILRGVAALVGLVGTWLYHRRQNQCSIDPARKR
FT                   KNLALFALLVVVLGTGFYLSFEELTSWYFNEYIVPAQQAEYESMSGT"
FT   CDS_pept        complement(373418..373648)
FT                   /transl_table=11
FT                   /gene="fer"
FT                   /locus_tag="SRM_00315"
FT                   /product="Putative ferredoxin"
FT                   /function="Plays a role in electron transfer. The FAS-
FT                   operon encodes genes involved in cytokinin production and
FT                   in host plant fasciation"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00315"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23236"
FT                   /db_xref="GOA:D5H5D1"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D1"
FT                   /protein_id="CBH23236.1"
FT                   /translation="MTRDIAGLTVEIDRTLCIGSGSCVGLADEIFEIDEQNLVRFQEDP
FT                   PDIDPERLKEACAVCPVDALRVYDGDEQVVP"
FT   CDS_pept        complement(373748..374416)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00316"
FT                   /product="conserved hypothetical protein containing
FT                   DUF1094"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00316"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23237"
FT                   /db_xref="InterPro:IPR009474"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D2"
FT                   /protein_id="CBH23237.1"
FT                   /translation="MGTGEHGSPSPRGCVAVPVARPIKTKNSEAPGRASTLILAIHSII
FT                   RTSGLMPYPKSMVEPMRKELTRLGIDELKSPDDVDAAFGAAEDETLLLIINSVCGCAAG
FT                   GARPAVAQALETGPTPDHAVTVFAGQDVAATDYVRDTHLPGIPPSSPFMALFRNGQPVY
FT                   VIERKHIEGREPAAISADLVEALQAYCTDEAPPSDAPSRPDLSSSPNAGGLPSTFQSIS
FT                   "
FT   CDS_pept        complement(374426..374851)
FT                   /transl_table=11
FT                   /gene="fdxA"
FT                   /locus_tag="SRM_00317"
FT                   /product="Ferredoxin"
FT                   /function="Ferredoxins are iron-sulfur proteins that
FT                   transfer electrons in a wide variety of metabolic
FT                   reactions"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00317"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23238"
FT                   /db_xref="GOA:D5H5D3"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D3"
FT                   /protein_id="CBH23238.1"
FT                   /translation="MLRERPDGPGRLFGRETVTNCLSLFLCMPYVVAEPCINCKYTDCV
FT                   EVCPVDCFYEGPNFLAIQPDECIDCNACVPVCPVEAIYPEDQLPEEWEHYTQWNEYLAN
FT                   QWRDLGYNVTEKTGPLDDAEAWEDAEKSEEDILTWDV"
FT   CDS_pept        complement(374832..375098)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00319"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00319"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23240"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D5"
FT                   /protein_id="CBH23240.1"
FT                   /translation="MHGPDPSSSMQIPPFHVAEDGEAIGMLRRFSARFRLSPASVLECL
FT                   RRHAPTSVLLEAGRGRRQLLAVSADGLRALRDCASSGNAQGTP"
FT   CDS_pept        375070..375165
FT                   /transl_table=11
FT                   /locus_tag="SRM_00318"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00318"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23239"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D4"
FT                   /protein_id="CBH23239.1"
FT                   /translation="MLDEGSGPCTNAYTKEKRGPRIFNIYVPNIF"
FT   CDS_pept        375256..375900
FT                   /transl_table=11
FT                   /locus_tag="SRM_00320"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23241"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D6"
FT                   /protein_id="CBH23241.1"
FT                   /translation="MPVLDLLQSETKRRLLRLMNRRGEITLNDALEKIDRARPTLRDHL
FT                   DQMGRDGLVTRRSKREGRGRPSMCYRMTSRAERLFPRREGAVFAEFLAYLEEQGRDQLI
FT                   EEFFQSFWDDRLDEVERRLPGSLESADTRQIVDVLKAVLEEAGFMPEVRVEEDRVVVEE
FT                   CNCPFAEIIGATELPCASETCFYEALFGRVERTRHIPDGDEACAYELPVLQ"
FT   CDS_pept        376669..378207
FT                   /transl_table=11
FT                   /locus_tag="SRM_00321"
FT                   /product="FAD dependent oxidoreductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00321"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23242"
FT                   /db_xref="GOA:D5H5D7"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D7"
FT                   /protein_id="CBH23242.1"
FT                   /translation="MPSTNPPAPATRDADTAEADVAIIGTGFAGLGAAIRLLQEGMTDI
FT                   VVLERADEVGGVWRENRYPGCACDTASHLYSFSFAPKADWSRRFAGRDEIFAYLKQCAT
FT                   QFGVRPHIRFGHAVRRAVWDEDDRRWHIETSEGTYVARALICGVGAHSQPLIPDLPGQE
FT                   RFKGRAFHSSGWPEGFDPSGRRVAVVGTGASAVQIVPALQPHVEHLTLFQRTPAWVVPH
FT                   GDREIPPAVHELFRRVPMLLRAWRFALHHLREATGWLFWDRRVARLVEPLVRYWMRSQI
FT                   SDPDLRETLIPDYALGCKRILHSDTYLPVLSEPNVTVVDGAAREVHPEGVSGPEGVSGP
FT                   AGPRDADVIVYCTGFQSTKMPLSHSIYGREGRALAETWGDSPRAHLGTTVAGYPNLFLL
FT                   RGPNTGLGHNSILPMIEAQIEHILGALRHMGDTGIAAVEPRAAAQARFVRQVDRWSEGT
FT                   VWTDGGCRSWYLDATGRNAVLWPRSVAAFRRRVTDFDPSEYATIRHTRCPAAAR"
FT   CDS_pept        378542..379714
FT                   /transl_table=11
FT                   /locus_tag="SRM_00322"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00322"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23243"
FT                   /db_xref="GOA:D5H5D8"
FT                   /db_xref="InterPro:IPR022134"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D8"
FT                   /protein_id="CBH23243.1"
FT                   /translation="MLSGSARLPGWGHTSGGTAAPLAAKATCTTESNRVFRLLASSPMS
FT                   SGPSEQHRQEESASEKRASGAHETATEGLTRATECPSCGTPFASDYCPSCGQAADPPIS
FT                   ATAVVGGFFRELFDIENGFWPTLVGLTLRPGNTLRRYLEGARAGLASPGRYLLASVIIG
FT                   IGINRFLAWTGMGKDPFDVGASSGTTGEGGPADGGDLLVEALFTAIGQWEQFFGAQIRT
FT                   LSALLMAVLLGALLFRLFGERLSRAGEALTLGAFLSGHLELLNQGAKLLCSPAVFLWTG
FT                   QPLKTPSFLLTVVIQVGFVGFTAHRCFGPGWRPGLKGAFAAGWALIEGMAISWIFLMGH
FT                   AGWLALTRPERFGAPEGAPAVAVALFAGMGILSAVPLLLHAGAEAYYRLR"
FT   CDS_pept        complement(379857..380279)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00323"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00323"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23244"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5D9"
FT                   /protein_id="CBH23244.1"
FT                   /translation="MEPPSIESPDVESPDVESPRVESSGSEDRGKAWAERCPIGEESPA
FT                   RREAWRQGWEYRKERGPGTPKMEVAAEMAGRPDLVSEWLEGFGAADKYFTGPEAGPLRL
FT                   WSSRGSPPRGRDSSCGSVPWPPAGRSSGQVGRRVLA"
FT   CDS_pept        381156..384191
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00324"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00324"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23245"
FT                   /db_xref="GOA:D5H5E0"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E0"
FT                   /protein_id="CBH23245.1"
FT                   /translation="MTNRYGPAFALLLAGLLALISAGPAVAQTEYTIEGQVTDESTSEV
FT                   LPGANVQVEGTNFGTATGTDGEFSFTARLQPGEYRVRVSFVGYETATRMVELTDQEVVT
FT                   LDPFQLGVSAARVDEVIVTGQAGPTERKELGNAISSIEAAELQDTPKSSTLQSLQGKLA
FT                   GVRVQQSSGDPAGGTDIRLRGTGTVLGAASPLIVVDGVIISNDSPELIQVGGTTQNRLI
FT                   DINPNDIERVEVVKGAAAAALYGSRANNGVVQIFTKSGQEGETKVTYSTRVKTQAVRKT
FT                   LDVNMAQNEQGQFLDNSGDPLPEGQRRFDFQDFIFDRAYGTEQYLSISGSSGDTRFFTS
FT                   GGYLGSQGIVDESGFQRFNGTARLQHTVNDWFNVSAGARYAFSKSDDVPNGGLNTLYGA
FT                   LTGFIFGPNTFDPRPNEAGEFPDDAAFSNPLEVQSRFDFGQTTDRFIGDIQLDLTPFDG
FT                   LSIDYTLGLDTYDQTGTAFIPRGVSTPGFETGFSRRAELSNLQLNSDLNVRYEASIRDG
FT                   LTSTSLIGGTLQHESEESFNAQSQDLPPIAETVGGGTSSREFGEFRSPLTVYGVFGQQS
FT                   FGLADRLFVTGALRLDASSSFGEGDRWQLYPKVSTSYVISEQDFWRGAIGSVLPSFKLR
FT                   GSVGWSGGLTSIGAFDRFTVYNAQSFDGNPGLQPAPQLGAQGVRPERQREIEVGADFSL
FT                   ISDRLSVEFTYYNQRTEDLLLTKSLAPTTGFNTELANIGTVENNGIELRARGVALNRSD
FT                   VRWVSTVTYARNRNEVTGIPGETGRVIIPSSFRVSAAQNGEPIGSYFGGAFARNEDGEV
FT                   IDTEGNPMREDDDGYWRPKNCDVSESGCSGIPARAEQDQIIGNPQPDFTLAWANQVEVG
FT                   DNLSIRFQVDGEFGQDVFNFTRRIGAFPSFGTLEDYERELEGDLPSGYGSGVFNIFENW
FT                   VEDGTYVKLREVAVNYTIRPGALPVESVRFNAAGRNLFSIDDYSGYDPEVNIGGQRTGV
FT                   RGFDFVVPPVPRTFSLGATITF"
FT   CDS_pept        384254..385633
FT                   /transl_table=11
FT                   /locus_tag="SRM_00325"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00325"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23246"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E1"
FT                   /protein_id="CBH23246.1"
FT                   /translation="MNRPRSVPNLLVLGIAALGVLSVAVSCDLDPTNENNPTEDQTLST
FT                   AQGIRTLTVGMQELYATDALNATIPRGVGITSREIAVNNTFSNLIEMERGGTDLSTSNS
FT                   NVEAIWSANYRVVGAAEDIIENAPQVNLSASTESGVVATARLFKAMALGNIGLSFEQAP
FT                   TTTRRDGTAEFVPNEQVLQEAVTLLNGALSALDDTAPSDEFSNSVLSISVSGGTPVEGL
FT                   RNVIHAYRARFNGVIGNNTPAITAANQVDPTITSTFSYDDQSQNPFWQELVQSEDLALR
FT                   DSLGSNLTEPGDERIEFFADPVGETSTPNGLPIEDPAGFYATASTPVPLFVPGEMPLIR
FT                   AEAKLNSGAPLAQVVEEIDSVRTDASGDDIPSPFGIAAGLPPYDETGRPTTEAALQTEI
FT                   LRQRRAELYLQGTSLADSRRLGGEVSDREDPGTFERNRNFYPYPDQEQRNNPNTPPSPN
FT                   F"
FT   CDS_pept        385884..386198
FT                   /transl_table=11
FT                   /locus_tag="SRM_00326"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00326"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23247"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E2"
FT                   /protein_id="CBH23247.1"
FT                   /translation="MPAFLRQPPSRSDDAHRAALPDDGLSRSQYNRRLHRVQPLLEALF
FT                   DWLGRLHKTASRENVFLIDSCPIPACDNIRIRDCRIYPSEAIEDVFGDITAANTGGSMG
FT                   "
FT   CDS_pept        386213..386398
FT                   /transl_table=11
FT                   /locus_tag="SRM_00327"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00327"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23248"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E3"
FT                   /protein_id="CBH23248.1"
FT                   /translation="MTAEGYPVEASLTPGSAGDTKHLRSFEIDLSEGAVLYGDEASGEY
FT                   FIEDLLAEACGIEPCL"
FT   CDS_pept        386498..386593
FT                   /transl_table=11
FT                   /locus_tag="SRM_00328"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00328"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23249"
FT                   /db_xref="GOA:D5H5E4"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E4"
FT                   /protein_id="CBH23249.1"
FT                   /translation="MLPKSIHAVSARGFELKVFLFVLAFSISVLV"
FT   CDS_pept        complement(386733..386975)
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="SRM_00329"
FT                   /product="putative thioredoxin"
FT                   /function="Component of the thioredoxin-thioredoxin
FT                   reductase system."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00329"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23250"
FT                   /db_xref="GOA:D5H5E5"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E5"
FT                   /protein_id="CBH23250.1"
FT                   /translation="MANKWATWCLPCVEEIGSFHSLHEGTRRGVSVVLAAEEDVETVRR
FT                   FAEKRGFSVPMYVADEMPAPLREETIPRTYVVKPD"
FT   CDS_pept        387853..390861
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00330"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23251"
FT                   /db_xref="GOA:D5H5E6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E6"
FT                   /protein_id="CBH23251.1"
FT                   /translation="MHNRPIRHAGTWLALLVLLGWPASAVAQTTVEGTVIDAEAESPLP
FT                   GVNVRVQDTQIGARTDSEGRFSVELPEGQRTLVFSFVGFATQEVTVPEGETEIQVAMES
FT                   DVVGIDEVVVTGLASSVKRENLANAVTKIDEEDIAGTVEPSTLDGALQGKLAGVNITSQ
FT                   SGAPGGGINVQMRGISTLGAGSSQPLYIIDGVYVNNSQISTGRSSVDGAGGASQDNAAN
FT                   RLADLNPDEIESLEVLKGPSAAAIYGQRANAGVVIITTKSGEGGDTRVNFSQDLGAVSA
FT                   LNLLGVASWSEDKIDRIYGEGTPAAAREKERFNEARRNGNLTNYEEKLYGNTGLTRNTQ
FT                   LEISGGNQQTQFYVSGGLKDEEGIIKNTGFARKTVRANIDHSLSDRVRISSRSNYIYSN
FT                   SDRGFTGNQNSTGGSVGYTLAYTPTYAQLQQREDGSYPDNPYFAENPLRLVNEATNNQE
FT                   VNRFLQSFSLNADLLQSESATLSLDLNGGLDYLNTNSTVYFPPFFQFQQAQSNPGDVIQ
FT                   GKEDNLNTNMQGLLVYNQTLESGAGTFNLTTQGGFSRFTQNENRQLVRGRGLAPGQTNP
FT                   LNGQIQEIFSQQFVEIVDIGYVGQQEVNWDDKLIGTIGARFDRSTLNAKQQDFYFYPKG
FT                   SLAVNLHNFGFWGFDPIGQMKLRTAYGETGGLPQFGDTFSALNSVNIGGGLGSTASQRG
FT                   IDPDLDPERARELEFGADVSALDGRVALEATYYRKVVDDIILDRENPVSTGITTIATNA
FT                   GTLRNTGVELGLSLSPIRRSNFSWFSKTLFWQNDSEITDLTIPAFTTGGFGAALGTYYT
FT                   GEGFSPTTIVGTPATPDQEVPFTVYGNAQPDFQMSFSNSFTLFQDLEVSFLFHWSRGGD
FT                   NINLSRFLSDIGGTTADWNEDFDDDGVPNGLDRTDQFGPGAAQFVEDASYVKLREASIY
FT                   YTLPSSVLETAFNGVLRNARIGLSGSNLLLFSDYSSYDPEVSVFGTQPVAQSVEVTPYP
FT                   SSRRLTFHLELEY"
FT   CDS_pept        390897..392282
FT                   /transl_table=11
FT                   /locus_tag="SRM_00331"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00331"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23252"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E7"
FT                   /protein_id="CBH23252.1"
FT                   /translation="MRPNTMTMRHSIYSVCIVALLAVSVTACDFFDPDPVTDPNSPSTD
FT                   EVLNGANKSELQNLVTGLESRHREAPPDVTELYGSFGREVYATFASDPRFITNWLGQDG
FT                   VTPDAEFFADGGAFDAPYAAIKQGNFLIEAVNNTDAVSEQERNGYIGFAKTIQAYQYLI
FT                   ALNGQWRGPDRSPPGSIRIDVADPLNPGPFLSYDDALAEIRSILDEANGQLGNAGSEFA
FT                   FTLSEGFAGFDTPSTMQELNRAIAARAAIYAEDWSDALSALDASFLSLESGEASMNEGA
FT                   YHVFGAPPDEFNPLFYPRDANTNQILMVHPSMIEDALPGDLRVERKFFRRDEPITNGDL
FT                   PGVELFYQDNRYESNESPVPFMRNEELILIYAEAKTQTESFSDAVDAIDIIRETWELDA
FT                   YSGPVNKEALIDEILFQRRYSLWAEGGHRWIDARRYGRLDEIPTELDGGQVFEKLARPL
FT                   SEK"
FT   CDS_pept        392444..392572
FT                   /transl_table=11
FT                   /locus_tag="SRM_00332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00332"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23253"
FT                   /db_xref="GOA:D5H5E8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E8"
FT                   /protein_id="CBH23253.1"
FT                   /translation="MLAESRAHWANALFLSAIAASEWIVFPAAFSGLPVPFSAAAL"
FT   CDS_pept        392725..392913
FT                   /transl_table=11
FT                   /locus_tag="SRM_00333"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00333"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23254"
FT                   /db_xref="GOA:D5H5E9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5E9"
FT                   /protein_id="CBH23254.1"
FT                   /translation="MLIWMVADAFLVGVAGMEEIEEDLALVAVLLGPLLAAAADGGLAI
FT                   YFLFIRAQEEVVRLREG"
FT   CDS_pept        complement(393585..394145)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00334"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00334"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23255"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F0"
FT                   /protein_id="CBH23255.1"
FT                   /translation="MPELRRNLEADPGEADARSWRECRALDPEEGSGRSLREVSITRDH
FT                   DFGPVNVLYHWAEGEEEPRRLVTNLSPGFRVVRLYRRRNKRRMWIEELFGDWPEGTFHL
FT                   HQPRLCDPERLSRLLLGLSLVYVWPVSVASYVAGASVALPHRPDRPASPQPPDPRAPMG
FT                   QQTSPESRTASDAPAAVRLQNVR"
FT   CDS_pept        394348..394638
FT                   /transl_table=11
FT                   /locus_tag="SRM_00335"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00335"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23256"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F1"
FT                   /protein_id="CBH23256.1"
FT                   /translation="MVPPREAKTLSFDEKRVTVYKKEDLPEGLGARPYGPAGQQVGDQW
FT                   GESEASAVLRVPSVVVPAEHNYLINPRHPEFEELEIGAPRPLALDPRLPAE"
FT   CDS_pept        complement(394802..395134)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00336"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00336"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23257"
FT                   /db_xref="GOA:D5H5F2"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F2"
FT                   /protein_id="CBH23257.1"
FT                   /translation="MTQTQQWLVGQIGVLLAFVGFIAQILVEQGTAVLGVPWAQAGADG
FT                   WAFWGFLVAAAGTAVQLVRFYQGGVDLSCHQMPGGAGRWVYPMLAAIGPLSALASLALL
FT                   ALEISS"
FT   CDS_pept        complement(395693..396085)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00337"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00337"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23258"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F3"
FT                   /protein_id="CBH23258.1"
FT                   /translation="MRGFFLCVIASFLALSPCAQAQPQELTFAEYQSQIDAPPSVVEDT
FT                   ATALAEKNQYLRGIALPQGNRLPALVPGRVLLSFAGTPYTLYLRSTTHHTEAVLKSQKL
FT                   DLSEEAQQKAQRFLQQIADRVGPENG"
FT   CDS_pept        complement(396153..396896)
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="SRM_00338"
FT                   /product="Protein TonB"
FT                   /function="Interacts with outer membrane receptor proteins
FT                   that carry out high-affinity binding and energy dependent
FT                   uptake into the periplasmic space of specific substrates."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00338"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23259"
FT                   /db_xref="GOA:D5H5F4"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F4"
FT                   /protein_id="CBH23259.1"
FT                   /translation="MNGCSASRPFGCPESSVLSRKKAWTQGRKTSRGSSNPHLDMAHPR
FT                   LDASSIRNQYATHLQAGLALSLVLLLGAVHLSPPLGREVEPTIRGHEAAALRHVQSTRQ
FT                   AQAPPAPPTPMPPQVLPREKVVESPSVEFDPSLGLDATVDRSDGGAKRPDCGGRRALRG
FT                   KTYYPPSALRAGLEGRVRVKFVVGKDGDIESPTIADGAGALLNRAALRAVRRLECTPGR
FT                   EQSRPVEAERTKTVVFALPEKMDGS"
FT   CDS_pept        complement(396921..397850)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00339"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00339"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23260"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F5"
FT                   /protein_id="CBH23260.1"
FT                   /translation="MPHTLVSRGIRPLVLAGILLCGLAPSGIVAAPLPAEPGQSATSGP
FT                   ALSNDRPLPMHIDPMCTRPARPAASPALCPRPMDLLQAGATRAVPAPRQSLAAFRRPPV
FT                   RRDVPLRQIVLRQRVSRQRMQGPERPALELGDSQAGRALWGSVIGTAVGWALGGVLLAG
FT                   ADEVEAPPQSAGGNQSTPEGVALLLLAGGPPAGAIINTDVEWGNAKAWALGVLGGAVLG
FT                   GAGIALGTAIGGSDRGEAVGALVLGAPGAAVGGGVGVLLAAPDGRSALRYSAESGTWSA
FT                   GLPAVRMRPGAGPEADLVGKVSLVTVDL"
FT   CDS_pept        complement(398010..398960)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00340"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23261"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F6"
FT                   /protein_id="CBH23261.1"
FT                   /translation="MWAMTDRLVGTRVFSCLPAAFLLLTPFGLLGVGLLGAGPAAAQPT
FT                   WPEGTWTEATTGRPQVSLDWTKPSFDGDTEATSLLTSRLVLSGQYPIGKSTRLVADLPI
FT                   SRFGIDDEDAGRADGVSSTKVGNPYLGAHARLSGGWAVGGGARLPLTSGPEAPDAGDEF
FT                   RQNAADVLALATGSLADMSRVEAFGAETFTARGYGEYTLRSAGGLSARLRSGLTLLAPT
FT                   ENTDFRANVVLLDYGARAWYDGKRFRVGLGLGGRTNLNADETETFNERSIYFFDSAVQA
FT                   RFGRVRPGLTFRTPLGGEPSDLLDFAAGINVTVAL"
FT   CDS_pept        complement(400025..401287)
FT                   /transl_table=11
FT                   /gene="rgpG"
FT                   /locus_tag="SRM_00341"
FT                   /product="Glycosyl transferase
FT                   N-acetylglucosaminyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00341"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23262"
FT                   /db_xref="GOA:D5H5F7"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F7"
FT                   /protein_id="CBH23262.1"
FT                   /translation="MATPLFLGLVGSVVAGFLVTVLLTGLVCEQAPRLGLLDRPTQARK
FT                   VHRRVTPTGGGIAIAAGLAVGLGVLWGFWGPFPGAVQSLSFWGGAAIMLTTGCWDDKHA
FT                   LDAKAKFAFQLVAAYLLLHSGTILPLSGGHADALSPDVVAGALPFSEALYIIPLSMLWI
FT                   VGIINAVNLIDGLDGLATGIIGIAFLACAALFGVKGEIALTAVGIVMAGALVGFLPHNF
FT                   KPATIFMGDSGSLLLGYLLAGYTLQGPLHTDPVLALLILPVLLGVPILDTGTAIVRRFA
FT                   SARTIFAPDRRHVHHRLVDRGTEQGAVLTLYGVGAWFGSAAVLMGVLPAVWGYLLAGGT
FT                   AVVAVVWAWRLGCLTPVPAAEGADARSKPVGGLAENEIPVPVDIITTGDPASVGGDGAS
FT                   PEAVQDRSADEPEADETPIAP"
FT   CDS_pept        401970..403589
FT                   /transl_table=11
FT                   /locus_tag="SRM_00342"
FT                   /product="Conserved hypothetical protein, secreted or
FT                   membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00342"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23263"
FT                   /db_xref="InterPro:IPR026444"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F8"
FT                   /protein_id="CBH23263.1"
FT                   /translation="MLARLSALVCAVLLGIGVLVPAAALGQSFTYAEECITNVDNATVH
FT                   VPSAAAPTLPDGTPVAAGDTIAVYTADGTCAGYGVWTDGEGATLAAAGSDSIDVSPDGY
FT                   ASGASLQFEIFDVTKGTAVDVDSAAAFSSCSEVDVPVCAEGVYEPGTFHQVTGFQADSS
FT                   ETVTRTITMAEGWSFVSVPVESDATFGALFPECSGGFSYTPGNGYTSLSDGDAVPVGMG
FT                   IAVQCQADTTSVTGTVPPTTVEVAAGWNLIGSVEDTVSVGAVTASPSGIVTSDFFRLPP
FT                   GQGYTPTAALRPGEAYWVKATEAGTLDLSGAAGTLVAGSETSKNDPAGVVRLSIADAEG
FT                   QQYTLRLEEGLTDRQRSRSELPPVPPGDVFDVRFASGHAAAAFASGKASAPGHAVQLQG
FT                   ATFPVEVRLKTGGSDRRIEIAAGGERHALSAAQPAAQIQESTDRIGVTAAPTPDEFRLG
FT                   KASPNPIRRGAELEYTLPEESEVSIAVYDVLGRRVARLVDEKRRTGVHRARIDAGTLPS
FT                   GKYFVRMRAGTFRQTRQLTVVR"
FT   CDS_pept        complement(403681..404757)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00343"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00343"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23264"
FT                   /db_xref="GOA:D5H5F9"
FT                   /db_xref="InterPro:IPR013229"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5F9"
FT                   /protein_id="CBH23264.1"
FT                   /translation="MADDAPFPEPDDAARSGAGSASWEPYQSPQGGRGGALRLLRRYAF
FT                   SITAGTIALAIGLLIYFAPTRLTSPPADDEPTSTLSVDSQPPGAVVIVGADTAGVTPIN
FT                   NHPLSPGTYLVTIDRADYGSRDTVITLSAGQSVALSPRFSRDESSVAAQDQAAARSQGS
FT                   APAGLSPGEPSPSSPSPSPPGPGDETPGSASDSPTANGRPDPSTAPAAGDIAPVTGTLV
FT                   LRATPDRATVALDGEEVGATPATLTEVTTGTYEVTFSRPGHKTVTRRVDVSATDTATVT
FT                   ATLKRRTGHLRVLVRPWGSIYIDDQRRAENSDVWYDTTLPAGPHTITARHPALGEKSRP
FT                   VTVAPQDTQSVVVDLREQ"
FT   CDS_pept        complement(404985..407087)
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="SRM_00344"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /function="Critical role in recombination and DNA repair.
FT                   Help process Holliday junction intermediates to mature
FT                   products by catalyzing branch migration. Has a DNA
FT                   unwinding activity characteristic of a DNA helicase with a
FT                   3' to 5' polarity. RecG unwind branched duplex DNA (Y-
FT                   DNA)"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00344"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23265"
FT                   /db_xref="GOA:D5H5G0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G0"
FT                   /protein_id="CBH23265.1"
FT                   /translation="MSEDFLQQDVRYVKGVGEKRADVWAEQHGVRTVHDLLRFYPRRYL
FT                   DRTTVTPVRRLQEGPDSVTVVGTVRSVNVVPGNNQKRLEIILEGEQGGRMKGTWFQGVW
FT                   WVRKAFDEGDRVAFHGTVEKYGRWHSMTHPDFDRLNDEGPLLDTGRIVPLYPGGEAMSN
FT                   VGLTSRTVRRVLYDLFKEHGLKLTETMPDWIMDGYDLMEGRVALRAIHFPKTQQELSRA
FT                   QRRLKFEELFFIQLLLAQMHEQQEEVAGPAFDDPGAYTREFVREVLPFELTGAQTRALR
FT                   EIIGDVQTGTQMNRLLQGDVGSGKTVVAVAAMMHAYDSGYQSAFMAPTEILAEQHHANL
FT                   QDYLQPLGLEPRLLIGSQTKAEREAALQAVRSGESPVAVGTHALIQDEVAFDRLGLAVV
FT                   DEQHRFGVAQRAEMFEKGERPHMLLMTATPIPRSLALTLYGDLDVSKIDEMPPGRKPVE
FT                   TRLRAEKRRGEVYAFLNDRLEQGEQAFVVYPLVEESEKMDLKDAESGAQELQEKFPDYT
FT                   VGLVHGQLSADDKDATMRRFKKGDIDLLVATTVIEVGVDVPNATVMLVEHAERFGLSQL
FT                   HQLRGRVGRSDQQSYCVLMASYKRSQEAKQRLEAMARTNDGFEISETDLQIRGAGDFFG
FT                   TRQSGMPDLKIADLTEDDEILEVAREAAFALIEKDPHLRADEHERLRHRYQEDYAEHGL
FT                   GFARVG"
FT   CDS_pept        complement(407216..407941)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00345"
FT                   /product="conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00345"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23266"
FT                   /db_xref="GOA:D5H5G1"
FT                   /db_xref="InterPro:IPR001727"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G1"
FT                   /protein_id="CBH23266.1"
FT                   /translation="MGEETPMTEWIEIMLIAAGAQLAVLPGEKVQFIIAGLSTRFSPYL
FT                   IVAAAGSAFAGWTILEVTFGAVLRDALPQLYLDLLTAGLFLLFAVLIYRSAPESGTTSP
FT                   ASEADDEGWIGAGTVEVLGVELPSSLATFLGIFSMMAFGEVGDKTQLVTISLAVQYEAA
FT                   SAIWLGEMLAILPVSLANALFFHHFAHRVNFRKAHFVGTGIFLFFALDMLLSVTTGHSI
FT                   WGTAVHTVSNVVATGGGVP"
FT   CDS_pept        408251..409765
FT                   /transl_table=11
FT                   /locus_tag="SRM_00346"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00346"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23267"
FT                   /db_xref="GOA:D5H5G2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032285"
FT                   /db_xref="InterPro:IPR032288"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G2"
FT                   /protein_id="CBH23267.1"
FT                   /translation="MSQTRRDFLKYLSLTGAALGVPGVATGAPHLSAGRESVAVTGRVT
FT                   GPDGGLEGVPVTDGVAVTQTGPDGRYELAASPRRPFVYLSVPSGYRLPTHETGTARFYR
FT                   PLGAAGGGTAEASFRLTPLDRDDEQHAFLFLADPQTRTAAEMRQFRDETVPDVQEAVRA
FT                   LGNRPVFGVGGGDLVFDELSLFSGYEAAVEEMGIPFVQAVGNHDLDFDAPGDPGSTATF
FT                   RQHFGPEYYSFDRGTVHYVVLDDVYWPGSDGFGRETGDYHGHLDAAQLAWLEQDLALVE
FT                   DGRPVVVFTHIPPLSTAYERRGEDSPSVRGRIGNRAALYELLDPFDAHIVSGHVHENEH
FT                   RFADGPHEHVVGTVCGAWWTGPVCYDGTPKGYAVYEVDGDSIAWRYKATGRAADHQVRA
FT                   YPSGADPEAPGEWVANVWDATDDWTVVWYEDGIRTGAMARRVGLDPMSRRRHEGDNQPE
FT                   KHTWVEPQPTAHLYYAPANPDANRVRVEATDPFGRTYVARPSSNRG"
FT   CDS_pept        409815..410450
FT                   /transl_table=11
FT                   /locus_tag="SRM_00347"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00347"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23268"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G3"
FT                   /protein_id="CBH23268.1"
FT                   /translation="MQVRPVGFAGAFRRGAPPGGLVGSGGTESEPPSIPSEVKAQTPIT
FT                   RIAFGSCNDQAAPQPLWAPIRAAEPDRWIWMGDNVYGDTLNMTALDSIYARQNRRPGHR
FT                   TLRESTRVIGTWDDHDHGANDAGRSYPKRDRSQAHVLDFMDVPEDHPGRERAGVYSAHT
FT                   YGPPGKRAKVILLDTRHHRDPITRAPISGQRYFPTRRGTSWARRSGSG"
FT   CDS_pept        complement(410909..411514)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00348"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00348"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23269"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G4"
FT                   /protein_id="CBH23269.1"
FT                   /translation="MFSVPNRRPSAPAWAGASLTPCRHTSSGGDAPRRVVRSDSLSSAT
FT                   KRPHPPMCFRRSALAAMLVGILLLSGAGCGSTAATTSQPPATTDAPVLDTARVARIDVP
FT                   DQIATSDTLRVHLSGTVGPNGCYALARIDEGRTPGRLTLTPRVRPPTADDRACTMEIVP
FT                   LDTTHVASPPFEPGRLAVTVPQGNQPAVTDTITVTDRP"
FT   CDS_pept        complement(411611..412354)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00349"
FT                   /product="Putative RNA methylase family UPF0020"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00349"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23270"
FT                   /db_xref="GOA:D5H5G5"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR026170"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G5"
FT                   /protein_id="CBH23270.1"
FT                   /translation="MPPAPLLARALLPIILAPPTMSRLRPITISLSAALLVLWAVLPLR
FT                   GTGQTVDPLPPILQEESLTESAVISDSDTVEKDVPYVSTSQRVVNRMLEAAQVTSDDVV
FT                   IDLGSGDGRIPIAAAQRHGARGIGVEIDPELIAKARENAEAAGVSDLVEFRQGDLFEAD
FT                   LSEATVVTLYLWPEINVKLRPKLLRTLDPGDRIVSHDFRMGDWEPDRVIDLGPGKIGQE
FT                   TVYLWTVPASVPEDLLDISDEVEVQ"
FT   CDS_pept        412884..414914
FT                   /transl_table=11
FT                   /gene="tktA"
FT                   /locus_tag="SRM_00350"
FT                   /product="transketolase"
FT                   /function="catalyzes the reversible transfer of a two-
FT                   carbon ketol unit from xylulose 5-phosphate to an aldose
FT                   receptor to form sedoheptulose 7-phosphate and
FT                   glyceraldehyde 3- phosphate."
FT                   /EC_number="2.2.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23271"
FT                   /db_xref="GOA:D5H5G6"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033247"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G6"
FT                   /protein_id="CBH23271.1"
FT                   /translation="MATDLLEETDIETQTINTIRFLSADAVQRAESGHPGTPMGLAPVA
FT                   YVLWTRHLRHNPRDPDWPGRDRFVLSAGHASMLLYSLLHLTGYDLPMEELKGFRQWGSR
FT                   TPGHPEAHLTPGVETTTGPLGQGFANGIGMAIAEQLLADEFNEEGFPLFDHHTYAICSD
FT                   GDLMEGISQEAASLAGHLGLGKLVYFFDDNDITIDGSTDLAFTEDVAARFEAYGWHVAH
FT                   VEDANDLEAVDRAIEEAKAETERPSLIRVQSHIGYGSPNKQDTAAAHGAPLGEEEVRGA
FT                   KENLGWPPGETFYVPDAVYDHMRAAKTEGQEAQREWEALREAYEEAHPGQAARLKRWMN
FT                   RELPEGWEEALPAFEPTADTGEELATRKASGLTLEALAPEVGYLIGGSADLTGSNKTDV
FT                   EGRGDFQKDSRSGRYFRFGVREHAMAGLSNGMALHGGIQPYAGTFLIFSDYLRPSLRLS
FT                   ALMEQPVVYVFTHDSIGLGEDGPTHQPVEHLMALRAIPGATLIRPADANEAARAWAAAV
FT                   TRTDGPTALALTRQTLPIVDRTELTTAEGLHRGAYILREAAGQPDAVLMGTGSEVQHAL
FT                   QAARALEKDGIQAQVVSMPSWELFEEQSETYRRKVLPPSVEARVSIEAGVTQGWERYVG
FT                   PEGTAIGVDRFGASAPGERVMEEYGLTAERVAEEARSLVRE"
FT   CDS_pept        415014..415694
FT                   /transl_table=11
FT                   /gene="tal"
FT                   /locus_tag="SRM_00351"
FT                   /product="Transaldolase"
FT                   /function="Transaldolase is important for the balance of
FT                   metabolites in the pentose-phosphate pathway"
FT                   /EC_number="2.2.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00351"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23272"
FT                   /db_xref="GOA:D5H5G7"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G7"
FT                   /protein_id="CBH23272.1"
FT                   /translation="MKFFVDTANLEDIREANDMGVLDGVTTNPSLVKAEGNVDFHERVL
FT                   EICQTVDGDVSAEVTATEFDGMMEEAHTLAQIHDNVVVKIPLIKDGIKALRALDEEGIK
FT                   TNCTLCFSPTQALLAAKAGGDYISPFIGRIDDISSDGMGLIEEIVQIYDNYGFETEILA
FT                   ASIRHPTHVKRAALAGADVATMPFSVLTNLLEHPLTDRGLERFLADWEDYKEARDEAPA
FT                   TTTA"
FT   CDS_pept        complement(415772..417394)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00352"
FT                   /product="Sodium/glucose cotransporter"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00352"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23273"
FT                   /db_xref="GOA:D5H5G8"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G8"
FT                   /protein_id="CBH23273.1"
FT                   /translation="MDSAAVAFTTLDYVIFGVYLFVIVGLGLWVSQEEEGEEKDSADYF
FT                   LASKALPFWAIGSSLIAANISAEQFIGMSGSGFRVGLAIASYEWMAAVTLLVIAWFFLP
FT                   IYLEKEIYTMPQFLEERYDGRVRMLLAIFWLLVYVFVNLTSVLYMGGLSINVIMGFPLW
FT                   ASVLGLAAVATAYSLYGGLKAVAWTDVVQVVVLVGGGLLTTWVALDAYGGSEAGVVGGF
FT                   TQLMGDASGRFNMILFEGELMYRNDEGALKDAYQLLPGLSVLFGGLWVANLFYWGCNQY
FT                   IIQRALAAKSLKEAQRGLAFAGYLKLLLPLIVVVPGIVAFALDAPIQRGDEAYPWLLGE
FT                   YVGSGFRGLAFAALVAAIISSLASMMNSASTIFTMDLYRNYTSRKDVSERRLVRIGRAV
FT                   ALICIVVAAALAPQLADLDQVFQYIQEYTGFVSPGVLAIFVLGLFWSKATPNAALVSAV
FT                   LSIPLSAAFKFWTPGVAFLNRMLIVFFISVALIVAISLLENEGEDHPKAIDVGGIERER
FT                   DPIYNVAAFGILAITAALYAFFW"
FT   CDS_pept        complement(417841..418830)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00353"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00353"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23274"
FT                   /db_xref="GOA:D5H5G9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5G9"
FT                   /protein_id="CBH23274.1"
FT                   /translation="MLQRFYETLSTLRARWTRFTESPMGAWVRTGLHWLFVGGIVAYLA
FT                   YELTTIGWGEVARALPVTPWFYVLLLLMYGTLPLTEAVLYGTAWGAQYRDLLPVLFRKR
FT                   VLNNDVLGYSGEAYFYLWARRETNLGTGTVLRTVKDNVVISSVASTSVAFGLLAVFFLT
FT                   GQIELLRQYLPSEAYTLGAGVAVLIILVSAVVAFRRSILSLPSSLLGLFAAGHFVRFVL
FT                   NNGLQVTQWAVVIPEVSAGTWITLLALYIVIQQVPFVPSRGLVFMSAGVGLSGPLQIPE
FT                   APLASMLLAQSLLDRGLNFLVYTGTTAAEAVGDDVEELDDLSIPEEMG"
FT   CDS_pept        complement(418877..419950)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00354"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00354"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23275"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H0"
FT                   /protein_id="CBH23275.1"
FT                   /translation="MTFEDRYGWLDRLLHRTAFRAGTAQHALSDVENILYRDTLSSISV
FT                   DDPVFITALPRSGTTIVLRLLWNTGRFASHTYQDMPFLLCPLFWDRFSDQFDGGTQTTE
FT                   RAHGDGLQVSGKSPEAFEEMIWKHFWPDAYRGRCIQPWSDDDHDPAFDTFYESHMRKVV
FT                   AVRRDAPSADLRYLSKNNLNIARLGALPRPLEAGTFVVPFRAPFQQAASMLQQHERFLQ
FT                   LHDDDDFVREYMEAIGHHEFGHGLRPVNFDGWVDDAPEPTSLAFWVRYWIAAYQHVLAH
FT                   ADENTVLLSYDRLVDEPRTALSRLADLISVDPSALTGQADQLRPPRSHSVETAALSSET
FT                   RRRAAALHETLKQRAPL"
FT   CDS_pept        complement(419947..420330)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00355"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00355"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23276"
FT                   /db_xref="GOA:D5H5H1"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H1"
FT                   /protein_id="CBH23276.1"
FT                   /translation="MNIVLAAGVVVGFAVIIERLRLPGHARQVGRHSTTCLRVLRDDSL
FT                   DDAAKETALQNRARELFGLLGRLVGGSALALGLPLGGVWLLGRAGVGSFSGTFATLQRI
FT                   DFLAVTTAVGLLAYVLVQRTRAS"
FT   CDS_pept        complement(420619..422037)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00356"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00356"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23277"
FT                   /db_xref="InterPro:IPR039535"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H2"
FT                   /protein_id="CBH23277.1"
FT                   /translation="MALLYVFLARRCTRFRRIRSSLSSYLMQSTFSKIWFVASVALLAF
FT                   LIGFAVRAARVPPNDVLKQAWMQARSTVEPPTFLKPRVHDRSGVRRADPDAMQDGVTLL
FT                   TSTWKGPEGWSPRIRLINRAGDVLHEWRIDETALFADSLDLSRKHYLHGSHLLPNGDVL
FT                   FNVEHGGTARVDACGTVKWRLPIGTHHSIDRAADGSFWVSDLTQSLRRTSSAYPDGYPG
FT                   LEAAYFDRLTRISPEGQVLQTIGVLDILYGSDLARYVSKAYISGQQESPESDLPGTDPT
FT                   HLNDVEPLPPSMADEYPLFEAGDLLVSLRNVHLVFVLDPETETVKWHASEPFIMQHDPD
FT                   FIGDGWIGVFDNNRDFTERGTVQGGTRIIGIQPHTDSTRKLFPTPQSESFHTKKGGKWQ
FT                   LLDNGNLLLTEHHAGRVMEVAPDGRTVWEWIHPPHEGSTVPAVQEGTRYDLSPDDLSDW
FT                   PCASKDFVRTPTPQ"
FT   CDS_pept        complement(422132..423295)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00357"
FT                   /product="Glycogen synthase"
FT                   /function="Synthesizes alpha-1,4-glucan chains using ADP-
FT                   glucose"
FT                   /EC_number="2.4.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00357"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23278"
FT                   /db_xref="GOA:D5H5H3"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H3"
FT                   /protein_id="CBH23278.1"
FT                   /translation="MRLLFVTQDFPPDVGGIQTYSWEVATRLAERVEALEVIAPHRPSA
FT                   ARVDRAAPPAVTRVRGRPDLLPVTALFTVARRAVRLRADVALHAQWQTVGASALARWLT
FT                   GYPRRIVCAAHGRELLFNPLSGRSGLGAAYDRFRRWSLAQPDALLPVSRYTARLLQERG
FT                   VPPARLRVVPNGTDPDRFRPRGGRALRDRLGIGRRPMLLTVGRLVPRKGVDTVLRALPR
FT                   IAASVPEVQYMVAGTGPDRSRLERLAVRKGVRDRVHFVGHVADDALPSYYAAADLFVMP
FT                   AREAPPDVEGFGLVFLEANACGTPAVGARSGGVPDAIVDGETGLLVPPAAPTALASALA
FT                   SLLHAPEQLATLGRQGRTRTLRTANWQEVARNVHALLSEVASHRPLP"
FT   CDS_pept        complement(423349..424245)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00358"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00358"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23279"
FT                   /db_xref="GOA:D5H5H4"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H4"
FT                   /protein_id="CBH23279.1"
FT                   /translation="MSTLARFAHTLRYELFENTPPDTKGRRLFFRGLELFIMGYAVYFC
FT                   WTWGVYIQQNISSVLLPLGLANYIDVSFMFDHNVALINAVLVGMLGLVGFFRLWRPAYL
FT                   LALLAFHLQYVARYSLGEISHGSNLIGMGVLGLGLALVVFQGERQRRRFTFGFLYFFIG
FT                   LGYTSAAVCKLIGTGITWPDGRHLLMWIGERKVDTLSRFGSFDATMLQDLVFYDYHFGT
FT                   LILLVGLLTEAVSFLMWWGKYRYLVVMLVVGMHFGILFSMNIFFQASTILLILLGLPWH
FT                   RLIDYGLNRAPATVASS"
FT   CDS_pept        complement(424293..424811)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00359"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00359"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23280"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H5"
FT                   /protein_id="CBH23280.1"
FT                   /translation="MCPMGFPKRALQIVVGVLVVYALLVATHLGEFWPFSIYPMFSQAG
FT                   NPWTRAMVREMPSQTDPDTLSWDAVSLQRLPGASYPLAPKGINQNDVANYVSKTDQWSD
FT                   ERVQGLRSLFFKNRSVNSSLLVYRVRGELVADSVSISATPVLLFTPDASHLNPSPSDRT
FT                   VAGRSPPAE"
FT   CDS_pept        425088..426074
FT                   /transl_table=11
FT                   /locus_tag="SRM_00360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23281"
FT                   /db_xref="InterPro:IPR021409"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H6"
FT                   /protein_id="CBH23281.1"
FT                   /translation="MCTCGASLGLRGWTETASGTVTSGRPDAASWMERGRERNGPERAK
FT                   NGGEGAHSFSTKCSPMPHSILPTYSALFGETVRRLGLCIGGLALGISLSAPEAGHAQGA
FT                   TSNEGDPVIVDNFEDDAPGTFPDGWVFVKSDENIQSYEESRDPGETVEVREEDGNRYVR
FT                   LITDGEALRYTKRNGVDFEWNLKDHPRLKWRWRARKLPEGASERDQNDTGGAVYVTFGS
FT                   DWLGRPKSIKYTYSSSLPVGHDRLLWPAEGHRRRLGPRAAHGRVGDGPAAHPRRLPAGV
FT                   WRGSPRSPGVDHAVERLGHHRRRGKGRRRRHRIASAPVRLHVAGREA"
FT   CDS_pept        426141..427145
FT                   /transl_table=11
FT                   /locus_tag="SRM_00361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00361"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23282"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H7"
FT                   /protein_id="CBH23282.1"
FT                   /translation="MPTPREGYVLHSYGPDRYVKHVVASVHTLRRHDPDRPVALFCPEH
FT                   HRALLERRGLDAHFDVLEDLPREHRSIVGFKHHLHRFKAFERSLFVDADIIWCRNPDPL
FT                   WRQFSAFPFTATGLQNADHFFGGPKGLGVVVDVLLGRRRRTLRRLGLTQLPRVQAGMIY
FT                   AQDDACTREVDAAAASFLDRVGKTHFRSRLDEGRSEETCEWSLALAMSKLDLHVFPWLQ
FT                   GRNSPQLDYIDSLTDHDPDFKEVSYRLYTNRFVYSLRGISNTSLRNALLRGAESLPRAG
FT                   EYMEVTPYALHFGWLHQKETFRDFTERTWARLAEERTRPRQVTPQNPDSASAE"
FT   CDS_pept        427188..427652
FT                   /transl_table=11
FT                   /locus_tag="SRM_00362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00362"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23283"
FT                   /db_xref="InterPro:IPR025494"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H8"
FT                   /protein_id="CBH23283.1"
FT                   /translation="MAGAYETDFRAHPEAYRYDSSEQGVFKVQPYKDELLPDWGFKDEA
FT                   AAEAAVEALREAYERYRAADDFVGMDMARKYLQMGFTRAMRYAKYPGGRKYEDDGTERE
FT                   PEQWADPEKRAAAVVFRNAWQALTDDPAYERLKEHHQNEVYDPAASPMVD"
FT   CDS_pept        427728..428618
FT                   /transl_table=11
FT                   /locus_tag="SRM_00363"
FT                   /product="alpha/beta hydrolase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00363"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23284"
FT                   /db_xref="GOA:D5H5H9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5H9"
FT                   /protein_id="CBH23284.1"
FT                   /translation="MESDPTNHCSVSLERHWVDREGVRLHVRAAGPEDGPLVVLLHGFP
FT                   EFWYGWRRQIPALAAAGHRVVVPDQRGYNRSDAPRAVAAYDLDRLVDDVCAVIDATGRA
FT                   RASVVGHDWGAMVAWHLAHARPERLRRLAVLNVPHPHVFRDTLRTSPTQLLRSTYALFF
FT                   QVPGLPEWLLGRNDGQGLATMLRWSGRPDTFADADLAAYRRAWRRPGRLRGMLNWYRAA
FT                   GRRALRSTPPSGAVDVPALVVWGAQDIALSRQMAAPSAAMCADGRLRIIDDATHWVQHD
FT                   APATVNRLLLGHLEA"
FT   CDS_pept        428708..429025
FT                   /transl_table=11
FT                   /locus_tag="SRM_00364"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00364"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23285"
FT                   /db_xref="InterPro:IPR021215"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I0"
FT                   /protein_id="CBH23285.1"
FT                   /translation="MPTVQGAVGPVVRRLRAVPFEAVFWTAALLAAASIAPQASGGINL
FT                   CLIEQLGLPCPGDGLGTAIAHLVRGHWTASWNAHPLAGPVVGVLAVHVVSLCRTAPASS
FT                   H"
FT   CDS_pept        429062..429436
FT                   /transl_table=11
FT                   /locus_tag="SRM_00365"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing TM2 domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00365"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23286"
FT                   /db_xref="GOA:D5H5I1"
FT                   /db_xref="InterPro:IPR003650"
FT                   /db_xref="InterPro:IPR007829"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I1"
FT                   /protein_id="CBH23286.1"
FT                   /translation="MSNVLRYLPELEGDEQVEVARLLNDMSDAQAEHFARIYRSRRRDP
FT                   AHILILAAVGFVGAAGLQRLYTGKVALGLVYLFTGGLCLIGTIYDVIKYQDLAFRYNRD
FT                   VALEVAETVRTVYDTADDGA"
FT   CDS_pept        complement(429452..431218)
FT                   /transl_table=11
FT                   /gene="mltE"
FT                   /locus_tag="SRM_00366"
FT                   /product="peptidoglycan N-acetylmuramoylhydrolase"
FT                   /function="Biosynthesis and degradation of murein sacculus
FT                   and peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00366"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23287"
FT                   /db_xref="GOA:D5H5I2"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I2"
FT                   /protein_id="CBH23287.1"
FT                   /translation="MPTVLSRVLFRGGCAGLALLVLAGCGGSLSSLAPTPEPKRVPEDT
FT                   ILVADTDTTALDPEVARLYALESELLAAEDSTRRAHLLNQAMAELATLLRTRPDALERS
FT                   AVRSVYGGLTAEYRRFHGYPSDPDSTLLARGQIFSVRARLFAELEDVENPLLEGAPVRP
FT                   EAEVEGTEIPMTSNRLVRQSTTALEEEPSEHVNHWRRRVQVYGPMIEHILAEEGVPQEL
FT                   KYLAMIESGLNPDARSWAGAVGMWQFMPGTGRRYGLTVNAWVDERRDPEKATRAAARHL
FT                   GDLYDEFGDWHLALAGFNCGAGCVRSALRRADAEDPSYWDAHEYLPRETQGYVPMFIAA
FT                   ARVMENPEAFDLAPPEPASPLAYDYVPIHGSRLSLRTVARLADTTRSAIESLNPELRRG
FT                   RVPPSKERYYVRIPLGSYPRFAWNYAELPDEKKQPATTYAVRRGDTLSEIAVRFGTSTA
FT                   TLKRLNGISGAIIRPGDRLVVPVQEYASALSAADQRRPLRVQYDTSPPTRPLDAIETAR
FT                   APSDTTSGPPDASPASSPQTAASAPTSYRVTRGDTLGEIAQRFGVSIRELQAWNDLSGT
FT                   RIRPGQRLQIRD"
FT   CDS_pept        complement(431331..432320)
FT                   /transl_table=11
FT                   /gene="mmt1"
FT                   /locus_tag="SRM_00367"
FT                   /product="Predicted Co/Zn/Cd cation transporters"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00367"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23288"
FT                   /db_xref="GOA:D5H5I3"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I3"
FT                   /protein_id="CBH23288.1"
FT                   /translation="MASSKKAIYAAILGNFAIAVTKFLGAAVSGSSAMLAEGIHSLVDT
FT                   GNGGLLLLGIRRSKRPPDENHPYGYGKSLYFYTLVVAVLIFGLGGGISLYEGILHTLDP
FT                   GHGGASTASVLGVTVGGLTLNTVVLGAAIVFEGLALRTALQEFKKQRGDTPFFEAIVTS
FT                   KDPTTFTVVFEDTAALAGLVVALVGIHLASLLHMPVIDGIASIIIGLILCGVAAFLIWE
FT                   SKKLLIGEAAAPEIRDDIRRMAHDDADIASVERLLTMHMGPRALLLNMDLRFRDDLDAN
FT                   TVEAAVDRLERAIREAHPSIRYIFVEAGSIARTRASDSGASAAGGPPS"
FT   CDS_pept        complement(432520..432666)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00368"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00368"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23289"
FT                   /db_xref="GOA:D5H5I4"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I4"
FT                   /protein_id="CBH23289.1"
FT                   /translation="MMDTDGCPHEGDGETLLADTRMALCRCGASESKPFCDEGHTEVGF
FT                   EAG"
FT   CDS_pept        complement(432788..433480)
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="SRM_00369"
FT                   /product="ABC transporter, nucleotide binding/ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00369"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23290"
FT                   /db_xref="GOA:D5H5I5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I5"
FT                   /protein_id="CBH23290.1"
FT                   /translation="MNDDSALILDGVFYRVPSLDILQGVHLKAHAGAITGLFGRNGSGK
FT                   TTLLKVAAGQIQPNSGLTIIDGTRLHKQSKWKRFSKIAYLPQESMLPPDVTVRTLVRSA
FT                   GLSSPHVPDRLSSSLTRTVRTLSGGERRLLEVAIVLGLERDYVLLDEPFTGVEPLLIDA
FT                   IGRRIEEAAAQGTGVLLTDHYHQHVTPLADDAYVLWQKQCVPLDGDAPLHDQLVEMGYL
FT                   RTDAAARS"
FT   CDS_pept        complement(433789..436209)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00370"
FT                   /product="peptidase, S41 family"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23291"
FT                   /db_xref="GOA:D5H5I6"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I6"
FT                   /protein_id="CBH23291.1"
FT                   /translation="MALFSKLRRSTLVAAGLVLLAGAAVLAYTYRDTLGLADPPRGEQV
FT                   ENLRAFATLYGYVRYFHPSDAAANTDWDAFAIHGVRQVRDAANRAELRAELRAELEALF
FT                   KPIAPTIQLYRTGNEPPTPADVLAPSDTAGLSLVAWQHQGIGLEGNLVSPYRSIRLNRV
FT                   SNTLGDTGTDEQQRRAPAAQILRILDAVPYAGQQVKVRAAVKTRGDASHAHLSLSPLRT
FT                   IQSDFLDEGAGRPITSQDWSVRERTREVASARGLVIGAFVDGNGTAWLDNVELLTRDSP
FT                   QDEWTSVALNNPGFESAKTGERPIGWTTGKGIAAYASVTAETAHDGDQSLKLESPLPSQ
FT                   VRLFPERPSPGEVVNKPLGRGLSVQLPLALNSRNGQTLRPADAPSPSALRDSLSHVETP
FT                   ILKTTSSLRLAGVTIAWNVFQHFYPYFGAVDVDWDAVLTRTFRRALADDTSTTEFLQTL
FT                   RRMVAQLEDGHGRVHHSQESSSSGLPVRFGRIGDEIVVVDTAGHLDRTLCPDVGDVVVS
FT                   IGGRPPEQQLQERKRYISGSPQWTEGRALQKLGRGDPESSVSLTVRRGGTEKTCKVTRS
FT                   DRRIRWRQLRLDNRPNTVDTLRTGVRYVDLTRAEWPTLRQHLGELADADGVVFDVRGYP
FT                   TGGARKLLPHLSSNTLRSARFQVPQFIYPDQANIVGYDASGRWTLPPEEPQITGDVAFL
FT                   TGPGAISYAESIMGIVRHYDLGTIVGQPTAGTNGNVNPFELPGGYKVWWTGMRVRKHDG
FT                   SQHHLVGIRPDIEAERTIEGVRNGRDEVLEKALEVLRSSKQDSSSERGATASN"
FT   CDS_pept        complement(436227..439733)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00371"
FT                   /product="peptidase, S41 family"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00371"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23292"
FT                   /db_xref="GOA:D5H5I7"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR008756"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I7"
FT                   /protein_id="CBH23292.1"
FT                   /translation="MAPSPMVRPLASSHLSTLLLDVLLKGAVLLLLAHVASALLRRWET
FT                   PASLRRAAWGLAFAALLALPIGQMVLPQSSLPDPVDEVVRLADDSANGPAVRRPSSRRD
FT                   EPWSDSKSASGASAEGRTSASAGASGGAGASPGRSTSALGEGRADESSWLLGWAWGPVL
FT                   LGVWGTGVVLLLARLLVGHLRSRRLRRQARRADAPDWDERLQEVQEQLGSGRTAEIRFH
FT                   PGATPMSLGLFSPTILLPDSAREWPPERQRLVLLHEMAHLKHRDLLLGLVGQLGRALHW
FT                   PNPLAWTGWSKLLQAREAACDETVLAAGEDPETYAHQLLAAARRAVSNHVPTPALQIAR
FT                   PTRLRERILAIVGRDDAASWPPRRKALLGTLGLVLTLLVVAVRPLPNDWYPRAERSGSS
FT                   LAAATVSDAEMSARRTAEPNQKIQNLRAFATLYGYVRYFHPSDAAANTDWETFAVHGVR
FT                   QVTGASSRAELRSTLDSLFTPIAPTIQWYETGAPPPAPHRVLPAADTSALNLVAWQHKG
FT                   LGLGNRGPYESARLHRQMEQGESSGGPGFGTVLQSVDATPHRGKQVRLRAAVRTDVSGA
FT                   GNRAQLWLRVDRAGDKQGFFDNMSDRPITTSNWETYQITGTVAEDATRIMLGGFLRGGG
FT                   TAHFDSFRLQVRDSSGTEWTDVSLENAGFETGAAGESPAGWRGRPDRYAFRTKQSEPAK
FT                   GQQFLSIAPATSSVSVGAEGLFETRPTAGETITKPLGRGLSAQVPLALYSNDEQTLRPD
FT                   DAPSPDRLHNTLDAVQMGKLSAADEALRLADVIIAWNVFQHFYPYFEVVDTNWDQVLTR
FT                   TLQRAEADTSSRDFLRTLRRMLVPLKDGHGGVSHPADSLTAGLPLRFDRVEGNVVVADT
FT                   AASAAAQSCARPGDVLTAIDGTPIEEALREEMRSISGSPQWRTVRALRQLGEGRPGTTA
FT                   RLELRREGQAVACQVARPSDSSTRRRKRRRLQAEPRPDSIDVLSGGTHYVDLTRVEMEA
FT                   LRPRLDTLAQAESVIFDVRGYPEGGNQELLQHLSSETLRSAHFEIPKIIYPDRRKIAGY
FT                   TGGRWTLPSKSPQLSGEVAFLTDARAISYAESIMGIVEHYDLGTIVGRPTAGANGNVNP
FT                   FTLPGQYQVYWTGMRVQKHDRSQHHLVGIRPDVEATRTVEGVRAGTDEVLRTALRVLER
FT                   SP"
FT   CDS_pept        complement(439764..440198)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00372"
FT                   /product="transcriptional regulator, BlaI/MecI/CopY family"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00372"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23293"
FT                   /db_xref="GOA:D5H5I8"
FT                   /db_xref="InterPro:IPR005650"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I8"
FT                   /protein_id="CBH23293.1"
FT                   /translation="MNSSLYNELGRREGQIMDVVYRLEEAGAETIRTRLPDPPSNSATR
FT                   SMLRHLEEKGYLDHRQEGRRYVYFPTRPKEEVRRSLLDHLQETFFGGSLSETVATLLSA
FT                   KSEDLSPETLRELEQIVEDAHDSSKSSEAGSSKTDASGDP"
FT   CDS_pept        440415..442280
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="SRM_00373"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /function="DNA helicase"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00373"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23294"
FT                   /db_xref="GOA:D5H5I9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5I9"
FT                   /protein_id="CBH23294.1"
FT                   /translation="MSLCLRVLHSRLCSMDVTHADPTHVLQSVFGYETFRPYQEPVVQR
FT                   LVDGGDALVLMPTGGGKSLCYQIPAMVRDGPGIVVSPLISLMQDQVDALQQVGVRAAVL
FT                   NSSLGRKEREAVEHRLTAGELDLCYVAPERATRDRFKTLLSRARPSLLAIDEAHCISQW
FT                   GHDFRPEYLALADLRGDFAQIPCIAVTATADPPTQQVVLDRLGMTDEDRFVAGFDRPNI
FT                   RYVVEPKGDRPRQQLHEFIEREHPGQNGIVYCLSRNGVETTADWLTDHGHTAVPYHAGL
FT                   SDHKRSEHQDRFLREDGLIVVATVAFGMGIDKPDVRFVAHLDVPKTLEAYYQETGRAGR
FT                   DGRPATAWMAYRRGDVVRMRQLIDDSAENDEHRWTQRHKLNALLGYCEAPDCRRKVLLN
FT                   YFGEDMGGDTCGNCDNCLRPPDTWEGTTAAQKALSCIARTGQRFGSGHVTDVLLGKDTE
FT                   KIQRHDHDTVSTYGIGADRSKAEWRSVLRQLVAKGMVEVDVMGYGALTLTEDCRPVLKG
FT                   RETVAFRDGAAASASPNTTKTAADDPLPADGPERELFEALRERRTQIATDQDVPPYVIF
FT                   NDKTLRAMVEHRPQSKSDFRALHGVGDVKLERYGRQFLDTIREHT"
FT   CDS_pept        442308..443816
FT                   /transl_table=11
FT                   /locus_tag="SRM_00374"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00374"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23295"
FT                   /db_xref="GOA:D5H5J0"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J0"
FT                   /protein_id="CBH23295.1"
FT                   /translation="MAQCRLLSKKELEGEGGVTNSGLCAAIRIPEPFLPFGYQRPMHRT
FT                   VSAGLRLVLLVGVLLITGVNSGHAQAPRGTGNGTAALEGWPRSLPTLLDEMGQDAPYLL
FT                   PRIDSMALDYRYAATDTTSRWSFVVNWRPAERVLYEGEVLPWRERPAGVRMTNVELRAN
FT                   VRVDGEKRAEMIIGVDSMALRPVPDRFAFNVTVPHERVFLDVSPTEARRILAEGATLEG
FT                   LVVERMGFTSDAAERTPRTGDGEARERRPEPSRSPSIYRPRSRIYIGWRVAPRPYYVGG
FT                   QDEDDDRTRRPRGETVGRSAADTERSEKTGRDERTEGRRGARDDSGKEGEDDEADTEGR
FT                   SRVEEILSDEDDEEDEDEEETDLGIPALGAAAAVGIVAFAGGTAGLYGRGDAPIGLASG
FT                   YTHPRGGVQLQAAVNSAVLEDGPDQELSVRALGFYDVFESRVQPALGLGAHIDPQAGRD
FT                   WDPVVSAGVVGNLGRVVLYGGLDVVHGTPEVGISYNFRYDGGDE"
FT   CDS_pept        complement(443941..444180)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00375"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23296"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J1"
FT                   /protein_id="CBH23296.1"
FT                   /translation="MCPNTGDTGATILPWWSESRGLRLLLFHRAVSGYAVVAGRPPPTR
FT                   CGLDSDSSGAVGTVFGHGPTSEPSHQATAFYYCY"
FT   CDS_pept        complement(444277..444423)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00376"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00376"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23297"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J2"
FT                   /protein_id="CBH23297.1"
FT                   /translation="MTAVYYCYCFTAKTLPQRRCVEVVRERSFVNSSIRVRLVCGTVES
FT                   HGA"
FT   CDS_pept        444838..447564
FT                   /transl_table=11
FT                   /gene="nrdB"
FT                   /locus_tag="SRM_00377"
FT                   /product="ribonucleoside-diphosphate reductase"
FT                   /function="Provides the precursors necessary for DNA
FT                   synthesis."
FT                   /EC_number="1.17.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00377"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23298"
FT                   /db_xref="GOA:D5H5J3"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR013344"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J3"
FT                   /protein_id="CBH23298.1"
FT                   /translation="MSQNPSSTDSSAADVAAPAESTNGHASNGHRVNTRSGRNGSHQYQ
FT                   LSESDLITDDRTNDDIFETEISEEVYGQNYQYGTDDRVPDTWYRNARAMAQVEDDTDMW
FT                   TQRFYQLLSGKGLGTGPFPFTPGGRIFANAGTGLGKATLINCFVSGFQGHDQDSMDEIQ
FT                   AELTRQAKILASEGGYGFCAHIMRPRGARIGGVGSMTPGAVQMLDVWNKQAATIVAGSG
FT                   MKSDRDDVKDKIRKGAQMVTMGIWHPDIIEFIEAKQEPGRLHKFNMSVLITDEFMEAVK
FT                   NDDTWALRFPDYENEKEFYKQHWDGNLKAYQEKGGTVKTWTDPATGEPAVYEAREIWNR
FT                   IMDSTYNRNEPGVIFVDTINKENNLAYTEHINATNPCGEQVLPVGGVCLLGNLNVTQLV
FT                   DREAGEINYDLVDDLVPLAVRFLDNVNDLSYVPLEEQQRNLQEKRRIGLGHYGDGSALM
FT                   MMKTRYGSEEGARVMREFQEHLANQAYQASARLAEEKGAFPLFDKDEYLSSPFVQRLSD
FT                   KTKEMIGDLGLRNSHLLSIQPTGNTSTLGNAPSSGIEPVFMHSYIRTSEQPALPDGINR
FT                   PPMSPNAYEVGQDIDADGTAWTAEEQGDETVLRCQEEGHTHWQIHPTRDICKDQEVKDY
FT                   AVRHMETDGTWDPDADWAVTTRDLDVDDHLTQMKALAPFVDSSMSKTVNVPNDYPFEDF
FT                   KELYKKAHDTGVIKGVTTYRAGTMSAVLSGDDDGDDDRTVPRTEAPDRPETLPCAIHRV
FT                   RYQGDHWTILVGFLEDHPYEVFAFKSEGEAPLFEGDSERVDEGYIRKNESRHYSLLGPN
FT                   GTVVIGDITSHMPSDDVRVETRLVSTALRHGSKIDFLVEQLEKAEGSIASFGQSMAKAL
FT                   RAHATDHEVTCDKCGSANVRHVEGCMECADCGHSRCS"
FT   CDS_pept        447721..450333
FT                   /transl_table=11
FT                   /gene="dapG"
FT                   /locus_tag="SRM_00378"
FT                   /product="Aspartate kinase"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00378"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23299"
FT                   /db_xref="GOA:D5H5J4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011246"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J4"
FT                   /protein_id="CBH23299.1"
FT                   /translation="MMPASGRPWVVCKFGGTSVSSRARWDTIVEVVRTHRAEGRAPFLV
FT                   CSALQGISDQLEALCAQLASAEPGAPESTLDTIRERHRALGQDLGVEAEAVLSGEFARL
FT                   ERWVDEIQATDGPSPRQRAAVLATGELLSTRLGAAYLSAQGLPAEWLDAREFLRATDDP
FT                   HLPPRRQYLAANCTSHADPGLQARLADAPETVYLTQGFIASNALDETVLLGRGGSDTSA
FT                   AHFAAKLEAERTEVWTDVPGLFTANPGEVPSGRLLRRLDYDEAQELATMGARVLHPRCL
FT                   DPARRHQIPLHVRSTEAPSLDGTIVSGEGPDVGPQVKAISAKTDITAVSMDTLGMWQEV
FT                   GFLADVFQVFKHHGLSVDLMATSESNVTVTLDPVANALDPDILDRLLHDLNRYCDAELI
FT                   DPCAIVSLVGRHIRSLLSELGPAFEVFDEQKVHLVTQAASDLNMSFVVDEDQASRLVRE
FT                   LHAQFFGHRAPDAVFGPRWQELVEDGTPEETPDVWWRERREALLRLADDESPRYVYDPE
FT                   VVTARSDEVQGLGPIDQSFYAVKANPHPEVLRLLERRGLGFECVSPGELDRVFEACPGL
FT                   DPARVLFQPNFAAPAEYADAFERGVHVTVDNVQPLAEHPDVFAGEELFVRVDPGQGEGH
FT                   HRKVRTAGAQSKFGVVPDDLGRLRAAVDQAGATVVGLHAHVGSGITDESTWAGLVDLLA
FT                   SLAAEFPAVRALNVGGGLGVPNASGGRPLDLDALDAALGEAAARHPQYDLWMEPGRYLV
FT                   AEAGVLLARVTQTKTKDAAAYVGLDTGMNSLLRPALYGAHHEIVNLSRLDEPPAMTADV
FT                   VGPVCETGDVLGHDRRLPPTEPGDTLLVATTGAYGASMSNRYNLREPASEVMLAPEPA"
FT   CDS_pept        451078..451845
FT                   /transl_table=11
FT                   /locus_tag="SRM_00379"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00379"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23300"
FT                   /db_xref="InterPro:IPR002838"
FT                   /db_xref="InterPro:IPR016031"
FT                   /db_xref="InterPro:IPR036983"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J5"
FT                   /protein_id="CBH23300.1"
FT                   /translation="MSTIRTDGIDYDIIGDDMQLVEVELDPQEGVRAEAGTMIYMDDGV
FT                   RMQTDTGGGLFKGFKRMVSGESFFITTFVHEGQGKSHVAFAAPYPGKIIPVQLDDFGGE
FT                   FLCQKDAFLCANASVEIEVAFTKRMGAGLFGGEGFILQRLTGQGWTFIHAGGTVVERTL
FT                   EAGETLRIDTGCLAAFSSSIDYDIEFIGGFKNALFGGEGLFLTTLTGPGTVYLQSLPFS
FT                   RLADRIVAGELANRGESEGPGGTGILGDLISGS"
FT   CDS_pept        451956..452540
FT                   /transl_table=11
FT                   /gene="umuD"
FT                   /locus_tag="SRM_00380"
FT                   /product="umuD protein"
FT                   /function="Represses a number of genes involved in the
FT                   response to DNA damage (SOS response), including recA and
FT                   lexA. Has been shown to bind to the 14 bp palindromic
FT                   sequence 5'-CGAACNNNNGTTCG-3'. In the presence of single-
FT                   stranded DNA, recA interacts with lexA causing an
FT                   autocatalytic cleavage which disrupts the DNA-binding part
FT                   of lexA, leading to derepression of the SOS regulon and
FT                   eventually DNA repair."
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23301"
FT                   /db_xref="GOA:D5H5J6"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J6"
FT                   /protein_id="CBH23301.1"
FT                   /translation="MRGLEERTCLKYVCWFVLWWGIDAMPRSTDPTAPMSLLCSADDPN
FT                   HSSVQSDVVVTAARPARHTPRLRQPFFLTRVEAGFPSPASDYVETELDLAEHLIEHEAA
FT                   TYYLRVSGTSMTRAGIHDGDILVVDRAVEPADGDVVVAALDAELTVKRLRTRDGRAFLV
FT                   PESQHHDPIPVRDGQELVVWGVVQHVVHEVS"
FT   CDS_pept        452595..453875
FT                   /transl_table=11
FT                   /gene="umuC"
FT                   /locus_tag="SRM_00381"
FT                   /product="Protein umuC"
FT                   /function="Involved in UV protection and mutation.
FT                   Essential for induced (or SOS) mutagenesis."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00381"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23302"
FT                   /db_xref="GOA:D5H5J7"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J7"
FT                   /protein_id="CBH23302.1"
FT                   /translation="MDSVIALIDCQAFYVSCERVFDPALRGRPTVVLSNNDGCIIARSA
FT                   AVKAAGVPMGAPVFKWRDELEAMDAAVLSSNYALYADLSRRVTAVLETMSIDLERYSID
FT                   ECFVTLPALDRDALRALGERIRCRVRDWVGIPVRVAIGPTKSLSKIADEKAKADKRAGD
FT                   GTGVYVCPPEPDLDVLLYRTDVGDVWGIGPSYEETLREHGVTTAAEFRALPDPWIRSTM
FT                   TVVGLRLARELRGQRCLDLDLVGPDRQSLVRSRSFDAPVEAKAELRQALAKHAQRAAEK
FT                   LREEDLVARGISAFITTKTHGPPPHYADEAQATLDEHTAAAPPFVRSSRRLLDAIYRAG
FT                   PAYRKAGVMLYAIRPRRPHQGSLFGRPVQDDEALMQAVDRINGTMGRGTIGVAAAGLPG
FT                   DRDWTMTRDNTSQHYTTRWDELPVARA"
FT   CDS_pept        454035..455681
FT                   /transl_table=11
FT                   /locus_tag="SRM_00382"
FT                   /product="probable RNA-biniding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00382"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23303"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J8"
FT                   /protein_id="CBH23303.1"
FT                   /translation="MVNSYYTLRALAREWHADLEGTTVRDVYSQTKNELTVALSGAEQD
FT                   WMVRGSVQRPFLYLFRRPGYHKARRNVATLFEGAIGQSVAGVSIADRDRLVSIELGSGG
FT                   RILWQLFGARANAFHVAPDGTVVAAFQRHDELTGTAAPEPYAAPMPDTFEAFEDRWKPN
FT                   RNKTRQAVQSAVSLFGGDLARETLHRAGVTTDVPADCTAAERRALFEASMALREALQDP
FT                   APVLYGAGQFPDAFSLIPLRHREDEPAERFDTVDAAVADFVRRTLAEQHFHRLYDPLEE
FT                   ALESAAEHERRSAERMVEELQSESRAGRYERWGHLLMAQQDQVPDGAEEVELPDLFEDG
FT                   APVTIPVDPAKSPVENAEHYYDRARSTRRSREEAEGRLDDTIERAERAEALLQALREID
FT                   TLDGIKAFRDEREAELLPFVERDDADVDDFPFRRFDLGEGFEVWVGKNARQNHDLTFHA
FT                   SQPYDLWLHARGVPGAHTVLHRPNRDAEPGKRRRYVAAAIAAHYSKSKGSDVAPVMITE
FT                   RKYVTSPTGADPGVVRVDREDVLMVEPGLPE"
FT   CDS_pept        complement(455740..458958)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00383"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00383"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23304"
FT                   /db_xref="GOA:D5H5J9"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR007541"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5J9"
FT                   /protein_id="CBH23304.1"
FT                   /translation="MLCRRPLPDMRSVAPVASLFAFVLAGLALLGVPDARAQYFGQNKV
FT                   QYDQFDFRTLETEHFVFHFYPEEEQAVRDAARMAERWYDRHTEVFLHRFDEKKPIIFYA
FT                   NDADFQQTNVTPRPISPGTGGLTEPLRERVVMPFASSYGETDHVLGHELVHSFQFDLGL
FT                   NADSLGIQLGNLPTWLIEGMAEYLSVGRQDSHTAMWMRDAVRRDDMPSFEGLANPREYF
FT                   PYRYGQAYLAYIGGKYGDQAVTDLFKRGGQVGLDSAYVELFGVSADSLTNEWAEATRET
FT                   YEPLMKGRTPPDSAGQTVLAPETNGGRINIAPSLSPDGRYVAFISERELFSFNLYVADA
FT                   ETGEVIAELDRAGTTGHFNALRFISSSGTWSPDGRRLAFVSSEDGDNQITVWNVVDEEI
FT                   ERSFSVDGVTSMKNPAWSPDGARLAFAGTDGGISDLYVLNLETESVRQLTNDRYADLQP
FT                   TWAPDGETIAFATDRAETNLETLSPSSNMDLGLVDVSSGEVTVRAPFGDALHHNPQFAP
FT                   DGQSLYFISDQDGFKDVYRMDLSSGDRFRVTRLKTGVSGITALSPALSIASQSGDMMLS
FT                   VFADGNYTGVRRPAPEAQGTPLRAASTAGGASAARVPAAADTTTDEAGTQSADTSRVAG
FT                   LLPSPAAARDGLIASNLRDATTGLPPDSTHYDAAPYDPTLSLESISRASGIGVSVGGPF
FT                   GGGLAGGIGLRFGDMLGHRTLGVAVQAQGTFRDIGGGVSYMNQRGQLNWGGSLSHTPLI
FT                   FSANTVPFRNDAGRLVGLGSVVQRAYITSASGNASYPLSPTRRFEFSLGGTRYGFGTNV
FT                   RTAGLAPDGAEQALQDQFGDRTPKYLATASAAYVRDFTTNGLTGPLQGGRWRLEVSPTL
FT                   GSQNFVTARADVRRYFYAEPFTVALQALHVGNYGASFNDEFGIGNEYIGYPYGQGFVRG
FT                   YSVQSIANGIRENGGCTRVDNAPTTSPCAEIDRLFGTRALTTRAEIRIPLLGPERLSLI
FT                   PFRYLPTTLAPFVDAGVTWTNDAGPDLFTFDTDSADTTIPVVSAGVSARFNILGSLLLE
FT                   TYYARPFQRRDTTWELGFRISPGF"
FT   CDS_pept        459226..461310
FT                   /transl_table=11
FT                   /gene="nosZ"
FT                   /locus_tag="SRM_00384"
FT                   /product="Nitrous-oxide reductase [Precursor]"
FT                   /function="Nitrous-oxide reductase is part of a bacterial
FT                   respiratory system which is activated under anaerobic
FT                   conditions in the presence of nitrate or nitrous oxide"
FT                   /EC_number="1.7.99.6"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00384"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23305"
FT                   /db_xref="GOA:D5H5K0"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR026468"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K0"
FT                   /protein_id="CBH23305.1"
FT                   /translation="MPDDLPIPPVHPRYLVVPLRTADVGTICGAADRPLPLGTGRRGRA
FT                   GRHVPWKARFSFWGKKLFRIFLSKIRPPILMRSLTYLFLLVLPLGLLGCGGSSASGDGG
FT                   DGGAPASYVPPGEKDDYYLFYSGGHSGQVFVAGLPSLREIQEIPVFTPSPGHGYGFSKK
FT                   SKKMMGEYRWGDVHHPGLSKTDGTYDGRWLFVNDNANNRVARISLRDLKTKQILGPIPN
FT                   SMGNHGSSFVTPNTEYLLVATRFSVPLPKGTHAPVETYEENFNGIVSGVDIDPETGEME
FT                   VGWQVKTPPFNWDLGSTGKGPSDGWAFWTSYNTEMAHDSLEINASQRDRDYAAFVNWER
FT                   AEEVVENNEGLNRRNGVPLIDPAEHEGVMYFVPVSKSPHGIDASPSGRWIAASGKLQPT
FT                   TTVFDFKQFKTAIENEDFQGEFRGVPVVNYDAVVEGEVPVGQGPLHTQFDGEGNAYTSL
FT                   FIESSVTKWKLPPWDKETKEDMSKAVTDKISVHYNIGHLVIPGSDTKEPYGNWLVAMNK
FT                   LQKGRGLNVGPEKPETSQLIDISGEEMEMIEEDYTRPEPHFAQAVPADVINPIEVYKKE
FT                   NNDHPDARWDPENTGVERTGPDEVTVHMIAKRSQYYPDKVEVQQGDKVTFHLTNIEQVS
FT                   DMIHGFGIAQYNMNGVVPPGDTQTFTITADEAGVYPFYCTNFCSALHQEMQGYLEVKPR
FT                   "
FT   CDS_pept        461407..462093
FT                   /transl_table=11
FT                   /locus_tag="SRM_00385"
FT                   /product="conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00385"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23306"
FT                   /db_xref="GOA:D5H5K1"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K1"
FT                   /protein_id="CBH23306.1"
FT                   /translation="MCLAAMFDFIDRIPKLTDRQVPGRGRLLLVVGAALLGAAIFLPLW
FT                   QIHLVAPQYQEGLDLYIHSYKLEAGNEGQDLKEINGLNHYIGMAPIKEEDFAEMTFIPF
FT                   LLGGFSLLALRGAFFGTVKSVVDTLVLFVYFGAFSMWRFYHQLYTYAHNLDPRAPMDIE
FT                   PFTPILIGWKKIANFTQYSYPREGSALLLGAVVCFGTAIWMGVRSGRETAAPDADERSD
FT                   AEAMSA"
FT   CDS_pept        462184..463581
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /locus_tag="SRM_00386"
FT                   /product="Nitrous oxidase accessory protein"
FT                   /function="Involved in copper processing and transport; in
FT                   the assembly of the copper chromophores of nitrous oxide
FT                   reductase."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00386"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23307"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR022441"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K2"
FT                   /protein_id="CBH23307.1"
FT                   /translation="MRVVRWLITFCLLAGVAPGSAWGQSLQARIGAAAPGDTIVVTGGV
FT                   HEGPFVVDIPLVLRGRNRPHLKGDEQTHVVAVDAADVTIEGFRISGSGTDLGDDHAGVM
FT                   VRAPRATIRDNHLSDVLHGVYVKGADRAVVVENVIEGPPTVTRRVSPEEARRHDCSVPP
FT                   GGGDCAVPLPVPQRGNGIHLWSSLHNTVTHNTVHHTRDGVYFSHSNHTYAARNTIHDVR
FT                   YGLHYMYSDDNTFEHNRFFDNESGSALMYSTRIAVRHNVFRDNRSQRGYGLLLQTVSKS
FT                   RFAHNRMIQNGTGVYLENSTRNTFADNVVASNYRGIRVTGSSMENRFGRNVIRGNLNTA
FT                   TVSGARATNAWHVDGRGNYWGPRGLLDLNADGVSELPHRTVDLFGERREDFPYVDLLAG
FT                   SPGLSLLADALARVPGTGIPTITDEHPLVAPPSPPEEEGATGLRSLFTLGIVLLTVGAV
FT                   ALRRRVV"
FT   CDS_pept        463578..464258
FT                   /transl_table=11
FT                   /gene="nosF"
FT                   /locus_tag="SRM_00387"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00387"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23308"
FT                   /db_xref="GOA:D5H5K3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K3"
FT                   /protein_id="CBH23308.1"
FT                   /translation="MIEVADLYKSFGDAAVLQGASFSAAPGTATVLVGPNGSGKTTTLH
FT                   VLAGLVAPDAGTARIDGTDVTTDRTAAQERLAFLPQDVRFHDALTPRQVLRFYAGLRDA
FT                   PDARLDALLDDVGLADAAQKSCGALSGGMRQRLGIAVFELARAPVLLLDEPGLSLDPKW
FT                   RGFLMDRLRARVEEGAAVLMATHLLDVWRPLADRVLRCEGGTVREVKPTTGAVASVDEN
FT                   ASAV"
FT   CDS_pept        464371..464631
FT                   /transl_table=11
FT                   /locus_tag="SRM_00388"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00388"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23309"
FT                   /db_xref="GOA:D5H5K4"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K4"
FT                   /protein_id="CBH23309.1"
FT                   /translation="MHLARLPASVYRALIRREVVTTFHNRFVQIFAVVAWAGSIAVAAL
FT                   SGRPEAVPYGLLLLFLYLVPLFGLLVGVSAAHEERDERAFL"
FT   CDS_pept        464641..465165
FT                   /transl_table=11
FT                   /locus_tag="SRM_00389"
FT                   /product="Hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00389"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23310"
FT                   /db_xref="GOA:D5H5K5"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K5"
FT                   /protein_id="CBH23310.1"
FT                   /translation="MPRAAFVLGKAVTLIVALAAVLLGALVAGAVVGASAGTLALLWGL
FT                   GTGLVLVSVSAGLAAGQYTTSRARGLMVVLVVWVVVFALYDAAALGLSGLGAMQAVPAF
FT                   WVGLLLLNPIDAVRLAGLFALEDVPFSAPGDAAWMGDLMAGLPAWVAVLTAVWTGGLLL
FT                   LACRRLRRLDL"
FT   CDS_pept        complement(465168..465647)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00390"
FT                   /product="regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23311"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K6"
FT                   /protein_id="CBH23311.1"
FT                   /translation="MDVSPADITDAMRDHPFFGGVSTEERERLIDLGQARTAASGTILF
FT                   QRGDAYRGFYLLVEGGVHVYRLSPEGRMLVLHVIRPGESFAEVPLFETDAGDTYPATAE
FT                   TLTDSALFFFPADAFLSFVDAHPRSALQDKDLIRTEDADIVLTDVRGLRHLVDSA"
FT   CDS_pept        465755..466063
FT                   /transl_table=11
FT                   /locus_tag="SRM_00391"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00391"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23312"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K7"
FT                   /protein_id="CBH23312.1"
FT                   /translation="MSTTVPTILDVRPLQAERKFESVLVVLDGLDAGESFVLVDDVDPR
FT                   TLRLRIRDERSGAVRWAYLKKGPRVWCVRVERGPAALQEGVRGEGEWGNAPPDRSRA"
FT   CDS_pept        466167..466385
FT                   /transl_table=11
FT                   /locus_tag="SRM_00392"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00392"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23313"
FT                   /db_xref="GOA:D5H5K8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K8"
FT                   /protein_id="CBH23313.1"
FT                   /translation="MCLLFMPTDESDASTDGAAAGDDSGKARDISLDEFQPYGTLAVTG
FT                   AYFILLLVLYALLYFVEFATHAPHIIE"
FT   CDS_pept        466399..466920
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="SRM_00393"
FT                   /product="cytochrome c oxidase subunit II"
FT                   /function="Cytochrome c oxidase is the component of the
FT                   respiratory chain that catalyzes the reduction of oxygen to
FT                   water. Subunits 1-3 form the functional core of the enzyme
FT                   complex. Subunit 2 transfers the electrons from cytochrome
FT                   c via its binuclear copper A center to the bimetallic
FT                   center of the catalytic subunit 1"
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00393"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23314"
FT                   /db_xref="GOA:D5H5K9"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034214"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5K9"
FT                   /protein_id="CBH23314.1"
FT                   /translation="MHVHRFEKLWIGLSLLLIAAFIGIVLFGFTVMNLKVPGVETGETV
FT                   DPATVLSEGPFAKPGVRKISDDHYEVYMLAQQFIFRPGSTRPLTLPADTKITFHMTSPD
FT                   VMHGFEVPGSGLNSTVIPGQVATFTTRFPEAKSYGIICHQYCGSAHHNMQGEIKVVPPS
FT                   EFDESNLISQ"
FT   CDS_pept        466917..468590
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="SRM_00394"
FT                   /product="Cytochrome c oxidase, subunit I"
FT                   /function="Cytochrome c oxidase is the component of the
FT                   respiratory chain that catalyzes the reduction of oxygen to
FT                   water. Subunits 1-3 form the functional core of the enzyme
FT                   complex. CO I is the catalytic subunit of the enzyme.
FT                   Electrons originating in cytochrome c are transferred via
FT                   the copper A center of subunit 2 and heme A of subunit 1 to
FT                   the bimetallic center formed by heme A3 and copper B."
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00394"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23315"
FT                   /db_xref="GOA:D5H5L0"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033943"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L0"
FT                   /protein_id="CBH23315.1"
FT                   /translation="MTFVDHYPKAARIVKANLIVAFVALGIGGFFGLIQALHRTDVFRG
FT                   FVSSVQYYDVLTGHGVLLALVFTTFFITGLYQWGVTRTMEREPESSAFSWTWFAMMGVG
FT                   TTMTATAILGGLVPGSGLSAAVLYTFYPPLQAHPLFYIGAALLVVGSWLAGADWFWTYR
FT                   KWRADNPDARIPLQTYMVIFTWLMWYLCSLGLALEVVVLLIPWSLGFVEKIDPLLPRTL
FT                   FWYFGHAVVYFWLLPAYFVWYSILPKLSGGRLFSDPLARVVFIFFLLLSTPIGYHHQYA
FT                   DPGITLVYKMWALIMTLVILLPSLMTAFTVISSMEHGARQRGGSGYFAWMGALPWGQPA
FT                   FVGCALAGIMFAAGGFSGMINASLNIDMLVHNTAWIPGHFHLTVGTAVALTFMAITYWL
FT                   LPQLTGKALKFKNLALAQPYTWFIGMTLMSNALHRQGLAGVPRRVAEPQYAGIDYEVPF
FT                   GTMAEMDWQVAIGGTILFVSMVLFLVVIGGTWWSGAPATDVDDVIPPALSGPEHSPKIL
FT                   DNLKLWMGVAVALVLIAYTLPLAEMVMDGLFSPGAFPAPM"
FT   CDS_pept        468597..469322
FT                   /transl_table=11
FT                   /locus_tag="SRM_00395"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00395"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23316"
FT                   /db_xref="GOA:D5H5L1"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L1"
FT                   /protein_id="CBH23316.1"
FT                   /translation="MGARTAAPGAPGLGRGPEARTEPVRWLSRRFPAFCSMDDPSSSET
FT                   DDAPSPSAPDAPDEVNPWVVRFFLILAFGLAFGIEGMTLVRSYLLSGEGESKTAAEKQG
FT                   APTGARGPQASDAPLRIGDDLLPATDVTERVVEMQVRAQSSGPWTFRLAVAVDNRTDTP
FT                   YRLTLRALETDDGTVLDERRTATWPPGDSTRFRAAWPMGADARPQSLTAEAQLQYAADS
FT                   TRTVRRRISFGHVPVQMER"
FT   CDS_pept        469545..470354
FT                   /transl_table=11
FT                   /locus_tag="SRM_00396"
FT                   /product="transcriptional regulator"
FT                   /function="May regulate the transcription"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00396"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23317"
FT                   /db_xref="GOA:D5H5L2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L2"
FT                   /protein_id="CBH23317.1"
FT                   /translation="MELESGRPRHEQISDWLREQIEQDTYEVDEKLPSEKQLGDRFDVS
FT                   RVTVRRALQTLENEDYIYRQQGLGSFVKERRAAQGLVRLTDFAQDMAQAGLEASSQVEH
FT                   HAPESPPPAVAVHLDTDDQTVMRLDRLRLGDGRPVAFDRTWLPMFYAQLLEGHDLEEET
FT                   IYHILEAEYDIPVLRGHYRITAANADAPIADLLGVDAGQALLLIERLSLTEGDKRVYFQ
FT                   RRYYRSDRVAYELELARDTTRHDAGEHGMPLREFEPVFDDDVDAHQE"
FT   CDS_pept        complement(470443..471642)
FT                   /transl_table=11
FT                   /gene="hcaD"
FT                   /locus_tag="SRM_00397"
FT                   /product="putative filamentous hemagglutinin"
FT                   /EC_number="1.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00397"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23318"
FT                   /db_xref="GOA:D5H5L3"
FT                   /db_xref="InterPro:IPR015904"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L3"
FT                   /protein_id="CBH23318.1"
FT                   /translation="MTDTHQVLIVGGGTGGLTVASQLLSRDDAPEVAVLEPADTHYYQP
FT                   LWTLIGGRVFDKEESARPMGEVMPSGATWIQDAAAEVDPEGGTVTTRGGDTHGYDHLVM
FT                   AAGIQIDWDGIPGLAASVGQPGTGVVSNYSYDTCETTWDAIQNFPKGGTALFTEPTTGV
FT                   KCGGAPQKIMYLSDDAFRRQNVRAGSRIAFMKAKGSLFSSPPYEETLYDVVERKDIDLN
FT                   LMTELTALEPSKKQATFQHLESGEEETIDYDLIHVVPPMSAPDFIADSPLSDEEGWVDV
FT                   DPGTLQHTRYDTVFALGDNSNLPTSKTGAAIRKQAPVLVDHLMATINDAASANGTYSGY
FT                   TSCPLVTGYGKLVLAEFDYDKEPEESFPFDQTEERYSMYALKAYGLPRMYWNGMLKGRM
FT                   "
FT   CDS_pept        complement(471715..472635)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00398"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23319"
FT                   /db_xref="InterPro:IPR012440"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L4"
FT                   /protein_id="CBH23319.1"
FT                   /translation="MDDVHTDGAPSLEKRLQDRDTRQTLHRLLDKLDTIEAALDRLDRI
FT                   EGEVPPLLQTTADVVDDELTRAADRGVVLDERAGEALRLAEKLTEPETVEVLSALIDRL
FT                   DHLDDLADLAEQVPAAATVTVDTIDEALTRAADRGVVVDERAREGLRLLEKLTEPETAA
FT                   ALEHLLDRSDQIDELAALAEKAPDAIATVVDILDAEYARAAAQGYDPERTLRQAFGALS
FT                   RLGTLFQTDEFEALLHSGVLDPEALEAVGSLGSALVDTQKEAQRGDTPSQGVFGLLGAL
FT                   RDPDVQRAVGFITTFAKKFGGNLRS"
FT   CDS_pept        complement(472772..473368)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00399"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00399"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23320"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L5"
FT                   /protein_id="CBH23320.1"
FT                   /translation="MRSPSVLRLLILSVPLLIVGCGGSDSAPTSSQTPPDAVRRDVEQS
FT                   IASLNEMRESLAATIDTSAVDKRTFKRVCAPVGKRARQLGADRGWEVQQLATKYRNPAH
FT                   EPDAEARRLHEEFVTSPELTERWIRTTRSGHEGWRYARRITVQPSCLACHGPKDERPAF
FT                   VKKDYPEDRAYGFEDGDLRGIYAVFVPDTSTGDAF"
FT   CDS_pept        473496..473726
FT                   /transl_table=11
FT                   /locus_tag="SRM_00400"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23321"
FT                   /db_xref="GOA:D5H5L6"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L6"
FT                   /protein_id="CBH23321.1"
FT                   /translation="MHPMSDPQFDVERATAGLVLALFLAASLLVGAMYYFVLRDMEERA
FT                   GASNASQAVRVEHPSAGPPASASIPVSEHHA"
FT   CDS_pept        473723..473941
FT                   /transl_table=11
FT                   /locus_tag="SRM_00401"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00401"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23322"
FT                   /db_xref="GOA:D5H5L7"
FT                   /db_xref="InterPro:IPR004714"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L7"
FT                   /protein_id="CBH23322.1"
FT                   /translation="MSYTPLLTILLVLVVGAAITLTVLFYAQRKGHFDNLKSEAYVIFD
FT                   DDEPVGEPQDQVFDAPDEPTGAPDPEA"
FT   CDS_pept        473972..475486
FT                   /transl_table=11
FT                   /gene="ctaD"
FT                   /locus_tag="SRM_00402"
FT                   /product="Cytochrome c oxidase subunit 1"
FT                   /function="Cytochrome c oxidase is the component of the
FT                   respiratory chain that catalyzes the reduction of oxygen to
FT                   water. Subunits 1-3 form the functional core of the enzyme
FT                   complex. Co I is the catalytic subunit of the enzyme.
FT                   Electrons originating in cytochrome c or a quinol are
FT                   transferred to the bimetallic center formed by a high- spin
FT                   heme and copper B."
FT                   /EC_number="1.9.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00402"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23323"
FT                   /db_xref="GOA:D5H5L8"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR004677"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L8"
FT                   /protein_id="CBH23323.1"
FT                   /translation="MPDDSSTPAPSAGTSQSEVKWRRVVDASTRWPVIAFVVSGTFWLV
FT                   AGSLLALIASFKFQFPDWWTHQAWLTFGRVRPAHLNTMIYGWISMAGVGVSSWLWARLL
FT                   KTKLRGRGLLLLSAALWNVGVLVGTIGILAGYSRAIEWVEMPYVAFAFIVPAMGLLVVS
FT                   FVRTLWHRHARHLYISVWYLGAAILWGPLLVIAILLPIYSGVPEATANWWYAHNILGLW
FT                   ITPPGLAAAYYLIPKVIGRPVHSYHLSYLGFWTLALFYNWAGVHHLVGGPAPQWVATVS
FT                   IVFSAMMIIPVIVVAVNHHLTVVGHFKKLKYSPTLRFVVFGAMSYTAVSLQGSLQSFRY
FT                   WQEVTHFTHYTIAHAHLGVYAFATMIAFGAIYYIMPRVTNWEWGSKRLVSLHFWTTGLG
FT                   IGAYVTALTIGGVIQGLQLLDPDVAFLTIVEDTKPWLVVRSVSGTLMTVGHLVFAYLLA
FT                   KIVVQSGERPDGPTYFHPVPAGTFEHVGGDGARSVPSGPAGEESAR"
FT   CDS_pept        476184..476963
FT                   /transl_table=11
FT                   /gene="cccA"
FT                   /locus_tag="SRM_00403"
FT                   /product="cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00403"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23324"
FT                   /db_xref="GOA:D5H5L9"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5L9"
FT                   /protein_id="CBH23324.1"
FT                   /translation="MADDSSSLPEPDPEQRSDPDPSPEPIDMLRPLFREEPLPPEGGEP
FT                   PKMWLWILIFGVLLFSTFYLGAYMGDFSPDPWLQSPEPVAQRTGPPEPEPVSGAQVYSA
FT                   RCASCHQSNGQGISGAFPTLIGTRWVENKGQVIRILLHGLQGEIEVQGATYNGNMPAWG
FT                   STLSDKEIAAVITHIRQSWDNDYGEVTPDEVASVRAATEGRSDTWSPEELKASENQTVP
FT                   GGNDDTAARGPSGAVGPALYDRLVAQASPNRMPAPAR"
FT   CDS_pept        477009..479144
FT                   /transl_table=11
FT                   /locus_tag="SRM_00404"
FT                   /product="Cation-transporting ATPase pacS"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00404"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23325"
FT                   /db_xref="GOA:D5H5M0"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M0"
FT                   /protein_id="CBH23325.1"
FT                   /translation="MQRCDHCDMPISGTEDTAVSGVAGRTHYCCYGCRMRAETLGDDEE
FT                   ATRSDEQQTLLVRLFAGVLMAGFVMVFSLAISSGYGFGALQRLEHEVGTAHWVLLLAAV
FT                   PALLLLGPPLLRSAWDDLRGGGLTLNVLFTLGTTSAVVVSGVSYARGTGPIYLETAVML
FT                   LALYTLGRYLTARAKDTTTHVLRRLLEVPDTTYVRLGPDAGEVAPDDLRVDDRIRVPAG
FT                   DVIPVDGTVVEGRSYVDESSLTGESQPVVKEAGDTVYAGTTAQDGALTIDATAVAEDRR
FT                   LARVAQMMHRALEQPPRLARLTDRILRWLIPGVVGLALVAFAGWWGAVGFSKALYVALS
FT                   VVLIACPCALGIAIPLSLTVALEQAGRKGVLVRSGRTLLDLARATAVTFDKTGTLSTLT
FT                   APSVRVLRPETVPVEEAPAPADDAVLRRAAAVEQGTNHALATAVVEAAADRDLSLPAVA
FT                   DVTTHPGAGVVGRVQVDGRMRRVGVGNERLLDALGVTGPPRLHEAFADEADAGRTPLYV
FT                   VDETAVVGLLSIEERVAPHAEAVVGAVRERSEAVSVLTGDRPAAARRLEDRLGVRAEAG
FT                   LAPDEKVDRLAALRDAHGPVVMVGDGINDAAALAKADVGIALSSGASVSMEAADVTLYN
FT                   PDLRLVPWLQHLGRRTHRVIQQNLWWTFGYNAIGLGLAVAGLLHPIAAVVIMTLSSILV
FT                   TGNAFRLRRIASPEALP"
FT   CDS_pept        479352..480935
FT                   /transl_table=11
FT                   /gene="gloB"
FT                   /locus_tag="SRM_00405"
FT                   /product="Metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00405"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23326"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M1"
FT                   /protein_id="CBH23326.1"
FT                   /translation="MGRVGRMPLRFTTRRAEGGSARRPLSIVSCPLFCPSEPNQFSPML
FT                   FRQINDAKLAQYAYLIGCQETGEALLVDPERDIDRYLDLAEREGLEITAVTETHIHADF
FT                   LSGARELAERFDTTLYLSDEGDENWKYEWAQGPKQGGGDYDVTWLHDGDTFQVGSVEVT
FT                   ALHTPGHTPEHLSFLVTDRGGGADEPMGLLTGDFVFVGDLGRPDLLESAAQVEGAMEPS
FT                   ARTLYTSVQRVLEMPDHLQVWPAHGAGSACGKALGAVPQSTLGYEKQFNPMIDAAREGE
FT                   DAFVDAILADQPEPQIYFARMKRDNKEGMPVLGSLPAPRELTVRELEDAAADEAPLVID
FT                   TRLDRSAYMANHIPGSLYAPMNDTFNTVVGSLVEDETTPIVLIADEGDVEEAVRDLVRI
FT                   GYDNVTGFAEIDTLQRYFQAGGPSETIDEITFADFDAELQDETTGVLDVRYRSEYEEGH
FT                   VEGALNASYTRMPEYETELPTDKTLLVHCGSGARAAAASSYLARTGHSVKYVNDHFANY
FT                   EAASEEAVAA"
FT   CDS_pept        481031..481795
FT                   /transl_table=11
FT                   /locus_tag="SRM_00406"
FT                   /product="Predicted permease"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00406"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23327"
FT                   /db_xref="GOA:D5H5M2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M2"
FT                   /protein_id="CBH23327.1"
FT                   /translation="MYTAWLGALLVGLVLGLLGSGGSILTVPVLVYLVGEPSKLAIAES
FT                   LGIVALISLVGAIPLALRGRVSWRTVGWFGGPGIVGAYVGASLSQLMSGAVQLAIFAVV
FT                   MLGAAVLMFRRTPSELVDEPDRAFWKVMVDGLGVGVLTGLVGVGGGFLIVPALVVLGGL
FT                   SMHLAVGTSLAIIALKSVSGFVKYLDVMEAAGLSIHWDLVLVFSGIGIVGSFVGGRLGA
FT                   YVPQARLKRGFAIFLVLMGIVILGQNVVAMVG"
FT   CDS_pept        482230..482979
FT                   /transl_table=11
FT                   /gene="gufA"
FT                   /locus_tag="SRM_00407"
FT                   /product="Zinc transporter"
FT                   /function="Mediates zinc uptake. May also transport other
FT                   divalent cations"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00407"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23328"
FT                   /db_xref="GOA:D5H5M3"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M3"
FT                   /protein_id="CBH23328.1"
FT                   /translation="MVIETGVWIVLLGATVTAVATGLGALPFLFVRDIGDWWLGVFNAA
FT                   AGGLMLAASHSLIAEGSMLSTGRTLIGILVGLALILGANTFISRGDDHDVAELAGADAR
FT                   KALLILGIMTAHSFAEGVGVGVSYGGGDELGAFITAAIAVHNIPEGLAISLVLVPRGTP
FT                   LWKAAGWSIFTSLPQPLMAVPAFLFVLVFEPFLPIGFGLAAGAMIWMVFAELIPDALED
FT                   VPGPTAGAAVTLAFAALFAFQHFVLHV"
FT   CDS_pept        483173..483682
FT                   /transl_table=11
FT                   /gene="dpsA"
FT                   /locus_tag="SRM_00408"
FT                   /product="Nutrient stress-induced DNA-binding protein"
FT                   /function="Involved in protection of chromosomal DNA from
FT                   damage under nutrient-limited and oxidative stress
FT                   conditions."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00408"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23329"
FT                   /db_xref="GOA:D5H5M4"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M4"
FT                   /protein_id="CBH23329.1"
FT                   /translation="MSAPDPNTTTASAPSTDVAPETAEADVTGLNDLLADATVFYQKVR
FT                   HYHWNVTGPHFFTLHEEFEALYTFWNDAIDEIAEQVRSRGDRPVHTLADVLDLASLEED
FT                   PSTPAAEEMVEVVIADLAALDEQVQQLAERAEEADDADGAATVLEDLSEQIEEDRWMLR
FT                   AWLNDL"
FT   CDS_pept        483834..486977
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="SRM_00409"
FT                   /product="Cobalt-zinc-cadmium resistance protein czcA"
FT                   /function="Has a low cation transport activity for cobalt,
FT                   it is essential for the expression of cobalt, zinc, and
FT                   cadmium resistance."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00409"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23330"
FT                   /db_xref="GOA:D5H5M5"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M5"
FT                   /protein_id="CBH23330.1"
FT                   /translation="MNRAIDWFARHGVAANLLTMLLLVGGVVAGGLVVQENFPEFSLDA
FT                   VEVRVRYPGASPEDVEDDIVRRVEDRIEGVEGIDRLLGTAADNIGVVTAELKRGTNLDR
FT                   ARTDIKSEVDRVTSFPENAEEPVVTEVTNREQVLQVALHGEASLRALKNAAQRAEGDLT
FT                   RTPQVSYAEVSGVPDEEISIEVSRGALRAHGLTLAQVSRIVREGSLDLPAGSIETEDSD
FT                   ITIRTEGQNYTKSDFEDIVLLSRNDGTNVLLGDVATVVDGFEQNSDLRTRFDGDPAVLL
FT                   NVFRTGDEQALSVEEAVKTYLSETLRPTLPRGIEATVWRNSAESLRTRLTIMVENGVLG
FT                   LVLVLVVLTLFLAPRKAFWTASGILLSFVGALIFMQQFGVSINMLSVFGFIIAMGIAVD
FT                   DAIVVVENVYAEQERTGAPLTAAVEGTQRVATPVVFAVLTTIAAFAPLLFVGGTIGKFL
FT                   GDIPTVVIFVLIVSVVEVLFVLPAHLSHGTGDDGPSTAVGQWLDGIRAGVHDRLVAFVH
FT                   GPLTTLLRFATRRYGVTLVGGLSLLVVTFSLVANGYVKNEFFPSIPGNVVTAQLEMPPG
FT                   TNADETARRAERLRAQGLGVLRDLEKEADERLLENTYTTVSRQPVASGGRTQAGFTAPR
FT                   PNVAEVSIEMVDAEARSVPSPVLEEQWRDTVGTPAGVQSLAFTSTAGGPGGDPVSVQLF
FT                   APTVDAMTRAADVVQDTLRRYAGVQDVTVDWEEKRELSLRMKPAARSLGLTLSDVARQV
FT                   RAAFFGTESFRLQRGEDEVRVYVRLPAAQRSAVADLSDYRIRAPGGAEVPLEEVATVSL
FT                   GYSPTQIDRQDGRRVVTVSADVNPAVTTGGATTARLERATLPALQAQVPTLSYQFGGQQ
FT                   REQRKAQGSLQIGFLLALFAIYGLLAIPFRSYVQPLIIMSTIPFAWIGALFGHFLLGYN
FT                   LILPSIFGIIGLSGVIVNDALVMLDFANEERGEGATWRDALVRAGQVRFRPILLTSLTT
FT                   FFGLAPFILERSVEAQFLVPMAISLGGGILVGTAVLMLIVPALAMLQRDVVAGLRSLF"
FT   CDS_pept        486992..487570
FT                   /transl_table=11
FT                   /locus_tag="SRM_00410"
FT                   /product="Conserved hypothetical protein containing
FT                   DUF1791"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23331"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M6"
FT                   /protein_id="CBH23331.1"
FT                   /translation="MRLNTMGAHCGVPAAIRPASLSTPSSMTFYPMTVHYMNALVCRRA
FT                   QSLLLLAAALLLPLGAQAQPTTSPPDAPSRAAAEAPRTAYLVRSADMLPVVLMSARTSL
FT                   TGEADGFAAAAADVVVVGPAVKGLVTGGPHAAALTESLDAGVRVVACGLAMKKTGVTEG
FT                   DLLDGIDTAPNGFHELFRLEAKGYVTLQL"
FT   CDS_pept        complement(487608..488321)
FT                   /transl_table=11
FT                   /gene="tenA"
FT                   /locus_tag="SRM_00411"
FT                   /product="putative Transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00411"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23332"
FT                   /db_xref="GOA:D5H5M7"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M7"
FT                   /protein_id="CBH23332.1"
FT                   /translation="MDLTAPLDTRAFSVPPFAEACLDHADDTWTAAFDHPFVHALAEGT
FT                   LDADTFMFYQMQDARYLEAFADAASLLSTQCTDPDDTLWFIDAARLAIVVEGELHEGYG
FT                   DELGYGPDDIRQLQLTPNNRAYQNHMIERAQRGTLVAGTAAITPCPWLYVELGQRLERD
FT                   LGAIPEDHPYAEWLAMYRDPEFNEYMDNLLERLQRFADAADDAARERAKTAFTTSVRYE
FT                   WMFWDQAWTQQEWPV"
FT   CDS_pept        complement(488601..491936)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00412"
FT                   /product="two-component system sensor protein"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00412"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23333"
FT                   /db_xref="GOA:D5H5M8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M8"
FT                   /protein_id="CBH23333.1"
FT                   /translation="MNNPASPPGTFFSVDGDRSAEVPIENPAYRDRLRGLQTDDTRPPN
FT                   ETLRALLRLGAEWLDVELGYLARVDTAASTYEVAAVSGPHPTVTKGDTAPLAQAYCRRV
FT                   IVRDDALALEDAPRQGWDGDPAYETFRLSTYLGAKVVADGALYGTLCFVDRAPRQAAFD
FT                   ESDAAALARLVQAVEQTLERRRPEARLRQTSARLEALFEEAPDMITFHDADGQLLLANP
FT                   RLCEMTGYDADTLTRRHMWDVDVSLNPDDARARWATMAPGDQHRREGRYRRKEGSTFPV
FT                   EVDLRCIAVDGARQFVATGWDTTEHRRTENALREKEARLRGLANSLPGVTYQFYVRPGG
FT                   EWGYHFVGEKAASVLGLSPDPDGFYDRFVQCIPPEHRERYRASTKAAAAEHRPARMELP
FT                   FERPDGTRIWLLCSSMPERRENETLFNGVLLDITDRREAEQAVQAERDRFETLFHNLPT
FT                   PVVHGWSDEEGHLRVQTVNDTFESVFGIGEEQIRTKDLQAEIVPPDAQDEADSIRRWLL
FT                   AGEPVDREVRRETSDGTRDFRVQVTLRDDGPGPTEGYAIYTDITERKTKERELRTRGRL
FT                   LKQLRENITDVVWMSPADKSEIEFISDAYEEIWGRPTDQLHDHPNAVVEAIHPADRERV
FT                   QAALDTQRKDPDAYEETYRVVQPDGTVRWVRDRAAGVYGEDGRLERIIGVATDITERKR
FT                   REQVLQARQDKVEALYTTTSQVLRAESTTAVGRSIVDLVNEVFGYPVVIVRFREDECLV
FT                   PVQASPDVADHVPNPSSFDVTGESVVATAFRDGDTALFDDLSAVGDSVDYGAVRATAVV
FT                   PIGTHGTISVAALEAGAIAGFDRRLIEILSTYAALVLDRIEYEGELVSAKEEAERLNRM
FT                   KSAFLANMSHEIRTPLTSIIGFAEVIGDEATSLLEHSDSPPDAVTALDQFADLIEESGH
FT                   RLLETLDTVLNLSRLEAGEMELDCSPLDLADEVAEATDLFEPQALTEGIDLQGETAEGP
FT                   LWARVDEGGLRIALQNLISNALKYTEEGGTVRVRAGRRGDDVALEVEDTGVGMDPDHVP
FT                   ELFEPFRQESEGTGRTYEGTGLGLAVTKQAIEQMGGTIAVETAKGDGSCFTVRVPAADA
FT                   PDLA"
FT   CDS_pept        complement(492120..492743)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00413"
FT                   /product="Ser/Thr protein phosphatase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00413"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23334"
FT                   /db_xref="InterPro:IPR024654"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5M9"
FT                   /protein_id="CBH23334.1"
FT                   /translation="MDLLLFSDVHGDREACQRLVDRAADVDVVVGAGDFCVARRNLQAP
FT                   IETLSAIDTPTVLVPGNAETEDELEDQVDAAGWGAAHVLHGGGTTIDGTPFFGLGGGVP
FT                   VTPFGPWSYDLTEDEARTLLSDCPEGAVLVAHSPPKDAVDRDSKGQSLGSVAVREAIEA
FT                   HTPRLTVCGHIHGSWEETAHVGPTPVHNAGPHGRIWTLSEADGA"
FT   CDS_pept        complement(492844..495402)
FT                   /transl_table=11
FT                   /gene="zntA"
FT                   /locus_tag="SRM_00415"
FT                   /product="heavy-metal transporting CPx-type ATPase"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00415"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23336"
FT                   /db_xref="GOA:D5H5N1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N1"
FT                   /protein_id="CBH23336.1"
FT                   /translation="MTRTLSYEDTLGMLNRDPDGHARRERTRRQSPAPAHVSRIDSGPS
FT                   ALYRQIYSSPPVSTMPTCTYCDAPTDAPVTAEDVDGVFCCSGCLEAHRVADPDAHDACC
FT                   HHGDGHGHAGHDPDRDTDETETAFLHVRGMHCTSCEDFIETVAASTDGIHEAEASYASD
FT                   MAKVAYDPSRHHESDLPALLSQAGYEAHLTAPEDETADQNTAARLVFGGFFGMMVMVVY
FT                   IVLLYPVHLGGEGLVDLSTEGGTYVLANVWAFTTFVLLVTGWPTLRGAAVSLRVLQPNM
FT                   DLLVGLAAVSAYLYSGGAVLMGQTDVYFDVTVVIIMAVSLGHYYEDRVKRRATDLLSTL
FT                   TREQVDEARRVSEGATETVAVDDLAPGDRVQVRAGERVPVDGTVVEGRAAVDESLVTGE
FT                   SLPVTRTEGDDVIGGAVVTNNALTVEVGAAAESTLDRLVNLMWNIQSSQPGAQRVADRI
FT                   AAVFVPLVLVLAAVAFGWQWASGAPAATALLTGLSVLIVSCPCALGLATPLAVASGLRT
FT                   ALEHGIVIRDVSLFETAPDVDTLAVDKTGTLTTGAMQVIDAAADAATWRRARAVEQHAA
FT                   HPVARAIVEDGAAGPAGDGAPARATDVRSRPRGVEGRVDGDRVRVGHPEWLRTEGLRMD
FT                   DTLAERAEAAQENAQVPVAVGWDGAVQGLIVVGDTLRDEGLAVMDALRGDAREVVVITG
FT                   DSAAAARPLREHDAIDRVIAEVQPAEKSDLVRGLRDAGTVAMIGDGSNDAPALAEADVG
FT                   IAFGPTALAADSADVVILRGDLTHIPAVFSLARAARRRIRQNLAWAFLYNAVAIPLALV
FT                   GLINPLFAALAMAASSLGVVGNSARSLPVADSRPTDGNEK"
FT   CDS_pept        495240..499019
FT                   /transl_table=11
FT                   /gene="cheB"
FT                   /locus_tag="SRM_00414"
FT                   /product="Chemotaxis response regulator protein-glutamate
FT                   methylesterase"
FT                   /function="catalyzes the demethylation of specific
FT                   methylglutamate residues introduced into the chemoreceptors
FT                   (methyl-accepting chemotaxis proteins) by cheR"
FT                   /EC_number="3.1.1.61"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00414"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23335"
FT                   /db_xref="GOA:D5H5N0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N0"
FT                   /protein_id="CBH23335.1"
FT                   /translation="MKNKFVDTTLTVRCRFGRHEPVRATVGGFVHVGRVRPGPGSTFPE
FT                   CPRRRACASPFLQSATGCVADCMSSASKEAIQASPVGPGSDETSEQSVPVVAIGASAGG
FT                   VGALRAFFEALPSDGGMAFVVVLHLSPDHESSLAEILQYDTDMPVQTATDDCGLRPDHV
FT                   YVIPPRHEMWVEGTQLRLSAHSDRHRPHTIDALFDSLAEEHGAQAVGIVLSGTGTDGTL
FT                   GLRAIKTHGGIAMVQEPADAGHEEMPRNALEAGVIDLVRPASELAEQLVAYHRNAHAIQ
FT                   LPESEEALPSGEQTTLQKIFAALRTHTGHDFSHYKRSTVLRRLERRLQVTDTETLEAYL
FT                   QVLQDRPGETRALYKELLISVTRFFRTPEAFDELADTVLPRLFEDTAADDEVRVWVPGC
FT                   ATGEEAYSVAMLLHEHARAAEAPPELQVFATDVDTEGLDTARRGTYPVSIEADVPDERL
FT                   DRFFYREEDRYHVTSSLRNTVVFAEHNLIEDPPFSKLDLICCRNLLIYLDQTMQEYVFR
FT                   LFQYALDPGGFLFLGPSEAVGPAQSSFSVVDDTRSILKAKPPAPDEDRPMPLFAPSRAA
FT                   SEPPSSSPSPVSAPTDVAATHRRLLMDQVASLLVDENREIVHLTGRAGRFLEHNPGTPT
FT                   HNLLEKVHPLLRLELRGALYQAFQKGEATERTVPFPDAGDGPEHVRVRVQPLDDAEGGQ
FT                   RLAQVCFEEADAPGRGVDEDGEATVSSKEPTERERDLESELQDVKEQLQITSEEHETVT
FT                   EEMETANEELMSMNEELQAKNEELQTSKEQLQSVNEELTTTNQQLNAKVEALDQANNDL
FT                   QNLMEATQVGTLFLDRDLEIRRYTSPMTDIFGLRSVDEGRPITDFTPKIAYDALVADAE
FT                   RVLEEQASIEREVEGPGRTWYLMRLRPYRTVSGEVEGVVMTFVDITAQKHAAESLRAER
FT                   DLVSALIDTAGALIVVLGEDGSIVRFNTACERLTGYDAAEAEGTDLRDLLVAPDDREAV
FT                   TSRLDALADGTTDRADLEMRWTPAEGEPRLIKGSFTALRDESGAVQHFIVTGTDMTRHR
FT                   ELEREVIEISDRERQRIGEALHDVISSGLTHVVMCTDTLAHRLTQEGTAVTADDLEGIS
FT                   SEVKEAADQIRSLSHALIPRALRQDHLAAALADLADEEEDFSDIDCTFVGDEGETRPED
FT                   ETDAMNLYRIAHEAVANAREHADPSRIQLGLREEGADLVLSIRDDGRGWEGDTPDDEGL
FT                   GLHLMRYRANLIGATLRLTSDDGETVVECRLPLP"
FT   CDS_pept        499155..499967
FT                   /transl_table=11
FT                   /gene="bacA"
FT                   /locus_tag="SRM_00416"
FT                   /product="Bacitracin resistance protein BacA"
FT                   /function="Catalyzes the dephosphorylation of undecaprenyl
FT                   diphosphate (UPP). Confers resistance to bacitracin"
FT                   /EC_number="3.6.1.27"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00416"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23337"
FT                   /db_xref="GOA:D5H5N2"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N2"
FT                   /protein_id="CBH23337.1"
FT                   /translation="MTWWEALLLGLIQGLTEFIPVSSSGHLVLGQYLLGLDKEAADVTF
FT                   EVFVHFGTVLSILTVYWDDVAELVEEAWAGLRAPRAVPTRFAENDTFRLGVFILVTLVP
FT                   TGVAYVLFREPLEQAFGSPRFTSAMLVGTGVLLLLTRIGPRPDGDLSGVKAFVVGVAQS
FT                   CALVPGISRSGATICVALYQNVAPERAANFSFLMLLPVVLGGTALKGLELMEQGVGAAG
FT                   LSLGIGTVAAYGSGIGAIYVVLDVVRRGNLQYFAYYCFLIGGLGLWLL"
FT   CDS_pept        500609..501436
FT                   /transl_table=11
FT                   /locus_tag="SRM_00417"
FT                   /product="Putative ABC transporter (substrate-binding
FT                   protein)"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00417"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23338"
FT                   /db_xref="InterPro:IPR024787"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N3"
FT                   /protein_id="CBH23338.1"
FT                   /translation="MPDTMRLTDEEKAVRREIEDWQHADASVASQAMDWAMRPVDWAVE
FT                   QVVSPDQMDQVTDRVEQFLSTLSDASEWTHAADDILAAAEDRGLPAESVQDLRNRPVAD
FT                   LDELARSRFRQNTLLAALEGGGTGLAGTAFVAADIPLLFTINLRLIQQIAASYGFSLEG
FT                   PMFRPLVLSIFNVAASGGREARNEALREVSVAAAAFADDLDYAGRVSGTFRDQNRHLPR
FT                   EIAKTLLERKLGQTVPLAGAAVGAGVNYWFTTQTAESAFMCARALYLDWKERR"
FT   CDS_pept        501584..503101
FT                   /transl_table=11
FT                   /locus_tag="SRM_00418"
FT                   /product="putative GTPases"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00418"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23339"
FT                   /db_xref="GOA:D5H5N4"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR016484"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031166"
FT                   /db_xref="InterPro:IPR032859"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N4"
FT                   /protein_id="CBH23339.1"
FT                   /translation="MWSRYHLEQARSSLLGGAGHHRGAPVVYDRRTPERTPPEDDHREQ
FT                   NAPLPHALPPVVSPLPPLLPSSQFPLPAVLVAIVGRPNVGKSTLFNRLTGSRQAIVEDT
FT                   PGVTRDRVYGEAEWKGHTIPLVDTGGYVPRSDDPYERAIREQAEIALEDADVILFVVDV
FT                   TTGITEMDKEIATVLRPTETPVMVVANKADNEEREWDASEFYQLGLGEVYPVSSTNKRG
FT                   VDDMMAALVEELPGTEDEADEDRVQVSLVGKPNAGKSSLVNATLGFDRAIVTERPGTTR
FT                   DTVQSVVQYEGRDLMLVDTAGMQKRSKADGVEFYATVRSERAIRAGDVCVLVLDATEEL
FT                   HKQDLSVLSEVNEHKKGMVVAVNKWDLVPKDDGTMDQYTKYLRQYLGTLDHVPIVYVSA
FT                   VTKQRVYELLDKALEVAEARATRVQTSALNDVVQAALDEKHPPTTSSGAFVNITYATQV
FT                   RTAPPVFVFFANHPEGIRTDYKRYLEGKLRDALGFEGVPLTLVFKEK"
FT   CDS_pept        503267..504046
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="SRM_00419"
FT                   /product="phosphatidylcholine synthase"
FT                   /function="Condenses choline with CDP-diglyceride to
FT                   produce phosphatidylcholine and CMP"
FT                   /EC_number="2.7.8.24"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00419"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23340"
FT                   /db_xref="GOA:D5H5N5"
FT                   /db_xref="InterPro:IPR026027"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N5"
FT                   /protein_id="CBH23340.1"
FT                   /translation="MGSTDLSDLKDRSERIRLGRKVRAYFVHLFTASGVAFAFLAMREV
FT                   VRVDLDPRWVFGWLTLAVFIDAADGPLARLWDVKLYASRILGKTIDLIVDYLTFTFIPL
FT                   TLVWRMDWLPGWDGLWVTLAMVASLLGFANTAAKQSQEGFFLGFPSYWNVVAYYVGLLA
FT                   VEYGAVGAYVSLGSVLTLTVLTLVPVRFVYPNAAPTPWRAIVTVGGVAWLGLLLALLPT
FT                   FPELPAWGGDWVLGVSFVYPAFYFGLSGWLDWTSRQS"
FT   CDS_pept        complement(504093..504797)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00420"
FT                   /product="Conserved hypothetical protein containing DUF330
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23341"
FT                   /db_xref="GOA:D5H5N6"
FT                   /db_xref="InterPro:IPR005586"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N6"
FT                   /protein_id="CBH23341.1"
FT                   /translation="MTVPVPSVLLRRLGWCAVVVGLVALSTAGCVRLLEPRTSDATYYL
FT                   LDGASPPDTAATPPPSTDPTGLRIGLQSPRLAPYLDETRLVTRHGPNAVAFSEFHRWGE
FT                   TLDRGIGRTVARTLEARPGIRSVEGVPWPRGATFDYLLRLHVLSFEGVGPRPPGPDADD
FT                   DAPPPDGHAQMTVQWTLRRPGADTVLVQETTHHRTEDWRVTDYEGLVARLSRGLHVLAD
FT                   DVGTHLQALHRP"
FT   CDS_pept        complement(504802..505836)
FT                   /transl_table=11
FT                   /gene="pqiB"
FT                   /locus_tag="SRM_00421"
FT                   /product="putative paraquat-inducible protein B"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00421"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23342"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N7"
FT                   /protein_id="CBH23342.1"
FT                   /translation="MSQRVSPTLIGLFVVGALALGVVGVGAFGSGQFFEQRTTFISYFD
FT                   ESVNGLDVGAPVKFKGVPIGEVTDINLRVDLENETFQVPVQYAINLDPVTDTTGARLNL
FT                   DDPTLLRDQIEDGLRAQLQLESIVTGKLYVELTYISDPDSAVYAQGPPSRLSIPTELSP
FT                   LAKLGEGASGLVTNLRQFDVTQINENLVTFLVNANDKLEALDAEAINRSALSTIESVRE
FT                   VVESKEVRTALQDMPKATERLRATIKDAQALIQRLDRGVEPTADELEKTSRQLRATLKR
FT                   MRRTMDEVDQTLSPNSGIGYQMNEALSNLSEATEALRVLVQSLERNPSMFLRGREEPPP
FT                   SNQQ"
FT   CDS_pept        complement(505870..506637)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00422"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00422"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23343"
FT                   /db_xref="GOA:D5H5N8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N8"
FT                   /protein_id="CBH23343.1"
FT                   /translation="MSPPESAPAISAEDLVLAFGSFVVMEDLTFDVESGEIFAIMGGSG
FT                   SGKSTLLKHLFGQMHPSAGTIRIGGRDLWAMSADERAAMLREVGILYQADALWSTMTLA
FT                   ENVALPLEEHTALAAPDIARIVSLKLALVGLRGFEDFRPHEISGGMRKRAALARAVALD
FT                   PDLLFFDEPTSGLDPISARRLDDLILQLRDSLDTTVVVVSHDLESIFTIADRALYLDID
FT                   TKTMTALGPPEDLRSNPPNERVYQFLTRSLDNE"
FT   CDS_pept        complement(506847..507962)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00423"
FT                   /product="ABC transporter, permease"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00423"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23344"
FT                   /db_xref="GOA:D5H5N9"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5N9"
FT                   /protein_id="CBH23344.1"
FT                   /translation="MQVETHHTDDTLVLAPVGDWTLDRPLPDARAVMVNAAPSSPVAAV
FT                   AFDTSGLGDWDSSLVTFLFEAAEYGRAHDLDVRIDTLPTSLERLVALSQAVPEADTTPE
FT                   AEDTALLARLGHWGLAAYDEAHALVTFLGQAVRSVGAILTGRGRMRWRTFGVALQESTA
FT                   SALPIVTVISLLVGLIVAFLGAVVLQRFGADYFVSYLVSYGMLRELGALMTAIIMTGRT
FT                   GAAFAAELGSMQVNEEIDALETFGISPIDFLVTPRILAVVLALPMLTLYADALGIVGGM
FT                   GVAVTMLDLTTTQFLTGLLEPVVLSDALVGIFKAVVYGGIIGLAGCMRGLQAGDDASAV
FT                   GQATTSAVVTGILLIVFANAVIDWAAAVLQV"
FT   CDS_pept        508348..508869
FT                   /transl_table=11
FT                   /locus_tag="SRM_00424"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00424"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23345"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P0"
FT                   /protein_id="CBH23345.1"
FT                   /translation="MTGSRPCRMHVMHRRARACPGAWPPTPPLCHETRRAMPDAHSRSA
FT                   DEGAPATQIADVTCRSLASALAQRCADLHGMDVEVARTDPGPPVKIQVRCGGRFEVGLR
FT                   VAVEHVGGNVYDVFCTIEEGASCRLTYSRPEGAGAPLPLCPRLGRRFSAFVLEELERRL
FT                   GRWHLRGEED"
FT   CDS_pept        complement(509161..510018)
FT                   /transl_table=11
FT                   /gene="ompA"
FT                   /locus_tag="SRM_00425"
FT                   /product="Outer membrane protein A [Precursor]"
FT                   /function="Required for the action of colicins K and L and
FT                   for the stabilization of mating aggregates in conjugation."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00425"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23346"
FT                   /db_xref="GOA:D5H5P1"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039567"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P1"
FT                   /protein_id="CBH23346.1"
FT                   /translation="MGRRVSPGGVGDGPAAVPQPPAEPDGNFASGPSLGTGHRPDCPLH
FT                   LLSRFPFSFHMPMSSVRHSTPLVLLVTALLLGGCSSLSNTEKGAIIGTGAGAAGGAAVG
FT                   KAAGGTAEGAIIGAAVGGAAGALIGSRMDTKAEELDEELDNADVERVGEGIKVTFDSGI
FT                   LFDFDSSTLRAEARQNLTEFAESMQGFEDTKILVVGHTDAQGSEEYNQKLSDRRAESAT
FT                   RHLVDRGVDPSRLTSVGRGETEPVASNETEEGRQQNRRVEVAIYANEEYRERVQAQTEG
FT                   SGGR"
FT   CDS_pept        complement(509988..511109)
FT                   /transl_table=11
FT                   /gene="mviM"
FT                   /locus_tag="SRM_00426"
FT                   /product="oxidoreductase family, NAD-binding Rossmann fold
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00426"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23347"
FT                   /db_xref="GOA:D5H5P2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P2"
FT                   /protein_id="CBH23347.1"
FT                   /translation="MGERRRTRDWKRAARTLAHATHLPARRWPLNLQFPTVQSSPPSAN
FT                   NMAVNWGILGTGNIAHLVAEDLRRLPNAELTAVGSRAQARADTFGDTFDVPHRHGSYEA
FT                   LVADPALDVVHVATPHSAHLEHATLALEAGHAVLCEKPLALNAAQAERLIDTARRHDQF
FT                   LMEAMWTRFLPVMDDVHRLVHEERVLGDVHLLRADIGVTQPVDPTHRLFDPALGGGALL
FT                   DLGVYPVAFAFDLFGAPDTVTSSAVLADTGVDAQCAAVFRYDDGTQAMWHASLGADAGR
FT                   TCVLAGPEGRLRGTRAWWKGAPFELTRSDGATASWARPYEGNGYQFEAAHVMACLREGR
FT                   TESPVMPLDESHALLRTMDALRAEWGVAYPQEA"
FT   CDS_pept        complement(511280..512668)
FT                   /transl_table=11
FT                   /gene="pncB"
FT                   /locus_tag="SRM_00427"
FT                   /product="Nicotinic acid phosphoribosyltransferase"
FT                   /function="The first enzyme in the salvage pathway of NAD
FT                   biosynthesis from nicontinate"
FT                   /EC_number="2.4.2.11"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00427"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23348"
FT                   /db_xref="GOA:D5H5P3"
FT                   /db_xref="InterPro:IPR006405"
FT                   /db_xref="InterPro:IPR007229"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR040727"
FT                   /db_xref="InterPro:IPR041525"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P3"
FT                   /protein_id="CBH23348.1"
FT                   /translation="MPFDDQLRPDTSALYTDLYQLTMLQAYWREDMDEPAVFDLFVRRL
FT                   KDRHYLVACGLEQALEFLETLSFSEAALDYLATQDPFEPAFLDWLADFEFTGDVYAVPE
FT                   GTPVFPDEPLVEVVAPIGEAQLAETFLLNQITFQTTIASKASRIVEAAQLDGEDRIVAD
FT                   FGMRRTHGTDAAVKGARAAHVAGIDSTSNVAAGQAYDLPVTGTMAHSYVEAHDSEVEAF
FT                   RAFSALYPETILLVDTYDTLDGVRKVIDLMNETGDEVQVRGIRLDSGDLAELARSSRTL
FT                   LDEAGLADVMIFASGGLDEHTIADLLDRGAPIDGFGVGTRMGTSADQPALDTAYKLSGY
FT                   AGTPRMKLAPEKSNLPGRKQVVRQYEDGTAVRDVIATEDEQTNGAPLLERVMADGKRTE
FT                   AGAPRPLSAIREHAAARLDELPSRLRAPTANPEDYDVVLSDALETRVADTRDALAETMA
FT                   AEAA"
FT   CDS_pept        complement(512810..515728)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00428"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00428"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23349"
FT                   /db_xref="GOA:D5H5P4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P4"
FT                   /protein_id="CBH23349.1"
FT                   /translation="MRAAPYERRAGLPHRSGREDAVVQWMRPPRSHALTSMRRFLFLVL
FT                   APLLLAACTTVNVRPDDAADEPGGPSTEAAPPTDDDGTAGADDGEDDPFEPWGETLEGT
FT                   RKVDGFLPLHEKDDGTLYAEIPSERMGDPFGLTLHVSQGVGVFNLHDGLPLSDTRLMEF
FT                   RRVNRSVHLVHRNVRFRADAGPMRTSLNENTGDSVVEAFDIVSRNDSTGHLLIEVSDFL
FT                   TSDYPEIGDRLSLYFGGAPASLQGGKSYVKKARGFPANTEIDVSLTYQGSSAPLIGGEA
FT                   VPDYRAVPVGVRYSLFALPESKMQRRRADDRVGYFVDAVKDFSRDQASTPYVRYVQRWR
FT                   LAPSDTAAYKRGELVEPAEPIVYYVDRTVPDRYREYVKQGIEAWNEAYRAAGYKNAVEA
FT                   RVAPDDSTWSAEDIRYSTVRWTAAHQMGYAIGPSQTDPRTGEILNADILISSSFVRGWQ
FT                   DTYSQITPGPSADTGALAQGPVSSRTPKALRKMLSPELARQACWAERGMAQQIGLQRTL
FT                   LLARGAIAPGESMPEKYLGAAIKDLVMHEVGHTLGLRHNFKASSGIPNDELHDESYTEE
FT                   HGVSLSVMDYAPVNVALDEEEQGHYWNPTVGPYDEWAIKYGYMPIAEQSDDGALTRNGP
FT                   LADTATAATAGLHKIAATSSDPTHRYGTDEDTWLGGYAVDPLTNAWELGSDPMAFAETR
FT                   AALVKTVMPKLEDRLVSAGERYYPLRRATTALLMERYRSLRPVTKTVGGSYVARDHKGT
FT                   PDARPPLRPVPAEEQREAVQLLVDEAFAPDAFEFDPERLNKLAPNRRSHWGTSPSLPLD
FT                   YPVHRRVHTIQRNLLRELLHPARLQRMIDAQARTPDGAGYAPGALFRTMTDAIWSELDT
FT                   AGPQPAPINSFRRPLQRTYADMLIELMMGTTSWITITTAGIDQIDAPEDVRSVARLELT
FT                   ELSDQIETALGTPGLKRETRAHLSETQARIDRALNASLDLSP"
FT   CDS_pept        complement(515906..516430)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00429"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00429"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23350"
FT                   /db_xref="GOA:D5H5P5"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P5"
FT                   /protein_id="CBH23350.1"
FT                   /translation="MSESKAPSPVEKELIEKFGNIYESYGLRRLQGLIVGLLLTKSEPV
FT                   SLDDMVEILDRSKGPISISVRRLDDMDYVRKVEGPNNRRNYYESHPNIFFNNFKFNMQT
FT                   VRENRSIAERFLNRIDTEGDETEKTKRSLEHMEAFYDLMESFFEEFAERWWEVKQEQLG
FT                   EESNQEAVTPR"
FT   CDS_pept        complement(516501..516875)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23351"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P6"
FT                   /protein_id="CBH23351.1"
FT                   /translation="MSSHHPAVQHPRYPRPRQPGGTARTRGLYEGTFRDNTSRSFWTTS
FT                   RAPPPVSERARFLFAKKDDASHHALPEQTGTTLGIGGRVGRAVVPSAVHATRLPQLRLV
FT                   APKKRWAPKKIVNSQTIRRL"
FT   CDS_pept        complement(517016..519316)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00431"
FT                   /product="Putative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00431"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23352"
FT                   /db_xref="GOA:D5H5P7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004483"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041677"
FT                   /db_xref="InterPro:IPR041679"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P7"
FT                   /protein_id="CBH23352.1"
FT                   /translation="MSDETTLLVHFQSPSDEGPSDIVGAFTNEADVAPDAIGAIDIDDD
FT                   TTTVNVRPDVADRIVQALDGGRIGTSTVSIALLDAETESARAYATRLTDLVELEREEEM
FT                   RRHEREIETLSGREREDRGRALLRMRGRDEGEGLGGHHVKLMREQKGQPLPDHEIRVGD
FT                   LVMISKTDPLRDDNPTGTVTQVTNYSITASFDPKPDGWVFGKGLRPDRREEVVSGLRVD
FT                   LYVNDIPYQRMQDALAQLPTADGALKQLRDVSTGVASPAATEPATIDDWHNSALNDAQR
FT                   RAVRKAVATDDVHLIHGPPGTGKTTTATEVLQQCVDRGESVLATAASNTAVDNVVAFLA
FT                   EQGTDVVRLGHPARVNDRLRTHTLDAQIEDTDTHRRSQQKREKAFAVLDRQEDLTAPSG
FT                   RWRRGMSDRKIKERAEQGRGSRGVPPERIEEMAAWLALQERADALFDEAEALEQEAIDE
FT                   VLRAADVVCSTNSTAGSDLLDGHTFDTLVIDEATQATAPSCWIPMTHARRAVLVGDHKQ
FT                   LPPTIQNQEAARRGLRRTLFERLAHHHETAPESPGSIRSLLRRQYRMHETIMGFPNRTF
FT                   YDGRLEADDTARHRTLAGLGVPEHALPADERRAILDPEAPLVFVDTSGIDAPEHQRSGS
FT                   HSRENPREADLIAQLTTALLEAGMAPSAIAVISPYDDQVDRIDRALAPDGPETDTVDGF
FT                   QGREKEIVLLSLVRSNDRGAIGFLDEPRRFNVAVTRAERKAVVVGDASTVAAADVLGAF
FT                   VRYAETTGRAVPL"
FT   CDS_pept        519635..522616
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00432"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00432"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23353"
FT                   /db_xref="GOA:D5H5P8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P8"
FT                   /protein_id="CBH23353.1"
FT                   /translation="MFRRHRYVLVVLFLIGAATLAFSDAAAQSAGIIEGQVVDAGDGSP
FT                   LPGANVVVEGTSIGTSTDPDGRFRLTSVPAGPQTLTVSFVSYKSGSTTVDVEAGQAQTV
FT                   NVELASEVLEGEEVVVRGLRRSQFRSINQKRQSLNIVDALAADRIGNLPEKNIAEAVQR
FT                   LPGIVLRNDRTEGRFVSIRGGAANLNNVTLNGNTLASTAGSRATALDLLPAEMVSNVEV
FT                   TKAVTPDMPGNAIGGSIDISTLSAFDREGAFAFGSVRALSHDQQVPDLGETAFPFRANV
FT                   TAGTKVGPDDAFGLLISASGSRRDFTTSGLKGEGWGEFSGEGSIDLRPDFGGAVVPEAQ
FT                   EQIVERNRRRRFAVNASLDWRPNKNVEVYLRPYYTFTDEKKLDNELEYNMVYDPEDYPG
FT                   DPRPSMTESGARFARGFGSVDLSDTDEEESLWGGNLGVEHQFDGAVTLSASGSYSRGVL
FT                   NRRQEDAEFETPETTRASGVADMGNFLFDYYPENPDYVGNGANYTANEVDLEYNENIEN
FT                   TYAAQADLRVPFSSAGVSGYVETGGQFQARDKSIDAADTGYDYVGGGSLTLADFEAPRV
FT                   QTVQVGNGLMPFANTQAMVADFLGDLCNPSTEQRFAGERRCRASNAVYERVGAEDLAIA
FT                   DIEDDSENAEAIYAGFAMASVEVGALTALGGLRVEHTSTETDRFQLREDEEFDPEEDVV
FT                   RQTFENAYTNVLPSLHLTLQATEALQLRAAWSNTIGRPEYDDLGAFSEVEIVEEGGNLL
FT                   ASVNEGNPTLDPFTAMNFDLAAEYYFPNGGLASVGGFHKRIDNAIYTFSSEQRNVQDPF
FT                   GQGRTFDRISRSQLRNADLGTVTGVEIAYQQPFTFLPEPFNALGLNANTTLTTSDVDVP
FT                   EYEDSPARPDYSFFQQSDLVYNIIPYVQTGGFEARVAINYQGEYLEGIDGSSPLEDEYV
FT                   GDRTTVDINATYQFQSVLGEPELLLQVQNITNEPEVFQTGRAKNLGFHYRSGRTVTVGL
FT                   STEF"
FT   CDS_pept        523125..526721
FT                   /transl_table=11
FT                   /locus_tag="SRM_00433"
FT                   /product="Two component system histidine kinase, putative"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00433"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23354"
FT                   /db_xref="GOA:D5H5P9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5P9"
FT                   /protein_id="CBH23354.1"
FT                   /translation="MRLLASVRPTGSGTRFLILHGRACDLGFWSLRELSLPCKKVLREQ
FT                   QSLFPGPSRYTMSNASSPDSEQGVEAPIFKTDEMEEQLDVLRRHDVLEGRLEGAFDRMT
FT                   RVAADLFDAEAAFVVFLNSSQQWLEDHVGLGRSACRAVAAWCTRVVEEDTPLVVDRTRT
FT                   DTASDAQTQEGEPDFYAGVPVHVSAGTCIGVCAIVDSIPRSFSDSQTRRLGDVGQMISE
FT                   KLEQRRQASSKRRLARERKEMSHRFQAILEDPNMMVGALDVDGTLVDANETALRYIEED
FT                   RESVVGRPIWETPWWGEEDRDTVRQWVQRAADGEYVTYEATSTDAQGRFYQVEGTIRPV
FT                   TGREEKGDERVEALVVSARDVTERERSRETLELYREYTDRLLDDIDDVFFVLDETARPQ
FT                   RWNQRVSEVTGYSDAEIVAMSALDFVPESERARLAGKIDEALSADNLQIEIPFLRKDGT
FT                   TVLYEFVGGSLEHPEGGRRIAAIGRDISERKKRERRLRQTETLFQNAQQPLFLLDVHEE
FT                   GERFRLRRVNPAYEEKFERTAESVRGRSPRDIYGAKFGGFMEEKRAECVRRGEALQYEE
FT                   KIPLDGAITYWKTRIAPVMGAGDVQQIVGHATNVTDQKRRERTLRERQDKIEALYKTAD
FT                   RLIRAPSKETVGTVLVRLIRTALGYQAVAVRFVQDENLVVTEVSETNFEFMPERPDFRV
FT                   DGDSPIAEVYRSGQTLVIGDVEEDIDDEDDRVFPPNYYGNPGSGVVVPVGRHGTLAVAS
FT                   QEPQAIGPFDRHLIEVLGSYAAVVLDRLGHGQSLRERQGKVEALYEATQRLLTAEELES
FT                   VSTRIHELLEDIFDYPLQNTGFVDGESIVPDQTSAEHAVGVPPPERRSTDGDSLSAQAL
FT                   RAGDTVVVDDAGSLDNDVEYGALRTAAAVPIGEWGVVVIGKTEVEAFDPFNLRLIEVLS
FT                   GYAALVLNRLDREATLRDAKEEAEEASRMKSALLANMSHEIRTPLTSIIGFAEVVGTEA
FT                   STLDLPTGSPLPDCADRIERGGKRLLDTLEGVLNLSKLEAGQMELDAEPVPLISEVQRV
FT                   AEELQPKAREKEIDLRLETESAWAEADEGGVQIIARNLLSNAIKYTEADGTVWVRSYRA
FT                   DGRAVLEVEDTGIGMAPEAVDDLFEPFRQASEGFSREYEGTGVGLAVTKRAAEEMDGSV
FT                   DVDTEEGEGSRFTVRLPTAGGGEASENGERTP"
FT   CDS_pept        complement(527373..529319)
FT                   /transl_table=11
FT                   /gene="dhlC"
FT                   /locus_tag="SRM_00434"
FT                   /product="Sodium/glucose cotransporter 2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00434"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23355"
FT                   /db_xref="GOA:D5H5Q0"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q0"
FT                   /protein_id="CBH23355.1"
FT                   /translation="MLRTAHRSRAFFRPPCRGTLGTIVPDLDPPYRHVSDTRSQTYALR
FT                   EGSCPRLARCPGANWGHGRILHTRLNLASLPRPCYFFVTAYINGRETITASCKRSGVSP
FT                   IPFRPMSPDFPLAPLDLAIIVGYFAVVGIIGYVVAQRIESGEDLFLAGRTLAWGTIGFS
FT                   LFASNISSTTLIGLAGDAYRTGIAVSNYEWMAGIVLVFIAVFFVPFFIRSGLTTIPEYL
FT                   EKRFDVRSRKYFSGLTIFTSVIIDTAGGIYAGTLVIKTFFPDLIPGMGPEMDFYVTCFI
FT                   LALIAGVYTAAGGLAAVVYTDILQAVILLVGSVFIAGITFAEFDFSWAQATAQLPEGHL
FT                   SLMRPMGAEGLPWLGTLVGVPILGFYYWGLNQYIVQRILGARDLDNARWGAMLGGLLKL
FT                   LPLFIMVLPGAFALQLYPDLGNPDQVFPTLVTDLLPVGIVGLVMAGLIAAIMSTIDSTL
FT                   NSASTLITIDFVKPRWPDLTPQQVGTVGRVTTIILMLFAAVWAPQIREFPGLWSYIQSV
FT                   LSYLVPPVVAVFLLGIFWPRTNGSGAFATLLGGHALSIAVFLCAQDGLLFADAPIDLHF
FT                   TIIAGILTALCLGMLVAFSLTLGPPPAEEEIDDLTWANRVLETGPAMAWYKNYRVHAAT
FT                   VLALTAVMLVVFW"
FT   CDS_pept        529413..530495
FT                   /transl_table=11
FT                   /locus_tag="SRM_00435"
FT                   /product="Transcriptional regulators"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00435"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23356"
FT                   /db_xref="GOA:D5H5Q1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q1"
FT                   /protein_id="CBH23356.1"
FT                   /translation="MSTTIYDIAERADVSTATVSRVFNDESGVSEDTRQHVLDAAAALN
FT                   YRPHASAQNLARQHTNQIAVVAPVVANYFYMHVMRGIQHALADRDMDLMVHAPANPQDR
FT                   IHEQPDPESLNTYMARALQPGRNDGILLLSMPLTDEWADRLAETSRAVVLVDGEHPRFE
FT                   SFAVDSREGGYKATQHLIDRGYERIGHITVEYDPPPARYRREGYEQALRDDNRAVRDNL
FT                   IAASDERPFAFSEKGGYRAMTTLLGRKPRPDAVFAASDMQAMGAMQAAHENDLRVPEDL
FT                   AIVGFDDLELSRCAGLTTLRQPARTMGARATRTLLRRIEAAGAPPVSSTVFSPELVVRR
FT                   TCGERPESEAASPGFVLRDQ"
FT   CDS_pept        530559..533678
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00436"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00436"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23357"
FT                   /db_xref="GOA:D5H5Q2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR023997"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q2"
FT                   /protein_id="CBH23357.1"
FT                   /translation="MGWCGTAPAMRAGRRSTRRLPIRFQIIDTATQPMQYRHSILTLAL
FT                   LGMALCVGAVQAQDRQTISGTVTSADDAAPLPGANVSVPGTTAGTATNAQGQYSLQVPT
FT                   DADSLRFSFVGFRAQTVPIAGRTTIDVALAPAAQQIDELVVVGYGEQEQGNVTGVVNKV
FT                   SSEDFNKAPTVSADRLLQGKVAGLNIKSNSGRPGGQTFIRIRGGTSINASNRPLFVVDG
FT                   VPLNDTPHSPGGLSEGRNPLNFLNPNEIKDITVLKDASAAAIYGARGANGVVLITTKQG
FT                   SGEQTRISYSGSVSSTNATGTRDVLGAPQYRDVVGEQFPDLTGDLGDANTDWQDEVFER
FT                   ALGQQHSLSFSGGSEQGDRYRIALGYQNEEGVLRTSETQRVNASVKYNRPFFDDRLDLD
FT                   INLRGSRTDDQYAPSVIETAATFAPTQPVSDESNERTGYFEWREFSNEAENNPVAAIDL
FT                   YDETGDTYRSVGNFKFTYEPAFVDGISADVNLGYDVSTGERQRFIPTNERGQVEAANPG
FT                   QVDRANFTRFSRLLDATLNYQDEFEELSSQIDVTAGYSYQDDLNKFPEISASGLSSDLL
FT                   GANSTLPASEVNTFVSETPSRLISGFGRVNYTLASKYVFTATVRRDGSSRFSPENRWGT
FT                   FPSAAVAWRVHNEDFMEPLSETLTRLKIRGSWGITGNQEIGDFQYSRLFELSNQRARVQ
FT                   FGDEFITTIRPSAVDQDLKWEETTSYNIGADYGLFGGRISGSIEYYRKETNDLLFSSIV
FT                   PAGANLSDQVLTNVGSVRNTGVEFSVDAAVYETDDFSYNARFNAATNDNELTKLTNFSS
FT                   GVRTGGISGGVGNQVQILQEGEPVNSFYVYRHKTDENGDPLTDNVDHNGDGEVNLADMY
FT                   KDTNGDGEVTSEDRTAYKSPQPDWTFGHTSQVRYDGFDLSFSLRAQLGNHVYNNVASNL
FT                   GTYNRVDEFAPSNLHASVLETNFNQPQYFSDYYVEDASFLKMDNITLGYTFDRIPGVDR
FT                   LRLYGSVSNVFVLSGYSGPEPEIGETSGVGIDNDVFPRTRTFTGGLNVQL"
FT   CDS_pept        533711..535321
FT                   /transl_table=11
FT                   /locus_tag="SRM_00437"
FT                   /product="Conserved hypothetical protein, outer membrane,
FT                   containing RagB/SusD domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00437"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23358"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR012944"
FT                   /db_xref="InterPro:IPR033985"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q3"
FT                   /protein_id="CBH23358.1"
FT                   /translation="MPNNYHLMFIKRSLRAVLFITLAVGLLGCDAGVQPRSSASPETAF
FT                   QDESSYRAFLGKLYGGLVLTGQDGPAGNPDLQLIDEGFSQYVRAYWQLQELPTDEAVLA
FT                   WGDEGIQPLNKQQWTPANPFVEAMYNRIFFQASMVNEFLRQTTEAKLNERGVSEDMRQR
FT                   VQQFRAEARFLRALSYWHGVDLFGGMPIVTEEDEIGLQSPTPNTREEVFNFVEQELLAI
FT                   EDQMPAPGAAEYGRADQAAVWMVLSKLYLNAEVYVGEPHYEEVITYTDKIIGSEAYELA
FT                   DEYMHNFKADNHTSPEVIFPVPQDGEQTRTYGGTTFLGHAAIGGGTMNANNYGFGGGWW
FT                   GLRTTSNVVNRYPSDSTDVDSRAIFFTQGQSKEVGSLTSFTEGYALPKYQNVTTGGEKG
FT                   ENSTFPDTDYPMFRLADAYLMYAEAVARGAGGSMSKAVGLVNDLRERAYGDPSGNITAS
FT                   ELTPEFILDERGRELVWEGHRRSDLIRFNQFSENGTWSGKGGSIEGTTTQGFRDLYPVP
FT                   ESQLQVNENLEQNPGYGGS"
FT   CDS_pept        535336..535590
FT                   /transl_table=11
FT                   /locus_tag="SRM_00438"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00438"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23359"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q4"
FT                   /protein_id="CBH23359.1"
FT                   /translation="MHERSTVDGLHKTMGTGRLRAGSSPFRFVAVRKAALHRKPSAPHR
FT                   PGPTAKSIAEAGETVAVRLPRSPFVDLAILRSVSSPTLL"
FT   CDS_pept        complement(535587..535802)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00439"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23360"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q5"
FT                   /protein_id="CBH23360.1"
FT                   /translation="MQPRTTPCGAEPPRLFLPLPAINWGTGPHRWDPDAFYAWVGVRPN
FT                   EERHGLGFRPTARGCPFARKPLSTTV"
FT   CDS_pept        complement(535820..536275)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00440"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23361"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q6"
FT                   /protein_id="CBH23361.1"
FT                   /translation="MIQRLLVLLVAGAAALLAPAAAAQSSNIETIEGSSPGEKMTLTIT
FT                   PHVLNDDVSARAVGIESPTGTRWALTLIGISRADSVGLSLGEEALPIADVSRPGKDEVG
FT                   PTRVYVSQETFLTVAEQSEARLHVGDAALSLPAPMRADMQQIFDTVL"
FT   CDS_pept        536467..537177
FT                   /transl_table=11
FT                   /locus_tag="SRM_00441"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase"
FT                   /function="catalyses the interchange of 5-
FT                   formyltetrahydrofolate (5-FTHF) to 5-10-
FT                   methenyltetrahydrofolate"
FT                   /EC_number="6.3.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00441"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23362"
FT                   /db_xref="GOA:D5H5Q7"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q7"
FT                   /protein_id="CBH23362.1"
FT                   /translation="MDVRFDTKSAAREAVWDALEDEGIARFPFPPHGRIPNFEGAPAAA
FT                   ERLFEEPPFTGARRLKVNPDAPQRHVRIEALRRGCVVFVPTPRLRGGFKRLDPASIPDD
FT                   ETKPAASLSKMDRWAEPVALDDLPPLDAIVTGSVAVTTGGHRCGKGEGYSDLEYAILRE
FT                   LGHDPVPVATTVHSRQRVASVPTDPHDLPLARIVTPEQTIDVADPPAPPTGIDWTALSA
FT                   ADLEEMPVLRELRG"
FT   CDS_pept        537303..538562
FT                   /transl_table=11
FT                   /locus_tag="SRM_00442"
FT                   /product="Putative sugar transporter"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00442"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23363"
FT                   /db_xref="GOA:D5H5Q8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q8"
FT                   /protein_id="CBH23363.1"
FT                   /translation="MNANDRSIIALVTTGHGLVHTYELSIPIFMTVWLAELGVAEATLG
FT                   AVVGGGYFLFGAGALPSGILVDRFGSRRLIACGLAGMGAAFVLLGLLPGLWGLGAALLA
FT                   WGAAASVYHPAGLALISTGVRQRGRALAYHGIAGNVGIAGGPLLTALLLLVFDWATVAV
FT                   LLGLPGLIAAAGAWRASVDETAAVGRHDATDGSSSTASANPGRLTALWRQTRHLFASGF
FT                   AGVFVLVALSGLYYRGVLTFLPDLLTPLVTVDLPIDVSAGRYVYAGLLAVGIAGQYVGG
FT                   RLSDRGGTEWVLAGALGLLSLVAVVFLPVAGGGTGALLVVSAGLGFVLFLVQPLYQATV
FT                   AEYTPPDTRGLSYGYTYLAVFGIGAAGAALSGGLLQLAGPPLLFGALAGVALLGAGLSA
FT                   WLAVRRAQLTDPEAATGLSP"
FT   CDS_pept        538859..542044
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00443"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00443"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23364"
FT                   /db_xref="GOA:D5H5Q9"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR023996"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Q9"
FT                   /protein_id="CBH23364.1"
FT                   /translation="MPPFVSSYSSFKIVLTAVFGVLLACGLPGGVQAVHAQDFEVTGTV
FT                   VSADNQSPLPGVNIREAGTSRGTVTGPDGGFSLAVDSPQDTLTFSFIGYQTKTVPVDGR
FT                   SEIRVVLETESQELEGVVVTALGIERQQRSVGYATSSIEAQDLVDVTESNPANLLQGNV
FT                   PGLVLSSNASGPNSSSSINIRGVSSIAGNNDPLFIVDGVPIDNTVIGGAGKFGGRDGGS
FT                   ALSVVSPENISDISVLKGAGAAALYGTRARDGVVLITTKTGRTSAPGEVSVQYSSTVTA
FT                   KDVISGFSDFQSQYGQGTQGRAPSNQDAALSAGLSSWGAPLGEVDEAPQFDGTVRPYDD
FT                   VADRQGFYRTGLSQRHSLSINAGFENTSLRLSASHQNTEGVVPNSGYEQTNINLRGQTR
FT                   LGGLTADASVTYQNELTDNRTFLNDAARNPNYLISFLPNNIPKSALQPGATEEGVEKQF
FT                   TSDGLPTNPYWAVNELEADDDKDRILGNVNLNYSINDWLSLQGQTGLDWYSLRRTNVDA
FT                   FGSAFEPGGSMTEDTYRVWESNSKLLATATPSLTDELSLRLDVGGSLRHRQFEQVGVFG
FT                   RNFSIPDLETISNTANPTRNYDFSEQQIRSFFGSASFTYRNYLFLTLTTRSDWSSTLPE
FT                   DNNPFVYPSVSGSFVFTDAFDLPDALSYGKVRASWAEIGGDTDPYRTSLTYGIIGQHQG
FT                   QALETITQLSVPLLDLKPTSTREIELGFETQFFNDRFGVDFTWYRRSTVDQILDVTVSS
FT                   ASGYTARTANSGEIRNTGVELLLTSIPFSTADWTWDSRVNFAANRSQVESLAPGLDVRV
FT                   GPENRLATANIAQVVGQPANAIYGNTYVRDDQGRIVHGEDGLPLSGEKEVLGTGAPDWT
FT                   LGFSNTISYQNVSLDFLIDAKWGGKVFSGTNANAYGNGLHKATLDARAACDEQAGSNGR
FT                   YPEDCFVGEGVIGSVNGEGEVTVDRQNDVGVRPSEYYGRISGEIAEEFVYDANFIKLRQ
FT                   LRLSYDLPSSVMSRVPVRSASVSVVGRNLFYLYDSVPNISPESSYNSEATPGFEQAGVP
FT                   QSRSIGASVNLRF"
FT   CDS_pept        542100..543725
FT                   /transl_table=11
FT                   /locus_tag="SRM_00444"
FT                   /product="conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00444"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23365"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR041662"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R0"
FT                   /protein_id="CBH23365.1"
FT                   /translation="MPFLTRSRIARVASLLSAGVLALVLLSCDGVGDFGDTNEDPTTAN
FT                   DPNPDLEFTTLQLGVSGSRFDMWRTNLIYTMPIVQHIANPGFYAGNFNQYVGAWSASFF
FT                   DTRYGGGPNGSNFLRTVTNAETLISELEGKPRQVNRLAATRIMRVLTFQRLTDVYGDVP
FT                   YFDAGKGALEGEFTPHYTRQDSIYMDLHDELRAAVDQFDASQPTFGGADLFFNGSIEQW
FT                   KRFANSLQLRLALRVVKVRPDLAQSWAEEAVNADGGVMQSVEDDAYVPHQSGPSGGPAG
FT                   FNTNAHSEVMQSFPGQWLSETFVDWMKDKSDPRLTEYGALAPGGLDSALVEDPAQQRGM
FT                   PNGFDNNELAASNEYTDDLDQYTRIHPNLRDRNDPMFFQTYAEVELMLAEAAVRGWNVP
FT                   GSAEAHYEAGVRAAMNYITRYGENTSVSDSEITQYLSDNSLPSGREARLRAINNQYWAA
FT                   TFLNGIESWSNWRRSGYPELTPAPEEGDTGGQFIRRLDYPQGERDLNGDNYQEARERQN
FT                   ITQSNRLTARVWWDCGAYADQCAE"
FT   CDS_pept        543795..546452
FT                   /transl_table=11
FT                   /gene="chb"
FT                   /locus_tag="SRM_00445"
FT                   /product="Beta-N-acetylhexosaminidase"
FT                   /function="# Hydrolysis of terminal, non-reducing N-acetyl-
FT                   beta-D-glucosamine residues in chitobiose and higher
FT                   analogs, and in glycoproteins."
FT                   /EC_number="3.2.1.52"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00445"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23366"
FT                   /db_xref="GOA:D5H5R1"
FT                   /db_xref="InterPro:IPR004866"
FT                   /db_xref="InterPro:IPR004867"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012291"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R1"
FT                   /protein_id="CBH23366.1"
FT                   /translation="MLVFRLRFARSMRHILLSFLLLLFGGTLAAHAQSDATHPPADELS
FT                   IRWGVETNRVDDGNRFRSSFTIANHGDVALGTTHWTLYFNFSRQIDPASVTAPVRITRL
FT                   NGDFYRLEPDADLPPIEPGDQLRVTVEAPGSVIKRIDAPAGFYVVFKDAEGRARPPAVV
FT                   SDVTVEPFTRPAQTSRGPGDTWPVPTPATRYADHRSLTARPPDAEGRIVPTPDSIHRRP
FT                   GAFALRADATIRYEAGLAAEARQLAAGLAAALGRRPRTTRTDSAAAITLRRAEAPRPAV
FT                   DTASAEAYRLTVDPETGITITGATDAGVFYGGQSLEAWLPVAAYRAPSSPVDVPAVQVL
FT                   DAPRFDHRGLHLDVARNMQSVAAVKRLLDIMAFYKLNTFHFHLTDDEGWRLAVEGLPEL
FT                   TRVGGRRGHTLDEQAHLMPSYGSGPSPSPEASRGSGWYSRADYLDILRYAKARHITVMP
FT                   EIDVPGHARAAIQAMEARTRRLRAAGDTAAARAYRLRDPADTSDYESVQGWDDNVMNVC
FT                   RPSTYRFLSTVVDELRGLHEAAGAPLPAVHVGGDEVPEGAWAGSPICDDYIARTEGVDG
FT                   ADDLFGHFLGRFQDTLATRGIAMAGWEEVGLEEADHRSATTTPNEALVDDDVQPYVWSN
FT                   IWGGGTEDRAYRLANAGYDVVMAQATNFYFDMAYSKHPREDGYYWAGFVDTKAPFAFVP
FT                   FDLYKSADRTRMGHPIDPDTAFADQVRLADTARNNIRGLQGQLWGETLRKPDRMEYMAV
FT                   PRLLSLAERAWAPRPGWATLDDSGALRARRAEAWTAFANRLGHRELPRLSIRHPDWSYR
FT                   LPPPGATVEAGTLRANVALPGLAVRYTTDGTRPTATSPRYTAPVPVPEGATVRLRTFDT
FT                   LGRGGRTVTVPTSP"
FT   CDS_pept        546660..547754
FT                   /transl_table=11
FT                   /gene="rbsR"
FT                   /locus_tag="SRM_00446"
FT                   /product="ribose operon repressor"
FT                   /function="Transcriptional repressor for the ribose
FT                   rbsDACBK operon"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00446"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23367"
FT                   /db_xref="GOA:D5H5R2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R2"
FT                   /protein_id="CBH23367.1"
FT                   /translation="MSPPSVLCARWVRRLFNTRPNPAMEDDMTIDQVAELAYVSRSVVS
FT                   RVLNDHPNVSEEARERVMRVIEEHDYRPSSVARSLATDRSFEISVLTPRRGDESLANGY
FT                   WPLLYSGLFERCLERGYFVSLSMVSDRMEDEIEDRARDSRFDGYVLVTTEVTDLVASTL
FT                   EADGAPTVLIGQDTSWDAFSSVDIDNEQGGYEAGRHLCDLGYEEIGLILGSRALEESAH
FT                   RRQGVERALSEAGIAVSDRHVAEGDYSQESGHSIVRAWAEQGRMPRALFCASDTMAMGA
FT                   LLALNEAGYAVPDEVALVGFDDLPAAQYTIPPLTTVRQPVYEKGQAAIDLLIDHIENAE
FT                   PNPEHTELEPELVVRQSCGARQNP"
FT   CDS_pept        547885..549108
FT                   /transl_table=11
FT                   /locus_tag="SRM_00447"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00447"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23368"
FT                   /db_xref="GOA:D5H5R3"
FT                   /db_xref="InterPro:IPR010502"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R3"
FT                   /protein_id="CBH23368.1"
FT                   /translation="MEAVPIFRPHCGPILCLLFCEALLFPSARGSMRRFLLTTIVGVFV
FT                   LVLAGGESVSALVGRPSGDAAKNNPESEAPPRTYAIYRASGPIAVDGRLDERDWAAAPW
FT                   TADFVDIRGRDAPTPRFRTRAKMLWDDEALYVAASLEEPDVWGTLTQRDTVVYYDDDFE
FT                   VFIDPNGTTHNYYEVEVNALETVWDLMLLKPYRDGGPAVDAWDVRGIDAAVHVQGTLND
FT                   PSDTDDGWTVEIKLPWSSLEEAAPGGRPPQAGEQWRLNFSRVDWPLAVKNGTYEKDLDT
FT                   TKAHPERNWVWSPQGAIDMHRPEHWGIVQFADAEVGTATVSVDERPNRRVKAALRRLYH
FT                   RQRAHHEAHGTYAGSLSALNASNVQLPERDFAPTLRTTQTMYEIAAPGAEGTTVHIRQD
FT                   GKVWVTGE"
FT   CDS_pept        549399..551261
FT                   /transl_table=11
FT                   /gene="putP"
FT                   /locus_tag="SRM_00448"
FT                   /product="Na+/proline symporter"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00448"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23369"
FT                   /db_xref="GOA:D5H5R4"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R4"
FT                   /protein_id="CBH23369.1"
FT                   /translation="MAPPLPVTSFDWFFVAAYLILSFGIALYFYQRAGEDTSEFFLSGR
FT                   AMPWWLAGTSMVATTFAVDTPLLVTEIVAQNGIAGNWLWWNAAIGGMLTVFFFARLWRR
FT                   SGVMTDVEFVEFRYSGRVAAWLRGLKALFFGLLLNILIIGWVSLAMETVIDRLFPDLTL
FT                   FGQAAFSVLGREMSAALVVTGGLILLVSVYALLSGLWGVMVTDLFQFVVAMGGTIALAV
FT                   LVLDMPEIGGVAGLREQLPDETFNLLPTIGGAAEGAATFSLSALAFAAYAGVQWWASWY
FT                   PGAEPGGGGYIAQRMMSAKDEPNALFATLWYTIAHFCLRPWPWIIVALAALVLYPDLDE
FT                   PRAGFVLVMKDVLPPGLLGLLFASFLAAFMSTVSTQLNWGVSYLVNDFWGRFVRPDADE
FT                   AHYVRVSRVLTFGVALLSLVVTLFLDTIAEAWGLLLSASAGLGLVLILRWYWWRVNAWS
FT                   EMAATLAPIGLTVAALVLNVFGVQVPGLQADFPLNLYSVVGFTTVVWLAATFLTRPTDA
FT                   ETLDAFYRTVHPGGPGWTPVAERHPDVTPDSGLGRLALDWLVGVVLVYSTLFGTGYLIL
FT                   GWTLWGAGCIAVALTAAAYLWRDLQRDEISLIEMKEEKDATEER"
FT   CDS_pept        551309..554248
FT                   /transl_table=11
FT                   /gene="bglX"
FT                   /locus_tag="SRM_00449"
FT                   /product="beta-N-acetylglucosaminidase"
FT                   /EC_number="3.2.1.21"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00449"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23370"
FT                   /db_xref="GOA:D5H5R5"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR019800"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R5"
FT                   /protein_id="CBH23370.1"
FT                   /translation="MMSSSRRSFMAAGLVVVLAVAALIFGAPGPVPLSAGSSMSDRGAA
FT                   DTAEAPPKSSWAGRQFRDMTLDEKIAQLFVVRIDGEFQNANTPSYRETVALVEEFGAGG
FT                   LIFGPGTPMTQIAMANDLQAKAERPLLVAQDTEWGVGMRIDAATSFPPAMAIGATRDAS
FT                   HAYRVGYATAREARALGVHQLYAPVADVNNNPKNPIINVRSFGESPSLVGTMASAFTRG
FT                   AQRGGTLATVKHFPGHGDTDVDSHINLPVLRFDRSRLDSLELPPFRQAFDAGVRSVMTG
FT                   HLALPEIAADSVPATLSRPLTHGLLREELGFDGLVVTDALNMQAVTRTFGVGETAVRVL
FT                   EAGADLVLMSTNPHAAHQAVRQAVTSGRIDTTEINDSVRRLLRVKQDLRLHETRRVSLD
FT                   TTRHRVAQRSHEVLARTVARESLTLLANADSLLPLTPPEQHDALVVTLSDSEYPGTGDT
FT                   FVDRLRAQPAIETLDTRRLDPRSDSTDVNDHLADAADYDVVVVPSFLRVQAWSGSIGLS
FT                   DMHHDFLEDLAGTDTPVAFVAFGNPYAPTGLEPAPDAILAAYGSGEASQRAAAQALGGG
FT                   AGTPGRLPVTIPGVAEKGEGRRLAPVAPREGPPESVGMDGAQLARLDTLLRSAMLDGAF
FT                   PGAAVAVGRGPALARLDAYGYHTYDETKPVQTGTQYDLASLTKVVATTTAVMKLYEADS
FT                   LELDAPVARYLPDFAQNGKEAVTVRQLLTHSSGLKPYLDPDERGPTRAALLDTLMAQPL
FT                   TYTPGTRSTYSGLNAIALMRIVETISGRPFDAFCRTHIFEPLGMDQTGFYDTDVTRAWV
FT                   APTTDTAGTRRRGSVHDPMARDMNGVSGNAGLFSTAADLARFGYMLTHEGRIDGRQFLE
FT                   PKTIETFTAQADVPGSTRALGWDTKSAEGYSSAGDEFSAASFGHTGYTGTSFWVDPAED
FT                   LFFVLLTNRVYPDDTADQITQVRPRAADIVHRAIDGPPRPLLPGPAPEQ"
FT   CDS_pept        554604..555518
FT                   /transl_table=11
FT                   /gene="nagK"
FT                   /locus_tag="SRM_00450"
FT                   /product="N-acetyl-D-glucosamine kinase"
FT                   /function="Catalyzes the phosphorylation of N-acetyl-D-
FT                   glucosamine (GlcNAc) derived from cell-wall degradation,
FT                   yielding GlcNAc-6-P."
FT                   /EC_number="2.7.1.59"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23371"
FT                   /db_xref="GOA:D5H5R6"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R6"
FT                   /protein_id="CBH23371.1"
FT                   /translation="MSANPFFVGLDAGGSTTLLLAECEECPGRIDRHGPAANPQRVGMD
FT                   QSVQVLSALVQKTLRAQRPVDHLSVCAGVAGAGRPDEQQALADRLRRTLGDDARSVSVE
FT                   VVHDACIALDAAFGAESGLVVIAGTGSVVLARTRGGTARRVGGWGHLLGDPGSGYAVGQ
FT                   AGLRAVAEALDGGADTILRPRVAEEYGVDERAALIHWVYQDRPPLQDVAPLVIEASADG
FT                   DTVATDILTAQVNELVRQVEWLLGETDDVAPRIALLGGMLQNEHYAAALRRALADRVPD
FT                   WSVEVLRHEPVVGALRRARRLDE"
FT   CDS_pept        555865..557418
FT                   /transl_table=11
FT                   /locus_tag="SRM_00451"
FT                   /product="Sodium/glucose cotransporter"
FT                   /function="# Actively transports glucose into cells by
FT                   Na(+) cotransport with a Na(+) to glucose coupling ratio of
FT                   2:1. Efficient substrate transport in mammalian kidney is
FT                   provided by the concerted action of a low affinity high
FT                   capacity and a high affinity low capacity Na(+)/glucose
FT                   cotransporter arranged in series along kidney proximal
FT                   tubules."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00451"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23372"
FT                   /db_xref="GOA:D5H5R7"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R7"
FT                   /protein_id="CBH23372.1"
FT                   /translation="MLTTLDFVVLTVYLLGVAAFGVWAGGAQESTEDYFLGGRDLPWWA
FT                   VCFSVVATETSTLTVVGVPAVAYGGTLTFLQITLGYLVGRILVGAYVLPRYYAGQLETA
FT                   YAFLGDRYGSTMQGAASVTFLGTRLLADGVRLFATAIPLKVIANMSGVDATYFQIILVI
FT                   GVATAVYTLVGGIRAVVWMDVVQMGLYVGGALAAIGFLLGDVPPGWWGKAVAAGKTNLI
FT                   DLGLDASFGRWWTQPYTLGTAVVGGAIFSMASHGTDQLIVQRLLACRSEADSQKAVVGS
FT                   ALIVMVQFALFLGVGLLLWAHYDGASVEALGLQRGDEVFPKYIIEGLPAGLSGLILAGI
FT                   VAAAMSSLSSSLNALASSSVNDLYERISGHSMSADRGLRVSRLLTLFWGVVFIGFASLF
FT                   QDSSNPVVELGLSIASFTYGGLLGAFLLGLWHRGTRQVDALVAFVVSIGVMVLVIFGVW
FT                   HSPTEGWLFVLNPSDARVEAANLRTIGWPWYTALGTAVNLVIGSVLALRHRDATKEGAE
FT                   "
FT   CDS_pept        557533..557763
FT                   /transl_table=11
FT                   /locus_tag="SRM_00452"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00452"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23373"
FT                   /db_xref="GOA:D5H5R8"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R8"
FT                   /protein_id="CBH23373.1"
FT                   /translation="MGSFSYLLPAHCVSQNPDRFMTNSKGWIFAAGVVALALSLYLWFS
FT                   GSDQAAIFVGLWVPSLWILADLVDQAETAAA"
FT   CDS_pept        557763..558002
FT                   /transl_table=11
FT                   /locus_tag="SRM_00453"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00453"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23374"
FT                   /db_xref="GOA:D5H5R9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5R9"
FT                   /protein_id="CBH23374.1"
FT                   /translation="MKVLVEYFGMFIFAFVVFVGGLVALPEIGAPETSLGEMGGLALAF
FT                   IVIAGGFSWFYSAELPSGTQRPPGRRSRSDEPPR"
FT   CDS_pept        complement(558006..558353)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00454"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00454"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23375"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S0"
FT                   /protein_id="CBH23375.1"
FT                   /translation="MRAVRGFALQLLVPPFPALSNLPLPSMELPEQSSTGDGSARQPFS
FT                   CPECERTVGHANVLTGDFTFNDVTPKTTRPDGSPEFQKTGMEGGPQKAIELRCDFCGEE
FT                   FMLGVETGDTD"
FT   CDS_pept        complement(558379..558744)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00455"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00455"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23376"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S1"
FT                   /protein_id="CBH23376.1"
FT                   /translation="MPRSIQQAKWKRASADSYTDITDAVDEGVLAATPHPDDAIDRPKG
FT                   YSVRLTLAPDSTALADALQDALLDVDPARMTLHLEGVDEPISALPVSVSKVPHLGTQNT
FT                   AELGVPSEGHDQLHPHF"
FT   tRNA            558821..558897
FT                   /locus_tag="tRNA_6"
FT   CDS_pept        559084..559554
FT                   /transl_table=11
FT                   /locus_tag="SRM_00456"
FT                   /product="Conserved hypothetical protein containing CBS
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00456"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23377"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S2"
FT                   /protein_id="CBH23377.1"
FT                   /translation="MKWNSAKDLMTADVQTVDASWPIDRVAQFLTDHGISGAPVVKDDQ
FT                   LVGVISLTDIARHNGTAGEPASDRPASFYRSELETEYAEEDLENLQISEGGETTAEHVM
FT                   TPQVYDVNEHTSVQQVAQVMHRGGIHRVFVTTNGEVRGVITALDMLEVVATM"
FT   CDS_pept        complement(559598..561208)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00457"
FT                   /product="Carboxypeptidase-related protein"
FT                   /function="# May be involved in vascular wall and kidney
FT                   homeostasis."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00457"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23378"
FT                   /db_xref="GOA:D5H5S3"
FT                   /db_xref="InterPro:IPR001563"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S3"
FT                   /protein_id="CBH23378.1"
FT                   /translation="MSPPPFCPSSTPCPLFPTCTSSFMTDASFLRVSVAAVLLLLLGGT
FT                   VPPAHAQSMGASPLKRSLPPDTAITKTDRVTVKGEEVPYEVTTGTQPVYGDDDTAVASL
FT                   HYTYYRRSDVDDRSGRPLMISFNGGPGSGSLWMHLGYTSPKHLLISDEGYPVQPYGVED
FT                   NNQSIIDVADIVYVNPVNTGFSRVIDDDTDAEQFFGVNADVDYLADWIDTFISRHGRWR
FT                   SPKYLIGESYGTTRVAGLAGELQNSHWTYLNGVILVSPTGLGMEPAGPSPRSEALKLPY
FT                   YAATAWYHEQLPDALQSRDLQALLSEVEDYTIEEYIPAVTRGGFVEDARRQAVAQQVAR
FT                   YSGLSEPFVLDHNLAVPADAFWKELLQDEGRTVGRLDSRYEGIDVTNAGSEYDYPAELT
FT                   AWNHAFTPAINHYLRDDLGFTTDLQYNTFGNVYPWDETENNTGAQLREAMAQNPYLHVM
FT                   VQSGYYDGATDYFSAKYVMWNLGTRETMRDRLRFEGYRSGHMMYLRSEDLATSNEDIRT
FT                   FIEESIPDEGTPARYGRNR"
FT   CDS_pept        complement(561251..562444)
FT                   /transl_table=11
FT                   /gene="kbl"
FT                   /locus_tag="SRM_00458"
FT                   /product="Glycine C-acetyltransferase"
FT                   /function="This enzyme can act in threonine catabolism."
FT                   /EC_number="2.3.1.29"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00458"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23379"
FT                   /db_xref="GOA:D5H5S4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S4"
FT                   /protein_id="CBH23379.1"
FT                   /translation="MPMTDDVAADFRQTLQEIKNAGTYNEERVITSQQDADIEVEGGQH
FT                   VINFCANNYLGLANHPEIMDAAKRGVDRYGFGVASVRFICGTQSVHKDLEHALSDFHET
FT                   GDTILYNSCFDANTGLFETILGEDDAIISDALNHASIIDGIRLCKADLHVFDHSDMADL
FT                   EAKLQAAQDAETRMIATDGVFSMDGDVAKLDEMCRLADAYDALVMVDECHATGFMGEGG
FT                   RGASEAKGVLDEVDIITSTLGKALGGATGGFTTGRKEIIDLLRQESRPYLFSNAIAPMI
FT                   ANASLKVLEMLQTSGERREQIWENARYFRSEMEARGFEIKPGDHPIVPIMFYDAKTSGA
FT                   IADELLDRGIYVISFSYPVVPEGEARIRVQMSAAHSKEQLDRAIDAFTEVGRKHDVI"
FT   CDS_pept        complement(562571..563761)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00459"
FT                   /product="epimerase/reductase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00459"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23380"
FT                   /db_xref="GOA:D5H5S5"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S5"
FT                   /protein_id="CBH23380.1"
FT                   /translation="MHLQKWRGRAESGSERTGARSVRHERDRGPLLPLRKDASGKTAPN
FT                   PRFGGKYDTSRTGLVQLPHTSEHMRILVTGANGQIGSELVEALRQRHGPEQVVGLDLNP
FT                   PPTANGPSAAAPFEVMDVRDREALAGVLDRHEIGTIYHLASLLSATGEQHPDRAWDVNM
FT                   SGLKNVLDLARRRPVDTVFWPSSIAVFGPTTPRDDTPQNTVLDPTTMYGVTKRSGELLC
FT                   RYYHRRYDLDVRSLRYPGLLSYKTAPGGGTTDYAIDMLTQAAAGEDYTCFLEPDTRLPM
FT                   MYMPDAIQGTLALMDADADALSVRDSYNAGALSFAPAELAAAIRARVPTFDCHYEPDER
FT                   QRIAENWPSSVDDTAARTDWDWAPEYDLDALTEDMLHHLRENVRAPGNVGEKKRGR"
FT   CDS_pept        563883..564380
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="SRM_00460"
FT                   /product="putative AsnC-family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23381"
FT                   /db_xref="GOA:D5H5S6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S6"
FT                   /protein_id="CBH23381.1"
FT                   /translation="MSHRIDEIDAKILELLQRDGRMQRSDVAEEVDLSISAVSERMRKL
FT                   EERDVIEEYRAVVDAKRLRLDITAFIRVSVDGSEHYPNFVDQVEGMEQVLELHSITGAG
FT                   SHLMKVRTTDTTALEGFLSDIQAISGVSKTTTSIVLSTFKEERTVPTEPMELYDYDASS
FT                   DE"
FT   CDS_pept        564472..565812
FT                   /transl_table=11
FT                   /gene="glnA"
FT                   /locus_tag="SRM_00461"
FT                   /product="glutamine synthetase"
FT                   /function="Glutamine synthetase ( 6.3.1.2 ) (GS) [ 1 ]
FT                   plays an essential role in the metabolism of nitrogen by
FT                   catalyzing the condensation of glutamate and ammonia to
FT                   form glutamine."
FT                   /EC_number="6.3.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00461"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23382"
FT                   /db_xref="GOA:D5H5S7"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S7"
FT                   /protein_id="CBH23382.1"
FT                   /translation="MPTKTDVLEQIEAKGVDFLRLQFIDILGTVKNVSVPAHQAEKAFE
FT                   EGIYFDGSSIEGFVRIQESDMRLDPDPDTFAVLPWRSQRGDDTVSARLICNIIDTSTGE
FT                   PFVGDPRYVLQRAIDRAADMGFELNAGPEPEFFVFEKDENGRATTETHDAGGYFDLAPK
FT                   DLAQEIRAEVIYTLEAMDFEVEASHHEVAQGQHEIDFKYDDALTTADNIATFRSVVRAI
FT                   AELHDVHATFMPKPIAGINGSGMHTHLSLFEDGENVFHDGDDEFSLSDTAYDFLGGILE
FT                   HAPALTAICNPTVNSYKRLVPGYEAPIYVAWSDVNRSALVRKPAARVPAASRIELRSPD
FT                   PSSNPYLALATMLHAGLDGIEKGRSAPDPVRENIYEFTEADREARGIETLPSTLGQAVT
FT                   ALQKDDVVLDALGPHVSEKFTQAKTQEYTEFLASVSQWELDRYLETF"
FT   CDS_pept        566133..567431
FT                   /transl_table=11
FT                   /gene="purB"
FT                   /locus_tag="SRM_00462"
FT                   /product="adenylosuccinate lyase"
FT                   /EC_number="4.3.2.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00462"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23383"
FT                   /db_xref="GOA:D5H5S8"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR004769"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR019468"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S8"
FT                   /protein_id="CBH23383.1"
FT                   /translation="MIDRYTRPPMGDLWSEEQKFQSWLDVELAACAAWSEIGAIPPEDV
FT                   ETLYDEADFDVDRIHEIEKETKHDVVAFTRAVSETLGEEKKWVHYGLTSTDVVDTAYMV
FT                   RIKKANSLIRTQLDGMIETLAEKAREHKHTLTMGRTHGVHAEPTTFGLKMARYYDEMNR
FT                   QKERFERAAEEMRMGKLSGAVGTFAHIPPEVERLTCERLGLKPAPISTQVLSRDRHANY
FT                   LSVIAGIGATLEKMAVEVRHLQRSEVREAEEAFSAGQKGSSAMPHKRNPVGSENITGCA
FT                   RLLRGYMNSEFDNVALWHERDISHSSVERIVLPDATTLLHYALRRFRGIIDGLVVYEDT
FT                   MRENMEETYGLYNSQRLMLKLIDTGLNREEAYDRVQPLAMTAWEEERPFQAVVAESDAI
FT                   TEVLSDDEIEEAFDPTYHVRNVDRIFRRVGLEE"
FT   CDS_pept        567674..569536
FT                   /transl_table=11
FT                   /locus_tag="SRM_00463"
FT                   /product="Glycoside hydrolase"
FT                   /function="hydrolyse the glycosidic bond between two or
FT                   more carbohydrates, or between a carbohydrate and a non-
FT                   carbohydrate moiety."
FT                   /EC_number="3.2.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00463"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23384"
FT                   /db_xref="GOA:D5H5S9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5S9"
FT                   /protein_id="CBH23384.1"
FT                   /translation="MHSPDDQYAPIEDYAVIGDCASAALVGTDGAIDWLCWPRFDSPSI
FT                   FAALLDAERGGRFQVRPTQDVSSLERRYMGDTNVLETTFTTETGVLRLTDLMPVGPPEA
FT                   YRRELWPTHEILRRVECVEGTVPVQVACEPQVEYAQLDLSFEDRGAHGFFYNYDGAVLI
FT                   ARSEVPLTPSPGQNALYGEQTLRAGDRRFLSLTYDDEAPAVLPLLGDHAQRKLARTINY
FT                   WRDWAGQCEYDGPYRDAVVRSALTLKLMTFAPSGAIVAAPTTSLPEAIGGERNWDYRYC
FT                   WLRDAALTLRALYELGYEDEGRAFFSWLLHTTRPTAPELQVMYDVHGNTNLTERTLSHL
FT                   EGYRQSPPVRVGNGAHDQLQLDTYGELISAAYEFVRREHELDPWHRRLLVSLGNEVCAR
FT                   WEEPDEGIWEVRSGRHHHTFSKAMCWVALERLLALHEEGYVTVPVDRYRTEAAHIRAAV
FT                   EEQGYNEEKESYVATFGGDRLDASLLLLPTYGYKEATSPRMKSTFARIHEELAQNGLLH
FT                   RYPPDTDDGFTSEEGAFGLCSFWDEEMFARLGRLDEAREKLGETIGYANDLGLFAEEID
FT                   PETGAFLGNFPQAFTHVGLINAAITITKAEEEAPTALHEQPDPQ"
FT   CDS_pept        569533..570042
FT                   /transl_table=11
FT                   /locus_tag="SRM_00464"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00464"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23385"
FT                   /db_xref="GOA:D5H5T0"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T0"
FT                   /protein_id="CBH23385.1"
FT                   /translation="MTSLLALNVGSALLWGLFATGLLTLLMSGSQGLGWSRISFPYMIG
FT                   SMFTSHRGRAMGIGFLVHLAVGMSFALLYALVFESWQWATWWLGGLLGVFHGLFLLAVL
FT                   MPALPDLHPRMASTHHGPTPTRQLEPPGFLALNYGRSTPVLTIVGHIVYGMLLGLFYPL
FT                   GGGGLL"
FT   CDS_pept        complement(570148..570645)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00465"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00465"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23386"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T1"
FT                   /protein_id="CBH23386.1"
FT                   /translation="MRTPSSGLLFLGLVFALLGCGDSATEKASEDVQQLAQRLYSEVGT
FT                   PEINNFQEYKFAKQIMEMRDERITTYTYHVDRNGRRHFICKSIGYGLPYSTQLTNPNQF
FT                   QNGLGEAANTLPQREPNGLYMPNNVDATWVLCADGAGGVEPVYSEPKLFVSPVPIDSLA
FT                   GR"
FT   CDS_pept        complement(570724..571071)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00466"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00466"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23387"
FT                   /db_xref="GOA:D5H5T2"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T2"
FT                   /protein_id="CBH23387.1"
FT                   /translation="MSDDSFLDSIRFSVTAALSLLAFVTILVGGGYYVYRWAAPKYEEA
FT                   QRETYEQSRQHVEGTVEDLMRYRVKYQEADSTHKDAVRKLILRRARDIDRADMPKDLRQ
FT                   WVEHLRTRTDP"
FT   CDS_pept        571291..572463
FT                   /transl_table=11
FT                   /locus_tag="SRM_00467"
FT                   /product="microsomal dipeptidase"
FT                   /function="# Hydrolyzes a wide range of dipeptides.
FT                   Implicated in the renal metabolism of glutathione and its
FT                   conjugates. Converts leukotriene D4 to leukotriene E4; it
FT                   may play an important role in the regulation of leukotriene
FT                   activity. In lung tissue, it may terminate or significantly
FT                   reduce the leukotriene induced signal for bronchospasm."
FT                   /EC_number="3.4.13.19"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00467"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23388"
FT                   /db_xref="GOA:D5H5T3"
FT                   /db_xref="InterPro:IPR008257"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T3"
FT                   /protein_id="CBH23388.1"
FT                   /translation="MVRLLLYVLIGFAALVVAGYFTVAAPIADARYNTVQAEPPYDPSG
FT                   RAQALHDTLMVADLHNDLLLWGRDPLTRHDRGHTDVPRLRAGGVGLQVFAAVTQVPRGR
FT                   SYAGTDADALDQIPFLAAAQRWPVRTWTSRLERARYQAKKLRRAAARDGALFLLRTRAD
FT                   LDALLARRRTKGAAMGTLLAVEGLHALEGEAAHVDTLVDDGYRMMSLTHMHDNALGGAS
FT                   TGLDKGGLTGYGAAVVDRLVARNVTIDLAHASEALIDDVLARTRGPVVVSHTGVRATCD
FT                   SPRNLSDRHIKAVAARGGVIGVGLWETAVCGTGPAAVAASMRHVADLVGVEHVALGTDF
FT                   DGTVSVPFDATGFPLLTEALLAEGFSPRDIEQIMGANVVRVLRQSLPPAE"
FT   CDS_pept        572591..574873
FT                   /transl_table=11
FT                   /gene="cirA"
FT                   /locus_tag="SRM_00468"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00468"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23389"
FT                   /db_xref="GOA:D5H5T4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T4"
FT                   /protein_id="CBH23389.1"
FT                   /translation="MVAGCSKLLRGRRACGWRIVAGIVLLGLVPLGAMAQGTGAVTGTV
FT                   VDAADGAPLVGATVRLRAAAAPTVVQRGVTGETGTYQLDRIRPGRYVLEVTSLGYQRRH
FT                   VHVTMEVGESRSVDVELRRDAFGLETIVEAPSRTRQRLLEAPASTTVLEPARIRREATT
FT                   SSVEALRTAEGVDVAQTGIDRREVALRGFNSAVSAGPHVRTDHREARAPALGLNLYSVM
FT                   PNTTLDLDRIEAVQGPAGALYGTGVDGGVLHFVTRDPFRDPGTSFALSGGSRRYLNAQF
FT                   RQAGVLGGAVGYKFTGQWGRADEWGLDPENARDVAELGRYRVYEDPESPALEGRNFVVR
FT                   DVDGDGSAEAQLRREDRYRRYNVNGLLRYRFDRTTSLSLRGGYASLTSPLQSPIGTLQA
FT                   SNLGYTYGQLRLDAGDLSAQVGLDRNLSGDGTYLYRTGNAITDEGTRVDGRMQYAFGVD
FT                   RLNTEVLVGSALDVTRLQSVPGGTTPDEEAFSTFGTYLQTITPLAPSVSLTLAGRADYL
FT                   SVREEVQFSPRAALVYTPAPKHALRVSYNRTASVSSASPLLQLAPEVSAPPRATVTQTL
FT                   EVGYKGQVADRLRIGVDGYYETRDDVFVPVGIPVEYQNGGTISYGGFDVSTELRASDAL
FT                   TLFGTTSVVSDDSFEGGAGRGDIALNAPAFKGKGGVDCGLPYGTTIGATVHHVDDFPVR
FT                   FGPYTGTVDAYTLLDVRLRSSLPAVPGGSVNVTAQNVLGNAHREFVGSPALGRMVVARL
FT                   TYELPSP"
FT   CDS_pept        575075..575449
FT                   /transl_table=11
FT                   /locus_tag="SRM_00469"
FT                   /product="NADH-ubiquinone oxidoreductase"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00469"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23390"
FT                   /db_xref="GOA:D5H5T5"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T5"
FT                   /protein_id="CBH23390.1"
FT                   /translation="MFGDFVPLFLMIALALGLALTLLAAAAYIGPSRPSGTKTMPYESG
FT                   MDPVGSAHERYSVKFYLVAMIFIVFDVEVVFMWPWAASFHSFVESGAGLGVIAVISLFT
FT                   LILLVGLLYDVKKGGLDFEQ"
FT   CDS_pept        575645..576286
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="SRM_00470"
FT                   /product="NADH-quinone oxidoreductase chain B"
FT                   /function="NDH-1 shuttles electrons from NADH, via FMN and
FT                   iron-sulfur (Fe-S) centers, to quinones in the respiratory
FT                   chain"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23391"
FT                   /db_xref="GOA:D5H5T6"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T6"
FT                   /protein_id="CBH23391.1"
FT                   /translation="MAGSSGTNGQGFFTTRVDTFLNWARSNSLMPMPMGLACCAIEMMG
FT                   FAGPKYDSARFGSEAMRFSPRQADLMIVAGWCSYKMSHAIRRVWDQMGDPKWCIAMGAC
FT                   ASTGGMHRCYGVVQGVDNFLPVDVYISGCPPRPESVLHALMDIQEKIRNEYSVVQDYEF
FT                   GKARERAPIMPENTNRFPGQLEKPKTSTLTLEAPDADDAEEASTPEPVAA"
FT   CDS_pept        576319..577074
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="SRM_00471"
FT                   /product="NADH-quinone oxidoreductase chain c/d"
FT                   /function="NDH-1 shuttles electrons from NADH, via FMN and
FT                   iron-sulfur (Fe-S) centers, to quinones in the respiratory
FT                   chain."
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00471"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23392"
FT                   /db_xref="GOA:D5H5T7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T7"
FT                   /protein_id="CBH23392.1"
FT                   /translation="MQDGVRAPATPQHDGVPMSKPDNPRDENPKNPEELRFHYTPTDEP
FT                   GAEQETENAHAKDTTRVPAVIDALREEFGAAVLDVERYANEDTVYVEKNRIREVCRFLK
FT                   EEEGFDYFVDLGGIDNFTAEDRYEVFYNLVSTERQKRLRLKVQVDEGDMQVPSVTEVYR
FT                   AANWNEREAYDMFGFSFVDHPDPRRMYMPEDFDYHPLRKEFPQLGIPGSLPLPPQTPDG
FT                   DLTMDPFAAAHGSQPVKSYEEPATDPDSE"
FT   CDS_pept        577130..578485
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="SRM_00472"
FT                   /product="NADH-ubiquinone oxidoreductase, chain 49kDa"
FT                   /function="Transfer of electrons from NADH to the
FT                   respiratory chain. The immediate electron acceptor for the
FT                   enzyme is believed to be ubiquinone. Component of the iron-
FT                   sulfur (IP) fragment of the enzyme"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00472"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23393"
FT                   /db_xref="GOA:D5H5T8"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR014029"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T8"
FT                   /protein_id="CBH23393.1"
FT                   /translation="MPQTQKPDFPGNDLGDQFRFWPKHNEKIYERLENKHAWLEEKRAA
FT                   AQGDGKPPATQRSEVDPLENEMILNIGPQHPATHGVLRCVVKMDGETIEKSVLDIGYLH
FT                   RGIEKLAEHKTYQEFMPYTDRMDYLSPYSNNVAWCLAVEKLADIEVPERAQWIRMIMSE
FT                   LARISSHCLWLGVGMMDAGAVSGFVWTFQEREEIYSIMDEVAGARFTVSHSRIGGVAND
FT                   FSPRAIEMIRDFVDTFPDRIAGWEGLLNKNRIWVERNKGVGRVTKEEALELGLTGPNLR
FT                   GSGVPYDVRRFEPYLKYDEVDFTIPVREEGDCLARYFLRLDEMKQSVRIIEQCLDRMTE
FT                   GPIRSDDAKEAYPSKEEVYYSMEGMIHDFMYTDVGTVPPKGAHSYHAIEGPKGELGFYL
FT                   TSDGTGRPWRVRINAPSFTNLQAMEHMLEGEMVADTVVIIGSLDPVMGEADK"
FT   CDS_pept        578583..579260
FT                   /transl_table=11
FT                   /gene="nuoE"
FT                   /locus_tag="SRM_00473"
FT                   /product="NADH dehydrogenase (ubiquinone), 24 kDa subunit"
FT                   /function="# Transfer of electrons from NADH to the
FT                   respiratory chain. The immediate electron acceptor for the
FT                   enzyme is believed to be ubiquinone. Component of the
FT                   flavoprotein-sulfur (FP) fragment of the enzyme."
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00473"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23394"
FT                   /db_xref="GOA:D5H5T9"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="InterPro:IPR042128"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5T9"
FT                   /protein_id="CBH23394.1"
FT                   /translation="MSSFDVQQPIVELPDQDPDPAFSDDELVWTDEEEAQIEAWKDQYP
FT                   EDQAAIMKVLWLAQEKFGYLAPEVIQLCADTLDMTFTQAYGVATFYHQYFKEEKGTYVL
FT                   DVCTCFTCQVCGGYDVLHYLEEKLGVHAGETTDDGMFTIQEAECLGSCGSAPMMEITNG
FT                   VYVHNLTPDKIDDLVESLRAGEVPSFTSMTLPQDEEELDGNRRTDVENTETYQTQPRAE
FT                   HTE"
FT   CDS_pept        579364..580725
FT                   /transl_table=11
FT                   /gene="nuoF"
FT                   /locus_tag="SRM_00474"
FT                   /product="NADH:ubiquinone oxidoreductase, NADH-binding (51
FT                   kD) subunit"
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00474"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23395"
FT                   /db_xref="GOA:D5H5U0"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U0"
FT                   /protein_id="CBH23395.1"
FT                   /translation="METNGTPQSPAGDWRSYERMLLPPIQDLHKLGVYEEHGGYDRLRR
FT                   VLEDDAFEPSDVTDEVKASGLTGRGGAGFPTGIKWTFMPEPDERPRFIGVNADESEPGT
FT                   FKDRQVMEYNPHLMLEGILLAGYALHIDTAYVYIRGEYTDWIVHLKEQLENAYEAGYVG
FT                   ENIMGSDFTMDIVLHKGAGAYICGEETSLMESLEGKRGYPRYKPPFPAQSGIFGSPTTI
FT                   NNAETLAHVPLIVEQGGEAYSNIGAGDMPGPALYGMSGHVKNPGVYEFPTGMLLTDMIY
FT                   DVCGGMARDKDLKAVVPGGSSVPPVPADQIDGISMNDESLGEVGSRTGTFCPLVLDEET
FT                   DMVSFLRRVAHFYQDETCGQCTPCREGTSWLEKILARIDEGEGRMRDIDLLLELCDNMD
FT                   GGRTICAFADGAVGPVRATVKRFREEFVAKCQASVHPVSTEVSAGAESAVAATE"
FT   CDS_pept        580780..581220
FT                   /transl_table=11
FT                   /locus_tag="SRM_00475"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00475"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23396"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U1"
FT                   /protein_id="CBH23396.1"
FT                   /translation="MLRCAAVLLGGALLAACGTGETETNATGAEETRGTLVDATAALPA
FT                   SAVAAEAGVYEGRPVTVDGRIAAVGATGCEVTLTTGSRPLVVAAPRTEADGCAWTVPGA
FT                   AQGFAVAAGTLRIADDTLRLTANGVRVTPVRISDAGPSGPSP"
FT   CDS_pept        581445..583184
FT                   /transl_table=11
FT                   /gene="nuoG"
FT                   /locus_tag="SRM_00476"
FT                   /product="NADH-quinone oxidoreductase chain G"
FT                   /function="NDH-1 shuttles electrons from NADH, via FMN and
FT                   iron-sulfur (Fe-S) centers, to quinones in the respiratory
FT                   chain. Couples the redox reaction to proton translocation
FT                   (for every two electrons transferred, four hydrogen ions
FT                   are translocated across the cytoplasmic membrane), and thus
FT                   conserves the redox energy in a proton gradient"
FT                   /EC_number="1.6.99.5"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00476"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23397"
FT                   /db_xref="GOA:D5H5U2"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U2"
FT                   /protein_id="CBH23397.1"
FT                   /translation="MPIVTVDGTTYEYEGEQKLLQFCLNQGIELPHFCYHPAMSIPANC
FT                   RQCLVKVGMPKEDRETGEVVRNEEGEPEIQYFPQLQASCTVDLQDGMVVKTHRTSEEVE
FT                   QAQTDNLEFLLTNHPLDCPICDQAGHCPLQIQSYKYGPEGSRFEFRKVHKPKRVKLGPR
FT                   VTLDAERCINCTRCTRFTDEVSESNQLTIANRGVKNYPITAPGETFDDPYSMNTIDICP
FT                   VGALTSSDFRFKARIWEMSSTPSITTTNATGANCHYWVRDNQVLRITPRQNMEVNEYWL
FT                   PDEDRLVYNQFNDNRPEGPHIRRDDTRTQSNWTQAYARAASLLGSADPERILFLGSAYA
FT                   TVEDNYLLTRLVDAVGADAPRYIPHVEPGAGDDWLITDDKTPNAEGCERLGIRPVDEEL
FT                   VGSRIASGEYDLVYMLEDDPVGAGLCDAEALADTDVVLHYYNTTNETLPRATAALPAAM
FT                   VVETVGTYVNQDGHAQRVRPAKEIQGVNRTLMMEMGTNREDEHGTPFDRWHNDENRINC
FT                   KPSWEILPEVARRYGAEMDYPKGPEQIMDEVQSEVDAFEGVTYDAMGLKGVPLEDVAAG
FT                   EAV"
FT   CDS_pept        complement(583441..583809)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00477"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00477"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23398"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U3"
FT                   /protein_id="CBH23398.1"
FT                   /translation="MPIMIAKGPIMIAKGPIMIAKGPRASQAKVASEQIADIGYCSSKD
FT                   TFYHGTKLHVVAERRSDTLPAPKRIGLTSASENDLKALRRVLPTIENGILCGDKAYCDG
FT                   PLKERLVEDQNLELLTPT"
FT   CDS_pept        complement(584330..584443)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00479"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00479"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23400"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U5"
FT                   /protein_id="CBH23400.1"
FT                   /translation="MTLASTDPIAMVTAQSKALPFEKICSPTSQAYRMCNP"
FT   CDS_pept        584427..584810
FT                   /transl_table=11
FT                   /locus_tag="SRM_00478"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00478"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23399"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U4"
FT                   /protein_id="CBH23399.1"
FT                   /translation="MLASVTLWQKPTLLEGAVTMGMLFTLQFVVGNLHKRVPGVTRLVD
FT                   TRRPLLMDGTEVLCDNLRRANVTEADLRAKLREANVTRWSQVRAIVMELTGDVSVLHAP
FT                   PDAPPIDKSLLAGGGTGPDRESG"
FT   CDS_pept        584904..585554
FT                   /transl_table=11
FT                   /locus_tag="SRM_00480"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23401"
FT                   /db_xref="GOA:D5H5U6"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U6"
FT                   /protein_id="CBH23401.1"
FT                   /translation="MSQIEYLIPLVSIIVGLGLSDLIQSVRELVRPNRAVRWHWLPVLW
FT                   SVTVFLLVLQIWWTSFGVLQEAAFGRVLVFLPYLLMFLALYLACAFALPDSDWTPGTTP
FT                   ESPAQKSGTSPASTSALDLEVFYFSASHRRWFFGTLIAIIVLFESITVFFLLVEMDATL
FT                   LSILAGRWVALSVVPAVLALPIVTDRRWVHGALGLLAFGGAVFSPFQASPIGG"
FT   CDS_pept        585671..587374
FT                   /transl_table=11
FT                   /gene="nadE"
FT                   /locus_tag="SRM_00481"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /function="an use both glutamine or ammonia as a nitrogen
FT                   source"
FT                   /EC_number="6.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00481"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23402"
FT                   /db_xref="GOA:D5H5U7"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U7"
FT                   /protein_id="CBH23402.1"
FT                   /translation="MQIALAQINPTIGDLEGNREKILDYARRADDCGADLAVFPELCVT
FT                   GYPPEDLLENPFFKRAVQRTVDHLAQALPSDLGVIIGAPVPNGDRFGKPLHNAALLLEN
FT                   GAVQDRVYKTLLPTYDIFDEDRHFEPAEERRLLEWRGLRIGLHVCEDMWNVHQPEGVDQ
FT                   SERYERDPVAELAALDPDLFVNISASPFSIGKHEVRDKLVEHICRRHERPFLLCNQVGA
FT                   NTEIIHDGDSRVHAADGTQVACAASFEEDLLFWDTESSPEACTTGRDAIADLHDALVLG
FT                   VRDYYEKTGIFDKALVGLSGGIDSAVTCALAVEALGPERVVGVTMPSEISSEGSVTDSQ
FT                   ALADNLGIEFKEIPIKPAVDAFDDMLADEFAGTEPGVAEENVQSRARGVTLMALSNKFG
FT                   HLLLSTGNKSEVAIGYVTLYGDTNGGVAVLSDVLKTRVYELARHINVRAGENVIPQNTI
FT                   EKPPSAELRAGQKDTDTLPPYETLDAILKRYVEQKKELGTIVGETGLDEDLVRGVLRQV
FT                   DQNEYKRRQAPPGLRVTEKAFGIGRRIPIVMEWDREAMEALAAEEPVSNL"
FT   CDS_pept        587438..588175
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="SRM_00482"
FT                   /product="lipoprotein signal peptidase"
FT                   /function="# This protein specifically catalyzes the
FT                   removal of signal peptides from prolipoproteins."
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00482"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23403"
FT                   /db_xref="GOA:D5H5U8"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U8"
FT                   /protein_id="CBH23403.1"
FT                   /translation="MRVFWIAGAVVLLDQATKATVLQFMYREQSIPLLGDWLRLTFTEN
FT                   PGMAFGITIGPPGTVTVLSLLATMLVGAYIYQVRNDYAPYRWSLAFILGGALGNIIDRV
FT                   FYGVLLDYGPYFTGRVVDFIHVSLWQGFIPRIIPVFGGAYMELFPIWNVADMSIVVGVV
FT                   GVMVFHQAFHERRIAKRRAARADGRTWRRPAAVFSDLDLEAPPPAPSALTQPDAPASRG
FT                   EAASGSGAASASARSSAVSEPHP"
FT   CDS_pept        588264..590147
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="SRM_00483"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00483"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23404"
FT                   /db_xref="GOA:D5H5U9"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5U9"
FT                   /protein_id="CBH23404.1"
FT                   /translation="MQPTGPAAPRPFTGRPSDGLSCLMPDLSTIRNFCIIAHIDHGKST
FT                   LADRLLERTGTITEREMKEQTLDDMDLERERGITIKSHAVRMAHTAPDGQEYTLNLIDT
FT                   PGHVDFTYEVSRALKACEGAILLVDAAQGIEAQTISNLWLALEQDLEIIPVINKIDLPV
FT                   ARPDEVAQALEDLIGEPAEDILQISAKTGEGVDEMLDLMIDRVPPPSGDPDAPLRALIF
FT                   DSIYDSYRGSVVYARVFDGTLEAGDTMEFMSNKKQYDAEEMGILRMGRQKVDTFTAGDV
FT                   GYIIGSIKDIQDARVGDTITTAHDPAEEPIPGFEEVKPMVFSGIYPTETDDFEELRGAL
FT                   EKLQLNDASLTYQAESSSALGYGFRVGFLGLLHMEIIQERLEREFDLDIITTVPNVEYE
FT                   VEVEEKGEPKTVTVDKPEDMPHYGDIEAVHEPYVKADIITPSDYIGNVIELCEKRRGEY
FT                   GSQRWLDGQTVKLEYELPLAEIVFDFYDNLKSASRGYASFDYELLEYRESDLVKLTILI
FT                   DEKPAEPLSTIVHRDSAHEVGRKLAKKLKDVIPRQLYEVPVQASIGSRIVARETIKAQR
FT                   KDVTAKCYGGDVSRKKKLLEEQKEGKKRMKQMGEIDVPQEAFLAILSVDED"
FT   CDS_pept        590234..591106
FT                   /transl_table=11
FT                   /locus_tag="SRM_00484"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00484"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23405"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V0"
FT                   /protein_id="CBH23405.1"
FT                   /translation="MRHPPGWHPQEALRSGALCAVCVVGWALLTVGGVGPAAAQTTGGD
FT                   ASLVERYQNERYRALARRHLRQKGTWPAHPPVQLPTPTDSLHLVRPSAPSPTAQLPSFP
FT                   LDDVRPVRHLEREWFRSRFADAEWAFLGGTADYTFLDTTRTPALRARLQAEFGDPTQTL
FT                   ADAPIEDSLAGRPQFEYWFVVNDSIPVQVMDGRGPQGRGLIVAADRAYRHRLRGLRDTL
FT                   LAPLQDAGPAPHVDYYYDERRRRWYRTGYDGRSFFLTPISRGAIVPGRRPRLDTTRTSD
FT                   ASASSPPSP"
FT   CDS_pept        591161..592339
FT                   /transl_table=11
FT                   /gene="lepB"
FT                   /locus_tag="SRM_00485"
FT                   /product="signal peptidase I"
FT                   /EC_number="3.4.21.89"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00485"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23406"
FT                   /db_xref="GOA:D5H5V1"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V1"
FT                   /protein_id="CBH23406.1"
FT                   /translation="MSTDDSSRDADARKSELRQWGESLVVAVVIVLIVRSLLFDLFRIP
FT                   TPSMEENLLVGDYLVVSKLHYGPRTPVSLGIPLTSIHLPGVTFPYHRLPGFSEVQRGDP
FT                   IVFNYPPDDEPIDRKVHYVKRVIGMPGDTLSVRDKLVHIDGDPLPLGRGMQQYWTVTKS
FT                   DARYQIPRRRMEEMGISEVRRTNRAETVRVLATPEGAKQMRQRSWVRSIEPYVLNSDEY
FT                   NDLMYPSGRGYTPDNYGPVHIPAKGTTVKLTDRNWALYRPVIVRYEGHDARQMTDSTFA
FT                   IDGARTSTYTFQQDYFFAMGDNRDNSQDSRFWGFVPMDHVVGKAVLTYFSWDHEAWLPR
FT                   FGRILRPIADAGVFREQPVMNELSGGQTAGVPLPDSSSRARPPVVTDRFPAR"
FT   CDS_pept        complement(592403..593380)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00486"
FT                   /product="conserved hypothetical protein containing
FT                   ErfK/YbiS/YcfS/YnhG"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00486"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23407"
FT                   /db_xref="GOA:D5H5V2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V2"
FT                   /protein_id="CBH23407.1"
FT                   /translation="MHAHRTLLLVGLGLLLFLTGLSSPAAAQGYFDQYAIENILARQAD
FT                   NLNDLPEVYYEYAVLDDPSGNSVVARDRFYQRIGEGSSETGRKRSQLVELLNRQTVENT
FT                   PLGDTLVVPTEFGLDFRAYSPFPRYYPEAHRIKKLFVIHKTVQAFAAYEYGRLARWGIV
FT                   NTGNPDSTATPTGRFNFNWKEKKRVSTMSPPGEEWTMRWVFNFHAARGIHIHQYSMPTG
FT                   GPTSHGCVRLVDADAEWIYDWAEPWQTTKGHMGPSSGRGRLIEPGTMVLVVGDDPEGSP
FT                   RPFEYRAQYPVLKRVELPSSPYDVPAGTNQQEMWDRLREQRASR"
FT   CDS_pept        complement(593463..594698)
FT                   /transl_table=11
FT                   /gene="trkA"
FT                   /locus_tag="SRM_00487"
FT                   /product="potassium channel, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00487"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23408"
FT                   /db_xref="GOA:D5H5V3"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V3"
FT                   /protein_id="CBH23408.1"
FT                   /translation="MQRGPQLCTGHSSCGFCVAWRAASRGARRRKPNNPPYATRNAWGA
FT                   PSPLLSPAPSTLTPDRLMAFIRTPWEALISWLARMEPSRREIFLAALALVLLFAVGTAG
FT                   YVLLEGWSVADGFYMTFITLSTIGFQEVSPLSDVGRFFTFGLGTTGIGILSFVAVRSAQ
FT                   LLLVSDRLRERRIMKRIDALSGHYVVCGYGRVGERLTEDLIQEGETVVVVDTDEEICAS
FT                   LSEAERLHVQGDAEDEGTLRAAGIERARGLILTLPEDSSNVFVALTAREMNPDLFVLAR
FT                   TIDHDNRSKLRNAGADKVIAPSEVGADRMAQVVLRPHTDDFLERVLHTSALSRQIDEVQ
FT                   IHKNAPLAGQTLAESNFRQQFDAIVIGIIDADTGAMTFNPSPTERIDAGDILIVLGETE
FT                   IIDALRERVCLP"
FT   CDS_pept        complement(594717..595358)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00488"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00488"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23409"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V4"
FT                   /protein_id="CBH23409.1"
FT                   /translation="MTGAARPRSPGPVGPRAPHKQLTGSSLQERHARFFSPSPLRPMAD
FT                   PPAFSALPDDARLWIHATAAPLDDATQSALLDRLSAFMDGWTSHQQPVEGAATILDDRF
FT                   LVVAAAPVGGGDISGCGIDDLAHAIDDAASALDVDWVPSLHVLYRTADGGVAAVSRRTF
FT                   QQRAGDGAVTADTPVFDPSLTTLGALREGAFEAPARESWHAQLLGTPAAS"
FT   CDS_pept        595381..596253
FT                   /transl_table=11
FT                   /locus_tag="SRM_00489"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing DoxX domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00489"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23410"
FT                   /db_xref="GOA:D5H5V5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V5"
FT                   /protein_id="CBH23410.1"
FT                   /translation="MKRRWRAAHKHPPSDDLFAPCVKCTVPAMSRYRDVVDWINEHRTV
FT                   ALDLVRVYLGIGLFVRGVLFAYESQGVGALVDLSAFSFASAALAHYVTFAHLVGGLLLA
FT                   AGLLTRLAALVQIPILAGAVFLVHLEQGLLSANQSLEFSALVFVLLLIVFVFGPGEWSA
FT                   DRYVFEREPELQDEAPELWWRDEDFERKPGPEPTENGGGVAVASASATSTKEVLAERVD
FT                   EEPCACGHDLTHPRVAVEPQYGWSAGFFFMLGVSAPLREVVFYCEECGTVMKRTRDPEV
FT                   LRRYRWHTS"
FT   CDS_pept        596355..597554
FT                   /transl_table=11
FT                   /gene="rssA"
FT                   /locus_tag="SRM_00490"
FT                   /product="phospholipase, patatin family"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23411"
FT                   /db_xref="GOA:D5H5V6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V6"
FT                   /protein_id="CBH23411.1"
FT                   /translation="MSEESSDGTVDPDPNGSAEAPAALVLGGGGARAAYQTGVLHYVGE
FT                   AFPDASMPLMTGVSAGSINAAHLAADPGPWKARTARLVRYWEGLTADDVFAPRSPWAIA
FT                   RSMLWGRPSKTQTLLDTSPLRAYLDRRLPTDDAGRLTGVADNLEAGRLKGLAISTSNYA
FT                   TLQTVTWVQGCSMHDWERPNRVGRRARLGLDHVMASTALPMVFPAVRLDDAWYGDGGLR
FT                   MLDPLAPAVHLGADRLFVVSTRYERSQAEANRSARTPAYPSLFQMMGILANVLMLDVLE
FT                   HDAAVLRRINRLVRKLRPGKHEPLRPIDLLVLRPSVDLGALAGDYQMDLGGAMGTLLSS
FT                   VQWRTDPPPDWWSMLLFQPDYLDRLLEIGYNDARRQHDRIEAFFAREPVDQSTSTFFRS
FT                   "
FT   CDS_pept        complement(597524..598084)
FT                   /transl_table=11
FT                   /gene="dfrA"
FT                   /locus_tag="SRM_00491"
FT                   /product="dihydrofolate reductase"
FT                   /EC_number="1.5.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00491"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23412"
FT                   /db_xref="GOA:D5H5V7"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V7"
FT                   /protein_id="CBH23412.1"
FT                   /translation="MAFSSASLPTFDLAAALMPELVIIAAVAEDNRVIGQDKDLPWHIP
FT                   EDLKRFKQLTTGHPLLMGRRTFESIVHQFGGPLPDRKMVVLTTQDDYEAYPEVDTYASV
FT                   DAALAALPDDATVFIGGGESVYEQFLPHADRLELTLVEGAYEGDTFFPPFEHLIGDVFE
FT                   ETAVDARDGFRFVTYERKNVDVD"
FT   CDS_pept        complement(598085..599668)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00492"
FT                   /product="Putative amidase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00492"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23413"
FT                   /db_xref="GOA:D5H5V8"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V8"
FT                   /protein_id="CBH23413.1"
FT                   /translation="MTGDFGSLFFGSGPAVRRPNGISRPVPPYEHGFVGFCLPVSRNVP
FT                   DLTSCSAVELARRIRAREVSAVEVLEAHLDRIERQNPAVNAVVTLDAERAHARANAADA
FT                   ALARDEVWGPLHGVPFTVKDQFSTAGLRTTYALPHYADFVPAADAPQVACLKEAGGVLM
FT                   GKTNLPLAAYDWQCDHPNFGRANNPWALDCTPGGSSGGSAAALAAGLTPLELGADVAGS
FT                   IRIPSHFCGVTGLRPTEDGPLRGIRPPDRPATVRHIAVAGPMARTVEDLQLEWAALCGA
FT                   DPAASVPATPSPDALRIAVTPELGGVPADTDTQRVLRDATTAWGAAGCEVKRRPAPFDV
FT                   EDAFDTWARIQGFELTAGLPAPLRTPPLKQLVWQGYVRSKFGSLAGRMAKGASLGPRGY
FT                   FQALDRRAALADGLDAFFDDWDLWVTPVAATPTFTHRPTGAARTLEGVSVPYALPIAPY
FT                   NCPTAVLGHPILTLPAGRTPTGRPIGLQVHARHGADATLLAAGRRLEAVLGRDPAPASL
FT                   AEAPRTDDSA"
FT   CDS_pept        600081..601214
FT                   /transl_table=11
FT                   /gene="lytS"
FT                   /locus_tag="SRM_00493"
FT                   /product="Sensor protein lytS"
FT                   /function="# Member of the two-component regulatory system
FT                   lytS/lytT that probably regulates genes involved in cell
FT                   wall metabolism."
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00493"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23414"
FT                   /db_xref="GOA:D5H5V9"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5V9"
FT                   /protein_id="CBH23414.1"
FT                   /translation="MNTLVRADTLPTIPPTMSRRHAYWICQLGGWTGYSVMRLTLYSFF
FT                   QTITWKWGVSYAVFIAAGVLYTHLYRRLAKRREWTQMSLGQLAPRVVGATLTVALLLHL
FT                   TMDGVGRYVLELDFYEEVQSEIGMLLASVVNMWILLMLWSLIYFGVHYFWSYRQAEVDK
FT                   WKLEAQAETARLKALKLQLNPHFFFNSLNSVRALIAEDPDGAQRMVTRLARLLRSTLQA
FT                   DDMKTVPLEEELSTVRTYLKLEKVRFEDRLRHRIEVDDEARSHPVPFMLVQTLVENGIK
FT                   HGVACCQEGGVITVRGRVVDGALHIRVTNPGTLDTEEGGTGLDNARERLRLLFGTEASL
FT                   TVENADAETVSATAVLPVRAVPESPVVQGEVSLAARD"
FT   CDS_pept        601275..602030
FT                   /transl_table=11
FT                   /gene="lytT"
FT                   /locus_tag="SRM_00494"
FT                   /product="two-component system, regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00494"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23415"
FT                   /db_xref="GOA:D5H5W0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W0"
FT                   /protein_id="CBH23415.1"
FT                   /translation="MASPPVLRTLIVDDERLARRELRRLLEPHEAVTVAGEAANADAAE
FT                   AAVHEKNPDLLLLDVQMPGDSGFDLLTRLDAVPHVVFVTAYDEYAIRAFKVNALDYLVK
FT                   PVEPERLAQAIETVQARAAEDGPQAAGAGDEESRSPLTAEDQVFVKDGERCWFVRLADV
FT                   RLFEAAGNYTRLYFDGEEPLTHRSLSYLEERLDPDRFFRASRQHILNLRWVADVTPWAT
FT                   DKLKATLEDGTEVELSRRRSRAFREQLSL"
FT   CDS_pept        602221..605199
FT                   /transl_table=11
FT                   /locus_tag="SRM_00495"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00495"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23416"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W1"
FT                   /protein_id="CBH23416.1"
FT                   /translation="MAQTPTRKRAMTPRHALCVLLLCGAISLPVQAQSFSMVTGRNHPE
FT                   IDWRVATTEHFEIVHPARLGDIAAEAAPIAEATYDTLSATLDVAFDERIRVYLSDQDAI
FT                   VNGFAVPFGTGYTDIWVNTNDWAASFSGATSWLRLVLAHELTHIFHYEAARSGLGVWAL
FT                   ALGGSFPRVWTEGLAQYQAETWNAQRGERWLRAAVLDDALAYDDGRSLWNGRLLYASGH
FT                   SQVRYFAQQHGDSTLTDLLHHKTDVLFGLAEVHDFEAAFRATAGQSYETFYEQWRRDVN
FT                   VYYNTLASQLETLDSLQTDTLAVPGRYVDGLAYSPDTSRIAALTQHSPARPVRRLHVID
FT                   PSTGAVTRGAEGAIEPPVAWHPSGERIAFSRRTRAAHGSLVDDVFVVDADGTDERRLTH
FT                   GRRTSAPTFGPDGDRLAFVATEGGTANVHLRALKTGGTTRVTDYEGDVQITALRWHPTQ
FT                   DTLAFARVSEAERELVLYDLDTGASTALTDPATDDRRPVWSPDGSQLAYTSLRDGVPNA
FT                   FVYDLSTHTHRRATHLVRGATVHDWVPADSAFGAESSRAAPEGALVTSTALSKARDGAF
FT                   RLPAHRTARSVAPAVPGQYDDWTTTRPPRTIPQQLAPDPSLIESQGDYDALSNLTHRAS
FT                   GALPYYTSTDNFGIAGVTSWTEPLGTHTFNAAGSVSFTDPDEKSEVVATYLNRQLRPTI
FT                   GLSLFSASSSGRIYGNDLLVEDRTGGALTVRWPLDWHVAPYVSTSFSTRLRYADLNPLD
FT                   PDDFTALGPLSPPQAGQQASVRLQVLRRKKPPSRHTLVHPLDGWGLRLRATGAAEVLGG
FT                   DRSFLRGDVAGYAVYPSIGDHRVFLYGRLQAQTGASFPQDYIGFSRYDAIDLPLPGAVP
FT                   VSLGDAERVRGYRRYVLGTRAAFGRAEYRVPVASSLQTNVLGVIGLGHTTLSAFVDGGM
FT                   VWRDADLRGGTRQLGTGVEVKNALRLFGVRVGHALGVAQPAAQVGTRDEVQLYYRVQTA
FT                   LPF"
FT   CDS_pept        605337..606596
FT                   /transl_table=11
FT                   /locus_tag="SRM_00496"
FT                   /product="Phosphate-selective porin O and P"
FT                   /function="# Anion specific, the binding site has higher
FT                   affinity for phosphate than chloride ions. Porin O has a
FT                   higher affinity for polyphosphates (tripolyphosphate and
FT                   pyrophosphate) while porin P has a higher affinity for
FT                   orthophosphate."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00496"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23417"
FT                   /db_xref="InterPro:IPR010870"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W2"
FT                   /protein_id="CBH23417.1"
FT                   /translation="MSTARPRLFVVLLAVLGGVGIGNLGMAQTGGASGTGGDVQAGKEG
FT                   FRVVSGDGAFALRLRGDLYADARFFSGTTEPAGADRFFLRRARPRLQGRIYDRFAFSIR
FT                   SDFGIGGPEIDDAFVEARFAPALRLRMGRFNVPVGLEVLSSSTGLMHVERGFPAGLVPE
FT                   RDVGLMLAGDAGAGRLHYALGLFNGAPGASEPGGDVDDAKEAAGRVFVVPFAGTDRMWE
FT                   GLGVGLGGTVGTVTGTGATPALTGLRTTGRQSFFGYRDEVRADGRRWRLAPQARLYAGP
FT                   VELLGTYTVTTETARRGPDQETLTHRAWQASAAVVLTGEDAREGEVVPDDPFGAERGTG
FT                   AIELGGRVHGVTFDDEAFPAFAAPTAASGATAWGLTLSWYPNAMVRVMLGMERTGFEAV
FT                   GAGPARDPETLLLTRMQISF"
FT   CDS_pept        complement(606612..607496)
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="SRM_00497"
FT                   /product="thymidylate synthase"
FT                   /function="Provides the sole de novo source of dTMP for DNA
FT                   biosynthesis"
FT                   /EC_number="2.1.1.45"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00497"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23418"
FT                   /db_xref="GOA:D5H5W3"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W3"
FT                   /protein_id="CBH23418.1"
FT                   /translation="MRQYLDYLQDILDHGTRHEDRTGTGTIRVFGRQLRFDLTEGFPLL
FT                   TTKRVWMRGVTEELLWFLRGETNIQSLVQAGVSIWTDWPLQRYRDETGDEISQEAFEER
FT                   IATDDAFAEQWGDLGPVYGTQWRDFEGPEGRVDQIERLVRGLRETPHSRRHVVSAWHPA
FT                   QIEDAALPPCHYAFQCFVEGEPGDGRLSLMWQQRSVDSFLGLPFNIASYALLTRMLAQQ
FT                   AGLTPHELIFNGGDCHIYQNHVEQVEEQLTRTPYDRPTLRLRQRDSIFEHAADDVAIED
FT                   YEHHPALTAPIAV"
FT   CDS_pept        607785..608117
FT                   /transl_table=11
FT                   /locus_tag="SRM_00498"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00498"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23419"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W4"
FT                   /protein_id="CBH23419.1"
FT                   /translation="MSAATRYSTDAAASDMANLDSDIPENKHLKQAINHLEKVLEYAPM
FT                   VAEGRDATVHLTPEDWQVVADALFNMSAPDDTFPDAITDYGLTNENQTITLTTDDYDIE
FT                   IEVVAS"
FT   CDS_pept        complement(608266..608901)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00500"
FT                   /product="Protein apaG"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23421"
FT                   /db_xref="InterPro:IPR007474"
FT                   /db_xref="InterPro:IPR036767"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W6"
FT                   /protein_id="CBH23421.1"
FT                   /translation="MRRGTVNEEQENLDWHPICTRLIQNKGLARWSSTARARESGSVKS
FT                   AAPPLRNSLPAGNNVAVHFSETPSFFRIGSDPLDAVPNAMISYASTTRGITVTVRPIYL
FT                   DEPSDLLEREFAFGYAIQIENTSPNEVQLLRRRWIIEAGNGSRQDLTGDGALRPHPVIA
FT                   PGETHVHDGSCTIESFKGTVEGNYLVQRADGEQFRVSVPPFPLHAAAN"
FT   CDS_pept        608901..609659
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="SRM_00499"
FT                   /product="phosphoadenosine phosphosulfate reductase"
FT                   /function="# Reduction of activated sulfate into sulfite."
FT                   /EC_number="1.8.4.8"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00499"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23420"
FT                   /db_xref="GOA:D5H5W5"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W5"
FT                   /protein_id="CBH23420.1"
FT                   /translation="MAFASDESASPWSSTRLAALNAQFEPHGPKAILNWATHTFGEDLA
FT                   QGTGFGPSGIVIMHMLADLRPGTTVFYLDTDLLFPETYELCDDLDERLDVDVTRVHGGL
FT                   SLDEQAEQEGEELWNRNPNRCCFLRKVKPLRNFLDDRRAWITGVRRDQSERRADTDILS
FT                   WEGQYGVFKINPLANWTQKEVWKYLFEHDLPYNPKHDQGYPSLGCVPCTEPVDQADGYS
FT                   REGRWGDRDKTECGLHTSPGDEDGAHAAES"
FT   CDS_pept        609815..611713
FT                   /transl_table=11
FT                   /gene="korA"
FT                   /locus_tag="SRM_00501"
FT                   /product="2-oxoacid--ferredoxin oxidoreductase, alpha
FT                   subunit"
FT                   /EC_number="1.2.7.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00501"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23422"
FT                   /db_xref="GOA:D5H5W7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR022367"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W7"
FT                   /protein_id="CBH23422.1"
FT                   /translation="MSAPADTTDTKEIPEATVLFAGDSGDGMQITGSQFTLASAYAQND
FT                   LATLPDYPAEIRAPAGTTFGVSAFQLHFGAEEVRTPGEKVDLLVAMNAAALKVHLHRVR
FT                   PGGTIIVNVNAFEEKDLTKADLDQNPLTDGTLDDYQVQEVPLTEITREALSDTDLSLQK
FT                   VDRSKNMFALGLALWMYSRPVEPAQEWIREKFGDKPAIRDANLTVLEKGFHYGETVDAI
FT                   GTRYEVNEAAMAPGTYRAVRGAEALALGLVAASVKSDLRLFYGSYPITPASDILHELSE
FT                   HKNFGVITFQAEDEIAAATSALGASFGGDLGVCATSGPGVALKTETIGLGVMTELPLVV
FT                   IDMQRGGPSTGLPTKPEQGDLLQAVYGRNGEAPLPVLAATSPGDCFHTAYEACRIAAKY
FT                   RTPVLVLADGYLGNGSEAWRIPDTDTLPAFDVDFETEATERTMHKDQDGNDQFLPYVRD
FT                   PETLARAWARPGTPDLEHRLGGLEKEHQTGNVSYDAENHQKMVEIRAQKVQNVTQDIPP
FT                   TQVYGHSDGDLLVLGWGSTKGAIEEATERAVDRGRRVGSVVLRHVWPLPADLADVLGRF
FT                   DHVLVPELNNGQLIRVLRDQYPNRDFTPLNKIQGRPFRAEEIVEKIGSLLERPAPA"
FT   CDS_pept        611866..613230
FT                   /transl_table=11
FT                   /gene="porB"
FT                   /locus_tag="SRM_00502"
FT                   /product="2-oxoacid:ferredoxin oxidoreductase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00502"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23423"
FT                   /db_xref="GOA:D5H5W8"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W8"
FT                   /protein_id="CBH23423.1"
FT                   /translation="MSNDTPDPSPNGQTPDGTKKPDLPPGLADGSDDQDQGASDEETSP
FT                   GTKKPDLPPGLGGENGESDAPGTKKPAGPPGAKKPAGPPSPGSDDDGDDGPTLPPGYGG
FT                   DGAGEALSREDFQSDQEVRWCPGCGDYAILSTVQRLLPDLGVDKENVVFISGIGCAGRF
FT                   PYYMDTYGMHGIHGRAPAIATGLKTSNPELDVWVVTGDGDALSIGGNHLIHVLRRNLDT
FT                   QILLFNNEIYGLTKGQYSPTSDAGTVSKSTPYGSVDRPFNPVSVALGADASFVARTMDR
FT                   DPQHMKAMMRAAHDHDGTGFLEIYQNCNIFNDGAFFEFTERETKDERALFLEHGEPMTF
FT                   ANGTRGIRLDTLQPEVIDLEADDWSVDDCLVHDETSQELGTILGRMSWQDDDGDPIPRL
FT                   DETGTQLPRPFGVIHRTERPTYAERVHQQIDTVTAEQGDGDLDALLRSGETWTIE"
FT   CDS_pept        613388..613798
FT                   /transl_table=11
FT                   /locus_tag="SRM_00503"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing DoxD domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00503"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23424"
FT                   /db_xref="GOA:D5H5W9"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5W9"
FT                   /protein_id="CBH23424.1"
FT                   /translation="MIWTHLSKFRDLGLLLLRGTIGLYMAIGHGWGKILGGPEQWAGLG
FT                   GTMELFGLGFVPTFWGFMAAFAEFAGALLVVLGLFTRPAALLLVINMGVAATAHMTGMI
FT                   DGSPESALVYGFVFLSLVFVGPGKYSVDEIAG"
FT   CDS_pept        614306..615388
FT                   /transl_table=11
FT                   /locus_tag="SRM_00504"
FT                   /product="Amine oxidase"
FT                   /function="Catalyzes the oxidative deamination of biogenic
FT                   and xenobiotic amines and has important functions in the
FT                   metabolism of neuroactive and vasoactive amines in the
FT                   central nervous system and peripheral tissues. MAO-A
FT                   preferentially oxidizes biogenic amines such as 5-
FT                   hydroxytryptamine (5-HT), norepinephrine and epinephrine"
FT                   /EC_number="1.4.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00504"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23425"
FT                   /db_xref="GOA:D5H5X0"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X0"
FT                   /protein_id="CBH23425.1"
FT                   /translation="MSESSSVLVVGAGLGGLVAATDLHAAGVSVRVWEARGRVGGRCRS
FT                   PAVGPDEVRLDLGAAWHWAEHRRVRALAERLGLERVRQHEPGVAVQEWARDEPVEHFEW
FT                   PDAPPPSWRLVEGTQALHERLAATLPDAALRRRHRLRSLRRTGASVQATAQTPNGPQTT
FT                   SVDAVVLAVPPRLAGHTLQFEPALPDALASALRGTTTWMSPSAKAAVTYARPFWREQGL
FT                   AGRVRSAAGPVHDWHDATPPDGPAALVGFMHPPGPDSPTPSDPGEREEALVRQLVHCFG
FT                   EAAGAPTGLATADWRHDTATTPPAGPTPGPHMPPDPAPILQRPHWEGRLHVAAAETATE
FT                   HPGYLDGAIEAGRRAARALA"
FT   CDS_pept        615594..616190
FT                   /transl_table=11
FT                   /locus_tag="SRM_00505"
FT                   /product="intracellular protease, PfpI family"
FT                   /EC_number="3.2.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00505"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23426"
FT                   /db_xref="GOA:D5H5X1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X1"
FT                   /protein_id="CBH23426.1"
FT                   /translation="MSKSILMIVGDFAEDYETMVPFQMLDLAGHEVHAVCPEKEAGDTI
FT                   KTAIHDFEGDQTYTEKPGHNFALNATFEEVDAADYDALCLPGGRAPEYLRLNDSVIEMT
FT                   RHFFAADKPVAAICHAAQTLAAADVLDGRRCSAYPACAPEVEAAGGTYVDVEMNEAVTD
FT                   GNLVTAPAWPAHAAWIRQFLDVLGTRIEHAEPVTA"
FT   CDS_pept        complement(616356..616751)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00507"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00507"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23428"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X3"
FT                   /protein_id="CBH23428.1"
FT                   /translation="MPDDRSAKVIETVADGLRLQVGDLPGDYAPTLLKAEPAAYVVGFT
FT                   AGVSRAMDVPVGNHTIRTLERGCRQGLPRDGDLGQRLADIAAGIVFDGSVTSDPDLTTI
FT                   REDGEEEGRAFVEDRSPPSLLDDLVRG"
FT   CDS_pept        616750..616923
FT                   /transl_table=11
FT                   /locus_tag="SRM_00506"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00506"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23427"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X2"
FT                   /protein_id="CBH23427.1"
FT                   /translation="MEHEPVDWKYRQSVYESAPWAFGPDAVGQADGRPRPNVLRLFVWF
FT                   YTSNAFSKILES"
FT   CDS_pept        617056..618246
FT                   /transl_table=11
FT                   /locus_tag="SRM_00508"
FT                   /product="ABC transporter, ATP-binding protein,
FT                   proline/glycine betaine"
FT                   /function="# Involved in a multicomponent binding-protein-
FT                   dependent transport system for glycine betaine. Probably
FT                   responsible for energy coupling to the transport system."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00508"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23429"
FT                   /db_xref="GOA:D5H5X4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005892"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X4"
FT                   /protein_id="CBH23429.1"
FT                   /translation="MGTGEKRRVRLSPRGSACPTTLTPSEQATYAMAVIEAEGLWKIFG
FT                   GDPERARTLAKEGMSKAEVKEETGSVIAVDDANFEVQEQEIFVVMGLSGSGKSTLLRCV
FT                   NRLIEPTFGKVHVHDDEVTAFDEDRLRKLRRTKMSMVFQNFGLFPHRTVIGNVEYGLEV
FT                   AGMDKEKRREKARQSLELVGLDGYEDSQTSQLSGGMQQRVGLARALVNDPEILLMDEAF
FT                   SALDPLIRADMQNELLELQEQWDPACTILFITHDLDEALKMGDRIAIMKDGRIAQIGTP
FT                   TEILTEPADEYVRSFVENVDRTKIVPARTVMRALGDDETVAADGPSVSPHTPIAELLPA
FT                   LVDADGPLAVRDSGGTLQGVVSQDAVMEEVVQNADGARRRDARAGRTDEDPEAAVA"
FT   CDS_pept        618310..619194
FT                   /transl_table=11
FT                   /locus_tag="SRM_00509"
FT                   /product="ABC-type proline/glycine betaine transport
FT                   system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00509"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23430"
FT                   /db_xref="GOA:D5H5X5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X5"
FT                   /protein_id="CBH23430.1"
FT                   /translation="MQLDLGGAFASLINWIQNNFGPLLDGIELVIGATIQGAKDVLLFL
FT                   PSWAMIVLFTVLAWWVASRGVALFTVVGLTLLEDIEFALFGMEIAFGMGLWEFAMQTLA
FT                   LIATATLISLLVGIPVGIWAAKNDVVDAIVRPVLDFMQTMPAFVYLIPAVVLFGLGAVP
FT                   GVIATFIFATPPCVRLTNLGIRQVSEEAVEAAESFGSTPSQMLFKVELPMALPTILAGV
FT                   NQTVLLALSMVVIAALIGAGGLGDPVVEGIQQLRIGVGFEGGLAIVILAIFLDRITQAV
FT                   GEKAGASTQPTTG"
FT   CDS_pept        619335..620330
FT                   /transl_table=11
FT                   /locus_tag="SRM_00510"
FT                   /product="glycine betaine ABC transporter glycine
FT                   betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23431"
FT                   /db_xref="GOA:D5H5X6"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X6"
FT                   /protein_id="CBH23431.1"
FT                   /translation="MNLSSTSLRSFIAVVAAVGLLGTGLAGCGGGGGDSQDVSRKMNMV
FT                   TVNWIEGMAFTYVQEQIMENQYDMEVDVREVGGGGIAFSSVAEGDRDYFNEAWLPTTHQ
FT                   DPWSKAQGNAAKLGYTYKGTSVGLTVPAYMDISSVSELENYRNELGGEINGIESGAAVN
FT                   DQTRKILENNGLNDEFSVVASSGPATWQALENAVNNEQPIVVTGWYPHWKWGSFDLKYL
FT                   EGAQTGQSPVFGDPEDVFKIVDSEFTEEFPKEVVCFLKVSEVTDEEIESLMGSFRNRGD
FT                   MSKREAASQWIENHSEDVNAWTKQAEECAASDGSVETLPDDATYSRKQST"
FT   CDS_pept        620493..621512
FT                   /transl_table=11
FT                   /locus_tag="SRM_00511"
FT                   /product="glycine betaine ABC transporter glycine
FT                   betaine-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00511"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23432"
FT                   /db_xref="GOA:D5H5X7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X7"
FT                   /protein_id="CBH23432.1"
FT                   /translation="MKRLITAARALCRSYCAAAVAASLLALGTMGCGGDASDSAGGGAS
FT                   ASSPPLKMVTVNWIEGLAMSYMQAQVLEDSLNVPVDLKEAQGGGIAFSSVAEGDRDFFN
FT                   EAWLPTTHQNSWGDLQGQLQKLGYTYRGTSGGLVVPAYMDLRSAANIGEYREALGEKIY
FT                   GIEAGSPTNDNIRQVLDQHGIEGFSVVAASGPATWQRLRSAIQDRQPIIVAGWKPHWKW
FT                   SAFDLRYLQDGKTNQSPAYGPPEDIFTVVDNQFIDEFPKEAVCFLQKFEVTDQQIGSLM
FT                   NTFRTRGDMSKSGAAEQWVRNHPEHVTQWLDQAEACAASDEAVTPLPDDATHSRDQEA"
FT   CDS_pept        621669..622964
FT                   /transl_table=11
FT                   /locus_tag="SRM_00512"
FT                   /product="conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00512"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23433"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X8"
FT                   /protein_id="CBH23433.1"
FT                   /translation="MNRYCTAVLALFLTAGLMLPGSALADDPEPADDSTNATSLVANAW
FT                   ESDNTTAAPQQDEPTLDVSFNGSLRFNALFRSYGAGQNGNFEDQADNVLGNGGFTFDTF
FT                   RIGASGSYGSLIFDAEWAFYPESFGGNYIHHGWVGYEFSDARQIQVGVSQVPFGIQPYA
FT                   SSSWFFNNTYYVGLEDDYEAGIKAMYQANGWDIQGAYYMNSEQVDFFGASNAGRYSYDV
FT                   VPSTSAGYIDTRGVTEQHQFNAKVAYSFDHGGLGFTKVGVSGQRGQLLNQGTGETDWHA
FT                   AYAAHLQGRYGGFEAKLEFAQQELNPPSVTDDRFVVMGAYGSPNRVASEHNVYSSSLAY
FT                   HIPVNAGPISEIKPYYDFSQVTKDVDAWNDNVNHDIGFLTSAGPLFVYTDLIISKGHPF
FT                   NQPFDGTFSGVMAEQNDNEWRTAFNVNIGIYF"
FT   CDS_pept        623192..624199
FT                   /transl_table=11
FT                   /locus_tag="SRM_00513"
FT                   /product="Conserved hypothetical protein containing DUF389"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00513"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23434"
FT                   /db_xref="GOA:D5H5X9"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5X9"
FT                   /protein_id="CBH23434.1"
FT                   /translation="MALRLIDLYHPDTDDALDVPDAPHDVLGHWTYAIDDGQRVDRLLM
FT                   EVEDTEPFLDWVEGTAITEYRVVIQAVEATLPRPEVDADEGETQAGGEAAEEDDEESAA
FT                   RVGRAELYEYARDATDVSSYYYSLIALSVIVAAGGMLRNQTAVVIGAMVIAPLVGPNLA
FT                   LALGTTLGDPDLLKRSVRANVTGLALALGGALGLGVVMTVDPATSELAGRTVIGIADIA
FT                   LAGAAGAAGALAVTRGGATGLVGVMVAVALLPPAVATGLLLGAGHPDPALRAGLLTVTN
FT                   VVALNLAAVCTFLLLGVRPRDWRDVAQARTSTRIALVLWGSALAVLALLLWQFA"
FT   CDS_pept        complement(624236..625477)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00514"
FT                   /product="transporter, major facilitator family"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00514"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23435"
FT                   /db_xref="GOA:D5H5Y0"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y0"
FT                   /protein_id="CBH23435.1"
FT                   /translation="MPDTKTSNPYLILFALWLMMFSASSQLIIMVPILPEIAATLGVNA
FT                   FWQGMLLTAYALSLGVSALITGPASDRIGRRLILLYGTILMAVTLTLHTVAESYVLLFS
FT                   MRLLAGIGGGMLTSGSVAYVGDYFPYEQRGWANGWVMSGTAFGQVAGIPIGKVLATGFG
FT                   YRWPFLMFAVPMAVSAVLIWLYVPQPDADLDDQRLTPARLVEKYRAVLQGSDAVNAVAS
FT                   YLLMFSGFGLFTSFLPSWLESTVGVSSYEIALLFAIGGTANILASPLGGRVSDRIGRKP
FT                   IVVWASLVLGLLMALAPLYITGFLIAAVLFFLAMGLIGIRVGPLQSLITALVPDRQRGL
FT                   LMGLAMSVGQAGFGFGSFVASITYGPYGFFSNAVGGALAMIGMAGLVHWGLPEPPLASV
FT                   EEPAPDAPSVAETP"
FT   CDS_pept        complement(625518..625724)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00515"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00515"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23436"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y1"
FT                   /protein_id="CBH23436.1"
FT                   /translation="MGRFPDVFTRLRLGVCPGTQPAARNATRPVNASPSDHLAPPVAGE
FT                   RQTSSNIWACILHVGRVLLILEA"
FT   CDS_pept        625871..628702
FT                   /transl_table=11
FT                   /locus_tag="SRM_00516"
FT                   /product="TonB-dependent outer membrane receptor"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00516"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23437"
FT                   /db_xref="GOA:D5H5Y2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR008969"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y2"
FT                   /protein_id="CBH23437.1"
FT                   /translation="MVNGWYRDLLLVAFLFLVGARTSPLVAAQDVSPKEVDTNGTVTGV
FT                   VVEDGRGEPLPGANVRVAGLSTGTTTDLNGRYRIENLDPGTYDLRFSFVGFQQKTVTEV
FT                   EVTAGGTTEIDITLAEETEQLDEVVVEAKAARDSEAGLILKRAEAAAVSNAVSAETMSR
FT                   AGAGTVADAMGLMTGGSVVEGKHVNIRGLQGRYVNVQLNGTTLPNADPEGNSVALDIFP
FT                   SSLIDNVVTEKTFTPDKPGTFTGGSVDITTKSFPNDFFLNASVSTSSNSEVGVGGGILL
FT                   PPDGLEEVPPVANSSSVPPGPTSDPERRDALNQVTQAFATGVSPRSNDVLGNRSAEVSL
FT                   GDRFSVMGDRSLGVIASLTYDHSFSGYNGGTTARFSQTGINAEQLRPEASYTTRRGVEE
FT                   TLFGGLAGISFQLTPTDELGVRLLYNRDDEHIARYESGILPRDNISGDRRFETRVARVI
FT                   ERTVRTTELDGTHQFGSGAEGVRFEWQTAYSKVRREEPDNRFFPNEFSPGERDTSFAIS
FT                   GPVTGLPTRYFRDLTEQDWSGEASVEVPVGPTLFEAGGRFRTKTREFRERVFKHDAPIG
FT                   HGFSGRPEAYVDERSGLLSDGTFGTYVTEVPSQGGNYDGALDTGAGYLMTETPVPGVPS
FT                   LEFIGGVRFEYTDMSLNTLDTDTEGAFSQFDVLPSVNLVWTLREDMNLRLAYGRTIALP
FT                   SFREFAPFQSFNFIGDFTERGNPALKRTRVDNFDLRWEWFPRAGELLSASLYYKDFTDP
FT                   IERTFVAESVDQGIITYRNRESARVYGLELEARKRLGGLAPWLEHVQVGGNLTLTQSQI
FT                   DRTEEVLTLIRQFRDDPDETRQLQGQSPYIANVNAGYDNPETGTAVNVFFNRFGDRLQT
FT                   VSANGADIFERARSTLDINFSQRLLPGVSASISIKNVFNSDEVVSQTFKGDEFINDRRP
FT                   LGRTVSVGVSYSY"
FT   CDS_pept        628889..630520
FT                   /transl_table=11
FT                   /locus_tag="SRM_00517"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00517"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23438"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y3"
FT                   /protein_id="CBH23438.1"
FT                   /translation="MNFFRTTILESRSLGPLFVGLLLIPALVFITACDSNGSGDNMDSP
FT                   PAEQEPARLDTGPVEETDTNVDVDYDDDGTAEVVRVTDVNNNGVVPRDANGSTVTWSSD
FT                   KTYELNGFVFVNPGDTLEIEPGTEIQGRLGGGADASALIVASGGVIEAEGTASDPIVFT
FT                   SVRAADETLGRDDRGLWGGVILLGDAPTNNGSEVAIEGVPDNTGARILYGGQNVDHDVG
FT                   TFKYVSIRHTGTQLGNGDEIQGLTLGGVGSGSTIEYVESYASDDDGFEWFGGTVNTKYL
FT                   ITAYESDDAFDIDQGYRGSNQFWLAVQGGNESGRASEMDGAGSPESAEPYAESIISNAT
FT                   YLGMGPGVSDASGDANDPFIIHRDNNATSYHNSVFAGGRTNAGIQIEDLEAGSEDAANR
FT                   WAAGQLEHQDNLWYNIGPGFSGQTTFEDLIQLTTDDDGTPSGDRGNALKGNLADYLRSE
FT                   NNAIVNKNPYVSISRANGNGAIQSFDPTPVNAATSGANEPSDFGNKSAGVNDSWTSVSF
FT                   RGAFGSGAEWNLDSDWAKITQDGTVQ"
FT   CDS_pept        630696..631877
FT                   /transl_table=11
FT                   /locus_tag="SRM_00518"
FT                   /product="glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00518"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23439"
FT                   /db_xref="GOA:D5H5Y4"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y4"
FT                   /protein_id="CBH23439.1"
FT                   /translation="MSHPPRTGDAMALRCLFVVQGEGRGHLTQAMALRRMLRDAGHRVA
FT                   GVVVGKSDDQAVPAFFRAAFEAPVTDVESPGFVSDDADRSVRPWATLRRALGRTPTYWR
FT                   SLSALDAAIKRHDPDVVVNFFEPLMGLYAVTHSPSVPVVAVAHQYMFLHPAYRFPSGRR
FT                   DKRWAARAFARLTACGASRRLALSLYPAPDRSQDDLAVLPPLLRPGVFRQPQDRSEPFI
FT                   LVYILNSGYADEVIRWHEQNPTVPLHCFWDRPDAAPVEAYDETLTFHQLDDEKFLRLMA
FT                   RCRGFVSTAGFESIAEAMYLGTPVQVVPVEGHYEQRCNAVDAVRAGAGVRSTQFDIGHL
FT                   RAALDRGSTPEARFQAWVRQGRRRFVRELEAAARRPVAGSLGPRVAERILEAA"
FT   CDS_pept        631923..633023
FT                   /transl_table=11
FT                   /locus_tag="SRM_00519"
FT                   /product="dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00519"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23440"
FT                   /db_xref="GOA:D5H5Y5"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y5"
FT                   /protein_id="CBH23440.1"
FT                   /translation="MGLQRALQGLAWSGAGLLVAAFLMGYAAPYLPPARFWWTDLFAVL
FT                   LPALAGAVGLLGIGLVGQGAYSGRWGRLGIGGALLLLVALRFGTVPTGEASGRDADALR
FT                   VMTFNLSPAFARGPDRERTLAELVQREAPAVLSVQETWMKTRSASDGGGLFVSWPLRVL
FT                   LEDSVGYALPRARPPETTIYRPVLGQVRLDSMRVHPLPPSGGSDPRSRYTRTFFTWQGR
FT                   PAVLYNVHLHTVGPRPWDLPGTAASLARWRTFLRTYRAGALHRADQARRIHRHIEQETR
FT                   PVLVTGDFNSTPHQWAYRHLLQGFRAAGGGATFPAGWPLVQIDHVLVGPEWRVGSATVP
FT                   GLEATDFVSDHRPVVARVRWRDGYEE"
FT   CDS_pept        complement(633011..633721)
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="SRM_00520"
FT                   /product="phosphate transport system"
FT                   /function="probably involved in phosphate transport and/or
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23441"
FT                   /db_xref="GOA:D5H5Y6"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y6"
FT                   /protein_id="CBH23441.1"
FT                   /translation="MPNRLARELTELRSRLLDMATIVAEQFTDAVDALLAHDVDQAERI
FT                   MDRDREVDALELEVDEYCQRILARHQPVATDLRTLLTVEKINTDLERIGDHCRNLAGNA
FT                   EHVTEAPGVLDAVKIREMSQAARRMLDEAKQAFLDQDAELARSIPDLDDEVDRLHHENF
FT                   RGLVDYIQKNPEHAEVAAHLITASKAIERISDHSTNIAKGVVFLIEGVDIRHASVQEEM
FT                   APGSRSPLRSSYSS"
FT   CDS_pept        complement(635106..636611)
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00521"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00521"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23442"
FT                   /db_xref="GOA:D5H5Y7"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y7"
FT                   /protein_id="CBH23442.1"
FT                   /translation="MCGGRGNSIPRFPGGNIPKRQRPQGRLLPGAFLVPVPRVGRPEDG
FT                   LRYFLLVEGGRVISKILSQLRVPCGRCVHVPGAVSRSPFARALTCMSPAPNPQPSRADR
FT                   RSRRSTRRIALFAGAYTHIADGVSLTLNRLVEHLEQQGAAVRVFAPTVDDPAIEDHAGT
FT                   LTSVPSLPVPGRSEYRLSLGLTPSVRQALDDFAPTLYHIATPDLLGHNALQRAQDTDTP
FT                   VVTSYHTHFSSYLKYYHLGLLEAPVWGYLRSFYNQCRQVYVPTHAMADVLRGHGIDSDL
FT                   RLWPRGVDTDRFAPSRRSAAWRRAHGIGTDEVVVAFVSRLVWEKGLDVYADVIDRLERQ
FT                   GVPHHSLVVGDGPAREELETRLPNATFPGFLDGTDLAEAYASSDVFLFPSDTETFGNVT
FT                   LEAMASGLPTVCADAAGSRDLVDDGTTGRLCAPGHVEAFAEAVRTLVVDERRRDRMGTA
FT                   ARKCARDFTWPAVLNRMSRYYDEVLPHPPSPSPQDPAPTGATA"
FT   CDS_pept        complement(636611..639316)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00522"
FT                   /product="conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00522"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23443"
FT                   /db_xref="GOA:D5H5Y8"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR032534"
FT                   /db_xref="InterPro:IPR033413"
FT                   /db_xref="InterPro:IPR034032"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y8"
FT                   /protein_id="CBH23443.1"
FT                   /translation="MKRVPGDDGRSPRRSPPSLHSLHHAIAFDMRSRTLLWILPLTLLL
FT                   IAGCSSSAQMMDSSASAQTAKQQAENADEEKSDFEKAIAKSDSLGGLFTVYRDTTDGSL
FT                   QMALAPSQIGQEYIYFTHTVDGVLEAGTFRGAYRDNTVFKVRRHYDQIEFVEVNTNFHF
FT                   NDESTLSRASDANVSPSVLHVEKIVAENDSTGRLLISADDLFLTESLTQVKPSPTPGGS
FT                   PTDFKLGRQSQKKSKVEGVHNYPKNTDVVVDYVFENPRPVNPGSDAVTDARNVTITLRH
FT                   SLIEVPENDFEPRFADPRVGYFTQQKDNLTSTSATPYHDLINRWHLKKKNPDAELSEPV
FT                   EPITWWIENTTPERIRPIIRDAVLEWNTAFREAGFKNAIEVKVQPDTASWDAGDIRYNV
FT                   LRWTSSPNPPFSGYGPSFVNPRTGQIMGADVMLEYAFLTNQVNQNKLFEETGLPLQAAS
FT                   ERPKTLPKHACTLPGFLHMNTLFGKAALAPTAADPSPEQSGPSDLNGEMTQLMEEALHY
FT                   LALHEVGHTLGLQHNMKASQLHPTDEVHDASVTREEGLVGSVMDYPAVNVAPPDTDQGQ
FT                   YYTTRPGPYDVWAVEYGYTPDASEEELDAILSRSTEPALAFGNDADDMRAPGKGIDPDV
FT                   MIGDMSKEALDYAEGRMQLVEGLMDDLLTKYEDPGQSYQELRNAFLSVTGQHAQMAAVA
FT                   SRYVGGVHVDRALIGQEGATEPYRPVSLEKQQRALDLLNEYLFAPDAFEIIPNELYRHL
FT                   QPQRRGFNFFGASEDPKVHARVLGIQENVLAHLLHPNVLERMTDTRLYGNEYTLAAYMR
FT                   DLTDAVFAADAQGNVNTFRQNLQVSYVESLATVVGEEGDARYDNVAQSAALQSLQEIER
FT                   MVDRKRGVNAETRAHTDHVLHLIDEATATE"
FT   CDS_pept        complement(639513..639884)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00523"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00523"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23444"
FT                   /db_xref="GOA:D5H5Y9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Y9"
FT                   /protein_id="CBH23444.1"
FT                   /translation="MNEILLSILVTVLGAVVTVWLGGFVVGKVASPYADQLGVDSGLKE
FT                   GGRLIGYCERLLIYVFVLANAPSAIGFLVTAKSLFRFGEVTGAEKRRHTEYIIIGTLVS
FT                   FAYAVTLSYLVRWVLRISA"
FT   CDS_pept        complement(639877..640722)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00524"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00524"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23445"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z0"
FT                   /protein_id="CBH23445.1"
FT                   /translation="MSGESLCALSPKRFAEGIPLSFEEVPPILCKPILASNNKRNQKRF
FT                   TKRTMAESFDLHAVATGDIVGSSDLPADRRRQLPDRLRSTYETVQQTAPEELPYELAIT
FT                   GGDGWQCYVRNPATALARLLHFWTLLYAQGLPSRMALVVDTVDFVSEEDLNESDGRAFR
FT                   RSGRLLSSLNGERWFDGALPSDASEAHHVASEGIGELVDLFFHEWTEAQARAIAGMIGT
FT                   IGTEREITQEKIAAQWTPEPVTRQAVNRHLKRAHWNRVERTVTRFEHLCHSLQTPTLDE
FT                   "
FT   CDS_pept        complement(640851..643796)
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="SRM_00525"
FT                   /product="Excinuclease ABC subunit A"
FT                   /function="The UvrABC repair system catalyzes the
FT                   recognition and processing of DNA lesions. UvrA is an
FT                   ATPase and a DNA-binding protein. A damage recognition
FT                   complex composed of 2 uvrA and 2 uvrB subunits scans DNA
FT                   for abnormalities. When the presence of a lesion has been
FT                   verified by uvrB, the uvrA molecules dissociate"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00525"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23446"
FT                   /db_xref="GOA:D5H5Z1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z1"
FT                   /protein_id="CBH23446.1"
FT                   /translation="MPTTERLPTQDPVIANASVTARESAQDHIVIRGARQHNLKDIDLD
FT                   LPRNELIVFTGPSGSGKSSLCFDTIYAEGQRRYVESLSAYARQFLERMDKPEADLITGL
FT                   APAIAIEQKTSGKNPRSTVATQTEIYDHLRLLFARIGTTYSPVSGEPVSRDTPHDVADR
FT                   LDDALDDGTRFYLCAPIPEHADMALRDQLTSLRERGFYRILRLPTERQAEKGQEPEILD
FT                   LNQEAPSSVNHYGRARLRVLIDRLKVKTGDADTRSRIAESVEQAFDEGDGYCTVIPAPR
FT                   GGYDETAHPDASQHQGPIPLFEFSAHFERDGMRFEEPTPQLFSFNSPVGACPTCQGFGR
FT                   VPGLDEDLIVPNKQLSIRDGALAPFRGDKWGKHFKDLIAVAADVGLDIDCPYHELADWE
FT                   EEIVWEGKDDYIGLHGFFEFLEENSYKRHYRIFRARFRGYSECPDCNGHRLCDDALYVK
FT                   VGGDAVEQKHIGEICAMTTRAARDYFEALALTDYEQEVAGRVMEELRERSRYLVDVGLD
FT                   YLTLDRLAQTLSGGETQRINLSTSLGSSLVGSLYVLDEPTVGLHPRDNERLIDILQRLR
FT                   DLGNTVLVVEHDPVTMEAADQLVDLGPASGAFGGEVVFQGPYDEILEAEDSLTGQYLSG
FT                   RKEVPVPDERRPADPDDTLVIENARQHNLKHVDVEIPLGQIVCVTGVSGSGKSTLTNQT
FT                   LFEGLHRLKGGSGDGKVGAHDTIRGHENVDAVEMVDQSSIGRSPRSNPATYTNAFDGIR
FT                   KLFAQARQSQVHGYDRGTFSFNTKGGRCEECEGQGVVKVEMQFLADLYLECEACNGQRY
FT                   KKEVLNVTYNGKNIADVLDMTVDEAADFFEGERAIINKLEVLQDIGLGYLTLGQPSTTL
FT                   SGGEAQRIKLASHLSGRASDRTLYIFDEPTTGLHFDDIRKLLGAFEQLVENSHSVLIIE
FT                   HNLDVVKYADHVIDLGPEGGDAGGNVVATGTPEEVAACDESHTGRFLRDVL"
FT   CDS_pept        643972..645252
FT                   /transl_table=11
FT                   /locus_tag="SRM_00526"
FT                   /product="putative Glucose/sorbosone dehydrogenases"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00526"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23447"
FT                   /db_xref="GOA:D5H5Z2"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z2"
FT                   /protein_id="CBH23447.1"
FT                   /translation="MCPSRYGRERRKGGSVKNPSQQVRSSRPPMSIPPAIPMRTLIGLL
FT                   ALVLCACTPGNGSEAPEARSSSPDKEVVLERVESEEETFQVVEMVEDLEHAWAVDWLPD
FT                   GRMLVTERPGRMLLVDGDGPTQLANVPEVWAKNQGGLLDVRVAPNYEESGWIYFTHSLK
FT                   DGDTGGTVLSRARLDGTALTDVEELYRQTPFLAPDYHFGSRIAFPGDGTLVVTMGERGQ
FT                   RRERTVDIPTPTTSVGTTVRLNMDGSVPADNPFVGSDEGLDEVYAYGHRNQQGMAIHPE
FT                   TGAIWQHEHGPHGGDELNLVEAGNNYGWPAVSYGDSYTDQSPIGGTTAPGVTDPVEYWD
FT                   PSPALSGMAFYTGDTFPNWQGDLFMGALAHQKAMRVELDGEDVSDQEELLRAELGRIRD
FT                   VATGPDGSLYLLTDAPEGALYRLEPAE"
FT   CDS_pept        complement(645313..646134)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00527"
FT                   /product="conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00527"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23448"
FT                   /db_xref="GOA:D5H5Z3"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z3"
FT                   /protein_id="CBH23448.1"
FT                   /translation="MTPAPRRTAARLSVAVVLLMALSSGAGLFAHDLYRDNALVAARWY
FT                   GSDLVTLGVAAPLLGIALLGAWGGSRRAVLVWMGMLAYSLHNAAFYLFGAAFNSLFLVY
FT                   AALVALSGVALVFGLLSIDATALHRQVQPGLPVRWIGGFLAGVAVTLGGLYGAFSLRHV
FT                   ATGQGPALLDAMGPRAHLVAALHLTMVVPVGLLAASWLWQQRPWGYVWATLWAVAGAAC
FT                   MLSLSAATVAAVVVGPSTTWMPLLLWAPIGVGCVLVGGVLLRALRPDSRTR"
FT   CDS_pept        complement(646285..647421)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00528"
FT                   /product="Conserved hypothetical protein containing M23
FT                   peptidase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00528"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23449"
FT                   /db_xref="GOA:D5H5Z4"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z4"
FT                   /protein_id="CBH23449.1"
FT                   /translation="MCVFNFVCSKRVLRPHGPCISVGPMTTLVRGKARRGNRRRAQGPN
FT                   QPGCAVHGNSRSDMTLLIASALLPLLILPGAALVWLTRRSPCRLLWGLKAAAVGGYVGL
FT                   TYHLGSWYMLSTHGRYVLLGLFAVGAGYGGWRMRHQVFWTRPRGWQWAGPGLAAVLLLL
FT                   SVVGLRQRNQAREIPAPPVNLTVPLRDGPVYVASGGSRSITNPHLKVDAPELQTWRGQR
FT                   WGLDLVQLYPSGNRASGLYPTALARYAVFGAPVYAPCDGVVETTAGSLPDRSPPARDTA
FT                   RKAGNHVLLRCAPDAYVLLAHLKQGSVRVESGDSVSPDTRLGRVGNSGNSWEPHLHISA
FT                   QDTVGTSALLDADPRPITFDGRFPIRNDVVRTNGAGRR"
FT   CDS_pept        647448..648068
FT                   /transl_table=11
FT                   /locus_tag="SRM_00529"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00529"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23450"
FT                   /db_xref="GOA:D5H5Z5"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z5"
FT                   /protein_id="CBH23450.1"
FT                   /translation="MEPLDPDAVVSLDPEQSFWERFYMVAPLIVVGTQNEDESYNLAPK
FT                   HMAAPMGWDDYFGFVCTPRHKTYRNAVRTGVFTVSYPKPSQVVLASLSASPRVGAPEGP
FT                   RRKPALNQLPMRAAAAVDGVFLDDAYLLLECTMERHVDNLGENSLLIGAVEAVHVEKEA
FT                   LRVSGKEDDAVIRDNPLLAYLPPDRYAAIDETNAFPFPAGFEK"
FT   CDS_pept        648114..649355
FT                   /transl_table=11
FT                   /gene="argE"
FT                   /locus_tag="SRM_00530"
FT                   /product="Acetylornithine
FT                   deacetylase/Succinyl-diaminopimelate desuccinylase and
FT                   related deacylases"
FT                   /function="# Displays a broad specificity and can also
FT                   deacylate substrates such as acetylarginine,
FT                   acetylhistidine or acetylglutamate semialdehyde."
FT                   /EC_number="3.5.1.16"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23451"
FT                   /db_xref="GOA:D5H5Z6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z6"
FT                   /protein_id="CBH23451.1"
FT                   /translation="MESVSESELAHALRRYLAGHREHMLAVLEALVRAESPTDVPEAQA
FT                   EAQGMLARLLRTLGFHVRSLPAAEEERGHLYARPKDRPRGRPVQLLVGHSDTVWARGTL
FT                   DEMPFEVDDNEVRGPGVFDMKAGLTQMLFALAALRAASVEPTVVPVVFVNSDEEQGSPT
FT                   SQRHLRRLARCAHRAFVLEPALGLDGKIKTARKGAGRFTIRIQGESAHAGLDPESGSSA
FT                   ILELSHTVQALHALNDPEAGVSVNVGTIGGGTHPNVVADAGSAEVDVRVATREQAEEVA
FT                   AAIRGLETTTPGTSLTIEGGIGRPPMEPTPAARRLWARARHAGSLLGLELEEGRSGGVS
FT                   DGNIISQYAPTLDGLGAVGDGAHARHEFCYVDRMVERSVLLALLLAQPPLPTTPDDAAP
FT                   TAETLDAPASTQAP"
FT   CDS_pept        649405..650451
FT                   /transl_table=11
FT                   /locus_tag="SRM_00531"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00531"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23452"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z7"
FT                   /protein_id="CBH23452.1"
FT                   /translation="MMSPIFDWCIFGSLARITDLSARTFEIEPRVPSEWDTGDYVVGIV
FT                   TDTSGYRAIELPSGRNMEVAEGDAVVGAFGTRHATLEMTGSWREIGDDQLMHALTRAGL
FT                   FGHVESRSTLVQPPLELRYHGHVCRDATKVTMAGAVPPVDEQPYTTPTILFAGTSMSAG
FT                   KTTAARIVTRRLKRMGLDVLGAKVSGAGRYRDVLSIQDAGADWGLDFVDAGLPSTVIPE
FT                   EEYRTAVRQLLARMAQPPADVAVVEIGASPLEPYNGAIAVEELQEALAMTVLCASDPYA
FT                   VLGLETAFDMLAPDLVTGIATNTAGGIDLLTQLTDLPAFNIRDNDTHDRLDALLRDRLG
FT                   LAEEVSTG"
FT   CDS_pept        650657..653899
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="SRM_00532"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /function="Catalyzes the attachment of isoleucine to
FT                   tRNA(Ile). As IleRS can inadvertently accomodate and
FT                   process structurally similar amino acids such as valine, to
FT                   avoid such errors it has two additional distinct
FT                   tRNA(Ile)-dependent editing activities. One activity is
FT                   designated as 'pretransfer' editing and involves the
FT                   hydrolysis of activated Val-AMP. The other activity is
FT                   designated 'posttransfer' editing and involves deacylation
FT                   of mischarged Val-tRNA(Ile)"
FT                   /EC_number="6.1.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00532"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23453"
FT                   /db_xref="GOA:D5H5Z8"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023586"
FT                   /db_xref="InterPro:IPR033709"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z8"
FT                   /protein_id="CBH23453.1"
FT                   /translation="MAQFDTPDQLSLPDLEEDVLDWWQDQNIFERSIEERDGQPTFTFY
FT                   EGPPTANGTPGIHHVLARAIKDIFCRYKTMQGYQVDRKAGWDTHGLPVEIEVEEELGLE
FT                   TRAEVEEYGIEKYNAACRESVLEYKDLWDNLTQRMGYWVDLDDPYVTFETDYIETVWWL
FT                   LKQIEEEDLLYKGHKIQWYSPGSHTVLSSHEVSLGYEETQDPSVYIRFPVAGEENTYFL
FT                   AWTTTPWTLISNTALAVGPELTYVKIHHDDPHQGEEKLILAEALLDDVIGEDYTVEETF
FT                   SGEELIGQRYEPPYDYFTDRAEAGEEAWYVLEADVVSTEEGTGVVHMAPAFGEEDHAVA
FT                   QEEGLPLFNPIDKDGEFTDAAPLVAGTWFKDADKTITDDLKARGRLYKHETYLHNYPHD
FT                   WRKGTPLMSYPVESWFIETTKLKDRMVELNDTINWQPEAIGEGRFGEWLENNVDWALSR
FT                   RRYWGTPLPVWESDKEDSDYYEVIGSVEELREKAGDQLPEDDEEIDLHRPFVDELTWEG
FT                   PDGGTMRRVPDLIDVWFDSGAMPYAQWHYPFENEDDFEANFPADFIAEGVDQTRGWFYS
FT                   LHAIATVVFDEVAYENVVVNGLVLDEDGNKMSKSVGNTVEPFEVIDDYGADVVRWFMMS
FT                   NAPPWESIRFSERGLRDLRRTFFGTLENVYRFFATYANIDGFAYERDRMPVEERPELDQ
FT                   WIISRLHTTTQAVEAALDEYDPTTAARAVEAFVEQLSNWHLRRSRPRFWASKKGEQNGP
FT                   SGQGGTVAAAKKEAAYQTIHECLAATAKLMSPIAPFFGEWLYRTLGDVTGTEADSVHLA
FT                   SFPEVREEERNEALERRMGLARSIASSTLSLRNQAEINVRQPLPRLLVVTGTGVPEAEV
FT                   EQVKEVILDEVNVKDIEYVEHSSEVVSRSAKPDFSRLGPRLGDLVKAVNQKVRQLDDET
FT                   IDEYVETGALTLTVDGEEVELGPDDLIIQSEGIEGWLVEQEGDVTVALDTDITPALRAE
FT                   GLAREGVKRIQDLRKAAGFEVTDRIAVAYDGSAQIADAVAAYADWIRNETLALELQPSN
FT                   EPTGEAVETFEVGDERLTIGVRRVEADEALNA"
FT   CDS_pept        653978..654454
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="SRM_00533"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00533"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23454"
FT                   /db_xref="GOA:D5H5Z9"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D5H5Z9"
FT                   /protein_id="CBH23454.1"
FT                   /translation="MANDDAQPEGDAPDAPLHAQSDTTEDGEARTTPFSDDELEHFREL
FT                   ILQRRQEAKSEIEQMRKQVEQAKEQSDDNTAYGIHMADAGTDAMEREKLHLMIARQQKY
FT                   VGYLDRALERIDNKTYGVCRVTGKPIAKERLEAVPHTEISIEAKRKEKAAGDAE"
FT   CDS_pept        654620..655228
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="SRM_00534"
FT                   /product="Holliday junction DNA helicase ruvA"
FT                   /function="The ruvA-ruvB complex in the presence of ATP
FT                   renatures cruciform structure in supercoiled DNA with
FT                   palindromic sequence, indicating that it may promote strand
FT                   exchange reactions in homologous recombination. RuvAB is an
FT                   helicase that mediates the Holliday junction migration by
FT                   localized denaturation and reannealing. RuvA stimulates, in
FT                   the presence of DNA, the weak ATPase activity of ruvB"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00534"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23455"
FT                   /db_xref="GOA:D5H600"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D5H600"
FT                   /protein_id="CBH23455.1"
FT                   /translation="MIDYVSGTLVDKTTDSALVDVNGLGYRVHVPTSTYKRLPDTDEEV
FT                   TLHTYHYLREDDESLYGFATKAERTVFETMTGVSRVGPKLALSALSAMTPTELRDHVME
FT                   GDKSRLTQISGVGTKTADRLIVELRDRLADLDVLEDTSPLSGGSDARAEARADALEALT
FT                   ELGLSKADAERSIRQVLRDNAGIQSADELVRRALKADQE"
FT   CDS_pept        655266..656243
FT                   /transl_table=11
FT                   /gene="prs"
FT                   /locus_tag="SRM_00535"
FT                   /product="Ribose-phosphate pyrophosphokinase 1"
FT                   /EC_number="2.7.6.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00535"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23456"
FT                   /db_xref="GOA:D5H601"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:D5H601"
FT                   /protein_id="CBH23456.1"
FT                   /translation="MPDDLRLFALSESRGFGEAIASALDTELDAHHERTFTDGEHEVRP
FT                   EVNVRGRDVFVVQSLYADDTWSVNDKLCRLLFMLGALRDASAERVTAVIPYLCYQRKDR
FT                   KTRPRGPVTTRYVAGLFEAVGVDRVLTMDVHNLAVLQNAFQARTEHLLGHPLFVHRLTD
FT                   VVGAEEVAVVSPDEGGVKRAGKFAEGLGAVLNCEVPTAFVEKMRKDDGVTGGALVGSVE
FT                   DRTAIVVDDMVSTAGTMTQAIRSCAEEGAESVYAVATHGLFVGEADERLETAPLDALFV
FT                   TNTVAPRLTGAAAERLQICNAAPRFAAAIQAVHTETSVSALNEV"
FT   CDS_pept        656256..656387
FT                   /transl_table=11
FT                   /locus_tag="SRM_00536"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00536"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23457"
FT                   /db_xref="UniProtKB/TrEMBL:D5H602"
FT                   /protein_id="CBH23457.1"
FT                   /translation="MLVGGALNEGQSNTEAPVGHVPARGRTNGKPASGRVPDEGDNG"
FT   CDS_pept        656696..656953
FT                   /transl_table=11
FT                   /locus_tag="SRM_00537"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00537"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23458"
FT                   /db_xref="UniProtKB/TrEMBL:D5H603"
FT                   /protein_id="CBH23458.1"
FT                   /translation="MVPLRSKYSIGVWGDSFVSEALPRSGRNTAGTDCVDMADIGERWR
FT                   WRRRGQTRVAPSFHPAVQRQYDEETEEREASLYDGADGRL"
FT   CDS_pept        657078..657641
FT                   /transl_table=11
FT                   /gene="dCTP"
FT                   /locus_tag="SRM_00538"
FT                   /product="Deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00538"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23459"
FT                   /db_xref="GOA:D5H604"
FT                   /db_xref="UniProtKB/TrEMBL:D5H604"
FT                   /protein_id="CBH23459.1"
FT                   /translation="MDEDSCASEPNRDQTVEPEGAGAGLRFPQRVSTHQYRPCAMDTAN
FT                   ALASQLDGLVHLDTQRASTGIDLTVDAVFRTTGPGQLDFGGGEFQTVPRERIGPTLDDP
FT                   DDDYGWWTLEKGAYVVQYNESLRLDDGQQAVVTPLERTLRAGAHHGAFVLDEGRDPIET
FT                   LLVVGRMGCRLKENCRVSRLVVLD"
FT   CDS_pept        658030..659331
FT                   /transl_table=11
FT                   /locus_tag="SRM_00539"
FT                   /product="Conserved hypothetical protein containing DUF72
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00539"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23460"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:D5H605"
FT                   /protein_id="CBH23460.1"
FT                   /translation="MRTGAPWRSSARASLPACASSTRRTRLSRRKISAPTRAAPTSILF
FT                   WRPSRPAAVPSKAGCWTRASWRASATSTPTRPSTRRASTRERPCRSSPRPTSAASTTQF
FT                   NGSWTPPSRSTPTPRPWTRTASCCPTATGTSTARRPACPSTPRPSPAARPTFPPPASRP
FT                   RSRPGSHTLHPHALHPHALHPHAPVPSTHIGTSGWQHDPFAGRFYPDDVPQDDWLARYA
FT                   DTFGTVEVNNTFYQSPEADTLRAWRRQTPDGFTFAVKANQYITHFKKLKDPDEPVQNLY
FT                   RNVEPLGDALGPILFQCPPNWHQNLDRLHNFLETLDDAHRHVFEFRDPTWLNEETYDAL
FT                   RAHDAAFCVYDFGDRSTYRVVTTDWAYVRLHGRGEAYHGRYTDAELDDWADAIADWRAD
FT                   GLDVYVYFNNTAGEGHAPHDAQRLAARVRDHLGR"
FT   CDS_pept        659374..660399
FT                   /transl_table=11
FT                   /locus_tag="SRM_00540"
FT                   /product="putative ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23461"
FT                   /db_xref="GOA:D5H606"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H606"
FT                   /protein_id="CBH23461.1"
FT                   /translation="MTLTLPERFRDATFESYEPQTPSQAEALRVARAFVAELRRTPSWT
FT                   ERLRALLGVGDERLPQGLYLVGPAGTGKTHLLAATCNALMPERACAFLHSSTLFRQTEP
FT                   PDAFAHRLADQYAVCCLDEVEIDDPANEMRLAGVMKTLAARDVPLLATSNVAPEEYLAT
FT                   QLGDGRVQRFLRTEVRDAYRVVGVRGDDYRRTRAVEQSGRGWVGPPDATQRAMRQARAD
FT                   ATGAARWWTFADLRRATTDTAHTDLIEDLVGLDYLFIEGVAIADTDDAFRLLRVVDALY
FT                   LHEDAPRLYFTAARPPDDWFDPDRHAGLARAVAEKFDRTVSRLHALCQVRPVEHEEAGQ
FT                   A"
FT   CDS_pept        660812..662734
FT                   /transl_table=11
FT                   /gene="typA"
FT                   /locus_tag="SRM_00541"
FT                   /product="GTP-binding protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00541"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23462"
FT                   /db_xref="GOA:D5H607"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:D5H607"
FT                   /protein_id="CBH23462.1"
FT                   /translation="MGTIHLSNANLRGHAVATRRSAPQDHSNRCPAMKQTDLRDIAIVA
FT                   HVDHGKTTLVDSMLWQSGIFRDNEEVQERVMDTMDLEREKGITIMANNTAVRYEGTKIN
FT                   IVDTPGHADFGGEVERTLRMVDGIMLLVDAAEGPLPQTRFVVQKALELDLPPIVVLNKI
FT                   DRKDARPEESLDEIYDLFIDLGADMEQLEFPVLYTVATEGRCKTDLDNEEWSTLRPLFE
FT                   TMIDEIPPPTGDPDGTLQVLVTSVQRDDYLGPVAIGRVEQGVLQDRQDVTLCHRDGSTE
FT                   QAEVTALFEYEGLQREETDAAGPGQIVAIAGVEGIGLGESISHPEHPEPMTPLDVDPPT
FT                   MSMEFRINDGPFSGQEGEFVTSRQLRDRLFDEARNNLAIRVEETDSANVMRVYGRGELQ
FT                   MAILIEQMRREGYEFCVGMPQVITKEIDGETREPYETAEIDIPEEYMGVVMERLGERKG
FT                   QMEHMVHQDSGRVRLTFRVPSRGLIGYRSKFLTDTKGTGLLTHRFEEFGAWAGEIPHRT
FT                   SGALVADREGETTPYALMELQDRGDFFVAPGDAVYKGMIVGENNKPQDLDLNVTKEKQL
FT                   TNMRAAAGTELEHVPPPREMSLEDAIEFIREDELVEVTPEAYRLRKRHRKPKARRRAQE
FT                   ERAAG"
FT   CDS_pept        complement(662783..663358)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00542"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00542"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23463"
FT                   /db_xref="UniProtKB/TrEMBL:D5H608"
FT                   /protein_id="CBH23463.1"
FT                   /translation="MSDKPKNVFRIDIEPTEDNPDRHPTHGWQVRIKRQKEQYTKYFSD
FT                   KRHGGREEALEKAVEYRDELLDELPEPMDPVRRSAEARSTTGVIGLNFCWKDDGSGTPK
FT                   PYVQLSWLEDDDTRRSAAYSVRKWNLRRAVWKACARLHEARAEHDGEAEEVNDMFQTAF
FT                   PNIKEQYEAGPDGEGLPEEDEEVMEAAA"
FT   CDS_pept        complement(663815..664834)
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="SRM_00543"
FT                   /product="chaperone protein DnaJ"
FT                   /function="Participates actively in the response to
FT                   hyperosmotic and heat shock by preventing the aggregation
FT                   of stress-denatured proteins and by disaggregating
FT                   proteins, also in an autonomous, dnaK-independent fashion.
FT                   Unfolded proteins bind initially to dnaJ; upon interaction
FT                   with the dnaJ-bound protein, dnaK hydrolyzes its bound ATP,
FT                   resulting in the formation of a stable complex. GrpE
FT                   releases ADP from dnaK; ATP binding to dnaK triggers the
FT                   release of the substrate protein, thus completing the
FT                   reaction cycle. Several rounds of ATP-dependent
FT                   interactions between dnaJ, dnaK and grpE are required for
FT                   fully efficient folding. Also involved, together with dnaK
FT                   and grpE, in the DNA replication of plasmids through
FT                   activation of initiation proteins"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00543"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23464"
FT                   /db_xref="GOA:D5H609"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:D5H609"
FT                   /protein_id="CBH23464.1"
FT                   /translation="MQGPARRLVSQCSPAAMPQTEDLYDVLGVDEDASQEEIKKTYRTL
FT                   ARKHHPDRNPDDPNAEEKFKEIQKAYSVLSDEEKREQYDAQRRFGGGGGFGGGGGGRGA
FT                   WGRSAGGGPEVRFEQGGFDEAFGGRGGGGLGDIFENFFGGGARTQRQNPFDGGRQQQRQ
FT                   QRQRGRQGGQDLETTLRLSFREALEGGRKQVELPSGESIRLKIPKGVRDGFKIRLKGRG
FT                   QPAPTGQRGDLYVTFEVGDHPHFDRKGDDVHRTETIGMFEAVFGTDIRVPTPYGQHLKL
FT                   SVPAGTQPGEKLRLKGQGVKTDDGTGDLYVEIDVNIPENLSRKQRAVLHEAAEDANLL"
FT   CDS_pept        664911..666431
FT                   /transl_table=11
FT                   /gene="accA"
FT                   /locus_tag="SRM_00544"
FT                   /product="Acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /function="Component of the acetyl coenzyme A carboxylase
FT                   (ACC) complex"
FT                   /EC_number="6.4.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00544"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23465"
FT                   /db_xref="GOA:D5H610"
FT                   /db_xref="InterPro:IPR004549"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D5H610"
FT                   /protein_id="CBH23465.1"
FT                   /translation="MTDSTVTSRPFDNVLVANRGEIAVRVLRTCHEQGLNTVAVYSTPD
FT                   RSAPHVRRADEAYHIGPAEAAQSYLDSEAILEAARRSGADAIHPGYGFLSENAAFAEAC
FT                   AEAGVHFVGPPAAAIRAMGDKTAARQLMKEAGVPMAPGTTDAVASTEEGEAIAEDIGYP
FT                   VLIKAAAGGGGKGMRIVHEPEHFAGAMDRAQGEAASSFGDGRVFIEKYIEEPRHIEFQI
FT                   LADHHGNTVHLFERECSIQRRHQKVIEEAPSSVLTPEVRREMGEAAVAAAESCGYRNAG
FT                   TVEFLVDADLNYYFMEMNTRLQVEHPVTEWVTGVDLVAEQLRVAQGEALGYTTDDLSIN
FT                   GHAMESRVYAEDPASNFLPDPGPLKRHSAPSGVGVRVDAGVEEGGEVLIHYDPMISKLT
FT                   TWGKDRTAAIDRMIRALDEYEVASMATTIPFCRFAMEHEGFRAGDFTTHFVDEEFDPAA
FT                   LQLEDPERDELAALAATLYYAETQADEAPTIAANGREDRSPWRQRRRP"
FT   CDS_pept        666407..666703
FT                   /transl_table=11
FT                   /locus_tag="SRM_00545"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00545"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23466"
FT                   /db_xref="UniProtKB/TrEMBL:D5H611"
FT                   /protein_id="CBH23466.1"
FT                   /translation="MAPAAASLIQRPRAAGERARLRSGDWGRNYDAVRDRLRGEGAGHV
FT                   VGCGSRTTNRLPTCFSASTSIVPFIGFVKRGAGCLPSGGPEHEDYRFFLGSTL"
FT   CDS_pept        complement(666915..667724)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00546"
FT                   /product="Conserved hypothetical protein containing DUF583"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00546"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23467"
FT                   /db_xref="GOA:D5H612"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D5H612"
FT                   /protein_id="CBH23467.1"
FT                   /translation="MLRRRARSLFANGRLVCSFGTTFGPAFYFLLRFLMYPFSDHSSSY
FT                   GNRTSSIPDSFSGSVLNEEDIAQGTLRLGTSDLLVRGHVHGPITTKGSVHIAESGSTQG
FT                   SICASEVRVAEGAQVSGTVRASDLHIGGTLQGAILVFDHLLILKTAHVHGGILTLQRAT
FT                   LEVKLGAQFTGTVSEVKRSFVAPDSPEQGDGSPGRAMSASVRPPDFCLPSHHMSEKPPA
FT                   NRPEQEKLGAPGPAETPGGDDSSSLRDDSTPENGSESDVDEDFGIDW"
FT   CDS_pept        complement(667866..668891)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00547"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00547"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23468"
FT                   /db_xref="InterPro:IPR040607"
FT                   /db_xref="InterPro:IPR042051"
FT                   /db_xref="UniProtKB/TrEMBL:D5H613"
FT                   /protein_id="CBH23468.1"
FT                   /translation="MFKTKTLPSVFEASNAELVDVSDSLLTGLKIGHNGRSYVVGELAL
FT                   LEGNAPHKGINNAPSDLDYRLLLQAALAVTKAGAEEPMCVTTGFPSSTYAAHRDTAEEL
FT                   VKGTHVIDLDGRTFGKSPDTSIRVEVDQVEIIPEIEGFTFGVRQGEPRERDPFFAVGLG
FT                   YGTMEAALSLPSGIVQRTTASASGLQYATQLMSDRLQKEHYLDMVTEHQLDMAMRKGSI
FT                   VIGRKKMDLTEMRQDVLSTYYEDIVSPTLKRAFDDADFGRARKMYVGGGGALFDELVDA
FT                   FTDEFGDVLSLEVVPNPASFISQGYALHAADANGGHRARAVGLDIGNANTVINLLREES
FT                   V"
FT   CDS_pept        complement(669493..669837)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00548"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23469"
FT                   /db_xref="UniProtKB/TrEMBL:D5H614"
FT                   /protein_id="CBH23469.1"
FT                   /translation="MLKDLGDKAAWDLRAEESPCTGVESFARPVRPVIEAPLRARDTMR
FT                   PRRHRQATGSSLGDTFGTPTGLARALFETVTGSGPALPTHCRKRASRRAGQPETIRLAR
FT                   SAFPWHHRSL"
FT   CDS_pept        complement(669831..675794)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00549"
FT                   /product="Sensory histidine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00549"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23470"
FT                   /db_xref="GOA:D5H615"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H615"
FT                   /protein_id="CBH23470.1"
FT                   /translation="MSTGPPNSNLSSSSSKYARIDPRRLQALRRYDVIDTPPEETFDRI
FT                   ADLAAALFDAPIGLVTFVGDQKQWHKACIGLDAQELGIDASFCVHTLDEGQRLVVEDAT
FT                   EDERFDDNPLVTEDPHVRFYAGAPMITPDGHVLGTVCVLDTEPRAPSERQLTGLDGLAQ
FT                   MGVDQLEQRRRQKISAVEQGGAESDETRLNELLASLDDAVWEVRVYPADSYEAEPVRRE
FT                   LAYVNSSEEHIFGRPTDAFVRDPMLWRSAAHPKDQPELPTARDLLEHGRWRGEYRVLRP
FT                   DGTAQWVETSVQVVGRPSFSSQDGSSQDERTLDAPVKLAGVTRSIHRRKQAEASVQEKS
FT                   AALAEEKTRLRVALDAADAGVFEWSIPDDRRVWDERTQALFGVDAAPQTTGALLGHVHP
FT                   GDRGRLQDTMARVLGTPDKETCQVRYRIRRPDGEDRHVQARARILRDEDGDAERLIGTY
FT                   QDVTERRRRRQKLRRSERQFEAVFQDPNLLTGLLDLDGTLRRVNDAALSFIGADRTDVV
FT                   GRPFWETPWWDHDSALQADLQGWIERAAAGEYVTYQSQHVTGNGLTFTVRGSIRPVTGE
FT                   DGTVTALIVSGRDVTAREDQRRELEVLHQAVEDSAEGMAVLAGDEYVYVDQTHAHMYGF
FT                   DDKEQLLGNTWRMLYGEDEIERLEKTVFPVLEEEGHWQGLVTGQRPDGSTFPAALSLTV
FT                   TEAGRLVCTVRDMTDRRNRNRKRQLLLTASETGIAEWDLQAGQIRWDGMLRNIFGRAPE
FT                   STDDFFALIHPEDRSRVRDGFDSVVDSASSWNGEFRIEDGDGRTRWIETLVIPIFEDGE
FT                   VGRLLASGTDVTERKERQRKLDLALAGTDTGILEWNLQTGEMQWDETLQDLFGHDPQTF
FT                   EAFTEIVHPNDLPDVEAALENMTSTGESWEGDFWLFHPEEGVARMSLRATPVHEKGEAV
FT                   RVLGIATDVTAQWERQRDLAASRERYQTLLQANPDPVLVADAETGKIVEANAAATGLLG
FT                   RPREEIIGAHQTDLHPSGRAEAYASLFRRSLDEDGPMRALPDGTQIEVVTDEGTTVPVE
FT                   VNATTVDLPDGRVVYGVFRDVSERKAMQKRLTRRERRFRMMFEGHSAPMLLIDEETGAI
FT                   EQANAAAVEFYGYDRDMLTSMSIQDINQLSAEEVARERREAAEDGDEFLFEHELASGEV
FT                   RTVRVLSAPVPNLDRGGTLLFSVIHDVTQREEHRQDLADQKAFLDQVLDTIDDVFYLLD
FT                   EQGDLLFWNRRVNEVTGYTDAELEAMTALDLFEGDDAARIRDAIEESAAGQAVRVEAPL
FT                   VTKDGRRVAHEFVGDAFDAPTRGRVLCGIGRDVTQQKERRRALRRANHRFDQFAETVPN
FT                   AFYIVTPDYSELLYANSAAETLYGVDRDTLRDDPSAWTRHVHPADLASLRSNVEAQGAG
FT                   EARWPQHQEFRVLHPTRGRRWLKAQIDGMYDDEGTLQRLAGVTTDVTDRKVREQRLRTL
FT                   YRVTQDLFDVSTKAGAASIVTDALGDTLGLQEAAVYLRDGDVLVRAGTIDSEVVGSMPR
FT                   VEQGHTPLWAALDEGDTHAYSDPSTIDDGVDRSGLAGCAYVPVGQRGVLVVGAAAQNRL
FT                   ADEELRFLETIAQSLRKALTSLTQEHDLIARERRYRTLAENIPNGAVFLFDGNLAYTLA
FT                   AGELLGTYELGESDLLGAQAGTVLVGIEGGRHPIVDRFEAALEGERTDRRIGVGGRTLR
FT                   VHVVPLQGDTNAKGLMLAQDITEDVRKERELMSAKKAAEEANRMKSSLLANMSHEIRTP
FT                   LTSILGFAEMIEEETGSLEPPAEAGDLKPLGEFAGLIQKSGQRLMDTLTGVLNLSRLEA
FT                   GEMDLAAEPVDLSEQAREVADELRPRAEAEGLRLQVQAGGEPIWAQADGGGMQIVLRNL
FT                   VSNAIKYTDDGEIRLRVYRENGSAMIEVEDSGIGMDPEKIEDLFKPFRQASEGMAREYE
FT                   GTGLGLAVTREAVEQMNGSIEVETEKGKGTTIRVQLPKEESRETDNGDVDDAEC"
FT   CDS_pept        complement(675911..676276)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23471"
FT                   /db_xref="UniProtKB/TrEMBL:D5H616"
FT                   /protein_id="CBH23471.1"
FT                   /translation="MLLYYKRKIFPDFAPRHPSLRPSLSPLGPVRICPTVTLRQSKEDS
FT                   DPPTPPVTDWFCVVDRSPAAAEEQWALADGSVVLTLSATRADAMAVADLDGVGIVRYGH
FT                   LSDSDRAALRRHLAPYR"
FT   CDS_pept        676827..677270
FT                   /transl_table=11
FT                   /locus_tag="SRM_00551"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00551"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23472"
FT                   /db_xref="UniProtKB/TrEMBL:D5H617"
FT                   /protein_id="CBH23472.1"
FT                   /translation="MPSRAAQARRQMHSGAACADMGAASVPTRISPRVYGRSWSQLAVI
FT                   AQRQGNTADPNSADEEGLPVCVFGPVKRRLTVSGICEQVEDYFVEWCPDLPAQESCNRR
FT                   LNRWVSFLPRSLLSDISCTKTQKEGGGAAKSTPITLAKGPRAS"
FT   CDS_pept        complement(677633..679840)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00552"
FT                   /product="HTR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00552"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23473"
FT                   /db_xref="GOA:D5H618"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H618"
FT                   /protein_id="CBH23473.1"
FT                   /translation="MIRDRSSTHPLRPTRFSTDMISPAVQNLNDDEALRRSTVLERVSE
FT                   GVVALDTNLRYTYVNDRAEQILDADRAQLIGRHVWDAFPESEETAAEDALDLALATQEQ
FT                   QSFERYDPSLDRWFEVRVYPDESGLSLYFTDITDRKASEQALAQKNRQLSALIENTAQA
FT                   VYVKDRAGRYQFVNEAAADLVGLSPEEAVGKRAEDLFDAESAAEIRRVDEQILADGTAD
FT                   SYEATRFIDGTKHVFLENRYPHRNEDGTIVGIVGISREITERKRREKTLEGSRQRLKSL
FT                   FEDLPDSVVIHDAEGHILDVNEQTVDELGYTYRELRSMNVADFEVGLSQEELRETWRTM
FT                   EVGDRAKKSGRHRRKDGSSFPIEVWVDKTEIGGEKRFIALTRDVTEQLQKERKLKALTE
FT                   EYHALLENAEDAIFFLDVEEEESGTEFRFERLNPYHEAATGLDSESVRGKTPREVLGPD
FT                   LGAELEANYHRCVEAGAPISYQEELDMPAGPRIWQTKLAPVVVDGTVTRIVGIARDVTA
FT                   QVHREEKLRRKNERLDEFAGIVAHDLRNPLNVAQMRTTLSVEDPDYEELHRRKVHEALD
FT                   RMEDIISDTLVLARRGNEAESLEPVSVTDIADQCWDMVETNAASLIVDDACTIEGDPDR
FT                   LRHVFENLFRNAVEHSGGDVTVRVGRADDAVLYVEDDGPGVPPARRETAFKPGETSREQ
FT                   GTGFGLSIVKRIAEAHGWGVRLTESPDGGARFEFTGVEIRS"
FT   CDS_pept        complement(680004..683219)
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="SRM_00553"
FT                   /product="multidrug efflux transporter, AcrB/AcrD/AcrF
FT                   family"
FT                   /function="Defense mechanisms"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00553"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23474"
FT                   /db_xref="GOA:D5H619"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:D5H619"
FT                   /protein_id="CBH23474.1"
FT                   /translation="MNRAIDWFARNGVAANLLMLLLLLGGGAAAFTTVQEVFPEFSLDS
FT                   VQIQVTYPGGSPEEVEQSIVRRIEDRIEGVEGIDRILGTATENSGVVTAELKRGTDLSR
FT                   ARTDIKSEVDRITAFPEEAEQPIVTEVTNRQQALQIALYGDASERTLKELAQRVKDDLT
FT                   RNPQISFVRIGGVRDYEISVEASREALRKYGMRLAEVSRIVREGSLDLPGGSVETDEEE
FT                   IVIRTEGQNYTKEDFEDIVALTRDDGTKVRLGEVASIQDGFAENSDLITRFNGEPAAIL
FT                   NVFRTGQEQVLDIEETVKTYLDDDLQASLPAGVQAAIWQNQAESLRSRLNLLIENGILG
FT                   LFLVVLTLTLFLAPRLAFWTSVGIFLSFTGTFILMQYLDVSINLLSLFGFILSIGIVVD
FT                   DAIVVGENVYAEQEGTGDPLEASIRGTQRVGIPVIFAVLTTVAAFSPLLFIGGTIGKFL
FT                   GDIPTIVIIVLLLSLVEVLLILPYHLSERPDQEPGTPTLPIRTLNRVRRWVAAQLWAFV
FT                   RGPLTTALRFATRHYGVTLVAGVSLLFISFSFASNGYIGFSFFPSVQGKLVTAQLEMPV
FT                   GTTPEATERMTARLQETGYEAIEALEAKAGQDLVENVYVAVGRQPQANSDPGAGGFTAT
FT                   QANVAEVSFEMIDPEERDITSAQFEERWRAETGRVPSARSLSFTANVVSVGKPVSVELS
FT                   APTPDKLDRTVAAVQDSLARFGGVFDIKSDQEQGKRELELSMKPGARTLGLSLNDLAGQ
FT                   VRAAFFGLESYRLQRGQNEVRVYTRLPDDQRNSIEDLSDYRIRTAAGAQVPLEEVADVS
FT                   FGYSPSQINRQDGRRVVTVTADVDPGVTTGNAVKASLQSSVLPNIQRAIPGATFTFGGQ
FT                   QRQQRKAQSALVIGFLLALFAIYALLAIPFRSYLQPLVIMSTIPFGWIGALLGHLMLDI
FT                   QLGLLSIYGIVGLSGVIVNDALVMLDFANEERAEGRDWPDALVRAGQMRFRPILLTSLT
FT                   TFLGLFPIIVEQSVQAQFLIPMAVSLGVGIVFGTAVLMMIVPSIAMFQDRAVGWVQTRL
FT                   LGYDEPVKHFGPYEERHAGDPSA"
FT   CDS_pept        complement(683216..683767)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00554"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00554"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23475"
FT                   /db_xref="InterPro:IPR012657"
FT                   /db_xref="InterPro:IPR036583"
FT                   /db_xref="UniProtKB/TrEMBL:D5H620"
FT                   /protein_id="CBH23475.1"
FT                   /translation="MLFNPTMFQRSTCKRFNAMATIERFEKLEVWKTARKLTNRVYKHT
FT                   QQEPFAKDFGRRDQIQRASVSVMSNIAEGFESRTQSIFVDHLGRARGSAGEVRAQLYVA
FT                   SDQGYLSDAEFEATYDLADKASRQLFRLIQYLESKPNASRVREKPASGRKASSTKSTWT
FT                   HRSDLLRPNVPTSNVPTFQR"
FT   CDS_pept        complement(683815..685065)
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="SRM_00555"
FT                   /product="Efflux transporter, RND family, MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00555"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23476"
FT                   /db_xref="GOA:D5H621"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="UniProtKB/TrEMBL:D5H621"
FT                   /protein_id="CBH23476.1"
FT                   /translation="MDTSTLKWALIGGGLLLGTAVVVALLTVFAPAPETSDPPPQSPLV
FT                   STVPVDVRAGSLLVRGTGTVRPVREIELTAEVGGRLVDVSDALVSGGRFDAGATLARID
FT                   PADYRSAVQQAEAQVTQARVQLLQAQEEAGAAREDYERLRGRTGETPAPDSTELGRLVF
FT                   NEPQVAQAQSTLESARAALQNARTNLERTRLQVPFDGMVRQKQADLGAYVAPGTPVATV
FT                   YGTEAAEVVVSLPSRKAALIENLWATSGQSADAGLPATVTSAYGDQTYSWEGRVHRVEG
FT                   AIDQRTRTVDVVVRVPEPYNQAPTIQSRRPEVPPEPRGRTRPPLAIGTYTTVDIEGRRN
FT                   GTYHVVPRRAVHTREPGQPPVVWTAVGDSMLAERTVEPIQTVEENTYLAPTLDPDARVI
FT                   TTDLRVQTDSMAVRVER"
FT   CDS_pept        complement(685124..686614)
FT                   /transl_table=11
FT                   /gene="sepC"
FT                   /locus_tag="SRM_00556"
FT                   /product="efflux pump outer membrane protein"
FT                   /function="# Probable outer membrane component of the
FT                   sepABC efflux pump with unknown specificity."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00556"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23477"
FT                   /db_xref="GOA:D5H622"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:D5H622"
FT                   /protein_id="CBH23477.1"
FT                   /translation="MIGSRLLIASFLLGMLTVAGCSMTPEMSTPEAEQDLPDRFEAAPG
FT                   DTTLPAAAADTAAYDATRWWAAYEDPSLTALVDTALAANLNLEEAQGRVEELAAQFRIA
FT                   RAPLFPSVTANGQGNYQNQPANTGIGGAIGGGQGPDRFEFTDYQATLGLSYELDFWGRV
FT                   RSQRTAALSQYFATAADLQTARLSVISQTISTYAQIASLRRQVRLGERTVGLLEERVAV
FT                   TEDRYARGLVPSFQLYTVRQSLQAAQADQPDLERRLYEAQSRFATLLGRFAGEQRALLP
FT                   DSMTVPLAPEPVPAGLPADLLMQRPDVRGAALRLEAARQEIGVARAEMLPSLSLTGQGG
FT                   TQSSELADLVDPGQVFASFAGQLTAPLFQGGQLRANLNAAEARYKQQAARYEQTVLTAF
FT                   QEVKASLVAYEKQRQRYREVERQVDTARDAFQAQRDRYERGVGDVLSLIDAERTLLQAR
FT                   TRLAGVRRAVTNARLALHRALGGPWTDAEPVDDPRLFR"
FT   CDS_pept        complement(686655..687593)
FT                   /transl_table=11
FT                   /gene="acrR"
FT                   /locus_tag="SRM_00557"
FT                   /product="transcriptional regulator, TetR family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00557"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23478"
FT                   /db_xref="GOA:D5H623"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:D5H623"
FT                   /protein_id="CBH23478.1"
FT                   /translation="MSDGRRGVVFRGCRRLSGKPIAAPATGPGRDRTALVPFGEPAPPS
FT                   RRPWSATPRRGDAFLYTTVNHLVEPSSGPSITAITSAPDALSMPPPSPFPSEYSETERQ
FT                   IFDAALHVFAREGRHGARMQAIADAADINKAMLHYYFQDKGTLYEEVFTYTVERFMASF
FT                   GASLREASTFEHTLRAFIDGYVEFVRSDEAAMRLMVQENLAGGRLLGTHLREATNAGDA
FT                   PPQILVETIAAAVDAGEIRDVDPQHTVLSVVSTCLFFFMARPTVQIMHPDAEDDWGAFV
FT                   EARKEHLFDLIYHGLAPRPEGGSGSRAAPRE"
FT   CDS_pept        687606..688124
FT                   /transl_table=11
FT                   /gene="rot"
FT                   /locus_tag="SRM_00558"
FT                   /product="peptidyl-prolyl cis-trans isomerase"
FT                   /function="# PPIases accelerate the folding of proteins. It
FT                   catalyzes the cis-trans isomerization of proline imidic
FT                   peptide bonds in oligopeptides."
FT                   /EC_number="5.2.1.8"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00558"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23479"
FT                   /db_xref="GOA:D5H624"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:D5H624"
FT                   /protein_id="CBH23479.1"
FT                   /translation="MPFCRCPLLAMADHPQWDHPPDLQIDTDAVHEATFETSKGTIHAE
FT                   LYPEHAPHTVNNFAFLADEGFYDGTPFHRVIEGFMVQGGDPTGTGRGGPGYEFDDEIDG
FT                   NPLTHETGVLSMANAGPNTNGSQFFITRAPQSHLDGKHTVFGDVTDGQDVVDAIEESDT
FT                   LKSVTVEKQ"
FT   CDS_pept        688473..689885
FT                   /transl_table=11
FT                   /gene="met17"
FT                   /locus_tag="SRM_00559"
FT                   /product="O-acetylhomoserine sulfhydrylase"
FT                   /function="Transforms O-acetylhomoserine into homocysteine"
FT                   /EC_number="2.5.1.49"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00559"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23480"
FT                   /db_xref="GOA:D5H625"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006235"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5H625"
FT                   /protein_id="CBH23480.1"
FT                   /translation="MSTCVLFIQRADLSMSAQNGQHDPQESERPDAPEAPRYETRQLHA
FT                   GQEPDPATNARAVPIYATTSYTFDDAEHGADLFALEEFGNIYSRIMNPTNDVFEKRVAA
FT                   LEGGVAAVATASGQSAQFLALNTLCEHGDNIVSTSYLYGGTYNQFKNSFPRRGLDVHIA
FT                   DGDDPDSIERLIDADTKAVYLETIGNPRFNIPDFERIADIAHAHGVPLVVDNTFGAAGF
FT                   LCSPIEHGADIVTASATKWIGGHGTTIGGVIVDAGTFPWDNGGFPEFTEPNPNYHGLQF
FT                   WETFGPDGVLDTNVAFAMRARVEGLRDFGPAQNPFGSFLLLQGLETLSLRVQRSCDNAL
FT                   ALAKWLREQDAVSWVSYPGLEDHPYHERANRYLENGYGAVLTFGVEGGVDGGKRFVENV
FT                   ELASHLANVGDAKTLVIHPASTTHQQLTEEEQQASGVEPDMVRVSVGIEHIEDIKADFD
FT                   QAFAELPSPAAS"
FT   CDS_pept        690016..691074
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="SRM_00560"
FT                   /product="Homoserine O-acetyltransferase"
FT                   /function="catalyses the first step unique to methionine
FT                   biosynthesis, converting L-homoserine to O-acetyl-L-
FT                   homoserine using acetyl-CoA as an acetyl group donor"
FT                   /EC_number="2.3.1.31"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23481"
FT                   /db_xref="GOA:D5H626"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H626"
FT                   /protein_id="CBH23481.1"
FT                   /translation="MSQTLTVPTLTLENGTTLRDVPVAYRTWGTLNATGTNAVLVCHAL
FT                   TGDTNVADWWGGLLGPGRALDPTEDFVVCLNVPGSPYGSVAPVTVNPDTGERYGAGFPP
FT                   FTTRDTVRLHRRALETLGVQRVACAVGGSMGGMHVLEWAFEATDGGAPFVRSLVPIAVG
FT                   GRHTAWQIGWGAAQRQAIFADPKWRDGTYPPDDPPTNGLATARMMAMVSYRSRPSLDGR
FT                   FGRDAMPEQDGTPYAVESYLHHHGNKLVDRFDANCYVALTRQMDTHDVARGRSDYAEVL
FT                   RGIEQPSLVVGIDSDVLYPLSEQEELAEHLPSATLEVLSAPHGHDTFLIELDALNDLVS
FT                   TWRANICPSVAA"
FT   CDS_pept        691206..692159
FT                   /transl_table=11
FT                   /gene="lysC"
FT                   /locus_tag="SRM_00561"
FT                   /product="Aspartate kinase"
FT                   /function="Catalyzes the phosphorylation of aspartate"
FT                   /EC_number="2.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00561"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23482"
FT                   /db_xref="GOA:D5H627"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:D5H627"
FT                   /protein_id="CBH23482.1"
FT                   /translation="MPDRSSSSTECASRPVRVLKFGGTSVGSADGIKNAVRLVHAATET
FT                   CRPVVVVSAAAGVTDALVQAAEESRADRGSVEAWTRRVGRRYRALAANTLADEALRARY
FT                   DTALRAELSELRRALQEMAGPNAAAARDVVLAAGERLMVPLLAAALDASGCTSQAVDAA
FT                   TLIRTDAAHGDATVQWAPTRRQVRDWHRTRAAGLPVVTGFVGETADGKTTTLGRGGSDL
FT                   SAAVLAWALAAERMERWTDVEGLYTRDPDAHSDAQPLQRIDFEQARAWTKAGRLGMHPC
FT                   TLDPLMDAGIPLRVRCTHRPAAPGTRIVPAPTLAQG"
FT   CDS_pept        692180..693307
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="SRM_00562"
FT                   /product="bifunctional aspartokinase/homoserine"
FT                   /function="Catalyses the first and third steps of
FT                   methionine and threonine biosynthesis"
FT                   /EC_number="1.1.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00562"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23483"
FT                   /db_xref="GOA:D5H628"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H628"
FT                   /protein_id="CBH23483.1"
FT                   /translation="MMASHSFSASPPVAPSTSSCPSPVHVYVAGVGDVGAALLRQIDAR
FT                   GDAGRDLRVIGACTSRRAAWGAPNRDPEAPLAGVDEAAPPDWPAIVDRLAQETPRPLVF
FT                   VDATGSPDVADYYEPLLRAGVHVVTPSKLANTRSQAAFDRLREAAAEAGVQYRYETTVG
FT                   AGLPVVQTVRNLVATGDRVRSIRGVVSGTLTFLFSALRDGSSFSEAVRAAVDRGYAEPD
FT                   VRDDLSGTDVARKFLILARTAGYAVEPTEVQVESLVPDSLADAPYEAFLDRLSTVHPYW
FT                   RERSAAAAAESAVLQYVGRFSPEGIEVGVEPVPGDTALGQLGAQENLFEVTTDRYAAVP
FT                   LVVRGPGAGPSVTAAGVLADVLTAVREARPPSPPA"
FT   CDS_pept        complement(693480..697520)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00563"
FT                   /product="histidine kinase-response regulator hybrid
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00563"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23484"
FT                   /db_xref="GOA:D5H629"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011123"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H629"
FT                   /protein_id="CBH23484.1"
FT                   /translation="MQGPPSPVPRSDDFVWMLHSAVKRYGIRLACGVVVGALLLSSPAA
FT                   AQNKRITAYETEDGLPEMQVWDGLQGPEGYLWLGLYGGGLARFDGQEFKRLTIDEGLPG
FT                   NLATTVHTDSTGAIWVGTLSGLARYDGREMTTLTADNSALVQNGIQSIVGGTNGTPVWV
FT                   GTSDNVYVHDGEGLRQLAPDRLQNLYPDGLASRGDTLWVGTSNGLYRYTDSTLTALSVV
FT                   DGGATASVTTLAAPPSGRLWVETGQGLFRRVGSRFEKLPGTSDRDVLSILDPSGRAPWL
FT                   GTRSGLYRWRGGRLQSTAIGDVSVQGLFEDQEQNVWVTTDSEGLYKYPHTPFDHFSTAD
FT                   GLPGDISWDVDRGPNENLWIATRNGLSRYDGTSFTDVPGPDDQLRQELTSIHWTQDDIL
FT                   WIAARSTLFRYDGDTYTSYDRVEGDPVGTVTRIVETPSGTLWFATTERGLLRYDGSGFA
FT                   RFTTADGLTSDQVRSVTVDDTGQVWAGEGASRFDGASFHPTPAVDSADLGGVLSLEVDA
FT                   KGHLWIGTQRGVFVHPPPQRGEAASLRRITPDDGLNGTSSVNLHLDRHNNLWVGNEGGF
FT                   NRIDVDAYHRTGQVSIRSYDKDVDLRGGVATEHATYEADGGVLWFGTSTGLVRYNPVQD
FT                   RGRPAPPQTHLTDIQLYPEDPDWSRYADGTTPWEQLPTNLSLPYDKDHLIFRFIGINYT
FT                   VPERVAYRYRLEGLDERWSTATKRQRATYSNLPPGSYTFQVQAANSDDVWSPVEAYSFT
FT                   ITPPFWRTTWFYLLCAIGGIGLVTGLIRWRTWSLQRRQRLLEAKVAERTEELEEAREEA
FT                   LAAAEAKSKFLANMSHEIRTPMNGVIGFADLLSDTDLTPEQQQFVDAIQSSGTTLLSII
FT                   DDILNFSKLEAGETELEEAPIRVQTCIEEALDPLAAKVAEKGIELTYLIDPAVPSVIRG
FT                   DRTRLHQILLNLLSNAVKFTEEGEVALRVRVASSPATPDGMYELHFSVRDTGIGIPKEK
FT                   RDRLFESFSQVDASKSREHGGTGLGLSISQQLTEAMGGEMWVESAVGEGSTFHFTIEAE
FT                   EAEDGAQTDKNGVATGSSSAMQGVQVLIVAPNDTNRALLRQQTETWGMEATVFASGDEA
FT                   LQQLDADRAHEVALIDEHLPQMSGHALATQLRERASGTELPVVLLGAGPAATPDLTAPT
FT                   SRLHKPIKQSNLHDTLTALLTGRENGGSGRDGDRSGPDSPSRRVLLAEDDAVNRTMTTQ
FT                   LLEKMGHEVYTASDGAEALAAVRDQAYDAILMDVQMPELDGLEATRRLRNEMPSEEQPY
FT                   VVALTASVTEDDRRRCLEAGMDAFLSKPIRKDELAEALDLGTAPDEARTAAPPPEDHSA
FT                   PDA"
FT   CDS_pept        697773..697979
FT                   /transl_table=11
FT                   /locus_tag="SRM_00564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00564"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23485"
FT                   /db_xref="UniProtKB/TrEMBL:D5H630"
FT                   /protein_id="CBH23485.1"
FT                   /translation="MRGRLVEGAYRDVRSSLRQPCRFCFRPAAGRTALQCPSATLVDDA
FT                   NALLSPILLAVQAFPLVASTIGR"
FT   CDS_pept        complement(698135..698866)
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="SRM_00565"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00565"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23486"
FT                   /db_xref="GOA:D5H631"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D5H631"
FT                   /protein_id="CBH23486.1"
FT                   /translation="MAEMQLNLEIKRYNPEEDDEPHWESYEVPADPLDSALSLLLHVKW
FT                   HIDGTLSLRKSCAHGICGSDAMQINGENKLACSVLVQDLVDEDGDTITYAPLPSAPVVK
FT                   DLIIDQSRFFEKYREVKPWLITDGPAPEREREQSPEEHAMIEDATKCIMCGACTHACPS
FT                   TWADPDYLGPAAMLKAYRYTFDSRDDGAEERLDVVDSPDGLWKCYTIFNCNEACPKDID
FT                   ITRWLSALKRRAATSQASTTA"
FT   CDS_pept        complement(698953..700788)
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SRM_00566"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /function="Succinate + acceptor = fumarate + reduced
FT                   acceptor."
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00566"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23487"
FT                   /db_xref="GOA:D5H632"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D5H632"
FT                   /protein_id="CBH23487.1"
FT                   /translation="MRIGAIGTSQILHAIRNTQHEIRNTKYATRTMTFEHDVVVVGAGG
FT                   SGLMAALYAREGGADVGVVSKLHPLRSHTGAAQGGIAAALGNEEEDHWLWHAFDTVKGS
FT                   DYVGDQDAIEALCKDAPRTIVELEHYGVPFSRNEAGKISQRRFGGHTRNFGEAPVKRSC
FT                   HAADRTGHTILHTLYDQCTKQGVRFYDEFQVLDLIMTEDGECAGVVAYEILTGEIHTFH
FT                   AKQVCFATGGYGRAFETTSNAHAGTGDGMGIMLRNGIPLEDMEFVQFHPTGLYRLGILI
FT                   TEGARGEGGILRNSEGERFMERYAPTVKDLAPRDLVSQCIYQEIREGRGVQGENYVHLD
FT                   LTHLDNAILDNKLPEVTEFSRTYMGVDPKEEPIPVVPTCHYAMGGIPANEDGHVEVGER
FT                   GEYVPGLYAVGECACVSIHGANRLGTNALLELVVMGRRTGIEMAKQVRQGKDYAPLPEK
FT                   PEVDTRDMLDDLLSNTRDEGEPIVNVRSELQETMMENVSVFRNDDTLSTALDDLQGLRK
FT                   RAKNVVVDDKSKRFNTDLMDAVEVGFMVDYAEAIAAGARHRTESRGAHSREDYEERNDE
FT                   DWLKHTLFHSDGNGSYEFDDKDVVITRFEPKERSY"
FT   CDS_pept        complement(700812..701264)
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="SRM_00567"
FT                   /product="Succinate dehydrogenase flavoprotein subunit"
FT                   /function="Succinate + acceptor = fumarate + reduced
FT                   acceptor."
FT                   /EC_number="1.3.99.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00567"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23488"
FT                   /db_xref="GOA:D5H633"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:D5H633"
FT                   /protein_id="CBH23488.1"
FT                   /translation="MAQTNALNWFLHRITGTFLIFMLITHFWVQHYDHQAASVTHEVVT
FT                   EKNEMPDYPDEAKEGVKARFGPDAEATPYQVVMQRLADPVYAVLWKGFNILFLVVALHH
FT                   GFYGLNNVMTDYIRDPMGRLVAKSLSWTVALGLLIIGTYSVLTAGW"
FT   CDS_pept        complement(701317..701778)
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="SRM_00568"
FT                   /product="Succinate dehydrogenase hydrophobic membrane
FT                   anchor subunit"
FT                   /function="Putative hydrophobic component of the succinate
FT                   dehydrogenase complex"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00568"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23489"
FT                   /db_xref="GOA:D5H634"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:D5H634"
FT                   /protein_id="CBH23489.1"
FT                   /translation="MAVDTKERPSAPQETNATAEQESRFQSYRIRTGMFAWMMHRLTGV
FT                   GLVVYLIVHIWGLTALTDPETFNALIAKYHSPIFKVGEFALLVAVAYHAMNGLRLVLID
FT                   FLGWSPKQKKLFWTLGAVTAVIIAVGGWPSIYALGEWLLGPGSMPTLFL"
FT   CDS_pept        complement(701943..703298)
FT                   /transl_table=11
FT                   /gene="gltA"
FT                   /locus_tag="SRM_00569"
FT                   /product="Citrate synthase"
FT                   /function="The exact function of the plasmid-encoded
FT                   citrate synthase is not clear, it could help nodulation by
FT                   allowing the bacteria to use citrate as a chelator of iron
FT                   and calcium."
FT                   /EC_number="2.3.3.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00569"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23490"
FT                   /db_xref="GOA:D5H635"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR011278"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR024176"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:D5H635"
FT                   /protein_id="CBH23490.1"
FT                   /translation="MLLCSGKTPAWAGPRGLLQKRSRADSLNAGLSKCPACLRPCPFGR
FT                   DGHAVSIPLRLSPHTFFDMADQESVTELTTDKAPIKARGLEGVIALESELSSIDGDKGQ
FT                   LIYRGYDIHDLADHASFEEVVYLLRHGELPTQSELDDFSSHLRSERALPAPILNLLRET
FT                   PADAHPMAVLRTAVSALALYDEEADTMEEAANHRKADRILAQIPTIIAAFDRLRKDKEP
FT                   VAPLDHGSMAHNFLYMLNGEKPGAAAEDTFDVCLVLHADHGLNASTFTSRVIGSTLSDM
FT                   YSAVSGSVGALKGRLHGGANQEVMRMLLDIDAKGADPTSYIRDRLDADERVMGFGHRVY
FT                   NTMDPRAAILRTMVKELSKEAGDMKWYEYTTKIHETMTEETGIDPNVDFFSGPTYYQLG
FT                   LDPDLFTTIFALSRTAGWTAHLLEQWADNRLIRPRAQYVGARDRTVAPIAER"
FT   CDS_pept        703915..705705
FT                   /transl_table=11
FT                   /gene="rne"
FT                   /locus_tag="SRM_00570"
FT                   /product="Ribonuclease E"
FT                   /function="Matures 5S rRNA from its precursors from all the
FT                   rRNA genes. It also cleaves RNA I, a molecule that controls
FT                   the replication of colE1 plasmid DNA. It is the major
FT                   endoribonuclease participating in mRNA turnover in E.coli.
FT                   It initiates the decay of RNAs by cutting them internally
FT                   near their 5'-end. It is able to remove poly(A) tails by an
FT                   endonucleolytic process."
FT                   /EC_number="3.1.4.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23491"
FT                   /db_xref="GOA:D5H636"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D5H636"
FT                   /protein_id="CBH23491.1"
FT                   /translation="MSKEIVFNVGNEQTRIAIVEDGKLVELYIENAEHKRTIGNLYLGQ
FT                   IRKVMPSIQAAFVDIGQEQDAFLHFSDLSDNLPYLLDFLGLEAPTVEAIDVPKGKKDWD
FT                   KRPSDLLNRGQTILVQVTKEPISNKGSRISTDISLAGRFLVLVPLQNYVAVSRKITDDE
FT                   ERRRLESLASSLVPDGVGVIVRTVAQDRDAKSLDKDMKLLMERWRRVEKRLKDKPSPPE
FT                   LVHEDVDMASSIVRDEFSEEYDRILVDHEGLYSSIQSYVRAVGPQLVDRVELHEGDQPV
FT                   FESVGIQHGADRAFKDRVELPSGGYLFIEKTEAMHVVDVNSGRSGKGKSQAENSLNVNL
FT                   EAARVIARQIRLRDLGGIIVVDFIDLRDEDDKKKVYDEVKKGFEEDRAVTKVLPMSDFG
FT                   LVEITRQRLRPSITTTFSSANGTPSDDGDDGADPEELRQAERKIQSLEKEVEKREREVK
FT                   RLKAEDDTPDEEVTALRQKIQVLEDKLEAARAQQTAENATPRPSSSDGSAASAEGDAAP
FT                   DELVEDIEQWLVAHSDTPRAVTLRVHPFVAAFLRRPVPTYTTRWFMEHLVRVHVEADTE
FT                   VPPHTFQVTDESGAPLPESP"
FT   CDS_pept        705788..706072
FT                   /transl_table=11
FT                   /locus_tag="SRM_00571"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00571"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23492"
FT                   /db_xref="UniProtKB/TrEMBL:D5H637"
FT                   /protein_id="CBH23492.1"
FT                   /translation="MDTTTIIDELEGVAARLGIEVRAEAGNFRGGRCVVAGEEVIMLNT
FT                   NDLPETQLVVLAEALRDAPLDTIYLKPAVRRALEEAWAEHMSAEAPHDH"
FT   CDS_pept        706062..706925
FT                   /transl_table=11
FT                   /gene="phnP"
FT                   /locus_tag="SRM_00572"
FT                   /product="metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00572"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23493"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D5H638"
FT                   /protein_id="CBH23493.1"
FT                   /translation="MTTSPHVSTDVPPADRHARTPPVTATLLGTGTSTGVPVIGCDCEV
FT                   CTSADPRDTRTRCACYVEVGDMGLLIDTGPDFRAQALREDIDRIDAVCYTHHHFDHVVG
FT                   LDDLRPYFRDNRRVMPCYAHAETAAVLRRNYDYVFGGDPYPGAANVELEVVDGPFRVPS
FT                   RTADDTAVPVDPILLMHGDVPVYGYRLGRFAYLTDASAIPEASYEQLQGIDTLVLDGLR
FT                   PRPHPTHFSFDEAVAAARRIGARETYLVHMTHDVRHAEAEAALPDDIHLAHDGLTLEVP
FT                   AFDPAV"
FT   CDS_pept        complement(707213..708118)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00573"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00573"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23494"
FT                   /db_xref="InterPro:IPR025665"
FT                   /db_xref="UniProtKB/TrEMBL:D5H639"
FT                   /protein_id="CBH23494.1"
FT                   /translation="MTCQAALHIYPITPLTWFCRATIRVVCPQFSSPMPALRLPLSCRF
FT                   LLLVGLCLQFLPSPASGQTHTSLFASALDGRRDAQTIESLRRADASTGAQSSPVDLQPG
FT                   IRVGLNFATFGGDEAETIQTLLRGVPTVSETDAGRRTGFMVGGFIVADFGGLLALQPGV
FT                   RYIQKGDQTAFTVRNSDGEPESGSITSKADYVEVPILARAELPEIGAVVPHVLAGPTLG
FT                   FSVNTAADVTLGGESQGINVGDDLGGNAISLDFGAGADVETEAGTVTVDARFGLGLSDV
FT                   PGLRFSAQNRGIMVTVGVVF"
FT   CDS_pept        708309..708737
FT                   /transl_table=11
FT                   /gene="aroD"
FT                   /locus_tag="SRM_00574"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /function="Catalyzes a trans-dehydration via an enolate
FT                   intermediate"
FT                   /EC_number="4.2.1.10"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00574"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23495"
FT                   /db_xref="GOA:D5H640"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:D5H640"
FT                   /protein_id="CBH23495.1"
FT                   /translation="MPLLVLNGPNLNLLGVREPETYGTTTLADIEADLTAAFLKVTLRF
FT                   AQENSEGALIDHLHAAHEDGVDGVVFNPGGYTHTSVALRDAVAAIDPPVVEVHLSNVHA
FT                   REDFRRTSRIAPACVGQMSGFGAAGYRLAVEYFVNRDT"
FT   CDS_pept        708906..709382
FT                   /transl_table=11
FT                   /locus_tag="SRM_00575"
FT                   /product="Conserved hypothetical protein, membrane,
FT                   containing DUF457"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00575"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23496"
FT                   /db_xref="GOA:D5H641"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D5H641"
FT                   /protein_id="CBH23496.1"
FT                   /translation="MAGYKGHIAGATVFGGAYLAALGYAFSVDAAYRQFTALEQVGYPL
FT                   ALLALALLFGLWPDVDTDSKGQEIFYSIFFAVDLFLVVTEQFRAAAYLGLVAVLLVLST
FT                   HRGWTHTWWAMVLVPSPLLILPYLHVPGRPLVGLPFYGAAVVGYLSHLVVDRLW"
FT   CDS_pept        709481..711178
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="SRM_00576"
FT                   /product="integral membrane protein MviN"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00576"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23497"
FT                   /db_xref="GOA:D5H642"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:D5H642"
FT                   /protein_id="CBH23497.1"
FT                   /translation="MGDEAETVSAEAESASDAEGESAAGSVAGGIFLSRMFGLLRERAV
FT                   AYFFGVGAHADVLQVAFKSPNLLQNLLGEGTISAAFIPIYSRLLDEDRPAAAGRFAGAI
FT                   FGLLLAAAGGVALLGVVFAEPIVTVLAPGFLDDAARVAAGDLPFNRFDLAVRAVRLIFP
FT                   MAGVLVLSAWALGVLNSHRQFFVPYVAPTLWNAVIIATLFGGGYVLAGTPGAPDALSSD
FT                   ALTQLLLVACVGAFGGGLLQFGVQLPFVVREMEGFSLSLSTRVEGVREALSAFGPVVAS
FT                   RGVAQLSAYLDLFLASWLAVGALSALRYAQLLYMLPISLFGMSVAASELPELSRLTQEK
FT                   VAAFSARLRRSLRQIAFLTVPTVVGYLAFGVLLVGALFRTGQFQAASTWLVAIVLGGYS
FT                   LGILATTFSRLLQNAFYAIGDTTTPAWIAVLRVTVSTLVAVPAMFWLDTIGLERVVGPL
FT                   SGDALFLGALGLSLGATVGAWVEVAALRHWLRGPLPDARIPWGPVGRMLGLALVSLGPG
FT                   AAAWGLLPSWHVLLVAPLVVAAYAAAYLGAAWGLGVGEIEAWTRRFFG"
FT   CDS_pept        711316..711882
FT                   /transl_table=11
FT                   /locus_tag="SRM_00577"
FT                   /product="Conserved hypothetical protein containing DUF179"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00577"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23498"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:D5H643"
FT                   /protein_id="CBH23498.1"
FT                   /translation="MPDSDEVDLGPGTLLISAPMMQDPNFRRSVVLLCEHNDREGTFGL
FT                   ILNRELDVSLGDVLDEYVTYDPPLYMGGPVQRETLHYLHTREDIPGGVALPGDMTWGGD
FT                   FEAVQQLAKGGDAAPDNLRFFLGYAGWGPGQLEGELGEEAWIPAPGAAEFVFDTDPDQL
FT                   WRAILRRMGGEYAVLANFPDDPRMN"
FT   CDS_pept        712083..712802
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="SRM_00578"
FT                   /product="NADH dehydrogenase I, I subunit"
FT                   /function="May donate electrons to ubiquinone."
FT                   /EC_number="1.6.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00578"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23499"
FT                   /db_xref="GOA:D5H644"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D5H644"
FT                   /protein_id="CBH23499.1"
FT                   /translation="MPGTPENTKKENERDLNFWESLYLPELFKGLGYSFDRMANEPTYT
FT                   FEYPEEQWYPPDSYRGRPVLVEEDDRPRCVSCNLCARACPPLAISMQSKEVNNVKEREP
FT                   EWFEINMLRCIYCGFCEEVCPEEAIVMSKEHDLTFQSRDEAVFDLDDLLRPSEQMQDRL
FT                   EYLDQYKNKQFGQQWDFKKENNLHSVKDQHFLDWLAEEGMDDLDTTHQRDDRMATEGDQ
FT                   DWGGDRQGPPQTTHAAE"
FT   CDS_pept        712921..713472
FT                   /transl_table=11
FT                   /locus_tag="SRM_00579"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00579"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23500"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D5H645"
FT                   /protein_id="CBH23500.1"
FT                   /translation="MEETIDIAEARAEDPEALRDALVDQFGYLVDEITALRTVVDGLPD
FT                   EILGGRPEPDAFTMKELYGAIATLDAEVRRTRVDRIVDEEEPDLAPVDVDAEVYDAGWN
FT                   DRAIDDILQEVKGARRALTERLEKLPLDAWHRAATLEDETLTLFGLVHRMTKNDFQRLR
FT                   DLGYRLHGAHLSEDDEPLPT"
FT   CDS_pept        713551..714594
FT                   /transl_table=11
FT                   /gene="holA"
FT                   /locus_tag="SRM_00580"
FT                   /product="DNA polymerase III delta subunit"
FT                   /function="DNA polymerase III is a complex, multichain
FT                   enzyme responsible for most of the replicative synthesis in
FT                   bacteria. This DNA polymerase also exhibits 3' to 5'
FT                   exonuclease activity. The delta subunit seems to interact
FT                   with the gamma subunit to transfer the beta subunit on the
FT                   DNA."
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23501"
FT                   /db_xref="GOA:D5H646"
FT                   /db_xref="InterPro:IPR005790"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR010372"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H646"
FT                   /protein_id="CBH23501.1"
FT                   /translation="MAKDTGPAYDDLATAFRHQNFEPLYFFFGEETFLIDELQELLIDE
FT                   ALDPSQHDFNLDVVYGSETEASEVIGLCQGFPAGAPKRVVVVREFEKLENNRQFKDYAA
FT                   QPNPQSIVLLACTSKPNLSAHPYRALKEHATWSEFESPYDNEMPGWIQDYVQGQGYEIK
FT                   PKAVQMLADYVGTDLQRAASEIEKLITFAGDATRLTADDVLAASGQTREFNVFELQSAL
FT                   GEGRPADAQRIVDRILQQASNPRSEAIMMVAVLNGYFDKLWKLQKPGALRENKYDLAGY
FT                   IGVSPYFVEEYKHAAQRYDRSAIADAYSALVAADYELKGGASREASLVMTLLLRRLLPP
FT                   DARPVAA"
FT   CDS_pept        714572..715489
FT                   /transl_table=11
FT                   /locus_tag="SRM_00581"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00581"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23502"
FT                   /db_xref="GOA:D5H647"
FT                   /db_xref="UniProtKB/TrEMBL:D5H647"
FT                   /protein_id="CBH23502.1"
FT                   /translation="MPVRWRRRGRAFPDGDASSPRRRSDPFAPARPGIHGNKECVARIR
FT                   IDDGPPPGSAARVRTAWDDRFPTSWGPRAARRRISCHGLRRKRTSGEPPFMQFPERPFD
FT                   GEASGDGAPSYEWLDEWLCEYVDGTMDPSVEAVFEQYVEANPELRAHIERLRQTRELLC
FT                   GGEDTGAPPTAPMEAAREVEEDLLRDAAPELLASEETSRSVVALGLASSIAMALVVGFL
FT                   AGSMLVEPSTLSSGPATAIERQAAPSEGGDEASPRRGAADRGRPPRASSFSSADRLLTL
FT                   PAEAPSPSTDTGRAAPTFMTAGER"
FT   tRNA            715566..715642
FT                   /locus_tag="tRNA_7"
FT   CDS_pept        715847..716407
FT                   /transl_table=11
FT                   /locus_tag="SRM_00582"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00582"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23503"
FT                   /db_xref="GOA:D5H648"
FT                   /db_xref="InterPro:IPR021515"
FT                   /db_xref="UniProtKB/TrEMBL:D5H648"
FT                   /protein_id="CBH23503.1"
FT                   /translation="MLPVLIRLDFVLATALLVAAPLGLLLASVRRPAVRGRLLAYWRAS
FT                   SLLMVTVYLMVDGRPGAFVAGNTALVAIPLALHAGDVLFVPGPASLGEGPVATWFRRWR
FT                   AGATAFCGASLLLTVPALRCAWEGAENPVCAAWLAPPRELHRALHASVDPATLGDAAVI
FT                   GGLIYGAYLVASVIRVGWAVWRS"
FT   CDS_pept        716470..716874
FT                   /transl_table=11
FT                   /gene="etp"
FT                   /locus_tag="SRM_00583"
FT                   /product="Low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /function="Dephosphorylates etk"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00583"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23504"
FT                   /db_xref="GOA:D5H649"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D5H649"
FT                   /protein_id="CBH23504.1"
FT                   /translation="MSAQYLFVCTGNTCRSPLAEALAEARGVSAESAGVAAGPGDGAAP
FT                   NADRALREARGLSLRGHTPRDVSAVDLTAAGRIVAMSPAVARRLRDDHDWAPDAMVTWA
FT                   VPDPYGGSLADYRWCLEEISAALDDLLASG"
FT   CDS_pept        complement(716956..717423)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00584"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00584"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23505"
FT                   /db_xref="UniProtKB/TrEMBL:D5H650"
FT                   /protein_id="CBH23505.1"
FT                   /translation="MGHISPKARSLGGGPGFFLCRYAIFAVLSRTIRLPPPPRGWEGGN
FT                   GDDPHALGTDGCSPQVCVSHSSFAPMPTYTIIGFEKDGFDPFSSVATADTPAEAAQKAI
FT                   QDTFIKTQGRRPPNTEALAQLENETGLFVVGIVEGGHDNLNEIVDHYEQWD"
FT   CDS_pept        complement(717513..718301)
FT                   /transl_table=11
FT                   /gene="spoU"
FT                   /locus_tag="SRM_00585"
FT                   /product="Putative RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00585"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23506"
FT                   /db_xref="GOA:D5H651"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR013123"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:D5H651"
FT                   /protein_id="CBH23506.1"
FT                   /translation="MPTPLSNRRRKAIAALTRRRGRRRHDRTLVEGPRALRAALDADAP
FT                   LVEVVVTPEGRGDPTVQALLEQLSVSVHETDPDTMTTLTDVETPQGVVAVAERRLRDPE
FT                   TVPEQIGEAGTVLVLDGIQDPGNVGTLLRTAAWFGAQAVVAGPGTAGLYGPKVMRAGAG
FT                   SHWALPLARTDAPGPFLDRLRRHGAALYGADLQGTRADAWGPDRPSALVLGSEAHGLSA
FT                   AVLDRLDLTVSLPGAPDRPAAESLNVAVAGGILLYEWLGP"
FT   CDS_pept        718521..720050
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="SRM_00586"
FT                   /product="Glutamate dehydrogenase"
FT                   /EC_number="1.4.1.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00586"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23507"
FT                   /db_xref="GOA:D5H652"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H652"
FT                   /protein_id="CBH23507.1"
FT                   /translation="MWDLSDRMGRLSLPEVWAPNRVWSDGLCSCNCPGGTVGRSTFWRR
FT                   IRIFLVPRPASFGKAERPSVHHHRILVRSPMPFNFDVYERSAYREPAPIDHDSPFQSMM
FT                   ERFDVAAEILELSPGFYEYLCRPARMHVTSIPVEMDSGRVKIFEGYRVIHNNVLGPSKG
FT                   GIRFAPDVTLNEVKALAGWMTWKCSLVDLPFGGAKGGVACNPEEMSPGELERLTRRYTA
FT                   DLFDVFGPDKDIPAPDMNTNEQIMAWVLDTYSMHARQTENAVVTGKPVGLGGSKGRRQA
FT                   TGRGVMTVTLAAMEQIGLAPGDCTVAVQGFGNVGATAADLLGEQGCTVVAVSDITGGYY
FT                   NENGLDLKAMKAYTQQNGGTLAGYEEAQHITNEELLTLDVDVLVPAAKEDQINREIAED
FT                   LRARIVAEGANGPTHPAADEVLAEKEVLVIPDILANAGGVTASYFEWVQNRQGFFWTEE
FT                   EVNRRLDRMMGEAFDKVYTAADKYDVSLRIAAYVVGIRRVAEALRMRGIYA"
FT   CDS_pept        720047..722095
FT                   /transl_table=11
FT                   /locus_tag="SRM_00587"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00587"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23508"
FT                   /db_xref="GOA:D5H653"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="InterPro:IPR032812"
FT                   /db_xref="UniProtKB/TrEMBL:D5H653"
FT                   /protein_id="CBH23508.1"
FT                   /translation="MNDDPTNPGYAVLWSRLMDVTRMDGMSVSGGGGGGWDGGTKNGGR
FT                   CAVGSAFGLLIGLLVSCANPQAPSGGPRDSTPPSVVQTRPVQDTVDVSTDVGALRVEFS
FT                   EYVERSTLSQALSITPTFEQRPQFSWDGRAVEIQFPSALRDSTTYIFTFGTTLSDARGV
FT                   SLETPITVAFSTGERINRGQIEGRVVNGPSGTTQQGVDVFAYALPPGASAVRPLPDAPS
FT                   YRTQTGEGGRFSFDYMREGPYYVLALRDNNRNRQPDSQEPVAVPPRLSIRADSGAAAVP
FT                   VPWLLARRDTTAPQLQQVRPVSRQRLRLRFDEPVRLGTRAPTAWAPRDSATGTPVPVRG
FT                   VYNAPDRPNAIVVRTAPMPDARHALPLRRGAVVDTLGQPLGPDTARFRAAARADTLRTR
FT                   FRGFVPTGLGQDSTGARPLLPGVQPGVRFNQAPDSAALREGISVQDTTGAPQSVSFATD
FT                   DGTTYRLRPDPPLSPGEVVDVRVAGDVFAQPDTTVRRRFRRVTGRVLGALAGRARVVDT
FT                   TRAVEADGDAPAARPSPIRADSSRADALATPEDSLGTQRDATPPDSLLDGGPVVVNLTA
FT                   VESSIPVAPRRLTTPPDSLFEFVELPEGRYRFRAHLDRNENGRWDGGQIQPYVPAEPVT
FT                   WLREPLEARLRWTTELPVPLRIPVLVPEPTRPDASPPDTSGSAGRGR"
FT   CDS_pept        722140..723771
FT                   /transl_table=11
FT                   /locus_tag="SRM_00588"
FT                   /product="Conserved hypothetical protein, containing
FT                   YjeF-related protein, N-terminal domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00588"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23509"
FT                   /db_xref="GOA:D5H654"
FT                   /db_xref="InterPro:IPR000631"
FT                   /db_xref="InterPro:IPR004443"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR030677"
FT                   /db_xref="InterPro:IPR036652"
FT                   /db_xref="UniProtKB/TrEMBL:D5H654"
FT                   /protein_id="CBH23509.1"
FT                   /translation="MMASSDAEALCPPVLTAGAMQAADRYTIEEYGLPSFTLMETAGRG
FT                   CAARIQDAYGPLEDEAVVVLCGKGNNGGDGLVVARHLVTDGARVHVVLASPPDELSDDA
FT                   AHNLSLLRQLQADGTVGERLTIEELEDVETLTAAVAPLRPRLYVDALLGTGLTSDVREP
FT                   IRSLVTWVNGRTAPTVALDVPTGLHSDTGAVLGVAVRADRTATMAAPKVGLRVGEGPTR
FT                   AGTVEVVDIGMPPFVLDRAAEKPGCARETTDAAVRAWWPARDPDAYKYSVGTALIVGGA
FT                   PPFAGAPVMAAKAAGRSGAGYVRCAGPETIHATLAGALTTIPTLPLPTGDDDGIAPDAA
FT                   LDALAEAADTADAILVGPGLGRAPGTAQFVRRLVRTVDTPLVLDADGLNALAGHIDELA
FT                   DQRQAPWVLTPHAGEFRRLAGEEGALTDRVRAAQTYAERWDAVCLLKGTPSVVAGPTGR
FT                   TVLGSIATPALATAGTGDVLAGQCVGLMAQGLSPLNAAAAALHVGGAAAERYGATHDPR
FT                   SMVATDLLDMIPRVAAERFGEKRRQR"
FT   CDS_pept        723805..724236
FT                   /transl_table=11
FT                   /locus_tag="SRM_00589"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00589"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23510"
FT                   /db_xref="GOA:D5H655"
FT                   /db_xref="UniProtKB/TrEMBL:D5H655"
FT                   /protein_id="CBH23510.1"
FT                   /translation="MIRLRPMRILSSLRTVHYRLLATLWTVGILVALTLPTGSMPDAQA
FT                   TGLDKVVHAGLFAGFGILWLRGLCPPDTERLSACFRRRGGMFFVGGLLFAVGTEVYQHL
FT                   LPVQRMADPYDVTADLLGFGVAFVGYYVYHVRRTDRASA"
FT   CDS_pept        724431..725090
FT                   /transl_table=11
FT                   /gene="tonB"
FT                   /locus_tag="SRM_00590"
FT                   /product="TonB protein"
FT                   /function="Interacts with outer membrane receptor proteins
FT                   that carry out high-affinity binding and energy dependent
FT                   uptake into the periplasmic space of specific substrates."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23511"
FT                   /db_xref="GOA:D5H656"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:D5H656"
FT                   /protein_id="CBH23511.1"
FT                   /translation="MALRKEEGADLRKQYPLYVEIGLVLSLTLLIVAFRADFSNESSFQ
FT                   VQMEEQETVDMKQIQQTQQEKEPPPPPKPPVPQEVPNNEVIENETDFDASLDMDERLDT
FT                   SQGPPDDGEDEEEEEQEIFMVVENQPELVGGMRALQQSVEYPEFAKKAGIEGRVIVQFV
FT                   VDEQGNVKNPKVTRGVHKLLNEEAVKAVKDQSFKPGKQRGQAVKVQMSLPVTFRLQ"
FT   CDS_pept        complement(725200..725895)
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="SRM_00591"
FT                   /product="Ribose 5-phosphate isomerase"
FT                   /function="Catalyses the conversion of D-ribose 5-
FT                   phosphate to D-ribulose 5-phosphate in the non-oxidative
FT                   branch of the pentose phosphate pathway."
FT                   /EC_number="5.3.1.6"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00591"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23512"
FT                   /db_xref="GOA:D5H657"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5H657"
FT                   /protein_id="CBH23512.1"
FT                   /translation="MDRDTAKQAAAEAAVQLVRDGMCVGLGSGSTTAYALDFLGRRIQD
FT                   EGLHVQGVPTSFATERRARTHGIPLTSLDDTPSLDLALDGADEVDDAFRLIKGGGGAHA
FT                   REKVVAHQADRFVVLVDPTKEVRRLGTQFPVPVEVLPMAATPVMNALDAAGATPTLRTA
FT                   DAKDGPVVTDQGLWIIDARFPDGIENPDALNRRLCDRPGVLDHGLFLNMATDVLVGRPD
FT                   ESVDHRSAS"
FT   CDS_pept        complement(726005..726496)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00592"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00592"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23513"
FT                   /db_xref="GOA:D5H658"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5H658"
FT                   /protein_id="CBH23513.1"
FT                   /translation="MRTPHEHSTPPEAHEAAKVPLEILEVGMEQLDAIRRLNVAIFDDA
FT                   HIIETFERDDLLMLLARSGGTDVGFKLGYRLNEAAFYSAKGGVHPAHRRNGIARALLYD
FT                   MLDVVAGRGYERFVYDTFPNKHPGMTVLGLDEGFEVIRAGYSAKYQDYRLRFAWTFDEA
FT                   "
FT   CDS_pept        complement(726536..728674)
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="SRM_00593"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="Members of this family are helicases that
FT                   catalyse ATP dependent unwinding of double stranded DNA to
FT                   single stranded DNA."
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00593"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23514"
FT                   /db_xref="GOA:D5H659"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D5H659"
FT                   /protein_id="CBH23514.1"
FT                   /translation="MARRIVLSSDRDEPSGSTEDLTIEYAEALNEQQYAAATAGEGPLL
FT                   IVAGAGTGKTRTLIYRLAYLVETGTRPQQIVLLTFTRRAANDMTARASNLLDGRCEKVR
FT                   GGTFHAFCLEVLRQHAEALGFPRNFTVLDAADAADVLSVIRTRGEYGDGEERFPQKNTL
FT                   YSMFSSATNRDETLGETITKRYPQFTSLHAELKALRDAYRRYKKEHGLMDFDDLLERTL
FT                   ELLETDDDVRHQVASRCRHVLVDEYQDTNALQAELVKKFSSVHGNVTVVGDDAQSIYKF
FT                   RGADFRNIFRFPDEFDDTEVVKLEHNYRSTQPVLDLANRVIEQAERSYDKTLFTEKTEG
FT                   ELPALVPAADGDMEARFVAEMVLRLREDGVPLSDVAVLFRSSHNAYDLEVELNQRNIPF
FT                   VKYGGMKLNEAAHIKDVLAHLKVVENPQDAASWNRALQLIHGIGPKTAQSLIEWTTEAA
FT                   EDPLTLGDGAPFSDRYAARLKQLFSTLRHVRSDDTSVTEQVEAILDYYQPLFENKYADD
FT                   HPKRAPDLEHLAGLAANHESRQRFLSSLTLDPIELTALDQETGEDDEPPLVLSTIHSAK
FT                   GLEFHTVFLIRALDGTIPSRHALREPGGVDEELRLFYVAVTRAEEDLFISYPMTQYRRG
FT                   QGEYMTTPSRFVEDLPDDVLEPVQLVEEDAVDENAPDAPEEGDTLPSSRNGEAPAPPES
FT                   TRDDGPPDDPADADGLPF"
FT   CDS_pept        728978..729898
FT                   /transl_table=11
FT                   /gene="soj"
FT                   /locus_tag="SRM_00594"
FT                   /product="SpoOJ regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00594"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23515"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H660"
FT                   /protein_id="CBH23515.1"
FT                   /translation="MGKVIAIANQKGGVGKTTTAINLAASLAATEHPTLLLDIDPQANC
FT                   TSGIGIESDEVDNSIYEVLIGEVDASDAVMSTAMPFLDMMPSHINLVGAEVEIIDETQR
FT                   EKLLSAALPRIRRKYDFIVIDCPPSLGLLTLNSLTASDSVLIPVQAEYFALEGLGQLLN
FT                   TIKIVRQHLNPDLDIEGVLMTMFDTRLRLSNQVADEVRRYFGERVFETIVKRNVRLSEA
FT                   PSFGKPALLYEASSTGAQNYMALAREILAHNEEYLDSAPDSNGRGDAESIETPSAGDQE
FT                   TLSDAIGASSEADEDAATPADEFSM"
FT   CDS_pept        729965..730945
FT                   /transl_table=11
FT                   /gene="spo0J"
FT                   /locus_tag="SRM_00595"
FT                   /product="spoOJ protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00595"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23516"
FT                   /db_xref="GOA:D5H661"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D5H661"
FT                   /protein_id="CBH23516.1"
FT                   /translation="MGKKSALGKGLNALLPEDQDEQASGDGEGPTDEAPEEQSQLYQFE
FT                   DGTRLLGRVAEVAVERIRPNPYQPRQEFEEGALDELAASIEQIGIIQPITVRALGDGEF
FT                   EIISGERRLRAARRAGMEHLPAFIREADSEEMLEMALVENVQREELNPIEIALGYQRLV
FT                   EECDLTQEEVAERVSKSRATVSNFLRLLRLPPRIQAALRDKQVSMGHARALIAMDDDEA
FT                   QVALLEETIAEDLSVREVERRARQWHEDEGAADSEAAEGADETAVPETAPDRDDLQFEE
FT                   LRNRLRSRFSTQVQIHHRKDGEGTIEISYYSEEDLNRLVELLASE"
FT   CDS_pept        731030..731773
FT                   /transl_table=11
FT                   /locus_tag="SRM_00596"
FT                   /product="conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00596"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23517"
FT                   /db_xref="GOA:D5H662"
FT                   /db_xref="UniProtKB/TrEMBL:D5H662"
FT                   /protein_id="CBH23517.1"
FT                   /translation="MTHHVVSFVDRVPVIQMRRVGLGLGLLVVLLGASLSTGTASAQPD
FT                   SVRASILEEKGFSPDHSPRGALWRAAAAPGWGQFYNRQYYKMPFVYAGLAGGGYAIYTL
FT                   TRRYRLFRNANLYVIGRNRAEENGGDNPYGQFEGEYDEAVVRLGGDPQGSTVGGRQLRD
FT                   QRDQYRRWRDLSILGTGLFYALTVLDAYVSAHLLSFNVGDVALDVRPSGGEPVVAGRQD
FT                   GTDQTPEEASLRDINGIGVRLHVRF"
FT   CDS_pept        732104..733417
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="SRM_00597"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /EC_number="2.3.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00597"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23518"
FT                   /db_xref="GOA:D5H663"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D5H663"
FT                   /protein_id="CBH23518.1"
FT                   /translation="MTTPDRPPRQSTRPEEPEQASPAQEEPSLFEKCHRFFDPSGDYAK
FT                   LKQADLYPYFRPIEESEGSRAVMNGDELVMAGSNNYLGLTADPRVKEAAQEATAMYGTG
FT                   CTGSRFLNGTLDLHLELEEKLADFMGKEEAVLFSTGYMTNEGVLEAVAGRGDIIFSDKD
FT                   NHACINAGAQKSLAETKRYRHNDFDHLRKMLKRAHEERPDAGKLIATDGVFSMSGKIAR
FT                   VPDLLDLADEFDAALMLDDAHAIGVIGDGGRGSASTFGRKDDVHLITGTFSKSFASIGG
FT                   FCVGDRDVVEYIRHEASTHIFSASMPPSTVATVLKSLEILQDEPERLDRLHEISDYMRD
FT                   GFRNLGFDVWESETPIIPVVIGDMELCFRFWRELIDEGVFVNAVVPPAVPKGQALMRTS
FT                   YMATHTDEELDQILDAFHKVGKKLGVIGTNGHEVPAGA"
FT   CDS_pept        733451..734701
FT                   /transl_table=11
FT                   /locus_tag="SRM_00598"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00598"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23519"
FT                   /db_xref="GOA:D5H664"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:D5H664"
FT                   /protein_id="CBH23519.1"
FT                   /translation="MTPSFSDLSSGSGGVFAWPSHSSRSSRMPAPTSAVTVRPVHGARD
FT                   RTRFIDVPYDFYPGRYPEWVPPLRRDVKDTLDPSSNAFFEHGDMQLFLAEDASGAVVGR
FT                   IAGIVNGMHLEKHEDGTGFFGFFECVEEYAVAEALLDAAADWLREQGLRRMRGPANPSL
FT                   NDTAGLLVDGFDRAPSLLMPYNPPYHEGFLERYGLDRAMTMWAYYLHKKYAKYERLQRG
FT                   VDLVKRRTPGLSLRTLNMDRLEEEVRTVRDIYNDAWSDNWGFVPMTEGELQQLADELKQ
FT                   IVDPEIVFFVEHEGTPVGFSVALPDVNQALRHVPDGRLFPYGVPSGLTTLFLHMQYGVH
FT                   ECRMPLMGIRKDYQGKGLDSMLVLATIENGPANGYAACEMSWVLDTNDRLKNHVESLGA
FT                   VVDKEYAMFETPLSQND"
FT   CDS_pept        734766..735464
FT                   /transl_table=11
FT                   /locus_tag="SRM_00599"
FT                   /product="Haloacid dehalogenase-like hydrolase, putative"
FT                   /EC_number="3.-.-.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00599"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23520"
FT                   /db_xref="GOA:D5H665"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D5H665"
FT                   /protein_id="CBH23520.1"
FT                   /translation="MDPEFVYFDLDDTLLDHQTAERKALADVRTRYLTVFGALSVDELQ
FT                   ETYHTINAPLWRRYADGEIDKRTVQQQRFEGLLEAVDAPHADATLIARHYMQRYAEHWA
FT                   FIPGARETFEAIADRHPVGVITNGFAEVQEKKFDRFPLLRERSDALVICEDVGVLKPDP
FT                   EVFDHATETAGVAYEDVLYVGDSYRSDVEGAEPVGWRVAWYARNGTNGHSTNERGFAFS
FT                   DWADLRARVL"
FT   CDS_pept        complement(735466..736158)
FT                   /transl_table=11
FT                   /gene="glpG"
FT                   /locus_tag="SRM_00600"
FT                   /product="Rhomboid protease glpG"
FT                   /function="Rhomboid-type serine protease that catalyzes
FT                   intramembrane proteolysis"
FT                   /EC_number="3.4.21.105"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23521"
FT                   /db_xref="GOA:D5H666"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:D5H666"
FT                   /protein_id="CBH23521.1"
FT                   /translation="MSSSSAFLVSHVPLVPRMERLLQAPITLALLLSNLGVSLYAFTDP
FT                   SLLRELSFRPHRIRTHREFYRFLTAGFVHASGTHLAFNMITFYFFGPLLEGILGIGAFL
FT                   LLYFGSELAAHALTFAAHRDDPNYSAVGASGAISGVVFAFCVFFPLRNLYLFFALPIPA
FT                   VLFAFGYVFGSIYAMGGDSRGGARGSVGDWIAHEAHVGGALAGVVLTILLEPRSVQVFL
FT                   ESFRQLLG"
FT   CDS_pept        complement(736247..736954)
FT                   /transl_table=11
FT                   /gene="purQ"
FT                   /locus_tag="SRM_00601"
FT                   /product="phosphoribosylformylglycinamidine synthase I"
FT                   /EC_number="6.3.5.3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00601"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23522"
FT                   /db_xref="GOA:D5H667"
FT                   /db_xref="InterPro:IPR010075"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D5H667"
FT                   /protein_id="CBH23522.1"
FT                   /translation="MSARFGVVVFPGSNCDHDAYHAAHDVFDQEARFIWHEEASLGDVD
FT                   VVVVPGGFSYGDYLRSGAVARFSPIMQDVVRFAEDGGLVFGICNGFQVLCEAGLLPGTL
FT                   MRNESLRFVCKDTPLRVENAGTPFTNALTEGQVITIPVSHGEGRYYADEDVLARIEAND
FT                   QVLLRYSTADGAVTDEANPNGSVRGIAGLVNEAGNVCGLMPHPERCVESLLGGDDGRLI
FT                   FESLLNHVSTVAA"
FT   CDS_pept        complement(737051..738586)
FT                   /transl_table=11
FT                   /gene="caiA"
FT                   /locus_tag="SRM_00602"
FT                   /product="Very long chain acyl-CoA dehydrogenase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00602"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23523"
FT                   /db_xref="GOA:D5H668"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:D5H668"
FT                   /protein_id="CBH23523.1"
FT                   /translation="MSIASYLSEDLGTSVEFETFRDAFQKKLHKVFRMRGDFDAVSTQR
FT                   GLPPFMMREIQSMTPLSVFIPEEYGGRGGHVHECQSILATASYESLALSLTLGINGALF
FT                   LQPLTKYGAESIKPPVFERFIEEKNLGGLMITEPDYGTDALSMETSYTETGGGDYHLTG
FT                   TKHWAGLTGWADFWLVTARRQGADGDLGRDIDFFVADMNQPEQMIEVEEFYENLGLYMI
FT                   PYGRNHVDIQVPAKHRLQPKSTGIKMMLDTLHRSRIEFPGMGMGFLQRILDEALAHCKE
FT                   RFVGGKSLLEYDQVQRRVADIQAAYTACSAMCLHTSEHAHTDNNLAGKALSANATKTVV
FT                   TDLMQNAAQSLLQLTGGKGYRLDHVAGRSVVDSRPFQIFEGSNDVLYQQITESILKSMR
FT                   QAKERNLRSFLEDHDLTARATDYFSGALDFEVDQSLPQRKLVDLGRVLGRVVTMEMVIE
FT                   LGDRGFRSDLISNCLQSFQEKVERLLASYGRSQTPSVIDDYVEGSAWLDFVKA"
FT   CDS_pept        complement(738660..738830)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00603"
FT                   /product="Hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00603"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23524"
FT                   /db_xref="UniProtKB/TrEMBL:D5H669"
FT                   /protein_id="CBH23524.1"
FT                   /translation="MFLSILRLDLSVSCLVASGTQTRNLPFSSASPGDLLQLRLQIAPL
FT                   RSIFCIVCSLR"
FT   CDS_pept        complement(738915..739430)
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="SRM_00604"
FT                   /product="Single-strand binding protein"
FT                   /function="This protein is essential for replication of the
FT                   chromosome. It is also involved in DNA recombination and
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00604"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23525"
FT                   /db_xref="GOA:D5H670"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5H670"
FT                   /protein_id="CBH23525.1"
FT                   /translation="MVIMARGVNKVILIGNLGDDPELRYTGSGTAVCNMSLATNETYTD
FT                   SDGNEVQNTEWHDVVAWGRLGEICNEYLDKGSQVYFEGKLQTRSWEDRDNNTRYSTEVK
FT                   AQEMMFLDSNRQGGADMDGFDQTRGDESLDQTRQEQPAGSSGPQPGQQASSGGEDEDTF
FT                   EPDDDLPF"
FT   CDS_pept        complement(739431..739607)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00605"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00605"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23526"
FT                   /db_xref="UniProtKB/TrEMBL:D5H671"
FT                   /protein_id="CBH23526.1"
FT                   /translation="MVQAVRVSVERTRVRALLLAFARTAAPSRDTFRGSSYRESRNGTV
FT                   RGRGHSSIFEQYG"
FT   CDS_pept        complement(739936..740751)
FT                   /transl_table=11
FT                   /gene="mhpC"
FT                   /locus_tag="SRM_00607"
FT                   /product="beta-D-galactosidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00607"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23528"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5H673"
FT                   /protein_id="CBH23528.1"
FT                   /translation="MHETPFPIHETGSFRYNAEGPTDSPLPPVVLLHGMLGDLSNWVDT
FT                   VEALSDNGYRVLAPILPVYDFPLSETGVPRLTTHVRDFVDTLDLDRVVLVGNSLGGHVA
FT                   LLYALDQVEKVHAMVLSGSSGIYETTMGSSFFRRQDREFIRERTEMTFYDPAHATEELV
FT                   DEMLEIVNDRPRAFRLLKIARSADEETVTEQLSQLDMPSLLVWGRDDIVTPPEVGEEFR
FT                   DRMPDARLEFIDKCGHAPMIEHPDTFNALTLEFLEELAEEAPLTPPSGR"
FT   CDS_pept        740729..740947
FT                   /transl_table=11
FT                   /locus_tag="SRM_00606"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00606"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23527"
FT                   /db_xref="UniProtKB/TrEMBL:D5H672"
FT                   /protein_id="CBH23527.1"
FT                   /translation="MGKGVSCIRRRLVVNEGGAVRGRAEHRSRRNARNDPQAPTKGDAY
FT                   DLRGTVTETGGEAPARSVGNSKIGRRA"
FT   CDS_pept        741229..741558
FT                   /transl_table=11
FT                   /locus_tag="SRM_00608"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00608"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23529"
FT                   /db_xref="GOA:D5H674"
FT                   /db_xref="InterPro:IPR024623"
FT                   /db_xref="UniProtKB/TrEMBL:D5H674"
FT                   /protein_id="CBH23529.1"
FT                   /translation="MKETSRKRMTRIGVCSALAGGAVGFALGMLFAPQRGPDARRRIAY
FT                   QLEQLSAQTGVLFRRLLQSGGESEGRRNSAAVVEDAETRADHIRDDIDALMEELRQASQ
FT                   ADDAD"
FT   CDS_pept        741639..742463
FT                   /transl_table=11
FT                   /locus_tag="SRM_00609"
FT                   /product="conserved hypothetical protein containig DUF328"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00609"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23530"
FT                   /db_xref="InterPro:IPR005583"
FT                   /db_xref="UniProtKB/TrEMBL:D5H675"
FT                   /protein_id="CBH23530.1"
FT                   /translation="MPDLTVLLSPADQKQPGGNPFAPDMFDYRTSGTFNYFDDLNPDRR
FT                   ELIDTLQAVVDEEDEEALGEVFGVEGYELEEAIRVNDEIYDAPLMSALDRFSPGVMYAA
FT                   MDFANLPTGAQRRLLENGVILSGLFGLLRPDDLIPNYQLGMEASLPDVGPVADYWRPII
FT                   SPMLNESLEDRWVWDLLPEVHRNAWTDEHTYTARVEVQFERVEDGERVPITGEDLEVQR
FT                   GQFVNFIVQETAEEMEDLREWSEEESDELTFDEDASTYDEDTKTWEIVMVQD"
FT   CDS_pept        742522..743193
FT                   /transl_table=11
FT                   /gene="udk"
FT                   /locus_tag="SRM_00610"
FT                   /product="uridine kinase"
FT                   /EC_number="2.7.1.48"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23531"
FT                   /db_xref="GOA:D5H676"
FT                   /db_xref="InterPro:IPR000764"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR026008"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5H676"
FT                   /protein_id="CBH23531.1"
FT                   /translation="MPAPRAPMPMNPPVVIGIAGGSGSGKTTVLNHILEEFGSDPIAIL
FT                   DHDAYYHDLSHLSREKRAQFNFDHPDALETSLMREHLDRLIEGEAIEKPVYDFTTHTRR
FT                   EETETVEPRPVIIIEGILVLAESALEERMDIKIYVDAADDIRLMRRIRRDMQERDRSIE
FT                   GILRQYERTVRPMHLEFVEPSKREADIIIPRGGHNEVAIQMVMSRIQELLRLVEQGTLQ
FT                   A"
FT   CDS_pept        complement(743223..743993)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00611"
FT                   /product="Putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00611"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23532"
FT                   /db_xref="GOA:D5H677"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/TrEMBL:D5H677"
FT                   /protein_id="CBH23532.1"
FT                   /translation="MLLALDVGNSAVKAGLFSGDELVRVFSVDPPDADATDASYWRAEL
FT                   DSALADATVEHAGLVSVVPARTDAVARALRGVVDAPLTIVAPGMALPFTLDYDTPDTLG
FT                   TDRLAAAAAGWTRYGRDASRSVIVVDAGTAVNYEVVHRNGTYQGGAIGPGAVLMRNALQ
FT                   AGTAQLPDVPLHLPETPVGPSTRTALQSGILWGLIDSVQGIAARLAAQLPDAPRLVLTG
FT                   GWSNPLIDHLEIEATHAPHLVLRGVRLLAEKNRA"
FT   CDS_pept        complement(744021..744818)
FT                   /transl_table=11
FT                   /gene="birA"
FT                   /locus_tag="SRM_00612"
FT                   /product="Biotin--acetyl-CoA-carboxylase ligase"
FT                   /function="BirA acts both as a biotin-operon repressor and
FT                   as the enzyme that synthesizes the corepressor, acetyl-
FT                   CoA:carbon-dioxide ligase."
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00612"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23533"
FT                   /db_xref="GOA:D5H678"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D5H678"
FT                   /protein_id="CBH23533.1"
FT                   /translation="MSLPLAADTQGRLSTDRFGRSMRGFEEVGSTNERAAQWAAAGAPE
FT                   GATVLTEYQTTGRGRHGRDWTADKGRNLLFSVVLRPTLPPDRFGLLTVAAGVAVAEAIE
FT                   DFVSPHSAALKWPNDVLLEGRKACGILLESSLAPPNTDAVVVLGVGLNVNQTDFPDALA
FT                   DTATSLRLASGRPLPRPPLLARLLRALERRYDAVQHNGAGSVRGAFRERLAALGSSLSL
FT                   RLPGTDETLSGTVQGITETGALRLRTADGVEKTVHAGEVTTRR"
FT   CDS_pept        complement(744882..745718)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00613"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00613"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23534"
FT                   /db_xref="UniProtKB/TrEMBL:D5H679"
FT                   /protein_id="CBH23534.1"
FT                   /translation="MQPAPSKRARFLHIIVGGWLLALGGLGCTSPPEHGGTYAAFGALD
FT                   TIEATDTPRDSALAVLARLDRTAFDSAFARLDAYAVTRDVRTEQLDTTGATTAYRTRTL
FT                   RYPPGTGPGTIQQADSAGRFQAGGFLARLTPSQSPRARPGNLAGQALADQPAYLAPRTQ
FT                   EAYRYALRRDSLLDGTPTHVVEAKVRSGERGADRSIRYARLTVDRASHELVGLTTTRAS
FT                   RILLFRERSQITLRLRRAPDETWVPHLTRVRAVVDVPLRAPRQFRTVSAYRGYAVR"
FT   CDS_pept        745858..746691
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="SRM_00614"
FT                   /product="Inositol-1-monophosphatase"
FT                   /function="enzymes of the inositol phosphate second
FT                   messenger signalling pathway"
FT                   /EC_number="3.1.3.25"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00614"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23535"
FT                   /db_xref="GOA:D5H680"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:D5H680"
FT                   /protein_id="CBH23535.1"
FT                   /translation="MDAPTHDSPYDLLLDTAVQAARRAAAVIREQAGRPGGVRDKSRND
FT                   FVTDADERAQAVIVESLRETFPRDAILAEEGAAGDGDAPVVSGRRWIVDPIDGTTNFMH
FT                   QVPPYAVSIALQEEDEIVVGVVLDVPRDELFTAVAGHGLQVNGEEEGVSATDAFGEAFL
FT                   ATGFPYCRFEHTDRYLDVLADILRDAQGVRRHGSAAVDLAWTACGRFDGFFETGLNPWD
FT                   IAAGVLLVREGGGRVTNYHDDAGLTPVFDQQMCATNGPVHAALLGHLAPMDDVRL"
FT   CDS_pept        746748..747584
FT                   /transl_table=11
FT                   /gene="fab1"
FT                   /locus_tag="SRM_00615"
FT                   /product="enoyl-(acyl-carrier-protein) reductase"
FT                   /EC_number="1.3.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00615"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23536"
FT                   /db_xref="GOA:D5H681"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H681"
FT                   /protein_id="CBH23536.1"
FT                   /translation="MDGYDLLDGKTGVIFGALNEDSIAWSVAQACHREGADFVLSNAPV
FT                   ARRLGSLDALAEETDSPIIWADATDDEELAALFEEVKDEYGSIDFIVHSIGMGVNVRKD
FT                   VPYEDLNYNWYEQTLDVSAVSLHRIVNHALDTEAIDDGGSILAMSYIGAERIFSKYSEM
FT                   GDAKALLESIVRSFGYRLGERNIRINAISQSPTKTTAGSGIDGFDAMYEFAERVAPLGN
FT                   ADADSCADYAVTLLSDLTRMVTMQTLYHDGGFSTMGISDEIVEAMEDAFAEDEEDE"
FT   CDS_pept        747594..748382
FT                   /transl_table=11
FT                   /locus_tag="SRM_00616"
FT                   /product="Phosphoglycolate phosphatase"
FT                   /function="Catalyzes the dephosphorylation of 2-
FT                   phosphoglycolate."
FT                   /EC_number="3.1.3.18"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00616"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23537"
FT                   /db_xref="GOA:D5H682"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H682"
FT                   /protein_id="CBH23537.1"
FT                   /translation="MERCTSNVPSSNAHRTNAVIELFITDIDGCLASPYEAYDLTGLDT
FT                   LRQLPHEADTAPALTLCSGRSYPYVEAMTQALALTTPVLFEAGGGQFDPVAAQTAWSPH
FT                   LTDEVEAKLRTVERWFATECVPGTQISIDHAKRTQTGVVSPKGNEIRALRPRTEQFVAE
FT                   ETPGLYVFATDISVDVVPPGITKRDGVEWLADRLGLALDETAYIGDAETDLEALNAVGT
FT                   SFAPANADATVRAQVDHVTEGTVLDGVLEAFRYCRAQNDS"
FT   CDS_pept        748358..749272
FT                   /transl_table=11
FT                   /locus_tag="SRM_00617"
FT                   /product="Conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00617"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23538"
FT                   /db_xref="GOA:D5H683"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H683"
FT                   /protein_id="CBH23538.1"
FT                   /translation="MSGPERLLIRAPTHRPERPRLTLVSRRVMRTTGWLLLLIGGLASG
FT                   LSSAAGQPSAPPDTTRGDAVASSPAPASGDLAEQGGALEATPLFYVAEDAATLHNRSGL
FT                   NAPVTRLAMRTPVRRLSCEADWCRVRTDGGTTGYVAADALSNVWIRVSKRKRRVYVYRG
FT                   AELAHAFEADMAYNAFADKKRNGGKTRPDHWRTPEGTFYVVHKNPQSEFYKALVLNYPK
FT                   VEDARRGLDAGLISRAQYEAIRQAQQEHRMPPMSTDLGGWIEIHGDGTGDATAWTQGCV
FT                   AIRNGAMDVIWEQVRVGTPVLIE"
FT   CDS_pept        749386..750132
FT                   /transl_table=11
FT                   /locus_tag="SRM_00618"
FT                   /product="Conserved hypothetical protein, membrane or
FT                   secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00618"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23539"
FT                   /db_xref="UniProtKB/TrEMBL:D5H684"
FT                   /protein_id="CBH23539.1"
FT                   /translation="MFSTRNIATALVGVLFFFFVGCGGGNSPTAPPDGWQTSDMHWWAE
FT                   GVDTSAVFITLDSLSSMGVENAEVQLSASGDVNQEQFQAAIKRSLLPLYRNNPMVVDSL
FT                   FEEYAAPQLEEVDLGGNVLQSNGELKSDLLNKNQKVAYEAITEYFREPQRDQSPDNITW
FT                   PDSLRSEEYSGVVQLQVHLDVEGEGENATSRADAVEVLSGPHPTLNRIALKAATQATWK
FT                   PAYVLEDGSWTPTESWVQFNIPFQMR"
FT   CDS_pept        complement(750276..751586)
FT                   /transl_table=11
FT                   /gene="nupC"
FT                   /locus_tag="SRM_00619"
FT                   /product="Nucleoside permease"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00619"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23540"
FT                   /db_xref="GOA:D5H685"
FT                   /db_xref="InterPro:IPR002668"
FT                   /db_xref="InterPro:IPR008276"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="InterPro:IPR011657"
FT                   /db_xref="UniProtKB/TrEMBL:D5H685"
FT                   /protein_id="CBH23540.1"
FT                   /translation="MSFPVALLRGLIGLVVFVGIAVLFSTNRKAINWRLVGAGIGLQLV
FT                   FAFLVLKTGPGEMLFDTLATFFDTLLSFTYEGSEFIFGDLGNPDEGNNFAFQVLPTIIF
FT                   FASLMGVLYHLRIVQPLVNGMGWVMQKTLRISGAESLAAAANVFIGQTEAPLAVKPYVE
FT                   DMTRSEIMTLMTGGMATIAGGVLAAYIGFLGGDSPESRQLFAKHLLSASVMSAPAAIVM
FT                   AKILVPETETPETQGGAEIQDTEEADNVIEAAANGASDGLRLALNVGAMLLAFLALIGT
FT                   INAGFEWVGAPVVYGVELYNVNELVAQASGGRFDALSLEAVFGFLFAPLAWAMGVGAAD
FT                   ILQFGTLLGEKVAVNEFVAYASLRDLQGALSERSMIIGTYALCGFANFSSIAIQIGGLG
FT                   GIAPSRKSEIAALGLRAVLGGALASWLTATVAGVLVA"
FT   CDS_pept        complement(751780..753810)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00620"
FT                   /product="Aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23541"
FT                   /db_xref="GOA:D5H686"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="UniProtKB/TrEMBL:D5H686"
FT                   /protein_id="CBH23541.1"
FT                   /translation="MRLRPRLLTSVLVAALVPMLWGGAFAQQSPDQVPEHNLEAFEPVD
FT                   LPDPNRYRDADGSPGRAYWQNAADYQIDVALDTARKRVTGTETITYTNNAPEALERLWV
FT                   QLEQNYFKTGSRGNAAVPADARFGGFFEEAGYDLSNLRLRRGGETTTPDTLVDGTRMRV
FT                   SLDEPLASGDSLQLSFDFAYTLPKDGADRHGWMEMEDGTVYQFAQWYPRMYVYDDVHGW
FT                   NPLPYLGQGEYYLEYGTFNVNITVPRNMIVGGTGRLQNPDDVLTETQRERLAEARQSRE
FT                   PVMIIDSTEVGAPDTRPDGTGRLTWRYEADRVRDFAWAASSAFIWDAARANAGDRTVLA
FT                   QSLYPREGLGTDQNPGWERSTAYTQHSVEFYSDFVAPYPYPNAINVAGRVQGMEYPQIV
FT                   FCDVNSRGRSLFQVTDHEFGHTWFPMVVGSDERRWAWMDEGLNTFMNQYSALDFYGQGR
FT                   VPPAKVMGGLSKYVTKQMGSPFGDQPIMTYADRIRDDALGFLAYLKPGYGLMVLREHVL
FT                   GPERFDSAFKEYFDRWAYKHPKPADFFRTMEDVSGEDLDWFWRSWFYETDALDQAVDSV
FT                   ARGDTTMVTVSQNEQLMLPVTVQLTYEDGSTEQRRIPAEAFYTRDTNTLRVTDGPLQRI
FT                   ALDPNQILPDMNRGNNVWTPSDATESSSTGSSTESTSDSGR"
FT   CDS_pept        754024..756384
FT                   /transl_table=11
FT                   /gene="uvrD"
FT                   /locus_tag="SRM_00621"
FT                   /product="DNA helicase II"
FT                   /function="Unwinds DNA duplexes with 3' to 5' polarity with
FT                   respect to the bound strand and initiates unwinding most
FT                   effectively when a single-stranded region is present."
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00621"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23542"
FT                   /db_xref="GOA:D5H687"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D5H687"
FT                   /protein_id="CBH23542.1"
FT                   /translation="MRRIPIRRSTTHTQVDPDPEAEQRILDGLNDKQREAVTTTEGPVM
FT                   IIAGPGSGKTRALTHRIAYLLAAGKAQPRDILALTFTNKAANEMQERVEALVGDDARGM
FT                   WVGTFHSSFARLLRMEGDKIGYSEDFSIYDTADSKRLIRQQMKGRNLDTDVVKPRSVQR
FT                   MISSAKNEMIDPQEYAELARGDQQEIVAEVYPAYERALKQANALDFDDLLLKPIELFEQ
FT                   HEDVLEKYQRRWQYVHIDEYQDTNQAQYVLARKLSGRHKNLCVVGDDAQSIYAFRGADI
FT                   TNILNFDTDYPDATTIRLERNYRSTENIIRLADSIIEENDDQIEKSLWTDNAEGEYVAL
FT                   MEALSEKDEAQKIERRVRDLHLRDGMEYGDFAVLYRTNAQSRAIEEALRKENVPYRVIG
FT                   GTSFYERKEIKDVLAYLKLLVNPNDTASLQRVINYPTRGIGDKTQERLQRYAQQHNLSL
FT                   WQAVERVEEIETLGTRAERAVGKFRRLIARYASKAGTGSVPADELARDLIQDAGLLSEL
FT                   RKEHTRENLQRWENVQELISALAEYVESTEDATISTFLQEVALMTDQDEAEEGDDKVTL
FT                   MTLHAAKGTEFPVVFVAGLEEGLFPLEQATQEKAELEEERRLFYVGVTRAEERLYLSWA
FT                   RSRYRYGEQTSNTRSRFLEEVDSDVVRTEAGGELEQQTDRFSAEEGPSADYDEMDPHYY
FT                   RQDLSGDGGASGSSDGLRRIESTDGGGGRRVVYDEGHGEIVPGAQVEHQKFGRGKVQSL
FT                   EGEGDKATAVVFFGSDVGNKKLKLKYANLRVIG"
FT   CDS_pept        756397..757326
FT                   /transl_table=11
FT                   /locus_tag="SRM_00622"
FT                   /product="Hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00622"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23543"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5H688"
FT                   /protein_id="CBH23543.1"
FT                   /translation="MGVEGWGLKGEGRAVVDGAHLDLQLHLARTGRHGRRPFDTGRRQR
FT                   RRDSREALESESGVTPASRARRERASSSPPPSPQSCPSGRGARRPRAAHAERGATGGRT
FT                   RHRWRRGRSGQQSRSQNDEVGICPFFPWLKGSNFGVKSEVLSRPNRSMPIRTYADTSVY
FT                   GGPYDEEFAEASRRFFAQVRVGRFLLVTSAVVSDELEEAPPKVQANYEALLPEVTVAEV
FT                   TDEALKLQQAYLDAGILTPTWEDDALHIAVATVQGCELIVSWNFQHVVHFQKIPQYNAV
FT                   NTLHGYDEIAIHSPHEVINDDDEFGEGV"
FT   CDS_pept        757476..757865
FT                   /transl_table=11
FT                   /locus_tag="SRM_00623"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00623"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23544"
FT                   /db_xref="UniProtKB/TrEMBL:D5H689"
FT                   /protein_id="CBH23544.1"
FT                   /translation="MNRDREAHRPPVFDVVADHRPLFRPRPLVSWNVRPLVYFDEIRWS
FT                   DVPDQEDKAIDVRSPRGAFAMENQSEEMGDGIDAVEITRRIRDERYEQMKDMTPAERLE
FT                   YYRKESAAAHARFVDRARNRPEEGN"
FT   CDS_pept        complement(757892..758080)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00624"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00624"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23545"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:D5H690"
FT                   /protein_id="CBH23545.1"
FT                   /translation="MLVAEVVAFAQRALDGVDPAREWLRAPHSLLGGASPLDRMDTRVG
FT                   MNEVKTMLAHVEHGMPV"
FT   CDS_pept        complement(758415..759356)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00625"
FT                   /product="Conserved hipothetical protein containing HIT
FT                   domain"
FT                   /function="The HIT superfamily are conserved as nucleotide-
FT                   binding proteins and that Hint homologs"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00625"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23546"
FT                   /db_xref="GOA:D5H691"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:D5H691"
FT                   /protein_id="CBH23546.1"
FT                   /translation="MERAVELLVSPDQTPSRHRVPAMPRRQNPYAHLTAKQRDRPSFPT
FT                   RKLLGLGHIEGRVLDYGCGHGADIDFLREKGFEVKGYDPHYAPERPEDTFDTILCHYVL
FT                   NVLLQREQTDVLMGVSELLRPDGTAFYTVRRDLQRTGYRQHYEHNVPTYQTNVRLPYET
FT                   VVRTEFCEIYQYRPYPQSTTGRDSDCAFCTLSSETTSLVSESARAVALAAPDPATHGHT
FT                   IVVPKRHVASYFNLAEREQRACWLLVDRAQSHLQERVSPDGFTVGFDAGSAGRQSADHA
FT                   HLYLLPRHGVSTPTSGIRTVTPNASSPGPRSI"
FT   CDS_pept        complement(759409..760899)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00626"
FT                   /product="conserved hypothetical protein containing
FT                   methyltransferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00626"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23547"
FT                   /db_xref="GOA:D5H692"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H692"
FT                   /protein_id="CBH23547.1"
FT                   /translation="MLDVGAGSGRDAAWFADQDYEVVAVEPAEALRQRAQEAHPSPRIQ
FT                   WIDDQLPALDSVHDLDYQFDVILLNGVWMHVPPSERKRPFRKLTELLKPGGHLIITLRS
FT                   EMPGDDRTAYETSKAELRDLSRSFALKFLDDAQSDDRLDRDLRWTSVVFRLPDDGTGAL
FT                   PLIRHILINDDTSATYKPALLRSVLRVADSAKGAVLNETRDHVEIPLGLVALYWLRMYR
FT                   WLILDRGYHQMPPGNGPPAFDDEHFQFLRRLSASDFRLGRRFTGAEARHLIETFRAIRD
FT                   TIREGPARFIMYPGTQDQVFEYGSGHIRSSNAITLDLDFLKAMGTLRVPRHVWDALARH
FT                   ASWIEPSILSRWVELLENYDGTAPPGAYRDALSWPNVEHSTREVRTLAAQLQESGGPLY
FT                   CVWSGKRLNDGYDIDHCFPFKHWPNNHLWNLLPAAPEVNSSKSDSLPSAQQLHKAEDRI
FT                   LRWWNQAYRRPTMSRSSTKRPKWRFHFRPNSPHRLTDC"
FT   CDS_pept        complement(761030..762238)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00627"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00627"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23548"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="InterPro:IPR021027"
FT                   /db_xref="UniProtKB/TrEMBL:D5H693"
FT                   /protein_id="CBH23548.1"
FT                   /translation="MVVVDNVMKHEIKRTYRYRIYPNSEQRQELARTFGCSRWVYNWAL
FT                   ETKTKAYYQDEESLSFTDLSSRLTSKKKEEETEWLSEVSAVTLQQSLRNLNQAFTNFFE
FT                   GRAEYPSFKSKKGDQTARYVGTAFDIREENGKRKLRLSKMPGLINIRWSRELPSEPSSC
FT                   TVTKNAAGQYHVCFVCTEEVRRLPRVNGEGGDLEFVGVDLGIESLAVLSTGEKVGNPRW
FT                   FENEYKRLRREQQKLSRKEKGSNNWERQRKRVAKVHQRIQDRRKDFIEKLTTRLVENFD
FT                   VIVVEDLSVKNMQQNGKLARHITQAGWSQIVRRLRDKCKWYGRTLVIADKWFPSSQRCS
FT                   ECGHVDGKKSLDVRDWTCDECGTCHDRDINAAKNLSRVGQTRIQAPGDLGKPDAFEVVG
FT                   SGR"
FT   CDS_pept        complement(762671..763510)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00628"
FT                   /product="Aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00628"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23549"
FT                   /db_xref="GOA:D5H694"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:D5H694"
FT                   /protein_id="CBH23549.1"
FT                   /translation="MTVYFNGSYMDKADVSISPDDRGFVFGDGVYEVARAEDGALFQLD
FT                   AHRRRLARSLEAIRIHDVDPDALWERVRGLLPRNGLDAGPAKVYLQVTRGAAPRQHAFP
FT                   DASTEPTVYARASAHEPPLAKWRNGVKVILRPDQRWDRCDIKSLNYLPNVLANQAAQEA
FT                   GAYEALLVRDGFVTEGSHSSVAAVFDGTVTVHPFTNRTLPGITREVVLELCEDLGRPVE
FT                   TFPVAVDALPDADELFLMGTTTGVMPIVQVDDWTVGDGTPGPVAQELLAAFRALEPA"
FT   CDS_pept        763519..764118
FT                   /transl_table=11
FT                   /locus_tag="SRM_00629"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00629"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23550"
FT                   /db_xref="GOA:D5H695"
FT                   /db_xref="UniProtKB/TrEMBL:D5H695"
FT                   /protein_id="CBH23550.1"
FT                   /translation="MRLAEIERALPCGGRFNVRGSGEKRSGGRGPSPRESRRSGFSPLE
FT                   LTFCKEIVNHNVGLKPVRCRSGPRSSAPSGAVSRDRSTEETTVFAIYSTRRDAEVAKEY
FT                   LREADIEAFVQADDAGGMHPQMQRPHGVKLVGMSGAAQDAYEALDAADLLPQPVERPEE
FT                   PDGTGEPAALTMSTGGVAGVLGAAAVVLLVLYLLLG"
FT   CDS_pept        complement(764300..764947)
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="SRM_00630"
FT                   /product="Pyridoxamine 5'-phosphate oxidase"
FT                   /function="Oxidizes PNP and PMP into pyridoxal 5'-
FT                   phosphate (PLP)"
FT                   /EC_number="1.4.3.5"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23551"
FT                   /db_xref="GOA:D5H696"
FT                   /db_xref="InterPro:IPR000659"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR019576"
FT                   /db_xref="InterPro:IPR019740"
FT                   /db_xref="UniProtKB/TrEMBL:D5H696"
FT                   /protein_id="CBH23551.1"
FT                   /translation="MSKLADLRQEYARAELSRDHVTDDPIEQFRAWFDEAEDTELEEPN
FT                   AMTLATAATDGTPSARIVLLKGLDDRGFHFYTNYESRKGTDLSQNPHAALVFLWKPLER
FT                   QVRIEGTVERLPAEESTEYFHRRPRGAQMGAWASPQSRVVDSRADLEENLDTVKAEYGD
FT                   EDEIPRPSHWGGYVVRPTEVEFWQGRPNRLHDRLRYRRSDPAGDWTLERLAP"
FT   CDS_pept        complement(765074..765817)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00631"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00631"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23552"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:D5H697"
FT                   /protein_id="CBH23552.1"
FT                   /translation="MPSSTEPSAWVAGTDGFRDGWVVVLHRPRTGTTRCRTVDGVDALF
FT                   DLPEDPSVLGVDMVIGLPDRAVPGGRTCDQAARQLLGHPRGASVFSPPAHAVLGAETYD
FT                   EAQRRNRASSPDAPGLTKQAFHLLPKMRALAERMTPARQDRVREVHPELAFYAMNGDAP
FT                   VADSKHTDAGRAARTALLAARGFSEIETVTDGLSGGPVGADDVLDAHAACWTARRIHAG
FT                   TAERCPSKDAAAPRNDRGLRMEIWR"
FT   CDS_pept        765931..766791
FT                   /transl_table=11
FT                   /locus_tag="SRM_00632"
FT                   /product="proline dehydrogenase"
FT                   /function="# Oxidizes proline to glutamate for use as a
FT                   carbon and nitrogen source, and also functions as a
FT                   transcriptional repressor of its own gene."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00632"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23553"
FT                   /db_xref="GOA:D5H698"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR008219"
FT                   /db_xref="InterPro:IPR015659"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:D5H698"
FT                   /protein_id="CBH23553.1"
FT                   /translation="MQLPFFLASRFVAGETLETSLPVVDDLNQDGLHVALDKLGEHVQN
FT                   RSEAIAARDAYIDLVRTMAERDDHGQRNRISIKLSMMGQLIDEDFCEENLRRLLEVAAE
FT                   HDLFVRLDMEGSDLTQSTLDLFEAVYPDFPNHVGPVLQAMLKRTDRDVDRMCELGVSVR
FT                   LCKGAYAEPASIAYQDMSQIRERYLDYTERLLQHTDDSGIATHDDELIEATKSFVDRRG
FT                   IDRDDFEFQMLYGLRRTTQREMAADGYNMLVYVPYGTEWFPYFSRRLREKKENVWFVLR
FT                   SLFQG"
FT   CDS_pept        complement(766911..767456)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00633"
FT                   /product="Appr-1-p processing enzyme family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00633"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23554"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D5H699"
FT                   /protein_id="CBH23554.1"
FT                   /translation="MTHADAGVTIELTTGDIAKQSDVEAVVNAANAQLRTGGGVAGALH
FT                   SAAGPGLATETRPMAPIEPGEAVISGAHDLPNDHVIHVLGPVYGRDEPSDELLRTGYEN
FT                   ALRQAEENGISSVAFPALSTGAFGFPMRPAARIALETILDAAPNLDSVTHVRFVLFDEA
FT                   ARSVHEKALSAVRDETDP"
FT   CDS_pept        767553..768455
FT                   /transl_table=11
FT                   /gene="ubiG"
FT                   /locus_tag="SRM_00634"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /EC_number="2.1.1.64"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00634"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23555"
FT                   /db_xref="GOA:D5H6A0"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A0"
FT                   /protein_id="CBH23555.1"
FT                   /translation="MTVRVPLRSGAPHRPMKYDPIKDRLGDLASRHPLLQRLLFGLLNL
FT                   LFLRAWYVRREVRRLLGARPGDRPARVLDAGTGFGQYAYFVARTFPDAQVRAVDVKREY
FT                   LERARAFVDQTPQADRVDWAIDDLTALQSEGPFDLILAVDVMEHIPDDEAVFEHFERVL
FT                   RPGGHVIINTPSDQGGSDVQDEGDESFIGEHVREGYGRAELADKLRAAGLEPVRGLYTY
FT                   GPYGAAAWRGLIKWPMQMLGATWASLLALPFYYAAALPLGLLLNATDVKRDNARGTGLF
FT                   MVARRPPTPESRNGGSGGP"
FT   CDS_pept        768482..769105
FT                   /transl_table=11
FT                   /locus_tag="SRM_00635"
FT                   /product="Inosine-5'-monophosphate dehydrogenase"
FT                   /EC_number="1.1.1.205"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00635"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23556"
FT                   /db_xref="GOA:D5H6A1"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A1"
FT                   /protein_id="CBH23556.1"
FT                   /translation="METGFARPVSTEHRHDLPVADGGTRSATEPPASSCLAHLFVAFLS
FT                   RDGRLPGPHADLTVVRSRSPDPDPRFTMTIDRIMSRDVVTVAPDAALIDIRKRLQEGGF
FT                   NHMLVVEDGALCGVISDRDVLKAISPFLDTYSEKHRDVKTLSRPASEIMQGDPITVAPG
FT                   TPVEEASQTLLDNRVSSLPVVEGGDLIGIVTGKDMLEYYVSEGA"
FT   CDS_pept        769155..771038
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="SRM_00636"
FT                   /product="CTP synthase"
FT                   /function="Catalyzes the ATP-dependent amination of UTP to
FT                   CTP with either L-glutamine or ammonia as the source of
FT                   nitrogen"
FT                   /EC_number="6.3.4.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00636"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23557"
FT                   /db_xref="GOA:D5H6A2"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A2"
FT                   /protein_id="CBH23557.1"
FT                   /translation="MVSGVDGRAPGAGRRKLSHDCAARGRRRRVELIKPHGAPYLEDRP
FT                   HGSGVPSSFLPPIFFRAVQTKYIFVTGGVTSSLGKGIFSASLGRLLSDRGLDVTIQKFD
FT                   PYINVDPGTMNPYEHGEVYVTNDGAETDLDLGHYERFLDQPTSQANNVTTGRVYMEVIS
FT                   KEREGAYLGKTVQVVPHIIDEIKHWMLKLGETGDYDVVITEIGGTVGDIEGQPYLEAIR
FT                   QLRNELGPRNTMIAHLTLIPHLRAAGELKTKPTQHSVKELLAHGLQPDTIVCRSERSIT
FT                   AEVRRKISLFCNVEEEAVIQMLDAESIYEVPLLLRDEGTGELVVDRFYPERGDENEKCS
FT                   DTPDLSDWIGFLKRLKNPEETIPIALVGKYVEHQDAYKSITESFILAGVPDEVQVEVKY
FT                   VPSEDLSPDTVESQLGDVAGVLVAPGFGDRGVEGKILAAQYAREHDVPFFGICLGLQCA
FT                   IVEFARHVCGWDGAHSTEFDEDTAYPVIDLMEEQKEISDKGGTMRLGQYDCRIQDGSRA
FT                   HEIYEADMVQERHRHRYEVNNVLRYKLLEEGMRFSGVNPDTDLVEIMELPDKRWFLGVQ
FT                   FHPEYRTTVGDPHPLFRSFVRACTAYAHEEDLVTSPQPPERKAVPLASVDM"
FT   CDS_pept        complement(771219..771971)
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="SRM_00637"
FT                   /product="LexA repressor"
FT                   /function="# Represses a number of genes involved in the
FT                   response to DNA damage (SOS response), including recA and
FT                   lexA. Binds to the 16 bp palindromic sequence 5'-
FT                   CTGTATATATATACAG-3'. In the presence of single-stranded
FT                   DNA, recA interacts with lexA causing an autocatalytic
FT                   cleavage which disrupts the DNA-binding part of lexA,
FT                   leading to derepression of the SOS regulon and eventually
FT                   DNA repair (By similarity)."
FT                   /EC_number="3.4.21.88"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00637"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23558"
FT                   /db_xref="GOA:D5H6A3"
FT                   /db_xref="InterPro:IPR006199"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A3"
FT                   /protein_id="CBH23558.1"
FT                   /translation="MLLPGWGGRTYVCSPSRQRSRTSPRPPPQPASFSMSKEPLTQRQN
FT                   QAYDFIEQYLDRHRKPPTLQEIGDALDIASTNGVYKLLQKLEEKGWIEREKHKARSIQL
FT                   AGREQDPLGQGGGPPTLPIVSRTPSDHPERLRERPAGTLSVDHQLLRNARTPDDCLLGR
FT                   AGDDGMIETGIQKGDLLLIEEREWDDLDNRTLVAVLLQDQLLAREFEFANRKIHLRPTA
FT                   PHYAEETFSPTESDYYVVGRVLGLIRTL"
FT   CDS_pept        772115..772681
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="SRM_00638"
FT                   /product="protein MraZ"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00638"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23559"
FT                   /db_xref="GOA:D5H6A4"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A4"
FT                   /protein_id="CBH23559.1"
FT                   /translation="MTLARNRVHCGARGEMWGIVPGWFSLLRSRLPFRRATRGACSVMA
FT                   FKGQAEYSVDSKGRVAIPAKMRKSLSPAANETFTITRGFEDCIFLYPMDEWSDIEEEID
FT                   ELSMYDREVRNFVRLIMRWASEVSLDGQGRISIPNPLIDFAGLDDSALILGAFDHIEIW
FT                   DPAQFDGYLNEQPDDYETLAESVMR"
FT   CDS_pept        772714..773724
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="SRM_00639"
FT                   /product="S-adenosyl-methyltransferase mraW"
FT                   /function="Exhibits a S-adenosyl-dependent
FT                   methyltransferase activity"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00639"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23560"
FT                   /db_xref="GOA:D5H6A5"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A5"
FT                   /protein_id="CBH23560.1"
FT                   /translation="MSDDDSQDDSVPEGDPRRYATDFHAPVLSHDVQARLVTDASGRYV
FT                   DATLGGGGHARALLDVLDPDGVVLGIDRDPEALETARDRLADEREAGRFWAVHGTFGNL
FT                   RDVLAAEDLIPIDGLLLDLGVSSHQIDVPERGFSFRDEGPLDMRMDPQRGLTAQQIVNG
FT                   WGERDLRDVLREYGEESRAGQIARALCDARPLDTTRALAEVVEDCVPPPDTVKTLTRVF
FT                   QALRIAVNAELDELEQALEQATEVVRTGGRIAAISYHSLEDRRVKRYLRYGNFEGEPRR
FT                   DLYGTLVAPWAETPRGPIEAGESEVEANPRARSAHLRVAERRDDDEAGAPLPPLS"
FT   CDS_pept        773764..774261
FT                   /transl_table=11
FT                   /locus_tag="SRM_00640"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23561"
FT                   /db_xref="GOA:D5H6A6"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A6"
FT                   /protein_id="CBH23561.1"
FT                   /translation="MSRRTGSSHAERSSTGAPLRPGRGDGAPRDAAASNAASGRASDGW
FT                   VRHGTALPSWTDLEPSRNRRRRMSEGAFLENVSTLRFSLLILAVGAVFTLYVGHVHATT
FT                   DLYNQLQQARTENQRLHLKHNRLQGEFGRQVGPSVIYERARELGLKGSVTYGPPITVDP
FT                   AE"
FT   CDS_pept        774322..776274
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="SRM_00641"
FT                   /product="penicillin-binding protein 3"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00641"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23562"
FT                   /db_xref="GOA:D5H6A7"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A7"
FT                   /protein_id="CBH23562.1"
FT                   /translation="MPMKPKDQILARMYVALTLLGLAPLAVAAQMGQIVVTETDALRDQ
FT                   VRAQARSSVTIPAMRGAIRDRDGRGLATNTARYDLAVDPTVEGFRGQAGTFFDKLADLT
FT                   DASASRYRRRVRDRHSPQYVKLREELTPRQYEAIRGWDVPGVILTPEFGRHYNYGSTAA
FT                   HVIGHVGSNGTGLAGLELAYDDTLTGTPGRRIVRRDRSGRIEAYVGGTVVQPERGDDLV
FT                   LTIDLTRQAALENELRRGVRESGAEWGTAVAMDPSTGAILGMANVPTYNPNRPGRAPSG
FT                   ARRNRALTDRFEPGSTFKLVGAVAAIEQGLVSLDDSVETGDGWAVFHGYTMKDVQAHGT
FT                   ISFADVIAKSSNVGMAKTVDELDRGTYYQYARNMGFSQPTWIDLPGEVGGVLKRPPQWS
FT                   ATTQTSMAIGYEVSITPLQLITAYSALANGGLLKRPYVVAERRDVTGKTLWENEPETIR
FT                   RAFREETADTLRSAFKRVVETGTGTNAQIDGLRVAGKTGTALQLADGEYSADETRASFV
FT                   GFFPANAPEVALLVVLGAPDGGPHGGEVAAPVFRRVARRWAGTFPAVVDRMTPDPSPAP
FT                   TAAPMEVRPSVDTLPSGRPDAMPDLTGLSTRRAVAWLRGRDIEPQLRGAGKVVRQRPRP
FT                   GAPLPETRALLTAAQ"
FT   CDS_pept        776249..777817
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="SRM_00642"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
FT                   ligase"
FT                   /function="Cell wall formation. Diaminopimelic acid adding
FT                   enzyme"
FT                   /EC_number="6.3.2.13"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00642"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23563"
FT                   /db_xref="GOA:D5H6A8"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A8"
FT                   /protein_id="CBH23563.1"
FT                   /translation="MPFSRRPSEPMPGPTSAHTERISEWEPDPLPWSALRRRLRKADLL
FT                   DETIAGAEAPDPDTLAIGGLTDDSRAVTPGGGFVAIRGVDADGHSFIDMAVDNGARLVV
FT                   CEALPTRARERFPGVVFARVTDTRTALAEGAAALHGDPADEMRLVGVTGTNGKTTVAYL
FT                   VHHLLEALGETAGLLSTIEVRAGGETTAPALTTPGPLVLHRTLRRMVDRGCTACAMEVS
FT                   SHALDQDRVHGLDYEVAIFTTLSVDHLDYHDTLDDYRAAKKTLFDALGPDATALYNTDD
FT                   EAGPTMVADTEARVVSFGLDRDADIEATVLEARLDGQRVRLDGHERDTQLAGRFNASNM
FT                   AAAYGTGTALGHVPEAVADALADAPPVPGRVEPLRFEDGTTVIIDYAHTPDALENVLRT
FT                   VRDTTPAKAALWCVFGCGGDRDAGKRPTMGRIAERLADRVIVTSDNPRTEAPVAILRDI
FT                   RDGVERPESMRWIVDREEAIQAAADETMPGDVVVIAGKGHETTQTIGTDTRPFDDREVA
FT                   RRYFG"
FT   CDS_pept        777875..779032
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="SRM_00643"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /function="First step of the lipid cycle reactions in the
FT                   biosynthesis of the cell wall peptidoglycan."
FT                   /EC_number="2.7.8.13"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00643"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23564"
FT                   /db_xref="GOA:D5H6A9"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6A9"
FT                   /protein_id="CBH23564.1"
FT                   /translation="MLYYLIDYIERLYHPPGFQVIRFITVRAALASITALGIALGAGRG
FT                   IIRWLRQQQLGEQVREGEAAGAISHAHKAGTPTMGGIIILLSVGGATLLWGAVANTYVW
FT                   LSLVAMGGLGVVGFADDYVKTVLKQKDGLNAWYKVAGQVAIGLFVGSVLYFHPDFAAYN
FT                   TFTFIPFLKDQVLDYDLFRFLELGVDLGWLVYLPVVVFIVTAVSNAVNLTDGLDGLTTG
FT                   VTAFVSLGLVALVYVSGNAEFATFLNVMHLPGTGELTVFVAAVTAACFGFLWYNGYPAT
FT                   VFMGDTGALALGGAVGSTILMVRKELLLPLLGIVYFAEALSVIVQTSYFKYTRRRTGTG
FT                   KRVFRMAPLHHHYEARGLHEAKIVTRFWIVTAITVIAALLILRIR"
FT   CDS_pept        779041..780486
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="SRM_00644"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /function="Cell wall formation. Catalyzes the addition of
FT                   glutamate to the nucleotide precursor UDP-N-acetylmuramoyl-
FT                   L-alanine (UMA)"
FT                   /EC_number="6.3.2.9"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00644"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23565"
FT                   /db_xref="GOA:D5H6B0"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B0"
FT                   /protein_id="CBH23565.1"
FT                   /translation="MTNPALRRGAEPILQSPSSSAMTPDEVHKTRATVVGGARSGRAAA
FT                   RLLAKVGGEVFLTEQDAPSDGAAAALDEAGVEYEFGGHTAEALNADVLVLSPGVPTQSN
FT                   IVQQALRAGLDVYSEIEAASWFCDAPIVAITGTNGKTTTTSLTGHVFRTAFADTPGREA
FT                   IVAGNIGYPFSDYVLETEPTDVVVLEVSSFQLDHVETFRPRVSVLLNITPDHLGRYDHD
FT                   FEAYAQAKHNIFRNQGEGDVVVYNRDDDDVRDAVEEAAAEQGVRPMAITREGVPAAGAG
FT                   FRDGRIVLRTDDEDDSLMPQDELALRGRHNMYNSLAAAVSARVMEVENDVIRESLSGFE
FT                   GVPHRLEEVRTVDDVLYVNDSKATNVNAVWYALESFDRPIVLIAGGRDKGNDYTDLKPL
FT                   VRDQVRAVVALGESTEKVERELGGEAPDHSRAATMEDALTQAQRAAQPGDVVLLSPACS
FT                   SFDMYENYEERGDTFRRLAETLL"
FT   CDS_pept        780601..781770
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="SRM_00645"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00645"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23566"
FT                   /db_xref="GOA:D5H6B1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B1"
FT                   /protein_id="CBH23566.1"
FT                   /translation="MSIVQSLTQKVTDRAPADKYVVWVVLALSSVGVVAVYSAVTYLAE
FT                   VRAGTEPVHFLLRHLARVGIALGAMGVVSLIDYRTLARYSRLALVGTLLLLVAVKVVGL
FT                   FSGGADRWLQIGGVGFQPSEFARVALVFYVAVLLVQKQDYVKSFSRTFLPVLFWVGVTV
FT                   GLIALDDLSTALVLLLGVLLMSFVGRVSVLQIGGLAVLGGVMAFGVLSTSPDRAARLEA
FT                   YLGMDLFPNTDTEQVMDARGEQYQSRQARMAFAAGGFTGVGPGKSVQRDFLPEPYNDFI
FT                   FAIIAEEYGIFGALALLTGFFVLLFRGYLRIARDAPDPLGLILAVGMTTLVVTYGFVHA
FT                   GVASGLLPVTGLPMPFVSYGGTSLLANGIMIGVLLNISRHAGQRSAERV"
FT   CDS_pept        781813..784452
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="SRM_00646"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /function="Cell wall formation"
FT                   /EC_number="6.3.2.8"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00646"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23567"
FT                   /db_xref="GOA:D5H6B2"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B2"
FT                   /protein_id="CBH23567.1"
FT                   /translation="MISFVTDEHARSAHTDGGWWHWGTRVPGHRHCRRGAGPPSGRPDR
FT                   VCGHAGPARSAGRAGGGVCPPPDYGAGPSATGRGVQPAAAVPCGAGPGAELAPRGGHRA
FT                   GRGGGHGRVRGRPGADGGVAAWTAPPDTGAERLRGPHEPGARAACAAHPPRLSRGEGLG
FT                   ARRARGGERKPHAPVVAGRRSRRGPGGLQRPGGRACAVGHGGVAGQCRDQRGDPADPGS
FT                   PAGRGRRVRGLADGNPVLRRPDGGPRRAPATSRRRVHRPDGTRLRRGRPRGVPGGGAHL
FT                   QRADGHGHARGARALAQCDGRPSDQERTEPGTGRRRRLAGRGGPRRAPGDGAARPARQF
FT                   RPARPDGRGRPRPGPPRRRGDDCPRRARPCRPLPHELIPIRSRRPVGICPGPAEPPTRP
FT                   TRTDAMAELRTQPALGRIRQVHMVGIGGIGMSSIAEVLLNRGYTVTGSDLERSDVTERL
FT                   EAEGATIHEGHAAEQVGTADVVVYSSAVDPDENPETREAERRRISLIPRAEMLGELIRM
FT                   KFGVGVAGTHGKTTTTSMAGLVVAEGGFDPTVIVGGKVTAFGSNAITGEGDVLVIEADE
FT                   YDRTFLRLTPSLAVITSIEEDHLDVYEDLAAIQAAFTQYANSVPFFGAAILCLDDPNVQ
FT                   AIVGDVERRVVTYGTTRQAEVRGENVRREGMTTRFDVVVRGERLGTIELHVPGMHNVRN
FT                   ALAAVAVGQELEISFERVRDGLGTFTGVRRRFEKKGEVGGITVLDDYAHHPTEIEATLD
FT                   AAHQGFPDRRVVAVFQPHMYSRTQNFMDEFARSFFNADMLVLTDVYGAREAPIEGVTGG
FT                   RLAERAEQFGHRAVHYVPEKTDLPGRLQELVGPGDVVLMLGAGDIWRASEAFVELLENN
FT                   GGTAIERD"
FT   CDS_pept        784600..785379
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="SRM_00647"
FT                   /product="FtsQ protein, putative"
FT                   /function="This protein may be involved in septum
FT                   formation."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00647"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23568"
FT                   /db_xref="GOA:D5H6B3"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B3"
FT                   /protein_id="CBH23568.1"
FT                   /translation="MTRDQTATFGRRALRVAGSGLLVAGVVALGLLGWQWRANVTVDRV
FT                   AVTGAQHAPPDTLRRLARVGRGTAMRAVAPMLVADRVARHPWVQEATAETQWMQGALMI
FT                   AVTERTPAALAVDAQGRPAYYLDRSGHAMPLPDSAGYDVPLVRGLEAEAPWTQPDTAQT
FT                   PSSLRRVLRALPEAGVADLVAEIEMQPDHAIQLTTTPIGPHDALPVDLGSGDMPRKLRT
FT                   LRAFARQVLASSPGEPIEHIDLRFDGQVVTRTHPLDG"
FT   CDS_pept        785514..786773
FT                   /transl_table=11
FT                   /gene="ftsA"
FT                   /locus_tag="SRM_00648"
FT                   /product="Cell division protein ftsA"
FT                   /function="This protein may be involved in septum
FT                   formation"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00648"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23569"
FT                   /db_xref="GOA:D5H6B4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B4"
FT                   /protein_id="CBH23569.1"
FT                   /translation="MNENIVVGVDIGTTKVCAVVAGKDDLDRVNILGVGMAPSDGLNRG
FT                   VVVNIDRTVAAVREAVEEAERAAGVEVQNVVVGIAGDHVQSFQTRGVVTINANEITQND
FT                   VQRLLEDTTHVALPADREILHVIPQEFIVDGQDGVADPVGMSGVRLEADVHIITGLVSA
FT                   AKNIYRCIEKAGFRVSDLVLEPLASSFSVLHEDEKEVGVALIDIGGGTTDIAVFEDHTI
FT                   RHTAVIAVAGDKVTDDIRKGLGVMRDQAEQLKRQFGVALADEADSDEKIEIPGIGGRDE
FT                   KTIGRDALAQIIQPRLEEILEIAAMEIKRSGYGRHLGVGAVLTGGGSLVPYTDELAAEV
FT                   LGMEARVGRPMGLSGGLVEEVSDPKFSTGVGLVLYGMRPDIIGGTTLSEEVRAHQNGQA
FT                   NGDTLMTRIANRMKAWFDEL"
FT   CDS_pept        786987..788306
FT                   /transl_table=11
FT                   /gene="ftsZ2"
FT                   /locus_tag="SRM_00649"
FT                   /product="cell division protein FtsZ"
FT                   /function="# This protein is essential to the cell-
FT                   division process. It seems to assemble into a dynamic ring
FT                   on the inner surface of the cytoplasmic membrane at the
FT                   place where division will occur, and the formation of the
FT                   ring is the signal for septation to begin. Binds to and
FT                   hydrolyzes GTP (By similarity)."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00649"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23570"
FT                   /db_xref="GOA:D5H6B5"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B5"
FT                   /protein_id="CBH23570.1"
FT                   /translation="MDQDFSSKFSFDDAANEEAKICVVGVGGGGGNAINNMVQKGIHGS
FT                   VEFIAVNTDSQALNENRAPQKIQAGQDLTSGLGAGARPSVGAEAIEESSEEIRQALEGY
FT                   DMAFITAGMGGGTGTGGAPVVAAIARSLDILTVAIVTKPFDCEGSRRMNTAQEGIELLR
FT                   ENVDTLIVIPNERLLDIADPDTSLIEAFEKADEVLYNATRGISDLITVHGLINLDFADV
FT                   QTTMKDGGTALMGSATATGENRSEKAAVQAISSPLLDGLSIAGATNVLVNITSGPSLGI
FT                   REATQATSVIQKEAGEDVEVIFGTVIEEDIEDKLRVTVIATGFDRDEEPEDEGDDGRRT
FT                   VPLEDQNEDDDPADYKGETNLRQLDTPAYERRNAPLRSEPSEDEPTDETDGESEDDTPN
FT                   IRRLEADDLNERTDRDERSRSDEETDDDTDTPAFLRKMMD"
FT   CDS_pept        complement(788369..788728)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00650"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23571"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B6"
FT                   /protein_id="CBH23571.1"
FT                   /translation="MRKDVPQKGVPRDGPGIPLGRPPHPPKHEKPRAGAGPGVALAHRT
FT                   EAAGTLPGPLVHNHSTATLLKRCGQASGRPTGRAPTGPGLPQTRTVSRRGTGRPVVGLE
FT                   GPLFDAVGGRFSTKT"
FT   CDS_pept        complement(788785..790479)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00651"
FT                   /product="Serine protease / subtilase peptidase"
FT                   /EC_number="3.4.21.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00651"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23572"
FT                   /db_xref="GOA:D5H6B7"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR017308"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR034080"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B7"
FT                   /protein_id="CBH23572.1"
FT                   /translation="MKPTTLFSTLVLAYLLIGCAGSRPPTTPTTSDSPAPSNSAAPDTT
FT                   TQAADAPPPAPSRAPQDWYHLDRVPRSGPGLDTRAAYRDVLQGRPPQDTVQVAVIDSGL
FT                   DIDHEDLAAKLWTNADEIPGNDVDDDGNGYVDDVHGWNFIGGPDGKNVDQDTYELTRIY
FT                   VDLQERFAGVDSARVGPDARDRYRRYQDIKRTFQKKRREARKRLAKVGKAQKAVQASVD
FT                   VLKSHLGTDSLTQSAVRSVTSSRRDVRRAQQTLQYFYDQDLSPSDLKDYKNQLERQVEY
FT                   NYNPDFNPRPIVGDDYADKTERRYGNNDAEGPDPGHGTHVAGIIGATRDNSIGIDGVAR
FT                   GVRLMSVRAVPNGDERDKDVANAIRYAVDNGADVINMSFGKSYSPHKGVVDAAVQYADS
FT                   MGVLMIHAAGNDGANVDSTDNFPSPYYADGGRAQRWIEVGASSWEGGEKLAASFSNYGA
FT                   ERVDVFAPGHSIYSTVPDDAYERNDGTSMAAPMVSGLAALIMAHYPSLTATDVRTIILE
FT                   TATPYRNRTVARPGDGETVPFGTLSDTGAVVNAHAALRRAADRVAAQ"
FT   CDS_pept        complement(790518..791090)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00652"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00652"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23573"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B8"
FT                   /protein_id="CBH23573.1"
FT                   /translation="MLPERIPIPESLHSIETGDPIATCLACDAPLLDGPTEYLVEKGYR
FT                   QYEAYDVQETVFEYAICMDCHAEMRQSFSEPSKRRCQAYLSEHVDLAARTGRLLDADSR
FT                   DPADWTRQCVVHGTPRDELEEYQVIAHCQGDELLLTHLPLLMGGPAIDALVQRLSSETL
FT                   DDLGGFRDEHLGLPPELKRDLQGPIVA"
FT   CDS_pept        791328..792497
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00653"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00653"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23574"
FT                   /db_xref="GOA:D5H6B9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6B9"
FT                   /protein_id="CBH23574.1"
FT                   /translation="MHVLVVPSWYPTTEAPLDGIYFAEQARCLQSRGMNVGVVYPEHQS
FT                   LRRCAATTLRRKHCQTEWTTDHGIPTLRRYGWNVWWQAPPGLRCRIRSAVRLARRYAER
FT                   RGVPDVIHAHSARWAGAAAARMSDALGVPYVLTEHFSGFQRGSILPWRRPLVDRGLRHA
FT                   RGLAAVSTGLKEALTARDGIVSQNVAVHPNPVRASFFTRPPEGRPSSPPFRFVTVAGLN
FT                   PRKDIGGLLEAFAQAFGASNGASLTIVGEGPRRAALETRARRLGVEDRVAFRGRQGRSG
FT                   VRKALWNAHAFVLPSRHETFGVALVEAMATGLPVVATRSGGPEDIVTTETGRLVPPDAP
FT                   AALAEALRSMRMRSGAHDAGRIRAHAVSHYGPAPFVRRRHAFYRRACAA"
FT   CDS_pept        792531..797591
FT                   /transl_table=11
FT                   /locus_tag="SRM_00654"
FT                   /product="conserved hypothetical protein, secreted"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00654"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23575"
FT                   /db_xref="GOA:D5H6C0"
FT                   /db_xref="InterPro:IPR001769"
FT                   /db_xref="InterPro:IPR011635"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR039477"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C0"
FT                   /protein_id="CBH23575.1"
FT                   /translation="MVDLRITLWWAVVGGLLLLAPMGAVGQVSNSFDPGWYDPGAPHLQ
FT                   IGVTTDGVYRVPAEALEGALPDGTTLADISPGTIRLLENGEEVPIQVEGAADGTLDPSD
FT                   TITFVGHRNRGTDELWAYDGDAAAQSSAYRSLYSDTTHYWMTWGGKEGRRYAEVSPGAS
FT                   PTTTALRDTVRIERDETYYFGRPSSTGNPLYTESEGYYWRQFRHNDTSPRSATYTLPVG
FT                   RRADTGASLDLRLRVDGASSSCHRVDVEGRLRQPGGSRAFESIATVEWRNLARRTIEAS
FT                   VAQDRIPDEGLELRLTSYNDGFSGDLDCPDPSSTPNVVLFDWAEAAYTRTLAARADDAQ
FT                   RFVPPTADATTVALTGHTGDTVHVYSPAGARRYAAPVEGDTAFVQANPSTARAPHWAVG
FT                   ADGYKTPAAIQPDAPSNWSDPDAHAADYLLLTTEALLPAAQQLADYRRSHDGYEVEVAL
FT                   VQDIFDEFDYGRPTPIAIRRFVRSTQAWPTAPEFLSIFADAQYPIRDGSVDTLYPEWSV
FT                   PSFGYAPSDGWFAMQSDGPDDWSELLAVGRIPVRSVAQGELFVDKLQTYEAAPLKRWQK
FT                   RMLLLAGGTTEREQGRLQKYSDWWGEIASDTVADPENRSYTGPVHTGADTLRYYKNVND
FT                   PLDASFQDSLAVDLERGAGWLNYFGHSGAQTWEIVTDPPAEFDNAGRLPVVVSLGCRTG
FT                   SFAGGRFEEKSAPSLGEQLVVGSVRPDGTPRDGALNGGIAHFGESALGNLVPSARLNDA
FT                   LVQRVFVDTMRVLGEAIRAAKAEIDADFGNSDFYVKHLLQYGLIGDPATTLALPAKPDL
FT                   HVSPDLIATEPTAPVPSDELTTTVRVQNRGLIPDDSVSTRLTWEQPDGRTTRRTRRLDR
FT                   FALEETLSFSDSLDERAVGTNTFRVTADPTNEYEEANETNNTAERSQVVFDAGVSLLAP
FT                   SDYGTVDPEQPSLEVVVSGPATDRGDVVLQLDTVPDFSSPARREVRRAADGLRGTWTPS
FT                   GLSADETYYWRARLAGTDAEAWRTARFTAAPDGGDGAWLQQDRLFSGNEQTQLRRSNQD
FT                   WAFDTYSRRIKTFSERGSGSEEDGFTVNGTSDYEYLKFGFGVLVMNGLTGQVRDSESFP
FT                   TYDLPQRWEDYLKERGEFIGDQQEAVDALDTFLDQVPEEGDYVFIRTRHLARQSSASIP
FT                   KEVKSIFQDLGSSTVDTLTYNHVWVMKTQKGAPSKTVEEVSPPSEADDVNEVILNTELD
FT                   FPYSSGTTHSPRIGPASEWGTLHWNGATPGMADAIELDVLAADSTVLLDDLTGGAGEQS
FT                   LESVDATAHPYLYLRATLSDTTARTAPQLDRWGGSYTGVPELVLDPSGLAALPDTVRQG
FT                   EPATAALPVVNYGPVESRPVRIRALLEDASNVATPVLTDTLSALPPDGGRDTTTLAVSS
FT                   TEFPGDNVLRAEAATGGPPERLPSNNTVVRNLYVQADEEAPSLRVLANGRELPPTSDDV
FT                   TNLQAPELPFVSTDPTLEVLVRDDNPYLALDDTSYVDVYLKGGLPSRGPGLGSDFRRIS
FT                   FADDALTFVPPDSGTADPLRLQFEPSLATRDSTYTLKVEAEDTRGNAVEPYQGSFRVQQ
FT                   EQVIRDVYPYPNPMNTHTTFAFRVEGGRNEALRDFALRIYTLSGRLVRQLEARHLDSPL
FT                   RVGWNTLRWDGRDEDGDRVATGVYLYRVRIEGAETTFRGDVEKISVIR"
FT   CDS_pept        797686..798825
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00655"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00655"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23576"
FT                   /db_xref="GOA:D5H6C1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C1"
FT                   /protein_id="CBH23576.1"
FT                   /translation="MADRHASSLHLAFFVPTLVGGGAERVVVTLANAFAEAGHNVDLLL
FT                   TSRCGPYSESVSPQVSVVNFGCEHTWHTVPALVQTLRQRQPDVLVSALFGATVAAYGAT
FT                   TWMRTRGESVPCLCATVHAPLPRTRKQGVRARLQAHAAHMILRRVETVVAVSRTLARSL
FT                   ATHVGRDRERIEVIYNPIDIDAVQSGTEAIPHDWLEDHVPVVVSAGRLHPQKDYRTLLR
FT                   AVARLHDRNRRVRAIILGEGPERKRLDELSRRLGISPDTAFPGFAQNPYAFMAQADVFA
FT                   LSSVLEPFGNVVVEALACGTPVVATESGGPAEILHTDSATYGSLVPPQDPAAMADALAA
FT                   MLSRPVDQCRLQRRARDFGVSKAVDRYYDLFEQTACGAS"
FT   CDS_pept        798877..800121
FT                   /transl_table=11
FT                   /gene="rfaG"
FT                   /locus_tag="SRM_00656"
FT                   /product="Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00656"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23577"
FT                   /db_xref="GOA:D5H6C2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C2"
FT                   /protein_id="CBH23577.1"
FT                   /translation="MEIAYIVSQYPARSETFIAREVKELLVQGNRLLIAPLRWSDTGEG
FT                   IRVEGADVLGLQWNPLDWVLSLAWAAARRPRQVLQMGRDICTAPLFSGLWRRLLVLSLV
FT                   SLALARELDDRSVDHLRAHFLDSEAIAAFWVSCLLDIPFSVTVHTLSTRFPTPLLRHVA
FT                   QATSFCAVSGNGTKRMMKGMANRQNRVGLIRNGVSLPSTVRSRAFPLVAPVWRLLAVGR
FT                   LVEKKGFDTLLDACALLRDWGRPFRCDIIGDGPCRDRLTEHARRLRIERHVTFCGAQPN
FT                   HEVYRALRQHDVLVAPCRLASDGDRDGLPTVLMEALSCGVPVVASAFAAIPELVTDGET
FT                   GRLVPPNAPVALARTLRRLFDQPRHAFRMGREGREQVRRRFRLEREVETLDARIRTPPR
FT                   ASTFRDFREQAYALD"
FT   CDS_pept        800118..801167
FT                   /transl_table=11
FT                   /gene="wcaA"
FT                   /locus_tag="SRM_00657"
FT                   /product="Glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00657"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23578"
FT                   /db_xref="GOA:D5H6C3"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C3"
FT                   /protein_id="CBH23578.1"
FT                   /translation="MNSVLHTWGGFPDTCAPTCGLSLLFMPSHSPAASEDGVVICTRNR
FT                   PSELARTLESVAEQSGAAQRPVIVVDGSDRDDEERTVEVVRNWCDEGLPVRYHRYAGTP
FT                   AGTRQRNAGVDLLPDSVEVVHFIDDDVTLRPGYFDALCKVLNQKRHLLGVGGVIAKSEG
FT                   TSPRPLVQWAHRLFLLRADQPSRVLPSGHTTPAWPTGENDVQPAEWLSTCASSYRAEVF
FT                   DRHRFDPAVKGPSPRLEDLDFSVRVARDGPLAVVPEARCVHRVSGRNRRGTAATTRERL
FT                   ARRYWFVRKNMDRPLNRLAFWWSALGQLIALVTSSDPDSRAALRGHVQGLRQAWTCAHP
FT                   LLGEGADDG"
FT   CDS_pept        801119..802372
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="SRM_00658"
FT                   /product="mannose-1-phosphate guanylyltransferase"
FT                   /function="# Involved in GDP-mannose biosynthesis which
FT                   serves as the activated sugar nucleotide precursor for
FT                   mannose residues in cell surface polysaccharides. This
FT                   enzyme participates in synthesis of the LPS group C2 O
FT                   antigen."
FT                   /EC_number="2.7.7.22"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00658"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23579"
FT                   /db_xref="GOA:D5H6C4"
FT                   /db_xref="InterPro:IPR001538"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C4"
FT                   /protein_id="CBH23579.1"
FT                   /translation="MDVCASAARRGGRRRLTGGVQLPASRPMLRTPLADHPPRVRAGHC
FT                   PSRGPLFFLSLQSDASMKYAVIMAGGIGTRFWPVSRKEHPKQFLDIFGDGTLIQNTIAR
FT                   LQGLVPPERCLVVTHDRYVEKTKKQLPAVPEENILAEPISRNTAPCIAYAATTLAKRDP
FT                   DATMAVLPADHVIGNVARFHDTLDVAFDAAQERDALVTIGIDPTYPATGYGYIQYDGSG
FT                   ADPPALEAYPVRTFAEKPDQSTAERFIDAGDFLWNSGMFIWRADTILDQIETHLPDAHE
FT                   AFAPVRAADGAADSETLTEAFRESPRISIDYGVMEQADTVHVVPGTFDWNDVGDWRAVY
FT                   DLSEKDEHGNVIEGEVIMQDSSRCYVQTEDRLVVLVGIHDKVVVDTGDAVLVCDRESAQ
FT                   QVKQVVEYLHAHQFEEYV"
FT   CDS_pept        complement(802438..803136)
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="SRM_00659"
FT                   /product="trehalose-6-phosphate phosphatase"
FT                   /function="catalyse the de-phosphorylation of trehalose-6-
FT                   phosphate to trehalose and orthophosphate"
FT                   /EC_number="3.1.3.12"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00659"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23580"
FT                   /db_xref="GOA:D5H6C5"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C5"
FT                   /protein_id="CBH23580.1"
FT                   /translation="MPPVVEPPLFFLDYDGTLAPIVDDPAAAVPHPEAPDLLRNLDAQF
FT                   PLWIVTGRDLQALSSFLDRPYSAIGLHGAQEGVVGRDVHNRMSDEAAAALRRLRASVPS
FT                   VDGLRVEDKARSFAVHYREARDESGARDQLKDWLADLPEVLDAIWGKKVVELRPDGLTK
FT                   GTAVRRIAAQHPDHVPVYLGDDVTDEDAFAALQEMDRDTVSIKVGPGDTRADARLDGPD
FT                   AVMAYLSRYV"
FT   CDS_pept        complement(803276..804640)
FT                   /transl_table=11
FT                   /gene="otsA"
FT                   /locus_tag="SRM_00660"
FT                   /product="Trehalose-6-phosphate synthase domain, putative"
FT                   /function="This enzime catalyzes the key, penultimate step
FT                   in biosynthesis of trehalose, a compatible solute made as
FT                   an osmoprotectant in some species in all three domains of
FT                   life."
FT                   /EC_number="2.4.1.15"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23581"
FT                   /db_xref="GOA:D5H6C6"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C6"
FT                   /protein_id="CBH23581.1"
FT                   /translation="MSLTVVANRVPIRQTDDGWETSVGGLTTALLPVLEEEGGMWVGMG
FT                   EDPDLPERQEYPADDPDFLVRRVPLSSKELEGYYYGMANQILWPLSHYLIQHLNLDDQF
FT                   IETYRQVNERFAEAVLAETETGDEDVIWIQDYHQMLSPNLIRQERPDATIGHFWHIPWP
FT                   AMEIFRILPWSRELLRGMLGCDLIGFHVQEYVDNFIESAEVLLGAEVDGDRVRHNGHET
FT                   RVEAHPIGIDVDRFKEMSRDDSIEQDAQKFRERLGSDHIVIGIDRLDYTKGIRSRMLAF
FT                   EKFLEENPEYHGNVSFFQIATPSRTELESYQQIRREVDEVVGRINGRFAEENWVPVNYR
FT                   YRTYTQYELCAFYRAADAALITPLRDGMNVVTQEFVTASQDGVLILSELTGAAYLLPEA
FT                   VQVNPYDHGGVADAIRTALEMPTGEREERLAGLKDTIETLDVHNWAGNFLDSIQE"
FT   CDS_pept        complement(804842..805162)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00661"
FT                   /product="Conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00661"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23582"
FT                   /db_xref="GOA:D5H6C7"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C7"
FT                   /protein_id="CBH23582.1"
FT                   /translation="MTRDAPDTDAPDTDTSAERHYRNWTVLAPLGLLATGLGASGVGQS
FT                   TLLKGRGAPTWKWVAAGTASLVALNAGLCLFGDAIKHRALYEWAHEQEAEADDAGHAEG
FT                   LQ"
FT   CDS_pept        complement(805221..806177)
FT                   /transl_table=11
FT                   /gene="glpQ"
FT                   /locus_tag="SRM_00662"
FT                   /product="Glycerophosphoryl diester phosphodiesterase"
FT                   /function="# Glycerophosphoryl diester phosphodiesterase
FT                   hydrolyzes deacylated phospholipids to G3P and the
FT                   corresponding alcohols."
FT                   /EC_number="3.1.4.46"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00662"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23583"
FT                   /db_xref="GOA:D5H6C8"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C8"
FT                   /protein_id="CBH23583.1"
FT                   /translation="MTPALLLSLLATVGIGMPATAGAAPPPDSVAPPEAFDLQGHRGAR
FT                   GLAPENTIPAFRRALALGVTTLEMDVVVSADGQVVVSHEPWMHPDICTLPSGAPVPEGD
FT                   ARGHNLYQMPYVDIQRYDCGRRRHPDFPQQAPQPAVKPRLHDVIRMAEAYVVEHDRPPA
FT                   FYNIEIKSRPAWDGTFHPEPEAFAQRVLEVVRGSGVAAQATIQSFDERALRAARRLRGD
FT                   ADPAVELALLATDGTAEALPDQLDALGFVPAVYSPAHTAVDAGLLRAAHDRGLRVVPWT
FT                   VNERDTMRRLIRLGVDGLITDYPDTGMDVVETMSVGE"
FT   CDS_pept        complement(806190..808733)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00664"
FT                   /product="Dipeptidyl peptidase IV (DPP IV)"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00664"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23585"
FT                   /db_xref="GOA:D5H6D0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002469"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR038554"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D0"
FT                   /protein_id="CBH23585.1"
FT                   /translation="MSEQAHDRRLPGRWFPKLPAPMARRTCSPRPPASQPTGPRPVEST
FT                   GIATAPRDEYVLGSRAGHFSLTSSPSLMMRRIAFSLVALLVLSVPAGPVQGQDGPEFTL
FT                   ESIHASATLRASTFQGGKWADQGPVITYIEAADSADATHLMRYNLRTDKQTRVIDGTTL
FT                   HAGDVGRVVPIEDYTFGPAGDKVLIYTDSKEVWRANTKGYYYVYDLDAQTLTPVSDRDR
FT                   GYQMFAKFSPSGAKVAFVRNRNLHVVNLTTGTETALTTDGDEGTIINGTFDWVYEEEFG
FT                   VRDGWQWGPDGRRIAFFKLDESETRSFPLMNNTARYPDITTFRYPKAGEQNSEIKIGVV
FT                   DLAAVDTTARSQPQAIQYFDTNTWNAGGQAHEYLARMGWTPEIDGTHRVWMYRLNRNQN
FT                   VLDLLYGHPETGRTEPVLQDTQDTYIDVTDDKLTYLDDGEHFVFLSERSGYNHAYLYRT
FT                   DGTELGPITGGEWEVTQFHGVDTEASTAYVTGTRDTSLERHLYATDVSLDAHEEAPPAR
FT                   KVTSRPGWHAINLSTDRDYYIDRHSAAGTPPSWALHEASGDRLTTLQANDTLEKRLDSL
FT                   NLPPKQFTRLPGADGTALNASIIKPNDFDPARTYPVLMYVYGGPGVQTVTNQWGSSRQL
FT                   WHQYLARAHDMVVVSVDNRGTGGRGKAFQDVSYQRLGQPESADQIRAAQALADSAWVDD
FT                   ANIGIWGWSYGGYMTLMSMLTEDGPSTFDTGVSVAPVTDWRLYDTIYTERYMSTPDQNA
FT                   DGYKNGAPQAYADRLREDQNLLIVHGDDDDNVHFQNSVQMVNRLQSANKQFRFMMYPTH
FT                   EHGIAGGRTRLHLFTMITNHLTEHLSSDEPAQHTE"
FT   CDS_pept        808594..809991
FT                   /transl_table=11
FT                   /gene="alr"
FT                   /locus_tag="SRM_00663"
FT                   /product="Alanine racemase"
FT                   /function="Provides the D-alanine required for cell wall
FT                   biosynthesis"
FT                   /EC_number="5.1.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00663"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23584"
FT                   /db_xref="GOA:D5H6C9"
FT                   /db_xref="InterPro:IPR000821"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR011079"
FT                   /db_xref="InterPro:IPR020622"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6C9"
FT                   /protein_id="CBH23584.1"
FT                   /translation="MPVDSTGRGPVGCEAGGRGEHVRRAIGAGSFGNHRPGRRLSCACS
FT                   LIFARSPVPFAIDRSPHTVGAAPVTATVDLAAIQHNAGVLQERAGGADVMAIIKADAYG
FT                   HGVRPVARAAYEAGIRHYGVARLPEGVHLREAGHGGRILVLGAPAPTQLPRYAEYDLDL
FT                   TVPSADIAAAVVRHASPEAPLRVHVTVDTGMGRLGLAPDDVPAVMTRLADAPGVRLAGL
FT                   WTHFATADAPGSSFAQTQLDRFRAVVDAVDVDVEHVHAANTGGLLTIGAPTHEFDASLV
FT                   RSGIALYGLAATPELSARLDLRPAMRLAARVTHLKTVPAGTPISYGAQWEAPRRTRIAT
FT                   LGIGYGDGYPRRCSGRASVRIGGASCPIVGTICMDMCMVDLGPPNEAPATRVDRGDEAV
FT                   LFGPAGPTAYDVAQWSDTIPYEILCGVSPRVPRRHVNCTDENGTDENGTDDMRAPSRLT
FT                   RPTASGG"
FT   CDS_pept        810158..810871
FT                   /transl_table=11
FT                   /gene="drrA"
FT                   /locus_tag="SRM_00665"
FT                   /product="response regulator DrrA"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00665"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23586"
FT                   /db_xref="GOA:D5H6D1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D1"
FT                   /protein_id="CBH23586.1"
FT                   /translation="MPITADPSDIDVLVVDDEKDVVEVVGHFLEEEGYTVHTAFDGEEA
FT                   LETASGKIDLIVLDIMLPGVDGYEVCRELRDSVETEEIPIVFLSAKTEEEDQIEGLMLG
FT                   GDDYLTKPVSPQVLVAHVKAVLRRSGVEESSILEVDGLKIYEDEYRAELNGEDLGLTLT
FT                   EFELLRYLVRHPRKAFTRQQLLETIWKDAMMVTERTVDAHIKNLREKLGDFAKHIQTVR
FT                   GVGYRFVQEEESAEA"
FT   CDS_pept        810939..812399
FT                   /transl_table=11
FT                   /locus_tag="SRM_00666"
FT                   /product="Sensor kinase"
FT                   /function="# Member of the two-component regulatory system
FT                   cusS/cusR. Copper ion sensor. Could also be a silver ion
FT                   sensor. Probably activates cusR by phosphorylation."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00666"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23587"
FT                   /db_xref="GOA:D5H6D2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D2"
FT                   /protein_id="CBH23587.1"
FT                   /translation="MSFVRSIRDALLPRRASTQTWMVLTFALFVGTAVVGVGLYVMLVL
FT                   RGEMRTAMQETLHDQADRIAVQAEQEPDPAGRGRIVDNLTELQDLHVSLVTPDTTYRPS
FT                   PQTAPPFPADTLVEVSALRNMTEETVRFARHDPDDGQQFFLAALYRPSANLIVQVGQPP
FT                   PPLYSLAQRSQVVLVLGMILALVLALIGSFIAAYQVTTPLTRISETARRVADGKLTGKI
FT                   QVESRAAEFQDLAESLNRASDTFREKIEELERMTRLQSEFIGNVSHEVRNPIFSISGYL
FT                   EALGTPGLDDEQRKMYSEKALTNLNRLQNLFNDLIDIARLEYKEDLINRSVFDLKDLVD
FT                   EVAEMLRPKAEEKGLDLEADVSRFFVHADRSRVRQVLTNLIENGIAYTGGGSVRCRVQR
FT                   RLDKVRVEVVDTGQGIDEDHLDRIFERFYRVDPDRSRESGGTGLGLSIVKQILQAHGED
FT                   IHVESTKGRGTRFWFELPYEPEPEAVEA"
FT   CDS_pept        812513..814930
FT                   /transl_table=11
FT                   /gene="acoA/pdhA"
FT                   /locus_tag="SRM_00667"
FT                   /product="2-oxoisovalerate dehydrogenase, E1 component,
FT                   alpha and beta subunit"
FT                   /EC_number="1.2.4.1"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00667"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23588"
FT                   /db_xref="GOA:D5H6D3"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D3"
FT                   /protein_id="CBH23588.1"
FT                   /translation="MPLFLRERTLRKRFQVGVTQYAPPWRSWRPGERMGGRQAGTNGGR
FT                   GSFGARRRVDSSSWLRPMATPEMQDTNDSDRDTQTNASSSPSGAAGGVKTAAEEIPAEN
FT                   LMHGDGHAAIPQIPSITSDGSIEVDELSPADFEPDDLRQRLRTMMLSRRLDEKMMTLLK
FT                   QGEGHFHIGCAGHEAVQSALSRYSRPGEGPGHDWFCFYYRDLCMALSLGMTTKEALLAH
FT                   LAKADDPNSGGRQMPEHFGLKHLNVMTTASSVGAQFNPGVGFGFGIQQRGEDSYVYISC
FT                   GDGATSQGDFHEALNWAAREQAPALFLVQDNKYAISVPIEEQTAGGTPYKLAAGYEGLS
FT                   RMRVDGTDFFASAAAAQAAIQHIRDGKGPVCLVADVVRLLPHSSSDDHTKYRTPDELEA
FT                   DRKIDPIDRLEAALIGEGILTEADAEALQEEVHEEVDEATEWAKRQDDPSPETAGDHVF
FT                   FEGDLGLDYNSEDDLDEDAEPMVMVDAINRTLKEEMARDESVIVYGEDVAGDKGGVFTA
FT                   TKDLTDEFGGDRCFNSPLAEGSIIGTAVGYAASGFTPVVEIQFADYIWPAMQQLRNQVA
FT                   PFRYRSDGEWSCPMVVRVPCGGYIHGGLCHSQNIESIFGHTPGLKVALPSTAADAKGLL
FT                   ATAIRSEDPVLFLEHKALYRAASARTPTPPEDYTLPFGKARIAREGSDMTIVTYGMMTQ
FT                   KSLNVAEELEQEGVDVEVVDLRTIVPLDSETILESVRKTNRALVVYEDHEFIGFGAELS
FT                   AQIADDAFTYLDAPIRRVAGEFTPIPFAHSLERSVLPSDEGILEAARDLAAF"
FT   CDS_pept        complement(814946..815647)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00668"
FT                   /product="conserved hypothetical protein, membrane"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00668"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23589"
FT                   /db_xref="GOA:D5H6D4"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D4"
FT                   /protein_id="CBH23589.1"
FT                   /translation="MGIDGAFGNTLLRWQVTEILPLLRSICFTVIPDFLLPEWVPNAHP
FT                   LIVHFPIALIFVAIAADALALWLGERWETGQEVATGLYAATGLSAVVSYYSGTWAIDTV
FT                   SIVTPGAAQTLSAHSFWAWYTMVSTSGYALLRAAGLFIPWVRTRRAAHLVLLLLGLGTL
FT                   VPMHETGENGGAMVYKRGVGVTRTQEIPAPSSPAPDSTRRDTVQQDTVQRDTVQGPAPA
FT                   AGSFSPGAGAP"
FT   CDS_pept        815740..816120
FT                   /transl_table=11
FT                   /locus_tag="SRM_00669"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00669"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23590"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D5"
FT                   /protein_id="CBH23590.1"
FT                   /translation="MSNTETSGFETHLRECYLLVDDYLQSNPKVAAWRRSTGGDSDFTD
FT                   AEVIVIALTGGYFRTDTLKRTYQLAIANTEGLFPTVPGTSSGFAACNGCSTRSADWSCR
FT                   PTRARWRGTNALCGRLAADLAA"
FT   CDS_pept        816393..816488
FT                   /transl_table=11
FT                   /locus_tag="SRM_00670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23591"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D6"
FT                   /protein_id="CBH23591.1"
FT                   /translation="MRQAIRQAESSFSGLWRRFTGRVYAQSWHGP"
FT   CDS_pept        817332..818243
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="SRM_00671"
FT                   /product="Sulfate adenylyltransferase subunit 2"
FT                   /function="ATP + sulfate = diphosphate + adenylyl sulfate."
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00671"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23592"
FT                   /db_xref="GOA:D5H6D7"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D7"
FT                   /protein_id="CBH23592.1"
FT                   /translation="MPMSDSTSEHLDWLESEAIHVMRETVAQFDNPVLMFSGGKDSLTM
FT                   IHLARKAFYPAKVPFPILHVDTGHNFPETIEFRDTLMEKHGLDLIVGSVEETIESGRAK
FT                   EEQGPDASRNKLQIVTLLDTIEEHGFDAALGGARRDEEKARAKERFFSHRDRFGNWDPK
FT                   NQRPELWNLYNGRSRQGEHFRAFPLSNWTELDVWQYIRQEGVEIPSLYLAHERTMFERD
FT                   GVLLPKSPYNDLREDEHYVEKMVRFRTIGDMTCTGAVESTATTLDEVIAEVATTQQAER
FT                   GARADDQRAEAAMEERKREGYF"
FT   CDS_pept        818324..818800
FT                   /transl_table=11
FT                   /locus_tag="SRM_00672"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00672"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23593"
FT                   /db_xref="GOA:D5H6D8"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D8"
FT                   /protein_id="CBH23593.1"
FT                   /translation="MPNKKYRVELTDSERSHLLERLGRGERPAAEQTRVRALLKVDEGP
FT                   EGPAWTDARTAEALEVAKGTVAGIRRRFCERGLTGCVKRKSPDREYERKLDGEQEAELI
FT                   RLAWSEAPEGRSQWSLRLLADKMVELDVVEDLSHETVRQTLKKTNSSPIGTANG"
FT   CDS_pept        818797..819462
FT                   /transl_table=11
FT                   /locus_tag="SRM_00673"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00673"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23594"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6D9"
FT                   /protein_id="CBH23594.1"
FT                   /translation="MIPPEQNANFVAKMEDVLSVYKRPYDPKRPVVCMDEMPRQLIREV
FT                   YAPLPMAPGKPKRHDYHYKREGVVNLFMFFEPLAGWRTVMIRERRTKVDWAYCMKRLLE
FT                   KHYPDVDKVVLVMDNLNTHGLSSFYEAFAPKEACRLAQRFEIHYTPEHGSWLNMAEIEN
FT                   SAMARQCLSRRIPEKQVMGEETSAWSKQRNEEGAAANWRFQTEDARIKLRRLYPNIDG"
FT   CDS_pept        819604..821628
FT                   /transl_table=11
FT                   /gene="cysN"
FT                   /locus_tag="SRM_00674"
FT                   /product="Sulfate adenylyltransferase subunit 1"
FT                   /function="May be the GTPase, regulating ATP sulfurylase
FT                   activity"
FT                   /EC_number="2.7.7.4"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00674"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23595"
FT                   /db_xref="GOA:D5H6E0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR041757"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E0"
FT                   /protein_id="CBH23595.1"
FT                   /translation="MGGVGRLTRFSGPCARPVGTNAQFDTRISKLDTDLMETQGASTQD
FT                   MDVLRFTTAGSVDDGKSTLIGRLMYDTQEIFEEKMEEIERNTQRDDEELELALLTDGLR
FT                   AEREQGITIDVAYRYFSTPERKFIIADTPGHEQYTRNMVTGASTAELAVELIDARNGVL
FT                   EQTRRHGFITSLLQIPHVIVAVNKMDLVGYSEARFREIVAEYEDFADNLDVQDITFVPI
FT                   SALKGDNVVHHSGNMPWYEGSTLLHRLESVRTESTRNQVDFRFPVQTTIRPHQDFRGFA
FT                   GQVASGKVRPGEEITVLPSGYTSEVDTITTLDGDLDEAGPGDSVVLSLEDELDVSRGSM
FT                   IVRSRNKPDVTRQLDADLCWMNQEAMRQDRPYVLQHTTRRTQAYVSKIVYRTNVETFHR
FT                   EEASTFELNDIGRVEIETADPLFVDPYKLNRATGSFILIDPDTNDTVAAGMIRGVATGV
FT                   TPFGQQAEPQAEDEAESSPNVTWEGLSVPREEREKQNGHKAGVVWLTGLSGAGKSTIAK
FT                   AVEERLFDADVQTMMLDGDNVRHGLSGDLGFTPADRTENIRRVSEVARLFFEQGNVTLC
FT                   SFVSPYQEDRDRARELLPDDVRDRFLEVHVDCPLQVCKERDTKGLYEKAEAGEITNFTG
FT                   VSAPYEAPEDPDVVVNTDEMGVEACADQIVEALEARGIV"
FT   CDS_pept        821685..822173
FT                   /transl_table=11
FT                   /locus_tag="SRM_00675"
FT                   /product="nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00675"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23596"
FT                   /db_xref="GOA:D5H6E1"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E1"
FT                   /protein_id="CBH23596.1"
FT                   /translation="MGTLRLGRHTRRQTPLCLRRPAVMLSEATEHRLRNVFADHPAVRA
FT                   AYLFGSVAAGRERDRSDLDLGIVVDSDRWEPTDDKVPLITDCMEAAGRDWIDLVVLNGA
FT                   PLVLQFEAVRPNAPLYGADDFDHGAFVSKVVRMYWDFEPHLRRQRKALKERLQEKAHG"
FT   CDS_pept        822662..824497
FT                   /transl_table=11
FT                   /locus_tag="SRM_00676"
FT                   /product="transporter, sodium/sulfate symporter family"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00676"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23597"
FT                   /db_xref="GOA:D5H6E2"
FT                   /db_xref="InterPro:IPR004680"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR031312"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E2"
FT                   /protein_id="CBH23597.1"
FT                   /translation="MAPLSSLGPDAWITIAVVVGLVGALMADLGRPDLVLLSGLAALLV
FT                   TGVVPPAEAFAGFSNPAVLTVGALYVVAGGVQQTSALSRLDRVLFPDTTRLGPVLARFM
FT                   VPTSVLSGLLNNTPIVAMLTPRLQEWADAQDIPASKLMIPLSYAAITGGMMTLVGTSTN
FT                   LIVAGLMEAEGYDPLSLFDVTWVGVPAALVVIAYFVLGGHRLLPDRGTSAPAAERRLGQ
FT                   NMFEVTVTAPSPIVGQTVAEAGLRDLGDAYLTHVRRGTEVLQGRPDRTLEQGDILAFNG
FT                   SLAARERLLGRRGLTRTLPRLDGAHGAPARYETLPLYEAVIAESSNLVGTTLGEANFRE
FT                   QYQGVVLGIQRQDEPVTSPVGTTELQAGDLLIVEAPGDFEERWSSGSREEFYLVAPRDG
FT                   RARQGGAPEHDDEETDRSGRAPIALGLTGTMVLAAATGLAPIVTAAFLAALLMILAGCI
FT                   RPAEAQRALNVQVLVVIAAALGIGKAIETTGLATAAAQGVLSVAEPFGSVTVLVALYLL
FT                   TNLLTEIITNNAAAVLMLPVAMAAASSLGAPPVAFGVLVAVAASASFLTPIGYQTNLMV
FT                   MAPGGYRFSDYARVGWPVTLLVMGTSVGIISLVWL"
FT   CDS_pept        824965..825450
FT                   /transl_table=11
FT                   /locus_tag="SRM_00677"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00677"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23598"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E3"
FT                   /protein_id="CBH23598.1"
FT                   /translation="MKESYLAVAGRIRRELEQIEAVVDRAQDIWNDVDLDRPADHRIDA
FT                   VALNLHGFYAGLERILRTIADRIDQTVPEGGSWRQELLGQMNAELNGVRPPVLSDEARK
FT                   RLDRYRGFRHVVRNAHAFEFDPEQINLLIKRLPDTADLVFRDLRAFADTLDRMASTE"
FT   CDS_pept        825486..825821
FT                   /transl_table=11
FT                   /locus_tag="SRM_00678"
FT                   /product="nucleotidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00678"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23599"
FT                   /db_xref="GOA:D5H6E4"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E4"
FT                   /protein_id="CBH23599.1"
FT                   /translation="MKPPVLDTIIERIVEVADPERIILFGSGARDEMGPHSDFDLLVVK
FT                   EEGEYSRGRLVEEIYMNLIGVGHAVDVIVVTPEEVEEYRDSHSLVISPALNEGKEVYHA
FT                   ERKATAS"
FT   CDS_pept        825793..826212
FT                   /transl_table=11
FT                   /locus_tag="SRM_00679"
FT                   /product="conserved hypothetical protein containing HEPN
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00679"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23600"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E5"
FT                   /protein_id="CBH23600.1"
FT                   /translation="MPSGKRRRPDDPWAWMDRARSNLIRARQRLPNVYLEDLCFDAQQA
FT                   AEKALKALCIERGIEFPYVHDLARLITLLQDEGQPVPDEVTEAGRLTRYAVFTRYPGLD
FT                   DPVTEEDHNRAVSIAERVVEWVEDRLDAGGGTPDS"
FT   CDS_pept        826236..827297
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="SRM_00680"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23601"
FT                   /db_xref="GOA:D5H6E6"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E6"
FT                   /protein_id="CBH23601.1"
FT                   /translation="MNDTLLVTGGAGFIGSAVVRHLIRETEATVVTVDALTYAGHQENL
FT                   APVANHPRHHFEQEDITDAPAMHRLFEEYAPDGVLHLAAESHADRSIGGPAAFVQTNVV
FT                   GTQVLLEAARTYWEDQGRPGGFRFLHVSTDEVYGELGETGAFTEETPYDPSSPYSASKA
FT                   GADHLARAWQRTYGLPVLITNCSNNYGPRQHPEKLIPVVILNALEGEPIPVYGDGKNVR
FT                   DWLYVKDHVRALLEVLQEGEVGETYNVGGNCERENIAVVRQICDILDEMRPPGSTLETK
FT                   SHHDLITFVEDRPGHDWRYAIDATKIKEAIGWAPEVEFEEGLRRTVDWYVGHREWVQAV
FT                   VQNTDDGTTGETH"
FT   CDS_pept        827419..828381
FT                   /transl_table=11
FT                   /gene="rmlA"
FT                   /locus_tag="SRM_00681"
FT                   /product="Glucose-1-phosphate thymidylyltransferase"
FT                   /function="# Catalyzes the formation of dTDP-glucose, from
FT                   dTTP and glucose 1-phosphate, as well as its
FT                   pyrophosphorolysis."
FT                   /EC_number="2.7.7.24"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00681"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23602"
FT                   /db_xref="GOA:D5H6E7"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E7"
FT                   /protein_id="CBH23602.1"
FT                   /translation="MSNVETDPSTRTRKGILLAGGAGTRLYPATRAVSKQLVPVYDKPM
FT                   VYYPLSTLMRAGIRNILLISTPKDLPRFEDLLGDGRQWGLNLRYAEQPEPKGIAQAFTI
FT                   GAGFIGGDDVCLILGDNIFYGDRLSEKLRRASGQPSGGTVFAYYVSDPERYGVVDFDAA
FT                   GRALAIEEKPDVPPSNYAVTGLYFYDSSVVDVAEGLEPSDRGELEITDVNRHYLQQGEL
FT                   QVETLGRGMAWLDTGTHDSLLQAANFVQTIEARQGLKISCPEEIAWSQGWIDADDVARI
FT                   GRSMENSSYGQYLLDLVERAESDATPTDTTPTDTAPTST"
FT   CDS_pept        828411..828971
FT                   /transl_table=11
FT                   /gene="rfbC"
FT                   /locus_tag="SRM_00682"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase related"
FT                   /function="is involved in the biosynthesis of dTDP-l-
FT                   rhamnose, which is an essential component of the bacterial
FT                   cell wall, converting dTDP-4-keto-6-deoxy-D-glucose to
FT                   dTDP-4-keto-L-rhamnose"
FT                   /EC_number="5.1.3.13"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00682"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23603"
FT                   /db_xref="GOA:D5H6E8"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E8"
FT                   /protein_id="CBH23603.1"
FT                   /translation="MTVSETSLPGVRLIEPDVYLDDRGSFAEMWNVRDYGHHGLDVTFV
FT                   QDNLSRSREGVLRGLHFQNPRAQGKLISVLEGAVYDVVVDVRTGSDTFGDWEGQVLSAE
FT                   SGRQLYAPEGYAHGFVATSGEVLFHYKCTDFYHPEADRTVRWDDPALAIDWPTEDPILS
FT                   AKDAGAPALEELPREALRFDDAR"
FT   CDS_pept        829018..829926
FT                   /transl_table=11
FT                   /gene="rfbD"
FT                   /locus_tag="SRM_00683"
FT                   /product="DTDP-4-dehydrorhamnose reductase"
FT                   /EC_number="1.1.1.133"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00683"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23604"
FT                   /db_xref="GOA:D5H6E9"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6E9"
FT                   /protein_id="CBH23604.1"
FT                   /translation="MPDATASILLLGATGQVGHALRCTLAPLSRVHTPGRAAVDLTDLK
FT                   SVREAVRELGPELIVNAAAYTDVDGAEEEPGRAARINAEAPRVLAEAARAVGAWLVHYS
FT                   TDYVFGGTKRAPYTEADAPSPISVYGRTKRDGEAAIQAVGGRHLILRTSWMYSRRRSNF
FT                   VRTMLRLAAENDRLTVVDDQIGVPTWAGWCAEATASVCERLFADDAAPAAGCYHLAGTG
FT                   QTSWYGLARAVFAQFGRTDVTVEPVSSDEYETAAPRPAYTVLDSSRARAAFDLPATTWT
FT                   AQLDRFRKRVRTAGGERLARG"
FT   CDS_pept        830124..833204
FT                   /transl_table=11
FT                   /gene="wza"
FT                   /locus_tag="SRM_00684"
FT                   /product="Capsule polysaccharide export system periplasmic
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00684"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23605"
FT                   /db_xref="GOA:D5H6F0"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F0"
FT                   /protein_id="CBH23605.1"
FT                   /translation="MRWISSTLCVFLVALTVFPGAVQAQQRSDLPEEAQQALEEREMTV
FT                   QEARQRLRQLGIDPNNPEQAAQRARELGVSEARIQALLQAVQDRQGDGGRMQSTGGSVA
FT                   PPAPTLSGTPGIEPDSISVDQLPVDVAATVSLRSESQIQQVRIGFLTADGDSVEVQDVN
FT                   RIGGSVIDGQWRGRVTVPRETGVGTWGLYVRVANQDTSTVLPTGRELRIVEQMRQRPTG
FT                   AAETLPYFGYDTFETIPEAFTPQSTGPVDGSYVVGPQDELRLTVWGGAEFTYDLQVDRG
FT                   GRVTVPNVGQFTVSGKSLDELRREMKQWLSQSYSGLTSDPPTVYMDLTLTRVRPTQVFV
FT                   LGEVPQPGGYTVSSFATVFNALYSVGGPLRRGSLRNISVIRDGEVVETVDLYDYLLEGY
FT                   SPDPVQLQSNDYIFVPPRGETVAITGPVKRPAYYEMKEGETVADLIDYAGGLKPNAYTK
FT                   RFQIERIVPPSEREDPSVAREVLDASLQAARADTAQVPLADGDRVKVLSLTEAQDQAVK
FT                   ARVDAAEVTGAVFQPGQYEIGGPVRTVKDLIEQADGLTGDAYRQQADLVRIGDTLSETS
FT                   RSLDLQAVMNDQPQANVVLQPGDSLHVSSIQEMRGNRQVRITGNVRDPGSYRFRKGMTI
FT                   RSLLQKAGGLTDDEYLKDVFLGRADLFRVSRDGGEERIIPFHLGDALAGEGMADRELRP
FT                   EDEIRVYPATVGRLEEKFVRISGAVQDAGRYAFRDNMTLKDAILQANGFGEGASLREVE
FT                   ITRMVEKKDESGQRASSISVPLVKRDIDPKDVNFSVQDTARALEAAENFDLQHRDRIFV
FT                   RESPSFQPQETVSVEGEVRYPGEYTILQDNERLSSVIQRAGGVLPTGYLKGGRLIRPEE
FT                   NQGDQGFQVQRDGQQVIVEMRRAVRGNPAEDLILRPGDEIVIPTQPNTVSVRGNVANEG
FT                   LIKHEEGRRVGYYLDRAGGTRQNTQDVFLTQASGATFEVNTGWFRRAPVVDDGAVIRVE
FT                   AEPERDQEINYSEIASNVAQVVSSTLSLIVLATQAFN"
FT   CDS_pept        complement(833235..833633)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00685"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00685"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23606"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F1"
FT                   /protein_id="CBH23606.1"
FT                   /translation="MTDGNGLPMGALLTAGQRHESPFFTEVMDAVRVPKPVGRPRKRPE
FT                   AVAGDRAYDSEENRRWCWRRNIESVIPARKGMHTGPGRPPTCDEKKYEQRNVVERLVGR
FT                   LKERRRVATLQGEESQPLQSDASVGLHR"
FT   CDS_pept        complement(833952..834080)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00686"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00686"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23607"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F2"
FT                   /protein_id="CBH23607.1"
FT                   /translation="MSRRRRYELTDGQFERIEEALPEVDGRGRPYENHRKVAGGIF"
FT   CDS_pept        complement(834105..834380)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00687"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00687"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23608"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F3"
FT                   /protein_id="CBH23608.1"
FT                   /translation="MFGRCHLSAAWSRLLAHELLTHEENVRPLQENIHPLQDSSHTGTS
FT                   RGYFRRRGSTQDIIDWGMCPYPSLRGRFHLWSRHCLTKSRYEATES"
FT   CDS_pept        835079..835285
FT                   /transl_table=11
FT                   /locus_tag="SRM_00688"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00688"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23609"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F4"
FT                   /protein_id="CBH23609.1"
FT                   /translation="MGLRKKGRPEGLPLCLGGKKVPLGATLPDIRWAEHKVADWSVARH
FT                   EQMRHEPEKIAVSTEKIPSQRPK"
FT   CDS_pept        836643..837950
FT                   /transl_table=11
FT                   /locus_tag="SRM_00689"
FT                   /product="Chain length determinant protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00689"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23610"
FT                   /db_xref="GOA:D5H6F5"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F5"
FT                   /protein_id="CBH23610.1"
FT                   /translation="MSDSEPTPSRDGGPRGSRPGRRMPPPEDEITLMELIVTLSRGRGL
FT                   IVLSVVGIGLLGVLYSVATPSRYTAESKVIREAGEGGGGPSLPSGIGGIAGGLGIDIGG
FT                   GGGVGLSPASYPEIATSREVRLAVARDTFYFPSIGRRTTFVDYVNRPPGTLDQILSYTV
FT                   YLPWTVKGALGSLIGSGEGKRSAGTDSTGTLIYPTEEEEEAISALGEMVSASVSESGAL
FT                   EGGSGLMTVSASSGNPRLSARLNERFIEHLRTRVRELQTEKTRRNLRFVEKRFEEVKQE
FT                   LDAAENRLVQFLERNKGVLAAGSKPQLESRRERLRREVGFKEQLYSQMQKQVTQTRLQL
FT                   QKEQPVVTIAEKPAPPAGPSAPNRTLNVVLSLFLGGLFGVGATFFRSAIQNQEDDDEAQ
FT                   EQIQEVQKAWKPSGIVEGVREELGIENDPEGSLTQR"
FT   CDS_pept        838271..839512
FT                   /transl_table=11
FT                   /gene="xerD"
FT                   /locus_tag="SRM_00690"
FT                   /product="Phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23611"
FT                   /db_xref="GOA:D5H6F6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="InterPro:IPR035386"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F6"
FT                   /protein_id="CBH23611.1"
FT                   /translation="MPAISIIARTRRKDEHGRVPLRLRIAHRGEKRFISLPVKVLAKKW
FT                   NGEKRRVTGTHPDAGEINAFLSDLERAAFSVISRLERAGTLITAQRIKDEIQEEREEGK
FT                   SAPEDFLAFAREKVKGYKRRGQIGTFRSYRTTCRKFTAFIEETYGREEVPFGALEAELF
FT                   REFRTYCYEERGNSTNTVGRELGIMRTLVRHAMKEGKLSGYPFEHITIDSEPSQKELLT
FT                   PEEVERIADLEIDEESPAAEARRWFLFAYYAGGMRFSDVATLQWQHIREGRSGRPRVCY
FT                   KMKKTADTVGVPLIPEAKEILGYYEEGDGEDWVFPISEGIDPGDEEALHRRKCQRNSAA
FT                   NRHLKELAGRAGIEKRVTFHLSRNAAAWKLYQNVGDIYKVSKFLGHSNVEQTQDYIDGF
FT                   VDESRDEDFIAAMT"
FT   CDS_pept        839583..840977
FT                   /transl_table=11
FT                   /gene="udg"
FT                   /locus_tag="SRM_00691"
FT                   /product="UDP-glucose 6-dehydrogenase"
FT                   /EC_number="1.1.1.22"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00691"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23612"
FT                   /db_xref="GOA:D5H6F7"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028357"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F7"
FT                   /protein_id="CBH23612.1"
FT                   /translation="MEIAVIGTGYVGLVSGTCFAEMGHDVTCVDIDEEKVEQLSGGELP
FT                   IYEPDLEKYFDRVREENRLHFTTDLAEGIEDAKAIFFALPTPPGEDGSADLTYVKQAAG
FT                   DVADLFASGTLQGPKQRIVVNKSTVPVGTGDEVEEVFAERGLEHGTDVAVVSNPEFLRE
FT                   GSAVEDFMKPDRVVIGTEVEWAAEEMERLYEPFVRQGNPILTVDRRSAEMIKYAANSLL
FT                   ATRISFMNEIANVCDWVGANVDKVRLGISKDHRIGPHFLYAGIGFGGSCFPKDVQALAR
FT                   KGREVGYEPEILNSVVDVNDRQRRRLALDAKERFDGDLSGKKIAVWGLSFKPGTDDTRE
FT                   APSHVIINELLEDGAEVAGYDPEAMGTTRETFGDQIEYGEGMYEVLGGADALIICTEWH
FT                   EFRRPDLGKVRDLLAKPIVFDGRNLYDPARMVEMGFEYQSIGRPSYAPETQEEAIEEAI
FT                   VENGQP"
FT   CDS_pept        complement(841109..841222)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00692"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00692"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23613"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F8"
FT                   /protein_id="CBH23613.1"
FT                   /translation="MYVQPSLGSATEKGIGEKLVKALILGVSQENYNQVTG"
FT   CDS_pept        841253..843052
FT                   /transl_table=11
FT                   /locus_tag="SRM_00693"
FT                   /product="ABC transporter, transmembrane region"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00693"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23614"
FT                   /db_xref="GOA:D5H6F9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6F9"
FT                   /protein_id="CBH23614.1"
FT                   /translation="MSLISDIVHYIRIYRRYVGRRIYLVFGLTVLTAFTQGLGFTMLLP
FT                   LLRVTQSTSDPSELSTAEKILHDLLASMGIAESLVGVLGFIAAIFFVKGALQFAQTSYI
FT                   GYLQADLLKELKIRFFDAYNGMTYKYFITQNSGHFINVINAQVNRFFRSFRSFARALTK
FT                   AVSALSFFGFAFAISWRFALMVLAIGVGLLWVFQYLNRYVRAASRRVSSEMSRLNKLLV
FT                   QSLQAFKYVVSTKQDDHLRTELVDSVERLTDDIFRQRMAGALTSSIRQPISVVIIVAVI
FT                   LVQAIVFDAPLAPIFVAIVLFHKAMQAVMALQSKWQRMMDQIGSVEVIDEEMRVVQEHQ
FT                   ESGGSRRLDTLSEGLVLQDVSFAYDEDEGDVLHSVNIEVPVNHTVALVGESGAGKSTLV
FT                   DMMTLLLTPRAGVVRIDGVPHDEVDLRSWRSQIGYVSQETVVFDDTVANNICLWQGDVE
FT                   EDAELREKVIDAAKRAHAHHFIRELPDGYQTVVGDQGVRLSGGQRQRLFVARELFKQPN
FT                   LLLLDEATSDLDTASEQHIQDSIDALQGKVTVVIIAHRLSTVKNADRVYVLDQGRVIES
FT                   GTYDELRMRENGEFREMVEMQSL"
FT   CDS_pept        843116..844114
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="SRM_00694"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /function="Galactose metabolism; third step."
FT                   /EC_number="5.1.3.2"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00694"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23615"
FT                   /db_xref="GOA:D5H6G0"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR026390"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G0"
FT                   /protein_id="CBH23615.1"
FT                   /translation="MADILVTGADGFIGSHLVEGLVDQGKEVRAFVRYNAFNSWGWLET
FT                   VDDDVLEAIEIFSGDVRDPNGVRESMRGVDVVYHLAALISIPYSYHSPDTYVDTNVTGT
FT                   LNVLQAARDSGTEKVVHTSTSEVYGSAQFVPITEEHPLQGQSPYAASKIGADQMALSFY
FT                   RSFDTPVAVIRPFNTYGPRQSTRAVIPTIITQIASGRRTLELGNLHPTRDFSYVEDTVR
FT                   GFMAVADSDEVVGEVVNVGSGFEISIGDLVDLIAEAMDVEVSVETDKERTRPEKSEVDR
FT                   LYADISKAEKLLGWTPTHGGRDGFKRGLQKTAEWFSRDENLQHYKAGTYAV"
FT   CDS_pept        844131..845372
FT                   /transl_table=11
FT                   /gene="wecE"
FT                   /locus_tag="SRM_00695"
FT                   /product="perosamine synthetase , putative"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00695"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23616"
FT                   /db_xref="GOA:D5H6G1"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR026385"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G1"
FT                   /protein_id="CBH23616.1"
FT                   /translation="MNSSVMETAEHPDSSETVQTASDLPGRVVNVLDACLAEAERPVPL
FT                   HKPVFEGNEWDYVKECIDTEWVSSVGSYVDRLERDLAEYTGAKRAVVAVNGTAALQVCL
FT                   RLVGVERNDEVLIPALTFVATANAVSYLDAIPHFVDSEERTLGLDPAKLGAYLDDIAEV
FT                   RDGTCVNTQTGRPIRAVVPMHAYGHPVDLDPLQNICDTYHLALVEDAAESLGSLYKGEH
FT                   TGTRGQCAALSFNGNKTITTGGGGAILTDDEALADEAKHLTTVAKKDHEWEYVHDRVGY
FT                   NYRMPNLNAALGCAQLEQLPTFLERKRTLARRYQKAFADVEGVSFFQEPGFARSNYWLN
FT                   VLLLDEADLGLRDAILEETNDAGFGTRPTWQLLSSLPMYEDCPQMDLSTAGSLERRLIN
FT                   IPSTPSLVDSNHDQ"
FT   CDS_pept        845373..846389
FT                   /transl_table=11
FT                   /gene="spsE"
FT                   /locus_tag="SRM_00696"
FT                   /product="Sialic acid synthase"
FT                   /function="Aminosugars metabolism"
FT                   /EC_number="2.5.1.56"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00696"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23617"
FT                   /db_xref="GOA:D5H6G2"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G2"
FT                   /protein_id="CBH23617.1"
FT                   /translation="MPTLDQVLSGSQSERRPPYVVAEMACAHDGSVERALAITRTSSQA
FT                   DALQIQLFHAEELVVPKEVPTVRGFELAPESWKRVVQKARAADLDLWATVFDEEAVELA
FT                   LELEADVLKIHSTDLSNPFLLQSCAQTNLPLSLSVGGSTVSEIASAVRSLEDHGASNLV
FT                   LTHGFQDLPTAPKDARLGFISTLDHLFPYPVGYQDHTDGGSDLAHTLPLAAIGLGAHVI
FT                   EKHVTDDRSREGTDYISALGPEGFAQFVEKVNAVNGVFSGKRPDDFSEAEEEYRQSMKR
FT                   RVVAGAEIPAGTTITEQRITLLRANDGIKANRLDVVLGRKSQRSLQPGEAITEDHLK"
FT   CDS_pept        846417..847223
FT                   /transl_table=11
FT                   /gene="spsF"
FT                   /locus_tag="SRM_00697"
FT                   /product="Spore coat polysaccharide biosynthesis protein
FT                   spsF"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00697"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23618"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G3"
FT                   /protein_id="CBH23618.1"
FT                   /translation="MDRVCACIIARLNSTRLSRKVLADIKGKPLLKWIVDRLNAVDNVD
FT                   EVVLCTSSDPGDEELLEHADDWGIPAIAGSPTNIVSRLQQAASTVDADILLRATGDNPL
FT                   ISVEYTERMVAAHKKSDFEYSRVNSLPLGATVEGLSKGLLPKIQETLPSPSHSEYLVLY
FT                   AYQPERYNCVVLQPPDEIQRPHYSVTVDTPDDLERAREIYGETAWRSDIGPSIDQVIQF
FT                   LDEDENYEEIPGDTMIKMPEQGRIPYNDFLDLLKDRAVESTTITFN"
FT   CDS_pept        847224..848138
FT                   /transl_table=11
FT                   /locus_tag="SRM_00698"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00698"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23619"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G4"
FT                   /protein_id="CBH23619.1"
FT                   /translation="MDELALYTTVHPGTRPFLGEWYESLRAQTDSGFELWIGIDDLDIQ
FT                   EARKAMGGRPGANWIQAGPGDTPAQVRERAWTELIPNADAVIMVDADDAMHPRRVECAR
FT                   EHISRCDVGACGLKLVDEEGNSIGHAMPPPEYDTPKDVLPHHNIFGLSNTVYRTQALEK
FT                   GLPLPKSITLIDWYLATQAWLRGGDLSLDRTVRMSYRQHGGSTLSLLPPFTAENVRRTS
FT                   EAVVGHFSAVACSLPSKPHPERLSAFRKAYEDLRQFKKQVLDNDERLEEYTSTLNQRPP
FT                   LLLWWGCVAYPELDHFWNKPMTE"
FT   CDS_pept        848135..849211
FT                   /transl_table=11
FT                   /gene="spsE"
FT                   /locus_tag="SRM_00699"
FT                   /product="Sialic acid synthase"
FT                   /function="# Produces N-acetylneuraminic acid (Neu5Ac) and
FT                   2-keto-3-deoxy-D-glycero-D-galacto-nononic acid (KDN). Can
FT                   also use N-acetylmannosamine 6-phosphate and mannose 6-
FT                   phosphate as substrates to generate phosphorylated forms of
FT                   Neu5Ac and KDN, respectively."
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00699"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23620"
FT                   /db_xref="GOA:D5H6G5"
FT                   /db_xref="InterPro:IPR006190"
FT                   /db_xref="InterPro:IPR013132"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="InterPro:IPR036732"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G5"
FT                   /protein_id="CBH23620.1"
FT                   /translation="MNTVDLGPANVGGDNPPFIVAEIGSNHNGDMDLCRDIIDAAVGAG
FT                   ADAVKFQSWTEETLISEEEYQRNTEYENKKKHFGTLREMVREYQLTPDQHHTIQEYCQE
FT                   RDITFCSSVFSEQEADLLEDLDVPFYKIASMDINNLPLLDYVAHKGRPMIVSTGMATMA
FT                   EIEQAVHTIQEAGNDEIVLLHCVSVYPPDMDLMNLRNMETLQTAFDVPVGFSDHTLGTS
FT                   IPLAAIARGACVVEKHFTIDKDLPGWDHAISSDPEEMETLATEGKRIQRALGSSVRTVS
FT                   QEEHEKRKQFRRSAIAQKPLAKGETLRSEDIAFKRPGNGIGPDEFEYAEGRKVAKSVKE
FT                   GHVVHWHHLSGEGKAEKG"
FT   CDS_pept        849249..849878
FT                   /transl_table=11
FT                   /locus_tag="SRM_00700"
FT                   /product="Acyl-[acyl-carrier-protein]--UDP-N-acetylglucosam
FT                   ine"
FT                   /function="Involved in the biosynthesis of lipid A, a
FT                   phosphorylated glycolipid that anchors the
FT                   lipopolysaccharide to the outer membrane of the cell"
FT                   /EC_number="2.3.1.129"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23621"
FT                   /db_xref="GOA:D5H6G6"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR020019"
FT                   /db_xref="InterPro:IPR041561"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G6"
FT                   /protein_id="CBH23621.1"
FT                   /translation="MADRPFIIVGGGGHARVVASTLQEIGKTILGFTDPDPKVYLGQGI
FT                   EHLGSDAILADYAPSSVLLTVGVGSSQDTTLRTQLFSELRSKEFDLPSIVHTSAFVASE
FT                   ASVSSGAQIMAGAVIQPGTTVSENVIVNTNASVDHDCEIGPHTHVAPGATISGEVTLGN
FT                   RVHVGAGASVIQGVHIGARSVVGAGAVVIDDVPPESVVVGIPAVQK"
FT   CDS_pept        849890..850939
FT                   /transl_table=11
FT                   /gene="manC"
FT                   /locus_tag="SRM_00701"
FT                   /product="putative mannose-1-phosphate guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00701"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23622"
FT                   /db_xref="GOA:D5H6G7"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G7"
FT                   /protein_id="CBH23622.1"
FT                   /translation="MTDWRTISVSPDQTIREALEVIDEGGVQIAIVANEEDRLRGVATD
FT                   GDIRRGILKDLDLDAPVASVMNEDPITARPKEDRQSLIDTMRARRIHQIPLVDNEGRVV
FT                   GIEVLDDLLEPDARPNPVVLMAGGLGTRLRPLTEDCPKPLLEVGDKPILETILEGFIAH
FT                   GFHRFYLSVNYKAGMIEDYFGDGSDWGVDISYVHEEKRLGTAGPLSLLPERPDETMIVM
FT                   NGDLLTKLNFAHLLDFHRKHDVAATMCVREHETQVPYGVIETDDQYMEGIEEKPTERYF
FT                   VNAGIYVLEPETLDLVPENEFFDMPDLFERLIEEGREATVFPVREYWQDVGREEDFHQV
FT                   NGEYENVFT"
FT   CDS_pept        complement(851201..851293)
FT                   /transl_table=11
FT                   /locus_tag="SRM_00702"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00702"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23623"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G8"
FT                   /protein_id="CBH23623.1"
FT                   /translation="MTPSRVATRPVGYVMFPMEVQQVGKVELCE"
FT   CDS_pept        851515..852108
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="SRM_00703"
FT                   /product="Probable poly(beta-D-mannuronate) O-acetylase"
FT                   /function="Together with algJ and algF, forms an inner
FT                   membrane complex which probably interacts with the alginate
FT                   polymerization-transport complex and adds acetyl groups at
FT                   the O-2 and O-3 positions of polymannuronic acid."
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00703"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23624"
FT                   /db_xref="GOA:D5H6G9"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6G9"
FT                   /protein_id="CBH23624.1"
FT                   /translation="MLFNSLNFALFFPVVVALFFATPKRHRWILLLAASYYFYASWKVA
FT                   YLGLILASTLVDYVAGIRMGKQESRAARRPYLLLSLVVNLGILFTFKYFNFFVGSAEAA
FT                   LASMGLGWEAPVLDVLLPVGISFYTFQTLAYTIDVYRGEQEPEHHLGRFALYVSFFPQL
FT                   VAGPIERSQRLLPQFRQPKSFDYQRVVDGLKLML"
FT   CDS_pept        852205..852447
FT                   /transl_table=11
FT                   /gene="dltB"
FT                   /locus_tag="SRM_00704"
FT                   /product="Predicted membrane protein involved in D-alanine
FT                   export"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00704"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23625"
FT                   /db_xref="InterPro:IPR004299"
FT                   /db_xref="UniProtKB/TrEMBL:D5H6H0"
FT                   /protein_id="CBH23625.1"
FT                   /translation="MATYFFAFQIYCDFSGYSDIAIGAAQIMEYDLMENFRRPYHAKSI
FT                   NEFWHRWHISLSTWFRDYLYIPAWWKQSPGGTLVL"
FT   CDS_pept        852464..853021
FT                   /transl_table=11
FT                   /gene="algI"
FT                   /locus_tag="SRM_00705"
FT                   /product="Probable poly(beta-D-mannuronate) O-acetylase"
FT                   /function="Together with algJ and algF, forms an inner
FT                   membrane complex which probably interacts with the alginate
FT                   polymerization-transport complex and adds acetyl groups at
FT                   the O-2 and O-3 positions of polymannuronic acid"
FT                   /EC_number="2.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:SRM_00705"
FT                   /db_xref="EnsemblGenomes-Tr:CBH23626"
FT                   /db_xref="GOA:D5H6H1"
FT                   /db_xref="UniProtKB/TrEMBL: