(data stored in ACNUC7421 zone)

EMBL: FP885891

ID   FP885891; SV 2; circular; genomic DNA; STD; PRO; 2085000 BP.
XX
AC   FP885891;
XX
PR   Project:PRJEA50683;
XX
DT   22-JUN-2010 (Rel. 105, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Ralstonia solanacearum PSI07 megaplasmid mpPSI07, complete sequence
XX
KW   .
XX
OS   Ralstonia solanacearum PSI07
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
OG   Plasmid mpPSI07
XX
RN   [1]
RP   1-2085000
RA   Genoscope - CEA;
RT   ;
RL   Submitted (11-MAY-2010) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-11-379.
RX   PUBMED; 20550686.
RA   Remenant B., Coupat-Goutaland B., Guidot A., Cellier G., Wicker E.,
RA   Allen C., Fegan M., Pruvost O., Elbaz M., Calteau A., Salvignol G.,
RA   Mornico D., Mangenot S., Barbe V., Medigue C., Prior P.;
RT   "Genomes of three tomato pathogens within the Ralstonia solanacearum
RT   species complex reveal significant evolutionary divergence";
RL   BMC Genomics 11:379-379(2010).
XX
DR   MD5; a455066352d83cb73978ebed51214f11.
DR   BioSample; SAMEA2272112.
DR   EnsemblGenomes-Gn; EBG00001127192.
DR   EnsemblGenomes-Gn; RPSI07_mp0058.
DR   EnsemblGenomes-Gn; RPSI07_mp0121.
DR   EnsemblGenomes-Gn; RPSI07_mp0122.
DR   EnsemblGenomes-Gn; RPSI07_mp0132.
DR   EnsemblGenomes-Gn; RPSI07_mp0133.
DR   EnsemblGenomes-Gn; RPSI07_mp0143.
DR   EnsemblGenomes-Gn; RPSI07_mp0144.
DR   EnsemblGenomes-Gn; RPSI07_mp0232.
DR   EnsemblGenomes-Gn; RPSI07_mp0250.
DR   EnsemblGenomes-Gn; RPSI07_mp0466.
DR   EnsemblGenomes-Gn; RPSI07_mp0570.
DR   EnsemblGenomes-Gn; RPSI07_mp0571.
DR   EnsemblGenomes-Gn; RPSI07_mp0664.
DR   EnsemblGenomes-Gn; RPSI07_mp0666.
DR   EnsemblGenomes-Gn; RPSI07_mp0670.
DR   EnsemblGenomes-Gn; RPSI07_mp0692.
DR   EnsemblGenomes-Gn; RPSI07_mp0693.
DR   EnsemblGenomes-Gn; RPSI07_mp0752.
DR   EnsemblGenomes-Gn; RPSI07_mp0758.
DR   EnsemblGenomes-Gn; RPSI07_mp0838.
DR   EnsemblGenomes-Gn; RPSI07_mp0880.
DR   EnsemblGenomes-Gn; RPSI07_mp0894.
DR   EnsemblGenomes-Gn; RPSI07_mp0930.
DR   EnsemblGenomes-Gn; RPSI07_mp0931.
DR   EnsemblGenomes-Gn; RPSI07_mp1015.
DR   EnsemblGenomes-Gn; RPSI07_mp1059.
DR   EnsemblGenomes-Gn; RPSI07_mp1105.
DR   EnsemblGenomes-Gn; RPSI07_mp1166.
DR   EnsemblGenomes-Gn; RPSI07_mp1182.
DR   EnsemblGenomes-Gn; RPSI07_mp1210.
DR   EnsemblGenomes-Gn; RPSI07_mp1293.
DR   EnsemblGenomes-Gn; RPSI07_mp1361.
DR   EnsemblGenomes-Gn; RPSI07_mp1372.
DR   EnsemblGenomes-Gn; RPSI07_mp1375.
DR   EnsemblGenomes-Gn; RPSI07_mp1428.
DR   EnsemblGenomes-Gn; RPSI07_mp1437.
DR   EnsemblGenomes-Gn; RPSI07_mp1466.
DR   EnsemblGenomes-Gn; RPSI07_mp1481.
DR   EnsemblGenomes-Gn; RPSI07_mp1482.
DR   EnsemblGenomes-Gn; RPSI07_mp1487.
DR   EnsemblGenomes-Gn; RPSI07_mp1492.
DR   EnsemblGenomes-Gn; RPSI07_mp1493.
DR   EnsemblGenomes-Gn; RPSI07_mp1499.
DR   EnsemblGenomes-Gn; RPSI07_mp1500.
DR   EnsemblGenomes-Gn; RPSI07_mp1545.
DR   EnsemblGenomes-Gn; RPSI07_mp1549.
DR   EnsemblGenomes-Gn; RPSI07_mp1550.
DR   EnsemblGenomes-Gn; RPSI07_mp1552.
DR   EnsemblGenomes-Gn; RPSI07_mp1558.
DR   EnsemblGenomes-Gn; RPSI07_mp1563.
DR   EnsemblGenomes-Gn; RPSI07_mp1588.
DR   EnsemblGenomes-Gn; RPSI07_mp1592.
DR   EnsemblGenomes-Gn; RPSI07_mp1605.
DR   EnsemblGenomes-Gn; RPSI07_mp1613.
DR   EnsemblGenomes-Gn; RPSI07_mp1638.
DR   EnsemblGenomes-Gn; RPSI07_mp1684.
DR   EnsemblGenomes-Gn; RPSI07_mp1731.
DR   EnsemblGenomes-Gn; RPSI07_mptRNA1.
DR   EnsemblGenomes-Tr; EBT00001718367.
DR   EnsemblGenomes-Tr; RPSI07_mp0058.
DR   EnsemblGenomes-Tr; RPSI07_mp0121.
DR   EnsemblGenomes-Tr; RPSI07_mp0122.
DR   EnsemblGenomes-Tr; RPSI07_mp0132.
DR   EnsemblGenomes-Tr; RPSI07_mp0133.
DR   EnsemblGenomes-Tr; RPSI07_mp0143.
DR   EnsemblGenomes-Tr; RPSI07_mp0144.
DR   EnsemblGenomes-Tr; RPSI07_mp0232.
DR   EnsemblGenomes-Tr; RPSI07_mp0250.
DR   EnsemblGenomes-Tr; RPSI07_mp0466.
DR   EnsemblGenomes-Tr; RPSI07_mp0570.
DR   EnsemblGenomes-Tr; RPSI07_mp0571.
DR   EnsemblGenomes-Tr; RPSI07_mp0664.
DR   EnsemblGenomes-Tr; RPSI07_mp0666.
DR   EnsemblGenomes-Tr; RPSI07_mp0670.
DR   EnsemblGenomes-Tr; RPSI07_mp0692.
DR   EnsemblGenomes-Tr; RPSI07_mp0693.
DR   EnsemblGenomes-Tr; RPSI07_mp0752.
DR   EnsemblGenomes-Tr; RPSI07_mp0758.
DR   EnsemblGenomes-Tr; RPSI07_mp0838.
DR   EnsemblGenomes-Tr; RPSI07_mp0880.
DR   EnsemblGenomes-Tr; RPSI07_mp0894.
DR   EnsemblGenomes-Tr; RPSI07_mp0930.
DR   EnsemblGenomes-Tr; RPSI07_mp0931.
DR   EnsemblGenomes-Tr; RPSI07_mp1015.
DR   EnsemblGenomes-Tr; RPSI07_mp1059.
DR   EnsemblGenomes-Tr; RPSI07_mp1105.
DR   EnsemblGenomes-Tr; RPSI07_mp1166.
DR   EnsemblGenomes-Tr; RPSI07_mp1182.
DR   EnsemblGenomes-Tr; RPSI07_mp1210.
DR   EnsemblGenomes-Tr; RPSI07_mp1293.
DR   EnsemblGenomes-Tr; RPSI07_mp1361.
DR   EnsemblGenomes-Tr; RPSI07_mp1372.
DR   EnsemblGenomes-Tr; RPSI07_mp1375.
DR   EnsemblGenomes-Tr; RPSI07_mp1428.
DR   EnsemblGenomes-Tr; RPSI07_mp1437.
DR   EnsemblGenomes-Tr; RPSI07_mp1466.
DR   EnsemblGenomes-Tr; RPSI07_mp1481.
DR   EnsemblGenomes-Tr; RPSI07_mp1482.
DR   EnsemblGenomes-Tr; RPSI07_mp1487.
DR   EnsemblGenomes-Tr; RPSI07_mp1492.
DR   EnsemblGenomes-Tr; RPSI07_mp1493.
DR   EnsemblGenomes-Tr; RPSI07_mp1499.
DR   EnsemblGenomes-Tr; RPSI07_mp1500.
DR   EnsemblGenomes-Tr; RPSI07_mp1545.
DR   EnsemblGenomes-Tr; RPSI07_mp1549.
DR   EnsemblGenomes-Tr; RPSI07_mp1550.
DR   EnsemblGenomes-Tr; RPSI07_mp1552.
DR   EnsemblGenomes-Tr; RPSI07_mp1558.
DR   EnsemblGenomes-Tr; RPSI07_mp1563.
DR   EnsemblGenomes-Tr; RPSI07_mp1588.
DR   EnsemblGenomes-Tr; RPSI07_mp1592.
DR   EnsemblGenomes-Tr; RPSI07_mp1605.
DR   EnsemblGenomes-Tr; RPSI07_mp1613.
DR   EnsemblGenomes-Tr; RPSI07_mp1638.
DR   EnsemblGenomes-Tr; RPSI07_mp1684.
DR   EnsemblGenomes-Tr; RPSI07_mp1731.
DR   EnsemblGenomes-Tr; RPSI07_mptRNA1-1.
DR   EuropePMC; PMC2900269; 20550686.
DR   EuropePMC; PMC4736150; 26830494.
DR   EuropePMC; PMC5446998; 28611742.
DR   EuropePMC; PMC5796747; 29422785.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2085000
FT                   /organism="Ralstonia solanacearum PSI07"
FT                   /plasmid="mpPSI07"
FT                   /strain="PSI07"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:859657"
FT   gene            272..1342
FT                   /gene="repA"
FT                   /locus_tag="RPSI07_mp0001"
FT   CDS_pept        272..1342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="RPSI07_mp0001"
FT                   /product="RepA replicase protein"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34361"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34361.1"
FT                   /translation="MVTKRLTPNGKPDDNSPGRIIVPSGGQVIAAPEKFQRLFDEAQAM
FT                   EREDAWQSGEVGFLSRASVQVTLPYRAPKGSPPVWTRSSGNISLMIQPGYFTQQRSERA
FT                   TNGRQRIVSETVSFGYPYGSYPRLMLAWIGKEIMAKKKRGEFQGTVEDRRISLGNSLSE
FT                   FMYNLGIPMATGGKRGTMTLVRQQMIRLFSATIAIVQNKSAPNNQNQEPLSIDRIGYLL
FT                   ADQLSTWWDPMQPGQGSMFESFVVLSEPFFNELVNRPVPVDMRALKALKQSPFALDVYS
FT                   WLTYRFFTIQKRTEIPWEALQMQFGTETESERKFRALFRKALKDVLVVYPDAKVDADSS
FT                   KALILQPSRTSVRKLA"
FT   gene            1641..1907
FT                   /locus_tag="RPSI07_mp0002"
FT   CDS_pept        1641..1907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0002"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34362"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34362.1"
FT                   /translation="MTQTYYSVQQKQLRKLSAGSLECGEDICRGEARQTRGEEAGKVVV
FT                   FGIVKRYGDVKHTHCQPRSGSHHGSDPSMPMKARCTTPTPRQT"
FT   gene            complement(2272..2475)
FT                   /gene="cspD"
FT                   /locus_tag="RPSI07_mp0003"
FT   CDS_pept        complement(2272..2475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cspD"
FT                   /locus_tag="RPSI07_mp0003"
FT                   /product="Cold shock DNA binding protein (transcription
FT                   regulator)"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34363"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34363.1"
FT                   /translation="MATGTVKWFNETKGFGFITPDGGGADLFAHFSEIQGSGFKTLKDG
FT                   QKVSFEVKQGPKGLQASGIKPE"
FT   gene            2881..3549
FT                   /gene="parA"
FT                   /locus_tag="RPSI07_mp0004"
FT   CDS_pept        2881..3549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="RPSI07_mp0004"
FT                   /product="plasmid partition ATPase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3586028; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34364"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34364.1"
FT                   /translation="MSAKIVTVFNQKGGCGKTTVSMHIAGTLGVRGSKTLLVDMDEQGT
FT                   ATRWAAQAPEEKPFPASVIGLAPSGGAMHREVRKFVADYDYIVVDCPPAVHSPASSSAL
FT                   LISDIAIIPVVPSPPDLWAAVAAKALAQQAQVTNETLRVRVLANMVQRRVSLAKQAIEI
FT                   LGDDGDIPLMESMIGSRSAFRECQAIGATVHGVPGAREAINEIDIMVNEVLQLLQEGRA
FT                   "
FT   gene            3546..4550
FT                   /gene="parB"
FT                   /locus_tag="RPSI07_mp0005"
FT   CDS_pept        3546..4550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="RPSI07_mp0005"
FT                   /product="plasmid partition protein"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9054507; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34365"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34365.1"
FT                   /translation="MSVKLKSLKDGMLAGIAAEKTKTTPVDRFALAEHAITSHPRGLLG
FT                   QPARPAFSAESQIETRSERRVVKIPVDRLQENPLNARRIYDPQIVQERAASIATHGQQT
FT                   PGLAAPDPARPGWYVLIDGHYRKRALAAAGKAEMECFIEDGLSDIDFYRLSFVLNEQRS
FT                   GQSALDNAIAWRQLLDDGKVKKEEDICEITGVSAGTVNKTLALLKLPESVLDVMKERPT
FT                   GIGIATGYELTLYFKSAGEDKTRELVHRVLEEGLSSRDVEQIRKVAQEGRTRKVKEVSR
FT                   QYKIRNDRGDLLGTIKEWDSGRVMLDVKLDDRAARESLVEALKSRFGLDVALL"
FT   gene            4867..5709
FT                   /locus_tag="RPSI07_mp0006"
FT   CDS_pept        4867..5709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0006"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34366"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34366.1"
FT                   /translation="MARPSQQFSEEQLRQITETIRQLDVAFPHDNGIFLDEVIDAVRQI
FT                   TRRVYGARRYANWLADAGVGRRPSNTTLQKAVDRARGWGEGGSGALADTATVEPWPIPW
FT                   APAETGTHVERSARATRDLVASRAIGSPGAGAEWMEARIRADVAERALEHEVARNRQLQ
FT                   AAMADLERRLGEALVSIPVMAPGLTGETLQRLQQTFETVSRLEGAANALAGTERFLRLQ
FT                   NDAVRQQTQSEAEQLRQRIRALEAEVVQLRTQIEAYRRAPERGAPVSRGWVKPPSSAT"
FT   gene            5949..6914
FT                   /gene="galU"
FT                   /locus_tag="RPSI07_mp0007"
FT   CDS_pept        5949..6914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="RPSI07_mp0007"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase
FT                   (UDP-glucose pyrophosphorylase) (UDPGP)
FT                   (Alpha-D-glucosyl-1-phosphate uridylyltransferase) (Uridine
FT                   diphosphoglucose pyrophosphorylase)"
FT                   /function="6.11 : Sugars"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="2.7.7.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7528731, 7961613; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34367"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34367.1"
FT                   /translation="MNEKITKAVFPVAGLGTRFLPATKASPKEMLPIVDKPLIQYAVEE
FT                   AAAAGITEMIFITGRAKRAIEDHFDKAYELESELAAKNKHALLEMVQSIKPAGVECFYV
FT                   RQPETLGLGHAVLCAQKLVRDEPFAVILADDLLDHEPPVMRQMTELYDHYRCSIVGVET
FT                   IAPQASRSYGVVAGREWDDRLIKLDGIVEKPAPERAPSNLGVVGRYILTPRIFDHLRNL
FT                   APGAGGEIQLTDAIQSLMTEEQILAYRYRGQRFDCGSKFGYLQATVELALRHPEVGAEF
FT                   EAYLYARMGLPRELPAAAEAPVSTVTPVRKAVPPLVEVAA"
FT   gene            7194..8537
FT                   /gene="kgtP"
FT                   /locus_tag="RPSI07_mp0008"
FT   CDS_pept        7194..8537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgtP"
FT                   /locus_tag="RPSI07_mp0008"
FT                   /product="alpha-ketoglutarate permease (MFS family)"
FT                   /function="6 : Energy metabolism"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2053984, 8419306; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34368"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34368.1"
FT                   /translation="MHQPQATVVAGAHVPAHEAVHESAHDVSKRLRSIFSGSVGNLVEW
FT                   YDWYVYSAFALYFAKSFFPKGDQTAQLLNTAAVFAVGFLARPVGGWLMGIYADRYGRKR
FT                   ALLVSVVLMCLGSLIIALTPSYATIGVAAPTLLVLARLLQGLSVGGEYGTSATYLSEVA
FT                   TRESRGFYSSFQYVTLIAGQLVALALLIVLQQFVLSPAQLDAWGWRIPFFIGALCALIA
FT                   MRLRSTMEETQSFTSTAMEQKKRGSLRELAKHPRAVATVVGLTLGGTVAFYTYSIYMQK
FT                   FLANTVGLSKDQATLVSGATLLLFALLQPVVGGLSDRVGRRPILIAFGVLGTLFTVPIM
FT                   TGISQTSSPWTAFFLIMAALVIVSGYTSINAVVKAELFPTEVRALGVGLPYALTVSIFG
FT                   GTAEYIALWLKQAGHEPWFYWYVTGTILLSLLVYVFMRDTRAHSRIEH"
FT   gene            8550..10457
FT                   /gene="dctB"
FT                   /locus_tag="RPSI07_mp0009"
FT   CDS_pept        8550..10457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctB"
FT                   /locus_tag="RPSI07_mp0009"
FT                   /product="sensor histidine kinase, transcriptional
FT                   regulator of C4-dicarboxylate transport"
FT                   /function="6 : Energy metabolism"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3671068; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34369"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34369.1"
FT                   /translation="MLSADGHADPTHVAHGRGLRLAVALAMVACCAAAGWGAYALALQR
FT                   YVAARAEEAGQRTTFYAQNLRGTLARYESLPRLAALEHVLHVALTAPHHRDAVLRRAAN
FT                   AYLKEVQVAADLTAVYLMDAAGQTLAASNWDQPSSFIGRNYAFRPYFVDAMREGLGRFY
FT                   GVGNTTGETGYFLAAPVREGDQSVGAVAVKINLDSFEATLARSGDTVLLVDRHGVIFLS
FT                   SVPEWKYRTLGTLSAAQRAALDATRQYVPHALAPLDPRAGGVPFSADQVPQTLRVALPG
FT                   RSVSTLRVQYRPVGLLGWQVAVLIDPRDEQRTALVAGASAAFAMALAFAVFVALRLRAR
FT                   RHEEQRSARAALREVQRDLEARIAQRTAELTSANAALASKVEALDATQRILRETRDAAV
FT                   QAGKLAVLGQMAAGITHELNQPLTALTTLSDNANQLAERGRIDEVRGNLAHISQLAHRM
FT                   GRIVSHIKGFARKGDALRAAVPVEEAIRQALMLVDTRRRQAGVPVAVGPVPPGVAVWAN
FT                   AVRLEQVLVNLIRNAIDATAEAPQPEAASVRVTVDADDALVRITVRDAGPGIAPGVLSH
FT                   LFEPFFTTKADGQGLGLGLAISLAIVEDFGGRLEGRNADDGAGGAAFVIELERVLEPHA
FT                   "
FT   gene            10450..11811
FT                   /gene="dctD"
FT                   /locus_tag="RPSI07_mp0010"
FT   CDS_pept        10450..11811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctD"
FT                   /locus_tag="RPSI07_mp0010"
FT                   /product="C4-dicarboxylate transport transcriptional
FT                   regulatory protein (response regulator in two-component
FT                   reguatory system)"
FT                   /function="6 : Energy metabolism"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34370"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34370.1"
FT                   /translation="MPDTSFSSELPATDLAPVFLIEDDDVVRLGCEQALTLADMPVQSF
FT                   ADAESALAALAAQTPSVVVSDVRLPGRDGLAVLREMLQHDRQMPVILVTGHGDVSMAVT
FT                   AMRAGAYDFIEKPFHSERLVDVVRRALEKRRLTSENLRLREALQGRQAFALIGQSAAMQ
FT                   NVRRLVAALAPTDADILVTGETGAGKEVLARAIHEGSRRRGPFVALNCAALPESVFESE
FT                   MFGHEAGAFTSANRRRIGKMEYANGGTLFLDEIESMPLALQAKLLRALQERSIERLGSN
FT                   ASVPVDCRVVAAAKVDLKDAADHGAFRADLYYRLNVVSIALPTLRQRAEDIPLLMAYFL
FT                   QQAALRYDRAAPDWAAQDMMRWQHHDWPGNVRELKNVAERFCLGLDDGLVTPEASRHSL
FT                   AGRMMAVERTTIEEALRATEGNVARAADLLVVPRKTLYDKLNRHGIEPERFRTG"
FT   gene            complement(11817..12614)
FT                   /locus_tag="RPSI07_mp0011"
FT   CDS_pept        complement(11817..12614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0011"
FT                   /product="putative lipoprotein transmembrane"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34371"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34371.1"
FT                   /translation="MTVPLSALAAHAIAAIVLAGIPIGAWFWLRRRFDLAWRDIGVGAA
FT                   VFAVFALVLERTLHVYLLQLNPVTAQWLRVPALFVIYGTLMAGLFEESGRWLGLRFLTR
FT                   RPGDTATPVAYALGHAGIEAWLVGVASQAQMVMFGIAANRGDLDARLAASGAEAMTATI
FT                   HALLAQLSPWLAAGAVAERIAAMLVQFALTLVVWHAVRQRRPVLLGLAIVLHALADLPA
FT                   ALYQVHALPLVVTESIYTVIALLLAATCWPPQGGRKPGESPLR"
FT   gene            12795..13217
FT                   /locus_tag="RPSI07_mp0012"
FT   CDS_pept        12795..13217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0012"
FT                   /product="putative signal peptide protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34372"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34372.1"
FT                   /translation="MKRSVWQWILVCSAGLGTAWASAPASAARWHEYLATTSVSASIDR
FT                   ASLRSDRAGHKVFLARTVLKRGERRSRGARYRPGTVILSRQEIDCRRQRIRLVDYVVRG
FT                   PDGATLDSDTAAGAHWMRIRPGTLAARSASYVCARR"
FT   gene            13348..16035
FT                   /locus_tag="RPSI07_mp0013"
FT   CDS_pept        13348..16035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0013"
FT                   /product="putative signal transduction GGDEF sensory box
FT                   domain, transmembrane protein"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34373"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34373.1"
FT                   /translation="MKLTLKSQAAIMATAISVAVVSLFGWSQREPIRREVMRQIKTQQT
FT                   ALVRESADDLRQRLDTYLGLLERTARQMTTVRFDSPAQEAAFYASIAPTAGLFDSVFLA
FT                   SADGKVTAVSPHREGVVGIDIADRDYFKQVMVVDQPTISAPLRNRVGDEPVVTFAAPVH
FT                   DRDGRIVGLIGAGLYLLKPNFLGDLRDMRIGETGRVYLVARGSKPVFILHPVADKMLAP
FT                   LDADPEIAAAFHADPAALPDPGGDVVTTQDVIATGWTLAAVLPGAEANRQLNAMRERFR
FT                   WSLLALAALIGVSVWAAMLWLLRPLGQLHAAMTQLSATDLREIRPAELPGASAEIEAVS
FT                   TAFRKLMDEVTRQRAELEAVNDASPLGLFRCDAAGHMVYANQACRRLLGLTLEEAMTGT
FT                   WLARLHPQDREAVTAGWADAVTRGVGHCAELRVIVPGRDERLLVVNTAPVRVEGQVVGH
FT                   VGAMEDITVRARAEQASRVLTQILDSTTDFVAQTDVQGRVTYINPAGRRFAGVALDADV
FT                   RDRRAETFYPDDTMQWLREVAVPTAARDGVWIGETTVFDAQRRAVPINHMVIVHRDPMG
FT                   RVEYFSSIMRDITQDKAAKEALQRSRETLQTVTDAMPALVAFVDADERFRFLNAAYEKV
FT                   FDRPTAAMLGLTVHEVLGEEAYAAMRGPLQRALAGETVVFEREAPDRDPYRCDEITYIP
FT                   QFDARGRVAGVHAVMLDITERKKQELHLRALSTTDHLTGLLNRAGFEARLSAALAQARG
FT                   DGTVGALLLLDLDGFKVVNDTHGHAVGDALLRRFAQRLARTVRPCDGVARFGGDEFAVI
FT                   LAQPDDARAVARHILAACDRPFRLGEAVVRVGASIGIAGFDAGTLAQSAVFEAADEALY
FT                   EAKSRGKGLFVAFDELSAGSSRTA"
FT   gene            16521..17681
FT                   /locus_tag="RPSI07_mp0014"
FT   CDS_pept        16521..17681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0014"
FT                   /product="putative Leu/Ile/Val-binding periplasmic (Pbp)
FT                   abc transporter protein"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34375"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34375.1"
FT                   /translation="MQKTIKRLLVTAVAAGAAVAAGAASAAQDIKIGVAEALSGGAAQY
FT                   GAAIRNGFQLAADEINAAGGINGSKIALVIEDEQGKKEEAINVFKKLIFQDKVAMVFGP
FT                   TLSNSAQAADPIAQGAKTVVFGTSNTADGITSIGDYVFRNSVTEADVLPATIQTVVKKA
FT                   GVKKVAVLYGNDDVFTKSGYDNFKKALEDLKIPVTTTETFAKGDVDFKAQLTKIKATNP
FT                   DAIVLSALIAEGGPIMVQARQLGLNVPIIGGNGMNSVKVFDLARDKSDNLWVGSPWSIE
FT                   NHTPENSKFITAYTSKYKAAPDQFAAQAYDAMYIAARALRAVKFSGSVEADRKAIRDAL
FT                   PAVKHTGATGAFAFRQVTARGKPAGYDAVQTPIVSVTKAGKYTIEK"
FT   gene            17779..18660
FT                   /gene="livH"
FT                   /locus_tag="RPSI07_mp0015"
FT   CDS_pept        17779..18660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livH"
FT                   /locus_tag="RPSI07_mp0015"
FT                   /product="high-affinity branched-chain
FT                   leucine/isoleucine/valine transporter subunit protein (ABC
FT                   superfamily, membrane)"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3009409; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34376"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34376.1"
FT                   /translation="MLEQQLVNALSLGCVYALFALGFTLVFGILGVINLSHGAVFMLGA
FT                   YAALQVVTHFELPLWAALLVGFAVSGVAGLVIDVVLLRPLRRRNAPHLIPMIATIGAGI
FT                   AINNAMQGVFGAENLRFPAGLVSDASLDLGGIHLTPLELGIIVLSFVLMAALMLLLKRT
FT                   QLGRALRAIAESPKAAALLGIHVEGLFLLTSFAAAALGGLAGVLIGLYSNAVFPLMGQP
FT                   MLHKGIAVIILGGLGDIRGAMLGGLFLGFAEVLSVAYIGSTMRDAVAFGLLFLILLVRP
FT                   QGLFGKVLERKA"
FT   gene            18671..19570
FT                   /gene="livM"
FT                   /locus_tag="RPSI07_mp0016"
FT   CDS_pept        18671..19570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livM"
FT                   /locus_tag="RPSI07_mp0016"
FT                   /product="leucine/isoleucine/valine transporter permease
FT                   subunit (transmembrane abc transporter)"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34377"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34377.1"
FT                   /translation="MEWFDNFWSVYSNLVLTLGINALLALSIYLTLSCGLLAMANAAFM
FT                   GIGAYTSALLTMNAEMPFPVALLGGMAAPAVVALIIGGPTLRLSGVYLAMATLGFGEVV
FT                   RVLILNTESWTGGALGLNSIPQLTEWWHVALAVVLTLFVLARLRRSKVGRAFEAIKEDE
FT                   TAAGLMGINVAGTKLLAFVLGAMIAGLAGALNAHLTFFIGPAEYGFDRGVEILTMAILG
FT                   GTSGLAGPVLGSVILSLLPELLRAFKDFRLVVNGLILMLIVLFLPKGIWDPARFARWFG
FT                   MKRGGTMPGASAASNESH"
FT   gene            19557..20375
FT                   /gene="livG"
FT                   /locus_tag="RPSI07_mp0017"
FT   CDS_pept        19557..20375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livG"
FT                   /locus_tag="RPSI07_mp0017"
FT                   /product="leucine/isoleucine/valine transporter subunit ;
FT                   ATP-binding component of ABC superfamily"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34378"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34378.1"
FT                   /translation="MNRTEAAMLKLASISKRFGGLSVLQDVNIEVPQGTIFGLIGPNGA
FT                   GKTTVFNLITGLLAPTGGTLTFAGASLVGRKPHQITQMGIARTFQNIRIFKEMTLLENV
FT                   VVGMHRHLDYGAPGLLLSLPKYRAAERRARDRALELLSWVKLDHKAGDIADNLSYGDQR
FT                   KLELARALATEPKLLLLDEPVAGMNTGEKVDLMAEIENIKARGYTIFMIEHDMRFVMGL
FT                   CERIAVLNFGRIIAEGPPEAIRNNPQVIEAYLGRDDDEGEGGAAAQEVTA"
FT   gene            20372..21106
FT                   /gene="livF"
FT                   /locus_tag="RPSI07_mp0018"
FT   CDS_pept        20372..21106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="RPSI07_mp0018"
FT                   /product="Leucine/isoleucine/valine transporter subunit ;
FT                   ATP-binding component of ABC superfamily"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14702302, 2195019; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34379"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34379.1"
FT                   /translation="MTVLLEVKGLEVSYGHIAAVKGIDFALNAGEITSLVGANGAGKST
FT                   TLLALSGLIPKAQGTVRGTILFEGEDVAQWSPHRRVERGIVQVAEGRAILTTMTVRENL
FT                   ELGAYTRHGRNQRSQIAADLERVFHLFPRLKERIDGMAGNLSGGEQQMLAIGRALMARP
FT                   RVLLLDEPSMGLAPIIVQEIFRILRTINAEGLTIFLVEQNVRQALKIAQRGYVLETGQI
FT                   VLADSGQNLLGNPRVLEAYLGG"
FT   gene            complement(21182..22051)
FT                   /locus_tag="RPSI07_mp0019"
FT   CDS_pept        complement(21182..22051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0019"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34380"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34380.1"
FT                   /translation="MQWDDVRYFLALAREGSLSAAARRLGVEHTTVARRADALEQALGV
FT                   RLFDRLPRGWRLTAEGGALAERAGRMEQEAAGFARAAAGAGSLRGTVRVSAPPTLASHI
FT                   IAPNLAALRRWWPGIDLVLLGEKRNANLMAHEADLAVRLSRPTSAALATRPLGDLGYGL
FT                   YATPEALARPEAEWEFIGYDDTLRHMPQQRWLAAYAGTRRMILRCSDLAAIHRAALAGL
FT                   GVAALPHFLASAETGTPLRRLPVSDPALQRPIWLVIHPDVRRSPRVRAVADGLIALFEA
FT                   QRHVLAGA"
FT   gene            22253..22510
FT                   /locus_tag="RPSI07_mp0020"
FT   CDS_pept        22253..22510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0020"
FT                   /product="Conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34381"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34381.1"
FT                   /translation="MHARRIQLREPGPPLGLRVAAIAIPLRHTAVDVNLVDGDRRAGLY
FT                   AGSAFSAAWGVVEATGPAARGAASLALVSGKTSGALLPRP"
FT   gene            22545..22892
FT                   /locus_tag="RPSI07_mp0021"
FT   CDS_pept        22545..22892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0021"
FT                   /product="putative ycII-related protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34382"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34382.1"
FT                   /translation="MLYLILLTYRAPLDVLDRVLPAHRAHLQAHYESGHFLMSGPFFPR
FT                   EGGGILARGDSREAIEAIVARDPFVVEKLVEARVIAWAPNRRLDEVPQAWLPEAAVSIR
FT                   TDEDAATRPLS"
FT   gene            22917..24302
FT                   /gene="clcB"
FT                   /locus_tag="RPSI07_mp0022"
FT   CDS_pept        22917..24302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clcB"
FT                   /locus_tag="RPSI07_mp0022"
FT                   /product="chloride channel protein clcB-like"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34383"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34383.1"
FT                   /translation="MSDTPPPSSDPPPRPPWWARAAARLPFQREHLMLVIAGVIGCAGA
FT                   LATIVFRECLRQLQWWLAGADQGLVATARALPWWARLLVPAVGGLLAGLTLQYGLKWIP
FT                   RKGAEDYMEAIAVGDGVLSARQSLVRSASSLCSVASGASIGREGPMVQLAAMCGSLLGR
FT                   LLRHAMPVSVEQLRLLVACGAAAGITSAYNAPISGAVFVCEIVFGAITTATLGPLLVSA
FT                   VTADIIVRQFFGYGAVYAMPHFDFVSGWEVLTYLGLGLAAGMAGPLLLGLIDRARDAFA
FT                   RTRLPQALRLALGGLIVGALSIRVPEVWGNGYSVVNGFLHAPWLWQAVALVLVCKVCAT
FT                   AASAGSGAVGGVFTPTLFCGAALGLLYGTGMHALLPDAAPVPVSYAVVGMGALLAATTH
FT                   APLMSILMIFEMTLSYQVVLPLMLACITGYVTAHATGAPSVYARALARNRDDTLRLPPP
FT                   SSP"
FT   gene            complement(24291..24914)
FT                   /locus_tag="RPSI07_mp0023"
FT   CDS_pept        complement(24291..24914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0023"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34384"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34384.1"
FT                   /translation="MPRRILRCGNHALFRESAPGHPPHRKDAGRGWLARRRIKRDRIPI
FT                   ASLALLRDAVAAPSYATSARHLRPSLVRTLQTNPLFCTLRHVADALPIVAAFDLGMQSK
FT                   NQHQEDMVRAWSGSDLPAPTEHAVCKSQPATGKKASQNWVRFGALRKSSVLSREMSRHR
FT                   NAWRLPRETYSARSCRHSAKSMATPSFRAMPDQAYPFLRKPLGR"
FT   gene            complement(24926..25072)
FT                   /locus_tag="RPSI07_mp0024"
FT   CDS_pept        complement(24926..25072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0024"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34385"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34385.1"
FT                   /translation="MKALAIHVSPASRFGRFWQIVRREAKRALVLHVEACGMMAELYQR
FT                   SGR"
FT   gene            complement(25204..25410)
FT                   /locus_tag="RPSI07_mp0025"
FT   CDS_pept        complement(25204..25410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0025"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34386"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34386.1"
FT                   /translation="MRDAERAIEGTGEANTIRTAIRCIARNARQAASMPAIVLLFASLP
FT                   HWETRSRPTPGSTSRAGQGKVTH"
FT   gene            25985..26746
FT                   /locus_tag="RPSI07_mp0026"
FT   CDS_pept        25985..26746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0026"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34387"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34387.1"
FT                   /translation="MALARVVLAAAALGGASLANAEALLVPAYIYPSGAGAAAWSTLAT
FT                   TAQTVPTTVILNPSSGPGSAQDSNYVAAVAQIHAAGGKVIGYVSTSYTNRSLSAVVQDI
FT                   STYLSLYNVDGFFIDEMTSDSVTAHIQYYQSVYNYIKGLSSTYAVTGNPGTNIPELYAS
FT                   LPVADQFVVFESSAAQYASYAPQAWQANYPTSRFAHIVYGVPSASRMLTLVQGAAALGA
FT                   GSVYVTSRGLPDTYVALPRYWSQEVSAAAAN"
FT   gene            complement(26877..27797)
FT                   /locus_tag="RPSI07_mp0027"
FT   CDS_pept        complement(26877..27797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0027"
FT                   /product="putative L-Serine dehydratase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="4.3.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34388"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34388.1"
FT                   /translation="MPLHIETPFVRSQALSRRLGSNVLLKMEAMQPGGSFKLRGVGAVC
FT                   EAQAAVGARRFVSSSGGNAGIAVAYCGRELRVPVLVVVPESTSQRARDLIRLEGAELIV
FT                   HGTSWAEANDLARSLTGPQDAFVHPFDDPVMWSGHATMVDEMAASGTKPDAVVLAVGGG
FT                   GLLCGVLEGLWRNGWSDIPVFAVETEGTDCYARSVAQGRPVELVAISSVATSLGAKRPC
FT                   DRAVEWAAKHAIHNLVVSDAQAVAAALQFLDEHRVVVEPACGAALAALNRDHPALRSAS
FT                   SIAVIVCGGATTSVDQLRTLDSKTG"
FT   gene            27955..28869
FT                   /locus_tag="RPSI07_mp0028"
FT   CDS_pept        27955..28869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0028"
FT                   /product="Putative transcriptional regulator, LysR-family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34389"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34389.1"
FT                   /translation="MRNVEMRHLRYFIAVAEAGSVMAGARVVGIVQPALSRQIRELEEA
FT                   VGTPLLVRKAKGVALTAAGASFLRDAKQLLADLRGSRDRALRCAAGQLGELRLGVLPNY
FT                   LTLPTVTQALQVFRASCPDVRVVVEPMLSAEQVAAIASHQLDGGVMAWRSDEASHLSGV
FT                   VLLRDRFVLAMPASPGRRRKAPARLADLTEQSFVWFDPVRSAAHHRFLMAQLERAGFTP
FT                   RISQTGSDIPTLIGLVSAGMGCAFVPESLSAVCPTTVRLVPLDEVADRYDVEFAFDGEA
FT                   TAPVVSRFLDALLQVTGGRERTL"
FT   gene            complement(28998..29477)
FT                   /locus_tag="RPSI07_mp0029"
FT   CDS_pept        complement(28998..29477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0029"
FT                   /product="conserved hypothethical protein,
FT                   Phosphatidylethanolamine-binding protein family, UPF0098"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34390"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34390.1"
FT                   /translation="MTLTLTSSAFAAGAEMPGKLTCEGTDTSPPLAWTGVPAGTRSLAL
FT                   IVDDPDAPDPAAPRMTWVHWVLYNIPPATTALAEDAARGHLPSGTREGTNDWQRTGYGG
FT                   PCPPIGRHRYFHKLYALDTELPDLGTPDKAALERAMRGHVLAQAELVATYQKHKR"
FT   gene            30057..31487
FT                   /gene="oprB"
FT                   /locus_tag="RPSI07_mp0030"
FT   CDS_pept        30057..31487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oprB"
FT                   /locus_tag="RPSI07_mp0030"
FT                   /product="Carbohydrate-selective porin"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34391"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34391.1"
FT                   /translation="MLFFSMLQYVWVAVRPLVWVRLQAHRHSVPIALMALLSVFAQGAR
FT                   AVEAPAADAPLIAGGELDDRFGFHGQTTWVWQRKPAFNAPYSGDNSLSPDRAKSDSFSA
FT                   TLDLGMRLWKGAEFHLNPEVAMGNAFSDLHGLGGPVNGELAKVSGTDPTLYRARAFLRQ
FT                   TWGLGGDTEKIDADFNQFADVVDKHRIVLTAGNVPVLDLFDAVEYAHDPRTQFLNWSFM
FT                   THPSFDYPADARGYDWGVALEYIDSENGWAARAGRFLLPIESNGLALDTRFLTHYGDML
FT                   ELEKRYTLFGQAGKVRLLGWRNKARMGRFQDAIAFGQAAGSAPDVGQVRKEHAKVGVGL
FT                   SFEQRVGENLGLFTRLNWSDDKTETYAFTEAGRNVSFGGLLKGTAWGRPNDVLGAAYSL
FT                   NMLGPDHRAYLAAGGSGAFLGDGALNYAHERILELFYSMQPVKGIMLSPDVQLIQNPGY
FT                   NRDRGPAKFVGLRVHAEF"
FT   gene            31707..31919
FT                   /locus_tag="RPSI07_mp0031"
FT   CDS_pept        31707..31919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0031"
FT                   /product="putative enterochelin esterase domain (Ferric
FT                   enterobactin esterase, partial fes)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34392"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34392.1"
FT                   /translation="MRKFTMPARRFSSVVLPFTSPFIQSPAVPQRTADPAADRDDRTRR
FT                   QAEAGQAMTPHDYAEAAIRLSRTYW"
FT   gene            31957..33600
FT                   /gene="mntH"
FT                   /locus_tag="RPSI07_mp0032"
FT   CDS_pept        31957..33600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="RPSI07_mp0032"
FT                   /product="manganese transport transmembrane protein and
FT                   ABC-type Fe3+-siderophore transport system"
FT                   /function="15 : Cellular processes"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34393"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34393.1"
FT                   /translation="MAQIASGIDAPPRHAALDDAHVGDIRGALGTIAQYDVGPRQGWRA
FT                   RLRTLLAILGPGLIVMVGDNDAGAFGTYTQAGQNYGTTLLWTLLLLIPVLYVNQEMVLR
FT                   LGAVTRVGHARLIFARFGSFWGSFSVIDLFLVNALTLVTEFIGISLALEYLGIPRHWGV
FT                   CASAALVLLAASTGDFRRFERFALALVAGSLTLIPVFVMVHPPLGQVARDFFVPALPAN
FT                   APLSEVMLLIIAIVGTTVAPWQLFFQQSYVIDKRITPRFIRYERADLWLGIVLVIAGAV
FT                   AMIAFSAQAFHGTPEFGQYTDALGTAVGLEKHMGRWAGILFAIALLDASIIGACAVSLS
FT                   TAYAIGDVLAVRHSLHRKPTEAKGFYAVYFGLTLLAAGLVLAPGVPLGLLTNAVQSLAG
FT                   VLLPSATVFLLLLCNDKAVLGPWTNSRLTNLFTGAVVAVLVMLSVILTAAVLFPNLGTV
FT                   EMVAVLAGGSLIAVAMSLVLWRIERRANHGIVRHRVSVLDRAQWTMPPLEQLTAARLTP
FT                   LKRTWMFVLRGYLVIAAGLVLVRIAGLVAG"
FT   gene            complement(33617..35239)
FT                   /gene="hmwS"
FT                   /locus_tag="RPSI07_mp0033"
FT   CDS_pept        complement(33617..35239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmwS"
FT                   /locus_tag="RPSI07_mp0033"
FT                   /product="HmwS, sensor, two components regulatory system"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34394"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34394.1"
FT                   /translation="MTRQTHFPASAAKTVPARSVRGLGTPSILRPIRVRLSLVFVTFLL
FT                   LVIGVGVFSIDQLASFHSVSAQISGRWLQSSRILGDLNNDISDYRAAEGDSLIATTSAD
FT                   ARAADQQIATLDDMIAAAQARYDKIEHDAAERELYRQFVTQWTTYRELAKRVRITVKSG
FT                   EPAGAVQLYHGESRRAYDSANDTLAVLTERNVAGAAAETEREAQAYRDARHWIIGAIVV
FT                   AACLVAVAVAYLVLAVSRPIAALVERMHRIANNDAHVDIPELDRRDEIGDIAQAVARFR
FT                   DNTIELGRSKDALVSQAVVLQDMLAKERRMAELQRNFVSMASHEFRTPLGVIDGHAQRL
FT                   MRMRETPAPEVLEERCGKIRAAVQRMTHLMDHLLDSSQWLDSTTLAAVRCTHFPLAGLL
FT                   HEVCEMHRDSAPGTRIEERLDEGTPEIFYGDAKLLFQAFSNLVGNAVKYSPPHARVTVR
FT                   ISGDAESVCVSVDDQGLGIPERDIDRLFERYVRGGNVAGTVGAGVGLYLVKLVVELHRG
FT                   TIAVSSVEGRGSQFVVRLPRLEA"
FT   gene            35311..35916
FT                   /gene="hmwR"
FT                   /locus_tag="RPSI07_mp0034"
FT   CDS_pept        35311..35916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmwR"
FT                   /locus_tag="RPSI07_mp0034"
FT                   /product="Two component heavy metal response
FT                   transcriptional regulator"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34395"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34395.1"
FT                   /translation="MNEPARKILCIEDDAETAELISEALLEHGFAVTVTHDGEAGLAAL
FT                   LREAPDLVLCDVGMPGMTGFELLERIGALAPRFAEIPFVFLTAMAQRDSELKGRRLGAD
FT                   DYVTKPVDFEILVSIIETRLARNARPRSPAPAVPLSEREVEVLAWSARGKTSGEIATIL
FT                   GLSKRTVDFHIDNARQKLGVATRIEAVVKASSAGIIKP"
FT   gene            complement(35982..39140)
FT                   /gene="hmwA"
FT                   /locus_tag="RPSI07_mp0035"
FT   CDS_pept        complement(35982..39140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmwA"
FT                   /locus_tag="RPSI07_mp0035"
FT                   /product="Heavy metal cation tricomponent efflux HmwA
FT                   (CzcA-like)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34396"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34396.1"
FT                   /translation="MLRAILRLSLLRRPLILLFLLVFVVAGLFAYSKLNIEAYPNPAPV
FT                   ILEITAQTPGLSAEEMERYYTVPMEIGLAATPGVESIRSTSFYGLSFVRVTFKYGIDYY
FT                   FAYTQAALSLQQNVSLPNSVQPQIQASSLVGEVVRYQLKGPPHFGLTNLRTLQDWVLQR
FT                   RLKTVPGVAQVVSWGGTTKEYDVEVDPKKLEAYGVTLPQMMTALGNANINVGGRTINFG
FT                   QQSVNIRGVGLIQDVRDIDKIVLTQAGGVPVQVKDVARTKIGFTPRLGRAGRDNDDDVV
FT                   TAIVVMNRTMQTNDVVARVKAELDKINADGSLPPGVKVERYYDRSELVSVTTHTVMHAL
FT                   LFGCLLVFFIQWVFLGDLRSAIIVSVNIPFALFFSILLLLLTGESANLLSVGAVDFGII
FT                   VDSSVILVENVFRNFQMPVAEQARLLMSRDAKVLGLRVPERLRMIFVSALQVDRAVFFS
FT                   ALITVAAFVPLFTMQGVEGQIFGPMARTYGYALAGALIATFTVTPALCSYLLPKHIEEK
FT                   ETWLVRALHRLYAPALGWSLSNRRIAVAIGALVLVATGLLTPFLGTEFLPALEEGNLWI
FT                   RLTMPQTSSLESGVMPVSRMRQILLKHPEVRTVVSQHGRPDDGSDSAGFYNAEFFVPLK
FT                   PFDQWTAGMTKEKLIAQVQKEFTSEFTGVGLNFSQYIQDNVEEGLSGVKGANAVKIVGP
FT                   DLAVLERLADQVQSEMGKVKGVTDLGVFRVLGQPNLNVRVNREAAARYGLNTGDVNTVV
FT                   QAALGGSQATTILEGDRQFALTVRLAPEYRSNIEAVRNIRVAYQNANGGNSYIPLSALA
FT                   DISLDTGASYIYHEKNIRYVPVKFSVRGRDLGGTVAEAQDRIAHNVKLPQGYRIEWAGE
FT                   FEELEQAKKRLEVVVPISILLILVLLYGLFNSMRDSLMALAGIPFAITGGVAALFLTGL
FT                   DFSISAAIGFVSLFGVSVMDGILMITYYNDLRRERGFKPTEAMFHAAQQRMRPMLMTAL
FT                   SACIGLFPAAVSTGIGSQVQRPLATVVVGGMLVGPLMLLVIVPALRMVFLGKESQDEAS
FT                   APPA"
FT   gene            complement(39198..40376)
FT                   /gene="hmwB"
FT                   /locus_tag="RPSI07_mp0036"
FT   CDS_pept        complement(39198..40376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmwB"
FT                   /locus_tag="RPSI07_mp0036"
FT                   /product="Heavy metal cation tricomponent efflux membrane
FT                   fusion protein HmwB (CzcB-like)(RND-HME-MFP)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34397"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34397.1"
FT                   /translation="MVAALAVGGLMWGLGGQRRSEAAPSSYEAPPSAVPAAPSRDGQSV
FT                   TLSPTQLQYIKVAPVELRDFANRREAIGNIDFNQDRAVQVFSSYAGKIRNVYAKVGDTV
FT                   AKGKPLFDIESPDLVQAESTLISTAGTRKLTTTALARARQLFEIQGLSQKDLDQATSDQ
FT                   QAAEAAYKAAREAVAIFGKTPAQMDQIIETRRTDPVLTVTSPIAGQVTARAAQPGLLVQ
FT                   PGNAAPFTVADVSTMWMQAFVPEADVPLLHVGQPVKIRVMAFPNRVFTGKVTTIGASVD
FT                   ANTHRILVRSEIEDPKHELRPGMFTSFDITTGNPIHSPALATDGVVREGDGTMTAWVTT
FT                   DRKRFARRVIKLGLEQDGFVQIVDGLAAGELAANEGALYLSTAAAGSFNGSD"
FT   gene            40596..42080
FT                   /gene="hmwC"
FT                   /locus_tag="RPSI07_mp0037"
FT   CDS_pept        40596..42080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmwC"
FT                   /locus_tag="RPSI07_mp0037"
FT                   /product="Heavy metal cation tricomponent efflux outer
FT                   membrane porin HmwC (CzcC-like)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34398"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34398.1"
FT                   /translation="MRFVALAATCLLASACAVGPDFRTPAAPTASGYTEQPLPAQTAAA
FT                   QTTGGEAQRFVSGMKVSEQWWQAFQSDKLNKVIADAFAASPTLAAAQAALRQAHQQMRA
FT                   QEGAYFPLLQGTYQPSRQRNAVGTISPTLASGDAIYSLHTAQLTVTYTLDVFGVNRRQV
FT                   ESLRAARDAQYFQLQAAYLTLASNIVVAAVQEASLRAQIEAQQRVVEINTQLLDNLRQQ
FT                   FKFGAVTGLDVAAAQTQLAQAEQTLPTLQKQLALQRDLLAALAGRLPSEGVGETFTFAD
FT                   FTLPQDLPVSLPSELVRQRPDVRAAEAQLHAATAQVGVAIGNMLPQLTLSGTKGGTATV
FT                   FSQMFRDGNIFWSLVGGVAQTFFDGGTLLAKKRAADAGVDQAEAQYRGTVITAFQNVAD
FT                   TLHALDADANVLKSALKSEQAARTTLDITTRQMGLGYVNVLAVLNAEQAYQTATQATIT
FT                   ARASRFADTAALFQAVGGGWWNRPEGAVAMEPAAAH"
FT   gene            42570..44048
FT                   /locus_tag="RPSI07_mp0038"
FT   CDS_pept        42570..44048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0038"
FT                   /product="leucine-rich-repeat type III effector protein
FT                   (GALA3)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 16983093, 18301771;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34399"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34399.1"
FT                   /translation="MPGDQASSADAEPAIKGSYLPPEMWTEIAHRSPVARQRLRAASKT
FT                   MKAAAEVDIRQLIITTPEGLAAVKRPGNYPNLTELTLVGDFWSNDLSGLPTTLRELDLS
FT                   RCERLRVEGLDHLLELPLVRLNINGCRLGAKGAQRLANHPTLTSLDMHGNRIGDEGAKY
FT                   LAANTRLTVLDVGDNMIGDAGVIALARNTTLTSLHLDRNKFGLDGIRALADNTTLTTLN
FT                   VNKNSIRPEGAEVLATNTTLTTLDIEGNAIGDQGAQRLAASKTLTALNVRENEIGRAGG
FT                   FALAVNKTLVSLAVGYNGIGSEAVIAMAANKRLISLDVEYTGISTAVAEVAAALAASTS
FT                   LVCLNVGANGFGDEGARRLAASKTITTLNVSYNRIGRDGALALAASKMITSLDLAGNII
FT                   GTAGIKALVDNTTLATLNLSKSQIAHEGVEALATNTTLASLDVSCNNLAPASVRMLLTR
FT                   TKLALLEASFSACDLGAKAELMTLAVRIGMTLRI"
FT   gene            complement(44162..44815)
FT                   /gene="cheZ"
FT                   /locus_tag="RPSI07_mp0039"
FT   CDS_pept        complement(44162..44815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheZ"
FT                   /locus_tag="RPSI07_mp0039"
FT                   /product="Chemotaxis protein cheZ; Chemotaxis phosphatase"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3298217; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34400"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34400.1"
FT                   /translation="MHDGTSVNADKAAADAEAKPDMLQRIGHLTRMLRESMRELGLDKG
FT                   IERAASAIPDARDRLSYVANMTEQAAMRVLNATDVARPVQDTLEGEAEELVRRWQAWMD
FT                   RQLSDEAIRNLVGETRGFLRNVPQKTRGTNLQLMEILMAQDFQDLTGQVIKKVLDLIQF
FT                   IETELISILVDNVPGHLSVEVAPTLLNGPQVNPDHPDVVASQEQVDDLLESLGF"
FT   gene            complement(44821..45228)
FT                   /gene="cheY"
FT                   /locus_tag="RPSI07_mp0040"
FT   CDS_pept        complement(44821..45228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheY"
FT                   /locus_tag="RPSI07_mp0040"
FT                   /product="Chemotaxis protein cheY; chemotactic response
FT                   regulator"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="12.3 : Protein interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3280143, 7860605; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34401"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34401.1"
FT                   /translation="MDKSQYRFLVIDDFPTMRRIMRGQLKELGFANIDEAEDGAAGLAK
FT                   LKESRFDFVISDWNMPKMDGLQMLQAIRADPNPGVSKLPVLIVTAEAKKENVIAAAQAG
FT                   ANGYVVKPFTAATLGEKLNKIFEKLERSEAW"
FT   gene            45319..45717
FT                   /locus_tag="RPSI07_mp0041"
FT   CDS_pept        45319..45717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0041"
FT                   /product="putative transposase (fragment)"
FT                   /function="16.1 : Circulate"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34402"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34402.1"
FT                   /translation="MCGLRGPTAGRVRTVAGTAANGNEVTQAHALPHRKETDVFGDAGY
FT                   QGVDNRDETQDIEVDWHLVMRPVKRRAPDKANPPGGFQNALDRVKARMHALIALRIARS
FT                   LVALGITKSPSGHCAVRGKRQWRRASFT"
FT   gene            complement(45714..45899)
FT                   /locus_tag="RPSI07_mp0042"
FT   CDS_pept        complement(45714..45899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0042"
FT                   /product="hypothethical protein, alpha/beta-Hydrolases
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34403"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34403.1"
FT                   /translation="MLTISAPRAELPDCGHMMMLEPPDRFCQAILRLLYSCIRQSPFGN
FT                   ARMPASSIQAPDLLEF"
FT   gene            complement(46394..46681)
FT                   /locus_tag="RPSI07_mp0043"
FT   CDS_pept        complement(46394..46681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0043"
FT                   /product="Histone-like nucleoid-structuring protein H-NS"
FT                   /function="8 : DNA metabolism"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34404"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34404.1"
FT                   /translation="MASYKDLLAQKAKLEEQLETARQKELAEVTERVRQIVQEYGLTAE
FT                   DIGLAPKRSKRGPKSAVAPKYRDPKTGATWSGRGRAPAWIGKNRDRFLIA"
FT   gene            complement(46815..47075)
FT                   /locus_tag="RPSI07_mp0044"
FT   CDS_pept        complement(46815..47075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0044"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34405"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34405.1"
FT                   /translation="MAGVVAIRDNAHLYHLFVDRHLHGKGIGTQLWEHAKRAAIRAGNR
FT                   GHFTVNSTVFAVKAYEAFGFRVTGPKTELNGIAFVPMALEI"
FT   gene            complement(47434..48360)
FT                   /locus_tag="RPSI07_mp0045"
FT   CDS_pept        complement(47434..48360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0045"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34406"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34406.1"
FT                   /translation="MTPAYGVPSVPTECKRLSARFVFAAPGYAGNACWRAYDGIAEDPG
FT                   VIMQLSRLARAVGLSVMLGLPALPAHAALPDEIQVYTGDINAPGEFGLELHLNTTPSGI
FT                   GEPGYPGEVTTPHGWRATAEFSYGWSPSLEFGLYIPTSLTRGNTYYVTGPKLRVKWLPV
FT                   RPEDGVGRFAGINVELAHVARRFDPSRQAMELRPIYGYQDDRWLWSVNPVLDWSLSGPG
FT                   RSGVPDAAPAFKIARTVATGLRAGVEYYADLGRINRLAPLHAQQHTVYLAFDVDRKPFV
FT                   FNVGIGRGLTRATDRWTVKWIFEIPFG"
FT   gene            48477..49295
FT                   /locus_tag="RPSI07_mp0046"
FT   CDS_pept        48477..49295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0046"
FT                   /product="putative oxacillin hydrolase (Class-d
FT                   beta-lactamase) signal peptide protein"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number="3.5.2.6"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34407"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34407.1"
FT                   /translation="MTKLRLTAAGALLAVLASFAHARPLCTLVADAATGQPIVQEGQCG
FT                   ERVTPASTFKIALSLMGYDAGFLKDEHAPTLAFKPGDPDWGGAAWHEPTDPARWLQYSV
FT                   VWYSQRIAHALGAERFQSYVRQFGYGNQDVAGDPGRNNGLDRSWILSSLKISPEEQVGF
FT                   LRKLVNRQLPVSAHALDMTARIAEVSRLPGGWVVHGKTGTGAPGTWSPDGTWDQAHAYG
FT                   WFVGWVTNGTKTYVFAHLLQDERIEPRPAGGRARDAVLDALPAMLARGHG"
FT   gene            complement(49542..50189)
FT                   /locus_tag="RPSI07_mp0047"
FT   CDS_pept        complement(49542..50189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0047"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34408"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34408.1"
FT                   /translation="MTPQELQAVESFLAQLTQAQAGAKDPQAEARIAEAVARQPDAGYL
FT                   LVQRAMLLDQALACAKAQIAQLQTRLQTAQAAGSGAFLDPASTWGQHANSVPPPAMASA
FT                   PMPPTTQPSRSGVFSDGVRSTLGSIATTAAGVAGGAFLFQGIENLFHHNSGNGFLGQPA
FT                   MGTLPTETTVINNHYGNDDASALRTDAASRDDSLLDTSLDDSNFADDDTSMF"
FT   gene            50448..52805
FT                   /locus_tag="RPSI07_mp0048"
FT   CDS_pept        50448..52805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0048"
FT                   /product="putative oxidoreductase (salicylyl-CoA
FT                   5-hydroxylase) protein (abmA)"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34409"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34409.1"
FT                   /translation="MKIVCIGGGPAGLYFALLMKRQDPSHDITVVERNRPYDTFGWGVV
FT                   FSDQTLGNLQRADPKSAAQILDAFNHWDDIEVHIRGQAVRSGGHGFCGIGRKRLLNILQ
FT                   ARCEEEGVKLVFETDVQDDTAYADADLIIASDGLNSRIRAKYAATYQPDIDMRHCRFVW
FT                   LGTHKLFDAFTFAFEQTEHGWFQAHAYRFDDETSTFIVETPEEVWHKAGLETMEKDAAI
FT                   AFCEQLFAKYLDGHKLMSNAAHLRGSAQWIRFPRVVCRRWVHCNGRTPVVLMGDAAHTA
FT                   HFSIGSGTKLALEDAIELARCIGGQSGDLMAALEHYEAVRSVEVLRIQNAARNSTEWFE
FT                   NVARYANLPTEQFAYSLLTRSQRISHENLRQRDRAYLESFEDWIAGQAGAPRAPDRAPV
FT                   PPMFTPFTVRGLTLKNRVVVSPMAQYSCQDGLPADYHLVHLGARAMGGAGLVMAEMTCV
FT                   SPDARITPGCPGLWNAEQRDGWARIVRFVHANSDARLGIQLGHAGAKGSTRVAWEGIDL
FT                   PLPEDNWPLISASPQQYLDGVSQWSRAMTRDDMDRVRDDFVRAARLAVEAGFDWLELHC
FT                   AHGYLLSSFISPLTNLRSDEYGGSLENRLRYPLEVFRAVRAVWPADKPMSVRISAHDWV
FT                   QGGITPDDAVEIARIFKAAGADMIDCSSGQVSKKEQPVYGRMFQTPFADRVRNEAGIAT
FT                   IAVGAISEADHVNSIIAAGRADLCAVARPHLANPAWTLNEAARIGYLDMPWPKQYRAGK
FT                   QQLERNLERERALATQAAGLSPLEQANRMQGV"
FT   gene            52807..53580
FT                   /locus_tag="RPSI07_mp0049"
FT   CDS_pept        52807..53580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0049"
FT                   /product="putative oxidoreductase (beta-hydroxyacyl-CoA
FT                   dehydrogenase) protein (abmB)"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34410"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34410.1"
FT                   /translation="MATLAGHHAVVTGAGRGIGAAIATRLAADGATLTLMGRNAAVLEA
FT                   TAATLPAVARTQVVTCDVADAASVAQAFASARAGLGPISILINNAGQAESAPFAKTTLE
FT                   HWQRMLAVNLTGTFLCTQAVLAEVQASGRGRIVNVASTAGLRGYAYVSAYTAAKHGVIG
FT                   LTRSLALELATRGVTVNAVCPGYTDTDIVRESIDRIVARTGRSAEAARAELVKGNPQGR
FT                   LVTPDEVADAVAWLCSDGAASINGQAISVSGGEVM"
FT   gene            53577..54191
FT                   /locus_tag="RPSI07_mp0050"
FT   CDS_pept        53577..54191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0050"
FT                   /product="Putative transcriptional regulator, MarR family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34411"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34411.1"
FT                   /translation="MSKPRKTALATRATGHHKVVQALGEARIGLEARAHADDHMDVKIW
FT                   LRLLACSTQIEQQIRQRLRMRFNTTLPRFDYLAQLDRHPDGLRMNVLSRYLMVTGGNVT
FT                   GLTDQLEKEGLVKREADPDDRRSFRVLLTPAGRRHFAEMAAEHERWLIGMFDGLGAANK
FT                   AALYAQLGNLRVHLARREIELTEPNRPDALTEPSSSTPSRP"
FT   gene            54188..55039
FT                   /locus_tag="RPSI07_mp0051"
FT   CDS_pept        54188..55039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0051"
FT                   /product="putative enoyl-coa hydratase protein (paaG)"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34412"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34412.1"
FT                   /translation="MNDRIDPALLAGNRRPLAGYQATHFLWRVQDSVATITLNRPERKN
FT                   PLTFDSYAELRDLFHQLKWADDVKAIVLAGAGADFCSGGDVHEIIGPLVQLKAPELLMF
FT                   TRMTGELVKAMRACPQPIVAAVDGVCAGAGAILAMASDLRLGTARSKTAFLFNRVGLAG
FT                   CDMGACAILPRIIGQGRAGELLYTGRAMGGEEGERWGFFNRLCDPAEVLTQAQALAADL
FT                   AAGPTFANGITKTMLHQEWTMTIEQALEAEAQAQTICMLTEDFSRAYHAFVAKRRPVFE
FT                   GN"
FT   gene            55041..56237
FT                   /locus_tag="RPSI07_mp0052"
FT   CDS_pept        55041..56237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0052"
FT                   /product="putative acyl-coa dehydrogenase oxidoreductase
FT                   protein (abmD)"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.3.99.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34413"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34413.1"
FT                   /translation="MSDMDYLQWPFFDDKHRKLAAELDAWAAEHVPHDHGADVDAECRA
FT                   LVRKLGQAGWLRHAVGGTAHGGAGETIDTRAICLIRETLARYSGLADFAFAMQGLGSGA
FT                   ISLHGTPEQRARYLTKVARGEAISAFALSEPDAGSDVAAMACAARADGDSYVLDGEKTW
FT                   ISNGGIADFYVVFARTGEAPGARGISAFIVDAGTPGFEIAERIDVIAPHPLARLRFTDC
FT                   RIPAGQRVGAAGEGFKVAMRTLDVFRTSVAAAALGFARRALDEALARATTRRMFNGVLA
FT                   DFQLTQAKLAQMATAIDSAALLTYRAAWQRDQGRTVTREAAMAKMTATENAQQVIDAAV
FT                   QMWGGLGVVSDQPVERLYREIRALRIYEGATEVQQLIIARDLLRSVAPATPAAPATAP"
FT   gene            56234..57883
FT                   /locus_tag="RPSI07_mp0053"
FT   CDS_pept        56234..57883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0053"
FT                   /product="putative AMP-dependent synthetase and ligase;
FT                   ATP-dependent AMP-binding enzyme family"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="6.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34414"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34414.1"
FT                   /translation="MTTARDGEPAMPSAHLDTFARDRLPPPELQPVYRFDLPALRFPPQ
FT                   LNCATELLDRRVAGGEGGRLCIQAPGGLRWRYADLLEHANRIANVLVHEMGVVPGHRVL
FT                   LRAPNNPMLAACWFAVMKAGAIAVTTMPLLRAKELGQILAKGEVGFALCDARLADELRA
FT                   AAGQVAMPVHIRCFNDASPDGLEAAMARQPATFTNVDTAADDTCLLAFTSGTTGVPKAT
FT                   MHFHRDVMAICACWPPHVLRPRPDDIFIGSPPMAFTFGLGGLLLFPMSVGASTVLLEKA
FT                   SPNDLADGIRAFGATVLFTAPTTYRSIAARGDELRATPLRRCVSAGEALPAATRALWKH
FT                   ATGIELIDGIGATEMLHIFISAADDDVRPGATGKPVPGYLARVVDEHGNPVPPGTVGRL
FT                   AVQGPTGCRYLADDRQRNYVKDGWNLTGDAYVMDEDGYFHYHSRTDDMIISSGYNIASP
FT                   EVEDALMQHPAVAECGVVGVPDAERGQIVKAFVVLHPGHEPGPAMAKALQDFVKQTVAP
FT                   YKYPRAIEFCTSLPRSEVGKLQRYRLREGGQS"
FT   gene            57880..58290
FT                   /locus_tag="RPSI07_mp0054"
FT   CDS_pept        57880..58290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0054"
FT                   /product="putative 4-hydroxybenzoyl-CoA thioesterase
FT                   protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34415"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34415.1"
FT                   /translation="MTVHFERAARIRFGHCDPAGIVYFPQYLVLFNGLVEDWFTDGLGI
FT                   SYADMLGPRRIGLPIVKLHCEFSAISRMGDDVQLKLRLERLGNASLSLALDCWAGDQQR
FT                   VRSQQVLVFTDLHTHRAIAVPPDVRQALAACA"
FT   gene            58328..58720
FT                   /locus_tag="RPSI07_mp0055"
FT   CDS_pept        58328..58720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0055"
FT                   /product="putative translation initiation inhibitor, yjgH
FT                   family (abmE )"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34416"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34416.1"
FT                   /translation="MQVLLPPGWPRPKGYANGVSARGRMIFVAGMIGWDAQGVFHTDDL
FT                   AGQVRQALQNIVEVLAEGGAGPGHIVRMTWYVTDKQAYVAAYREIGEAFRELIGNFSIA
FT                   MTAVEVSALVEDRAKVEIEVTAVVPD"
FT   gene            complement(59035..59316)
FT                   /locus_tag="RPSI07_mp0056"
FT   CDS_pept        complement(59035..59316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0056"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34417"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34417.1"
FT                   /translation="MSSISVENRTGRDVLVTIYSPFGPITDGPVKADETKKFALGTVSI
FT                   GSTLKVLAHYPVEEPHTWTATIKHTLRHQESDVIVLAGGPDGGDWRTA"
FT   gene            complement(59449..59733)
FT                   /locus_tag="RPSI07_mp0057"
FT   CDS_pept        complement(59449..59733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0057"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34418"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34418.1"
FT                   /translation="MAGYAVTNKTDKEVWITIYEPFDTIISYGPVKSGETWTFNKGAWA
FT                   IGSTYKLLAEYPVKEPHSWTTTTRQTLRHMDFDSINLIGGPSGGYWQTP"
FT   gene            60067..60261
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0058"
FT   CDS_pept        60067..60261
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0058"
FT                   /product="putative transposase (fragment)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="PSEUDO:CBJ34419.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(60388..61701)
FT                   /gene="kgtP"
FT                   /locus_tag="RPSI07_mp0059"
FT   CDS_pept        complement(60388..61701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kgtP"
FT                   /locus_tag="RPSI07_mp0059"
FT                   /product="alpha-ketoglutarate permease (MFS family)"
FT                   /function="6 : Energy metabolism"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2053984, 8419306; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34420"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34420.1"
FT                   /translation="MSTSAAQASQAVMAPHDTRRRIFAIVGASSGNLVEWFDFYVYAFC
FT                   SLYFAPAFFPSGNTTTQLMNTAGVFAAGFLMRPIGGWLFGRIADKHGRRIAMMISVLMM
FT                   CGGSLVIAVLPTYAQIGALAPFLLLVARLFQGLSVGGEYGTSATYMSEVALKGRRGFFA
FT                   SFQYVTLIGGQLCALLVLVVLQQILSTAELKAWGWRIPFVVGALSALVSLYLRRSLDET
FT                   QSTASREARHAGTIRGAWQHKGAFLRVIGFTAGGSLIFYTFTTYMQKYLVNTAGMNTKT
FT                   ASNVMTAALFIYMVLQPVFGALSDRIGRRMSMILFGVGSVLGTVPLMHALGSVTSPYAA
FT                   FGLVTVALAIISFYTSISGLIKAEMFPPEVRAMGVGLSYAIANAVFGGSAEYVALWLKS
FT                   AGSESTFSWYVTALCAVSLIVSYTMPDPSKEGYLRHEP"
FT   gene            complement(61912..62217)
FT                   /locus_tag="RPSI07_mp0060"
FT   CDS_pept        complement(61912..62217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0060"
FT                   /product="putative transcriptional regulator, lambda
FT                   repressor-like DNA-binding domain"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34421"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34421.1"
FT                   /translation="MMMAQRTIKTRPWDSAEHLRTEADIAAYLDACLEEAGDDPAFITH
FT                   ALGVVARARGMTQIARETGMTREGLYKALSEDGNPSFATVLKVIRALGIRLHAVPA"
FT   gene            complement(62214..62522)
FT                   /locus_tag="RPSI07_mp0061"
FT   CDS_pept        complement(62214..62522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0061"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34422"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34422.1"
FT                   /translation="MLTIRTTEIFDDWFYSLRDKAAQRRVQVRIDRLQMGNPGDVKAVR
FT                   EGIREMRIDHGPGYRVYVAQRGVVLIVLLCGGDKSTQEADVRRAIDLSRRLDVDNME"
FT   gene            complement(62607..63806)
FT                   /locus_tag="RPSI07_mp0062"
FT   CDS_pept        complement(62607..63806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0062"
FT                   /product="putative transporter, MFS_1 family"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34423"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34423.1"
FT                   /translation="MPASPAPSTQSATAAPQGLIRLLTAGAGVSVACIYLNHPLLGLIG
FT                   HDLDIAPHALGVLPTLTAAGYASGIFFFGPLGDRYDRRLVILWKAVLLTLALIGSCVAP
FT                   GLPMLAASGFAIGLAATIAQDFVPSAAAISTDLTRNRNIGTVMTGLLIGIVGSRVFSGI
FT                   VADHFGWRAAFGVSAVAIVGLALAVRAAHFGVAPATRQPYFTLLRSLGTLFAQHPRLRA
FT                   SAFTQAFISVAFSGFWSTVALHLTGAIGLSAGQAGLLGLAGAAGALGASIAGRLSGRVA
FT                   PGHIAAGGALLMAATFATMALFPHSLPAIVIGTLLFDVGVQAALVSHQTIIYALAPEAR
FT                   SRINAVFMTIMFVGMSAGAYGASLAWNAGHWTGLMAFCTAASSIGLGLRLVFNARLGTR
FT                   "
FT   gene            complement(63934..64749)
FT                   /locus_tag="RPSI07_mp0063"
FT   CDS_pept        complement(63934..64749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0063"
FT                   /product="putative HTH-type transcriptional regulator, GntR
FT                   family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34424"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34424.1"
FT                   /translation="MPDAVVPLYHQIYVVLRQQILEGKFGDGPMPGEIELARQFGASRV
FT                   TMRRVFDYLVKEGLVRRHRGMGTFVMRPDDPEAAGGSQTLLQNIIDVGERTSAVVVEFE
FT                   DVMAPPDEAKLLEVAPGTPIKKLVRVRHLEDTPMALITTWLPLDVTVKLTLERLANQSL
FT                   LRLIEASGVRIDRASQVVSARLADVATAQYLDVAVGAPLLSVQRIVREMSGRPVQLLQG
FT                   LYRPDRYEYRMELSRVGEDRARLWIDNAGRGRSEDEEDERTPPRDSRRG"
FT   gene            complement(64923..65420)
FT                   /locus_tag="RPSI07_mp0064"
FT   CDS_pept        complement(64923..65420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0064"
FT                   /product="putative transcriptional regulator, HxlR family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34425"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34425.1"
FT                   /translation="MEAPCSIGAAVSLVGEKWTLLVLREAFSGVTRFDEFLRRIGCSSA
FT                   ILSSRLKALVAYGILRRVPYQEPGDRVRDAYRLTHAGVDLLPAIVALMQWGDRYLTPDG
FT                   EGPVLLRDRASGTPIHVALVNAAGQEVAPRDSVPERNPRYKHRAGRPGEAAEEDREAIS
FT                   NG"
FT   gene            65606..66202
FT                   /locus_tag="RPSI07_mp0065"
FT   CDS_pept        65606..66202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0065"
FT                   /product="putative gcn5-related n-acetyltransferase
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34426"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34426.1"
FT                   /translation="MLYTIHRYPAQWIDRWTVHDGTVATVRPILPQDAPLEAALVEGLS
FT                   SESRYARFLVGGGRLSDEMLAAYTQVDYVNHLALVVSVADADGAGERLIADGRFVLEDG
FT                   VAEFALLVADAWQGKGVGRRLFAMLVRAARAAGAREVFGEVLSMNRRMIVLARDAGFHV
FT                   ASVPGDATVCTVHLPLIDQPAPGASIPLPFATVAG"
FT   gene            66465..66899
FT                   /locus_tag="RPSI07_mp0066"
FT   CDS_pept        66465..66899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0066"
FT                   /product="putative dioxygenase/Glyoxalase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34427"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34427.1"
FT                   /translation="MSEVTPVLAPFHLAFPVHDIAAARAFYGDVLGCPEGRSAPDWVDF
FT                   NFYGHQIVAHLAPEEVGHRKTSAVDGDAVPVRHFGVVLSMPEWEAAADKLHAAGIAFII
FT                   EPHIRFKGEVGEQATMFFLDPSGNALEIKAFANMALLFAK"
FT   gene            67231..68112
FT                   /locus_tag="RPSI07_mp0067"
FT   CDS_pept        67231..68112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0067"
FT                   /product="putative transcriptional regulators, LysR family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34428"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34428.1"
FT                   /translation="MLRELKTFIAVARYGTFAGAGERIGLTQSAVSAQIQRLEASLGFP
FT                   LFDRTGRSATLNAAGRDALALAENIVAMADRLGEQGGSNEQRGLVRVGAIASAQASFLV
FT                   DALIRFRAEFPHCRTRILPGVSLDLLGRVDAGEIDLAVLIRPPFAVPADLEWRTLVAEP
FT                   FVLLAPAGLPGDDWRALLETAPFIRYDRRSFGGRRVDQFLRDQCIAVQEAIELDELQAM
FT                   VQLVARGQGVALAPQTFAQGAWPAGVRALALGDDTFYREIGLVERPRHSRQAIAGRLAD
FT                   CIDAAARQMALA"
FT   gene            68179..68376
FT                   /locus_tag="RPSI07_mp0068"
FT   CDS_pept        68179..68376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0068"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34429"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34429.1"
FT                   /translation="MRLQIGFACAHAISPGWAPTALSGASIKDSPLVWCCSDAFIGAVS
FT                   VGTHVARGGGGQASLSKVAP"
FT   gene            68373..71756
FT                   /gene="ripA"
FT                   /locus_tag="RPSI07_mp0069"
FT   CDS_pept        68373..71756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ripA"
FT                   /locus_tag="RPSI07_mp0069"
FT                   /product="Type III effector protein AWR2"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 15225308; Product type
FT                   ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34430"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34430.1"
FT                   /translation="MKLFSSRSSVNTASAVAAAPVSGRAASTASTPPQPPASAPSGVRR
FT                   IGDALRGLKRCLRPAAISVTAVPGFTKTTIDPLPVPKRPPPPKLGKVPKPAGQHKLDGI
FT                   DRQVHNLTEKLYPPLPAGLHSEPDAKRSIAHEWAFAGAVEALFVPSGASAEAASRLPDL
FT                   LGHLKQVADAQPGVADATRYAGMLQCARALATATGGNAADACVALEHLRTHFSLTDGSG
FT                   GAPATPAQKHAWSTAKLLAHTASGFDALLALRPALAEVDARHPDDGMNGRMKREGLRTF
FT                   LQASDLLAARMPAGVTPPQTPHAQWQDAHNRLSHAADRTSLGGDGLVLNALLCAAKVHA
FT                   APHDAANAIDDRTQVAAYVAWRSGYREGGKGTALERSLGRMNKFTTWARRAEHRANHRL
FT                   AAFDPRRLLGMRKSPLTAAAYGTGGANLGLLNREAQALHDTVKDGLEAMLAHSTVLRQP
FT                   GGGHSLSTEQRGLLLLREAVLKHWGAHIDPTWRASKLKLTDADKRDIAQAVRSAAHGTG
FT                   IDAKAVLSYREFRKLDKLDLMTLARWLDEAASFDPDPSASPTLHLARTKIAEAGGIERG
FT                   RPIKPQGATMADFRNAMTGAIDAMPLGNYVRYFDGGTYGASINMTVNQHAFSHNSLVPA
FT                   LGFGPGAKTLRGRHAFVEIGSSSYGGEVFIGTDKRSSDGTGMGAYAGLKFGTEDWHLSA
FT                   GFSAGVTHSHDRSAPAGVIIRTGLSYDAEGKPTSAWRDNVADVTRFLFQTAAVGQSARP
FT                   VPPDRMWEQFADRFFRTPDISVNWRDQQRSNHTVTKHGSAAVRVAAGPVRVGPAFAVGH
FT                   ERLLASKNDRIDDNGWLRGVERARAQSSSVHVSASLAAVAPAIGHFSNHSGFPDSITLP
FT                   SAPIVGVAANIMPSGTSVTLRRVDEHGRLNPRFIRRLVEFIDPSAFLSHMQARLPRIAH
FT                   TDASRAKVGAFMSAMDDMGTQGNLAYGESWKIRPEVTEVLNAYTDEIQLILKCARDSAT
FT                   QGASAQGAHAEQVYRSIIERIFETVERETAMSPDAQAEAFRQALAGLSEHDADQILRLA
FT                   TETIRVLKDEQSWKLSGYYAYDITTHGYTAGSALLLHATASTSVAGERVLAELAVRDLE
FT                   MLDDPALAAQDKDPAAGDVL"
FT   gene            complement(71785..73890)
FT                   /gene="fhuA"
FT                   /locus_tag="RPSI07_mp0070"
FT   CDS_pept        complement(71785..73890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="RPSI07_mp0070"
FT                   /product="TonB-dependent siderophore receptor
FT                   ferrichrome-iron receptor precursor"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7515827, 9856937; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34431"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34431.2"
FT                   /translation="MNSGGWAAGLAVALMGLPCIGDVSAQEVELPATTASGQRQASGYR
FT                   ARESSVATRTDADLMEIPFAVSSVNTELIRTVAAGRGDDLYDWVAGVARQNSFGGLWDN
FT                   YAVRGFAGDGNWAGTDYLLNGFSWNRGNSVPRDTASLERMEVLKGPASALYGRGDPGGI
FT                   ISYTTKQPQFKSANTVSVSAGSYGATRETLDSTGALSPTLAYRLNLMNEDNGSFRDTVS
FT                   SKRYLVAPGFTWKAGPDTVIHYEMEAMRQRAPLDRGVVAVNNQLGVIPASRFLGEPRDG
FT                   DYEVRNLGHQFTVDHHINADWSVNAGVAQRETDLYGLSSEAFSLQADGRTLWRRYRHVD
FT                   FHTNDLQGRLELTGKLQTGAVGHTLVMGTDAYRFTYDQLVQRSTPTAAAPYAIDIFNPV
FT                   YGQATPALRTVTNALERDEGQGAYVQDTLALGERWKIITGLRWDNYRQSIENRQSGTTT
FT                   SQQQTAFSPRLGVVYQWSPAFSVYANTAYSFRPNNGTDVNGNAFDPEKGRGYEVGAKWA
FT                   GPGWLATVAAFNVTKRNVLTADPANDGFSRAAGEVRSRGVELEWNGELGGGLRGIANLA
FT                   YVDAEVTRDTVLTPGARLVNIPRVNGSAMLMYEFAPGFAQKAGVGAGVVYVGRRAGNTA
FT                   NTQDGFQLPAYTTVQLNGYVQIDKHLRASVVLSNLFNRTYYVSSYNSVWVTPGAPRSLL
FT                   GTLSYSF"
FT   gene            74433..75899
FT                   /locus_tag="RPSI07_mp0071"
FT   CDS_pept        74433..75899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0071"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34432"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34432.1"
FT                   /translation="MAGEAASAPRHRPLPHAGTQGASLSSKLQNWLGQDSAGLSPLALN
FT                   RMPDAYAIESAGNATAGATYTYDGLLAHDVLNLVAAGLGVASRSALMERYRTALDVMLQ
FT                   ADVATLKRASALNERSRRSGKPSARPADSAERARYPALDAHYRESDASRVENLIVTRDH
FT                   RGRWQYDSQKLLRIARDDTHPHARHARDVLMLVYVCGQQGMRRRNDAVYQTFLSGLGAG
FT                   ASALMIAGTHGAALPVVAAGYAVAAAREVLWLGKPLAEEKQKMRDAKAEQMTRIVNREL
FT                   KQLDTRGADQDAGTSSTVDPGNLPLEARAGIVAAAFANAEKRVADQNFGKGIPGRWINH
FT                   RKATAFKDEERSIVVDHALQLIGDELMREATRSADTLTALQAIAQAPDLSLSRRARKLA
FT                   RHVKASPGLLAIHTLLTDMGMRKGEALHVLSRLVDVQLARASGGDAIPFLGDDAARIAD
FT                   WIHQPQLKEAPLQVAHATLHGALRRRSERV"
FT   gene            75931..76185
FT                   /locus_tag="RPSI07_mp0072"
FT   CDS_pept        75931..76185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0072"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34433"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34433.1"
FT                   /translation="MWRNAEGVEMGTGGTYREIVRPERLVRTEHFDQDWTGGETLCTAR
FT                   ADRALQHHASPGRRAGERHGKGIARSYNRMEVLLQEQAA"
FT   gene            76316..77062
FT                   /gene="modA"
FT                   /locus_tag="RPSI07_mp0073"
FT   CDS_pept        76316..77062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="modA"
FT                   /locus_tag="RPSI07_mp0073"
FT                   /product="molybdate transport protein; ABC transporter,
FT                   periplasmic binding component"
FT                   /function="4.6 : Molybdopterin"
FT                   /function="7.2 : Anions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8576221; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0073"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34434"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34434.1"
FT                   /translation="MRAVGLAAALSLGLCAQAQAAELVVSAAASLTNAFKTLAQSYEAQ
FT                   HPDTKIVLNFGASDVLMQQIARGAPADVFASADQEAMDKAVSEKVIQPGSRRDFVANQL
FT                   VLIVPSTSAVPVHALGDLARSDVQRVAIGNPASVPVGRYAKRALEAAGLWQPVSAKAVL
FT                   AQNVRQALDYVARGEVEAGLVFATDAAVAADKVKVAAPVPLSVPLTYPIAVTAGTRQPQ
FT                   QAADFVAFVLSPAGQAILAKYGFLKP"
FT   gene            complement(77063..78361)
FT                   /locus_tag="RPSI07_mp0074"
FT   CDS_pept        complement(77063..78361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0074"
FT                   /product="monocarboxylate permease, transmembrane transport
FT                   protein of the MFS family"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34435"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34435.1"
FT                   /translation="MQRLARFVAPRFHYGWIALAVVFLILLCAAGTRATPSVMMLPLEH
FT                   EFGWSRGTISLAISIGIALYGLTGPFAAASMQYFGIRPTVLGALALLISGTALSAMMSQ
FT                   PWQMVLLWGVMVGGGTGVAAITLGATVVNRWFTTHRGLAMGILTASSATGQLVFLPMMA
FT                   AVVEHHGWRPVVLIVAGALALLLPIVGFLLPESPKSVGLRTYGEPADAPEADHGPRANP
FT                   ITLAMHTLVQAMRKRDFWLLFASFFICGASTNGYIGTHFIAMCADHGLTEVKGASLLAA
FT                   MGIFDLIGTTLSGWLSDRYNSRVLLFWYYGLRGLSLIYLPYAFGFEFFGLPVFAIFYGL
FT                   DWIATVPPTVRLTNDVFGKAAAPIVFGWIVAGHQLGAAFATLGAGLMRASLGNYTVASM
FT                   ISGGLCVAGAFLVLRIHRQRKPDEEASGQPATA"
FT   gene            78525..79169
FT                   /locus_tag="RPSI07_mp0075"
FT   CDS_pept        78525..79169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0075"
FT                   /product="putative TetR-family transcriptional regulator"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34436"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34436.1"
FT                   /translation="MAARGPRPLSSAEHTTPRRISGEEAQASLLEAARELFYYEGVRAV
FT                   GVEAVVERAGVNKMSLYRQFKSKDDLVLAYLERSDENFWGYFNASMDAHPGDARAQLLQ
FT                   FFVDLSGRAAKAGYRGCPFVNVAAEFPDPSHPARQFVERNKAQLLARLRERAAAAGAPD
FT                   PEALADDLAFLIEGAYTASQTFGSGAPRLMHSLPRTAAALLDAAIPTRGAA"
FT   gene            79323..80246
FT                   /locus_tag="RPSI07_mp0076"
FT   CDS_pept        79323..80246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0076"
FT                   /product="putative ATPase, MoxR-like"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34437"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34437.1"
FT                   /translation="MPAQPLSLPAALSQAQRALDRIVLGKPLQIRLALACLLARGHLLL
FT                   EDLPGVGKTTLAHALARTLGLQYQRVQFTSDLLPADLIGVSIYLKEKGAFEFHPGPLFA
FT                   QVVLADEINRASPKAQSALLEAMAEGQVTHDGATYPLPAPFFVIATQNPLNQIGTHPLP
FT                   ESQLDRFTMRLSLGYPDQRSERALYLGGGVAQDIEPALTAAQVVALQAATDAVHAAPAL
FT                   VDYVLALVNATRTDAQVQMGLSPRAGLALLAAARAWALIDGRDAVLPEDVQAVFNAVAA
FT                   HRLLPTGGTLSATALAQRLLDTVAIP"
FT   gene            80254..81297
FT                   /locus_tag="RPSI07_mp0077"
FT   CDS_pept        80254..81297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0077"
FT                   /product="conserved hypothethical protein, putative
FT                   membrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34438"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34438.1"
FT                   /translation="MPLLSALLRVLPGLRFVRERVQRFLSRPRRPRDGAIRLDRNHVYI
FT                   LPTATGAGFALLLVAMLLTSLNYNVSLGFLLTFLLVGVMASAMWQTHRNLVDLEVRGAA
FT                   GEPVFAGRTVNVSVALANATAWARVGVETGARGAAPAESSLDAHDGTVTALSFGAQPRG
FT                   WFRLPRLTVSTRFPLGLFRAWSYADAPLTLLVYPEPEAVAPPLPAAFVPDPGEADDPRV
FT                   ARPRAEEAADQLRPYRPGDPLRSIAWKHSARLDTWLARSGQQARHAQCVLAWDALPRSM
FT                   EVEARLSRLCAWVLAAEQAPAGEAPEYTLVLPGLALGPARGPAHRDACLRALALWGRPP
FT                   VPEEAVA"
FT   gene            81294..83306
FT                   /locus_tag="RPSI07_mp0078"
FT   CDS_pept        81294..83306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0078"
FT                   /product="putative protease, Transglutaminase motif"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34439"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34439.1"
FT                   /translation="MNATFGSARALTHREHGWLIALLALVLAPLLRGLPLVTCSVFGVL
FT                   LLWRTWLWVRRAPLPNKWLLGVAGVAVLGITLALALRTGGNIGRDLAVAVLGAFLVLKL
FT                   MESHTARNGILVTQLCCFLLLSQTLFDQPPWMAATLLASVALLLYHWMLLLHPQARTRL
FT                   SVARALLRLVVTGLPCAAVLFLLFPRLDHPLWRLPQGADVATSGLTDRMAPGSIGQLIL
FT                   SDDLAFRADFNGAPPPPGARYWRGIVLWRFDGQAWTASAFRQRAERAGVPDSADAQHDA
FT                   GPLVEYNITLEPTRQRWFFTLDRGVSIDARDGLRRSIDAEFLSVQPLDQRIRYHARSRL
FT                   PGSGAGDDAQVLDRLTQQSALVLPPGNPRARALAAQWAGLAPAERVASALKLFRGAPFA
FT                   YTLEPEPLQGEQIDDFLFRTHRGFCEHYAGSFVFLMRAAGVPARVVVGYQGGEVNAVSG
FT                   DLIVRQSDAHAWAEVWLQGRGWVRVDPTAAVAPQRVERGLAGAVPASEFRSRRVEEPAW
FT                   LRSVRWGLDGLISGWNRWVLGYDRTRQARLFAWLGLDAADPRAVLWGVSALFLLAALPL
FT                   LWQQRRPRPDPVQAQWQRVCDRLARHGCVRGAAEGPMAYAERAAARFPQAADALRRIAA
FT                   GYVALRYGRDDGDAQARAQRLAQWRKDIGALRVPG"
FT   gene            83789..84433
FT                   /gene="can"
FT                   /locus_tag="RPSI07_mp0079"
FT   CDS_pept        83789..84433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="can"
FT                   /locus_tag="RPSI07_mp0079"
FT                   /product="carbonic anhydrase protein"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34440"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34440.1"
FT                   /translation="MYRPKRMLVGNVAWAHEIAERDPRFFSSLAQGQKPQVLWIGCADS
FT                   RVPAETITHSNPGDLFVHRNIANLVCPADDNTMSVLEYAVRILKVGHIIVCGHDGCGGV
FT                   RASLLPQSDALPHVNRRIAPLCALAGRHRAELDAVPDMDDRVNRLAELNVLEQVRWLRE
FT                   SPIVREAEPAPRVHGWIFGLADGRIRVLASGDPGAAPPVHGDIFVPAEAVA"
FT   gene            84549..86120
FT                   /locus_tag="RPSI07_mp0080"
FT   CDS_pept        84549..86120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0080"
FT                   /product="putative sulphate transporter; transmembrane
FT                   protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34441"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34441.1"
FT                   /translation="MQTPTQPAFFPRDMLAGTIVFLVALPLCLGIASASGVDPLAGLMS
FT                   GMIGGLVVALLSGSQLSVSGPAAGLVVIVVDGIAKLGGFSAFLMAVLLSGVLQFAFGML
FT                   RAGRFAAYVPSSVIKGMLAAIGLLLIIKQVPLALGFTRGDAAAAAGAIATPFGTVSPAA
FT                   MAVTVLSAAVLIGWETRALRRFLLVRALPAPLVVVALGIGVTLLLDAVASGFAPPVEHR
FT                   VGLPSLASFGALFDALQSPSLDALTNPDVWQLALALAIVASLETLLSLEAVEQIDPKKR
FT                   TAPADRELKAQGIGNMMAGVFGALPITSVIVRSSANVQAGAQSRWSAVMHGVLLLASVF
FT                   TLTSIVNLIPLACLATILIFTGFKLAKPSLFVAVARQGMERFAPFIVTIAGVLLTDLLI
FT                   GILMGIALSIALAIRAHLRRSIVMARHHDHFLLSFRKDVSFMGKVPLKRCLAQVPDYTT
FT                   LIIDASRADYIDPDVRELVERFIEEAPSRGILVERHHFDAVAPQPARASKPSMLSKLRL
FT                   SRCPAR"
FT   gene            86405..87187
FT                   /locus_tag="RPSI07_mp0081"
FT   CDS_pept        86405..87187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0081"
FT                   /product="putative transmembrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34442"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34442.1"
FT                   /translation="MDARSMRALPGALNKVPQVALGFWIIKILSTTVGETGADFLAVNV
FT                   GLGTAITGGAMAALLLAALVAQLRARRYVPWLYWLTVVLVSIVGTQITDLLTDRLGVSL
FT                   YVSTAVFGVVLLAIFAVWYRIERTLSIQAIDTRRRELFYWAAILCTFALGTAAGDLATE
FT                   AIGLGFQRGIVVFSVLIALAAIAYRLGADKVLAFWIAYILTRPLGAALGDFLSQSPAYG
FT                   GAGLGAMVTSAVFLAVIVVLVAFAQRGAGRADVAVTAS"
FT   gene            87255..87665
FT                   /locus_tag="RPSI07_mp0082"
FT   CDS_pept        87255..87665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0082"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34443"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34443.1"
FT                   /translation="MTNKLTPTLAAASLVLFMAAAGHVVPAHFSAINTAHAATAAPLGD
FT                   LGSFRTIAADTAAIVDKGDLPGAKLRIKDLEVSWDAAEAGLKPRSASDWHRVDKAIDRA
FT                   LDALRAGKPDAATCRQTLAELIQTIDQVSGKR"
FT   gene            88248..89486
FT                   /locus_tag="RPSI07_mp0083"
FT   CDS_pept        88248..89486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0083"
FT                   /product="putative exported lipoprotein of unknown
FT                   function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34444"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34444.1"
FT                   /translation="MQKIHRATLISATVAGLLILGGCASTGSGDTSGTAGGSSGAASGN
FT                   STTGSTGSGSDGTTTGSTGSGSGGTATASTASTTPTGTVAGKSGGVLTAAGGAVSGTGS
FT                   TVSNANLPLVPGATQSALGNVVTNAGSVLTAAGTGVDSGLGSLGTNPNPVGTTVASSGN
FT                   IVTATGNTVTATGGLVGGLGTGPLQPLSPVTTPTGGLVSQVGQAVSSAGGTLGTTLSTG
FT                   PVQQVTQQASSVIVPLTSQVTGATQTLGAATGLGAPAANLLQTVGGTVANVGTGLTHTN
FT                   TPIVSGVGNVVTATGNTVAALGGPVSGPAASSGSPLAPVTSILGGGTGGSSPLASVTST
FT                   VTGGPSVPAAGAPTAGVGAAAAVTAPAGSLAAGAGASLASTGGTTALSPVTSVVGGALT
FT                   TVGSALGGTALRH"
FT   gene            complement(89579..90766)
FT                   /gene="prpF"
FT                   /locus_tag="RPSI07_mp0084"
FT   CDS_pept        complement(89579..90766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpF"
FT                   /locus_tag="RPSI07_mp0084"
FT                   /product="AcnD-accessory protein (DUF453)"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14702315; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34445"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34445.1"
FT                   /translation="MTHPAQIRIPATYMRGGTSKGVFFRLQDLPDAAQVPGAARDALLM
FT                   RVIGSPDPYGKQIDGMGGATSSTSKTVILSRSARPGHDVDYLFGQVSIDKPLVDWSGNC
FT                   GNLSAAVGPFAISNGLVDASRIPHNGVATVRIWQANIGKTIVAHVPITDGAVQETGDFE
FT                   LDGVTFPAAEVQLEFLDPAAEEDGDGGGAMFPTGNLVDDLEVPGVGTLKATLINAGIPT
FT                   IFVDAASIGYTGTELQDAINGDPKALAMFETLRAHGAVRMGLIRHVDEAATRQHTPKVA
FT                   FVAPPQDYVASSGKRVGEGDVDLLVRAMSMGKLHHAMMGTAAVAIGTAAAIPGTLVNLA
FT                   AGGGERHAVRFGHPSGTLRVGAEASQTDGEWTVTKAIMSRSARVLMEGWVRVPGA"
FT   gene            complement(90763..93360)
FT                   /gene="acnA"
FT                   /locus_tag="RPSI07_mp0085"
FT   CDS_pept        complement(90763..93360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="RPSI07_mp0085"
FT                   /product="aconitate hydratase 1 protein"
FT                   /function="6.3 : Anaerobic"
FT                   /function="6.12 : TCA cycle"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="4.2.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10585860, 9421904; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34446"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34446.1"
FT                   /translation="MNTAYRKPLPGTSLDYFDARAAVEAIAPGAYDTLPYTSRVLAENL
FT                   VRRCDPATLADALGQLIERKRELDFPWFPARVVCHDILGQTALVDLAGLRDAIADQGGD
FT                   PAKVNPVVPVQLIVDHSLAVECGGDDPDAFAKNRAIEDRRNEDRFHFIEWTKLAFKNVD
FT                   VIPAGNGIMHQINLEKMSPVIHAKDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAE
FT                   NVMLGRASWMRLPDIVGVELSGERQPGITATDIVLALTEFLRKQKVVGAYLEFYGEGAA
FT                   LLTLGDRATISNMAPEYGATAAMFSIDPQTLDYLRLTGRSDEQVKLVETYARTAGLWSD
FT                   TLQHAAYERVLRFDLSAVVRNMAGPSNPHARVATTELAAKGIAGRWEAVPGRMPDGAVI
FT                   IAAITSCTNTSNPRNVIAAGLLARNANRLGLVRKPWVKSSLAPGSKAVALYLEAAGLKA
FT                   ELEKLGFGIVAFACTTCNGMSGALDPTIQQEIIDRDLYATAVLSGNRNFDGRIHPYARQ
FT                   AFLASPPLVVAYAIAGTVRFDIERDSFGTGPDGKPITLKDLWPSDEEIDAIVRASVKPE
FT                   QFRQVYIPMFDQRSEAAASVSPLYDWRAQSTYIRRPPYWEGALAGERTLRGMRALAVLG
FT                   DNITTDHLSPSNAILADSAAGEYLAKMGLPEEDFNSYATHRGDHLTAQRATFANPTLKN
FT                   EMAVVDGEVRKGSLARVEPEGKVTRMWEAIETYLERKQPLIVIAGADYGQGSSRDWAAK
FT                   GVRLAGVEAIVAEGFERIHRTNLIGMGVLPLEFKPGTTRIALGIDGTETFDVVGGRTPR
FT                   TDLTLVIHRRNGERVEVPVTCRLDTAEEVSIYEAGGVLQRFAQDFLESAKEAV"
FT   gene            complement(93447..94610)
FT                   /gene="prpC"
FT                   /locus_tag="RPSI07_mp0086"
FT   CDS_pept        complement(93447..94610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpC"
FT                   /locus_tag="RPSI07_mp0086"
FT                   /product="2-methylcitrate synthase (Methylcitrate synthase)
FT                   (Citrate synthase 2)"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="2.3.3.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12473114; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34447"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34447.1"
FT                   /translation="MSEADNSPPAGAFKPKKSVALSGVTAGNTALCTVGRTGNDLHYRG
FT                   YDILDLAAACEFEEVAHLLVHGKLPNKAELAAYKTRLKALRGLPANLKAALEWVPASAH
FT                   PMDVMRTGVSVLGTVLPERDDHNPPGARDIADRLMASLGSMLLYWYHYSHNGRRIEVET
FT                   DDDSIGGHFLHLLHGVEPPKSWVDAMHVSLNLYAEHEFNASTFTGRVIAGTGSDIYSAI
FT                   TGAIGALRGPKHGGANEFAFETQKRYDTPDEAEADVRRRVEAKEVIIGFGHPVYTISDP
FT                   RNKVIKEVARKLSKDAGNTNMFDIAERLETVMWDVKKMFPNLDWFSAVSYHMMGVPTAM
FT                   FTPLFVIARTSGWAAHIIEQRIDNKIIRPSANYIGPEDLKFVPIGKR"
FT   gene            complement(94645..95541)
FT                   /gene="prpB"
FT                   /locus_tag="RPSI07_mp0087"
FT   CDS_pept        complement(94645..95541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpB"
FT                   /locus_tag="RPSI07_mp0087"
FT                   /product="Methylisocitrate lyase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="4.1.3.30"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10482501, 11422389; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34448"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34448.1"
FT                   /translation="MSTSKRHPASAGAKFRQAVAESQPLQVVGAITAYAARMAEQTGFK
FT                   AVYLSGGGVAANSLGIPDLGISTMDDVLIDARRITDAVDIPLLVDIDTGWGGAFNIARA
FT                   VRAFIKAGVAAVHLEDQVGQKRCGHRPGKEVVSADEMVDRVKAAVDARTDDDFVIMART
FT                   DAAASEGIDAAIERAVAYVEAGADMIFPEAMKTLDDYRRFKAAVKVPILANLTEFGNTP
FT                   LFTVDALRSADVDIALYCCGAYRAMNAAALNFYETVMRDGTQQAAVQTMQTRADLYHYL
FT                   GYHAYEDKLDALFAAQK"
FT   gene            95736..97673
FT                   /locus_tag="RPSI07_mp0088"
FT   CDS_pept        95736..97673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0088"
FT                   /product="putative propionate catabolism operon regulatory
FT                   transcription regulator (prpR)"
FT                   /function="12.1 : DNA interactions"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0088"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34449"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34449.1"
FT                   /translation="MSTALHLTPRPRIWACGISRLSDLFLDIAAEYNDRAELRVITRGF
FT                   EDIVREIETAGAERPDVVVAGGSNGAYLKPRLSLPVVVINPTGFDVMHALARARREAES
FT                   VALVTHGDTPDEVRRFVAAYGMDVVFASYASRQDAESCVLDLRDRGVGAVVGPGLVTDL
FT                   AAQAGMNAVFLYSRDSVRAAFDTALEVVQATRRETLRRQRLDNLLQHLRDGVVALDARG
FT                   RIEAINQRLATALGIDARQAAGQPLLDIAPNLLGLLPDTDGDTLGTVRGVSYVIHRGPL
FT                   ASTGAADGTVFTFQESRAVERLDRTLRSGQRAQQFTARYRLDDLIGTSAPMERVRTLVR
FT                   RYARSDATVLVLGESGTGKEMVAQGMHQLSARRDFPFVAINCGAFPEALLESELFGYEE
FT                   GAFTGARKGGKTGLIEAAHRGTLFLDEIGEMPLPLQSRLLRVLQEREVVRLGSTEPTRV
FT                   DIRVVAATHCALTDAVAAGTFRADLYYRLNILSIALPPLRERPGDVMPLAAELLVQAAR
FT                   REPRLLLRIPDTEVAARVFAGIGEPLRGYAWPGNVRELQSVIERIAVELADEEEAGAIT
FT                   REALRAIAPEVFASAPRDKTAALTLRERSRGVEAEEIRAALAAHGGDRDAVCAALGISK
FT                   TTLWRRLNVS"
FT   gene            complement(97681..98532)
FT                   /locus_tag="RPSI07_mp0089"
FT   CDS_pept        complement(97681..98532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0089"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10510"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10510.1"
FT                   /translation="MTDTMPYRFRQLSVSCAIAAVLSACTSAPTPLYQQEEFDAAKSPY
FT                   ARTFQAKSDATCEAARRALLSQGYVSSSPRPDTIDGSKNFQPSNDSHVVIAFHVVCADA
FT                   SADGTSSTAYVNAVQDRYSLKKTSTSASVGLSVLGSVSLPISSSDDSMVKIASETIPAG
FT                   VFYERFFNLVDHFLKIDPTQRDRATVKAAEKEHVAPLPEPAPTPQGEPMKMTTPVVPTP
FT                   PAPPVPVTSPASAPAPAPAPAPATASPAPTSKAPVEPTPDTTAPTAASAPPAASASASG
FT                   TN"
FT   gene            complement(99019..99231)
FT                   /locus_tag="RPSI07_mp0090"
FT   CDS_pept        complement(99019..99231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0090"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34451"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34451.1"
FT                   /translation="MNVGANDETKSIATSCAAPPPHKPNQTMARYNVNSIDGHQDSTSF
FT                   IVDYVVTMMTREVYGALSQPFSMNL"
FT   gene            99969..101807
FT                   /locus_tag="RPSI07_mp0091"
FT   CDS_pept        99969..101807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0091"
FT                   /product="putative helicase protein"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34452"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34452.2"
FT                   /translation="MATLIPSLNSCLGRMTSGEKRFARRLEAFLEDDYLCWYDVTVGIK
FT                   RRRPDFLILNPHRGLLALEVKDWKVGSIVRLDPQLVEAEFDGRLVKDVNPLLKSREFMT
FT                   ATVDMLKRDPLLVEPATSKYAGKLCMPYGHGLVLPNISRQEFETSGMQDVMPGRLVICK
FT                   DEMTESADPEAFQQQLWDMFTQPFRCLLQLPQIDRIRWHLFPDVRIVSRQGSLFEADDD
FT                   KTTQDTRSAIPDLIRVMDLQQEQLARSLGDGHRVIHGVAGSGKTMILGYRAEYLAQASA
FT                   KPVLVLCFNRALAQKLTGWMEHKGLSQKVSVRTFHSWCVEMATTYQLGKLAGRRDEDYA
FT                   ALVQNVIDGVNRGQVPAGQYSALLIDEGHDFDPAWLRLVVQMVDPESNSVLVMYDSAQD
FT                   IYQKSRKLKFSFSSVGIQARGRTTILKLNYRNSAEVLAVAYAFANDLLTAEEAEEDGAP
FT                   LILPQTAGRHGSAPEFIRLPSFKAELDYVADRLRASNEAGTPWRDMAVLTYRKAQAAEV
FT                   VSYLAAAKIPARAGLSKPDNDSVNVLTLHASKGLEFPVVAIPGLGQMPYASHDANEQAR
FT                   VLYVGMTRAMNELVMTADRESEFAVRVGEACGRLVA"
FT   gene            101908..103425
FT                   /locus_tag="RPSI07_mp0092"
FT   CDS_pept        101908..103425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0092"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34453"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34453.1"
FT                   /translation="MAVTVTIENLKSISRLEFEVPLKGAFVITGANGCGKTSLLTVLHR
FT                   MGVHNAFQTGLPGGKSAAGIDGIGNTTIRYEINGKMVAYRYNNTRWSATPKSNSKLVGS
FT                   AFSEVLFLKADSSRVEPTQNELRGVRKYPADQRLRDFMNNVFDTGRFNNIYQIRLRGRN
FT                   LVAHLIDRSAPSDRKKTFYSEKTFSLGELCVMRLGLRLLSMKNGGLYIIDEFEMALHPA
FT                   AQIRLFREIEKMAGESGSTILVSTHSSSLIKSVKRANIIYLENDAGSVTIHRNVYPTYA
FT                   LQHLALEEENAPDKLVFVEDVAAKQCIDEMWLQYVRRRNAAGKNLPTVQVAVIGGYKEV
FT                   LRFLQRSQAFVPSLTKRMAALDADAEIDCMPPVPQPGTVAPQLTVAQQLYHEQKSQVIF
FT                   LPWTPEVGLCELLRSHLARHTQGIQRYTGVTNLQISQASVNAHVGKNGRAQRDECKRTV
FT                   DIIASTIAQKKNWSDDRAREALFSYLVEETFDSNGELMQQLTGKIFG"
FT   gene            104098..104346
FT                   /locus_tag="RPSI07_mp0093"
FT   CDS_pept        104098..104346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0093"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10511"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10511.1"
FT                   /translation="MMSPSSWEVRNTVILYYPPRKVFSLAGGLSSKAMHGPTLDIVGES
FT                   MVSVPEMNELAACSPCATQSAAQVGTPPCAELLLMHR"
FT   gene            104361..107345
FT                   /locus_tag="RPSI07_mp0094"
FT   CDS_pept        104361..107345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0094"
FT                   /product="conserved hypothethical protein, Rhs element Vgr
FT                   related protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34455"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34455.1"
FT                   /translation="MSMSLPQSAVSALSGLLGQHTRQITIETALTTGNLVVERVTAREA
FT                   VSASFVLCVDCLSPSAHLDTAKLATEEITLRLTLPDGNRRAWHGYVLACAALGGDGGLA
FT                   RYRLTIGAWFDRLRNRVDCYVYQDKTALEIIEDVLADYPLAHYRLAVSQPTRKRSVCCQ
FT                   YRETDFAFVERLLAEEGLSYRFEHQQGDALHSEAGKAAQSRHCLVIFDNDAQRPACAQP
FT                   EIRFHRVDATESEDAIEQWSHTRSVGTNAVTLASWDYKALAATAAQATAIDPGGELPTL
FT                   ESFEVAGPYRFADTDGGSRAARLRMQAHEGAYLRYQGQGSVRQLGAGERFTLTQHFDRR
FT                   HSEFVALEVQHEAANNLGADIARLLSTTDIESGGYRNRFVAVPADAPIVPPYRRRPTAP
FT                   EGQAAVVIADEGAPLTTDRDHRVHIRFPWVRAPVVNAFADPASSDRSQVTAWVRVATAS
FT                   AGPNWGANHLPRAGTQVLLTFLDGDIDRPLVAMQLHNTQDALPWPAVDAPLGQALSGWH
FT                   SQGLSGDGYNQWVVDDHPGQLRTRLASSAANSQLNLGYVMSHGATGGERGSWRGIGAEL
FT                   RTDAWAVVRAGAGLLLSTTARPQAGGTVLDAHEACGQLTVAQRTAQRLSDAASSQQALR
FT                   LAANEAFDPLTQALDPAQDGHYADNVNGQDATQPNKAPVERFGQPWLVAESPTSIALAS
FT                   QATTTVYAGRHLHGTAQADWHLAAGNVVAAAAAMGVSLFAQRNGIRAIAEGGPVSIQAH
FT                   TDALAVLADKAVTVTSSTDSVEILAQQNIVLHGGDSSIRLEGSAITFETTKLDVKGAGH
FT                   PLIGPGGQAAELPALPQPATQTHWLELSYRDLYALPMVGAPYTIRFADGTTRKGNLDAQ
FT                   GHAKLDGVPPGPYTVAYGEAQPPAEPRFPATPNPFFSAGLPNSAADATKRLQAFMDQDD
FT                   AYLKDNYFPDEIAEMQSTTHTGEDTTSLLTAAHLSDYLVTSEAGERKAQSSYCDDHPGG
FT                   REVQS"
FT   gene            107306..108838
FT                   /locus_tag="RPSI07_mp0095"
FT   CDS_pept        107306..108838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0095"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34456"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34456.1"
FT                   /translation="MRRPPRRSRGAILNAEAVALRGAVKVADDDLSDWLKGLVTGEGSS
FT                   PSQIIVSGVLGVIPGLGQAMDVRDIIVGVVTISKSPTSPAGWLDMSITLVGCVPALGDA
FT                   LKTSFRMIKSGHSLPRVLDAISPSLKGNLEHWFRTVNWGSVASGLKRNFDEVMGAFIHG
FT                   LDGWVVQTIMGKKEVALLIEQIKDLRQRAPKMLDEAVEELQALWKKSMGDAVPKSTAAH
FT                   ATPHAPAAPHAPSEHAPHGPSAGEAPKAKAPEPRKTEKVERDHTATEHAPTDAARSDTR
FT                   RATKKKQTWETGVPAEHITDYWCARNKRNLKKANNFGKLWEEWHPAGRQGIDHVWIQTG
FT                   NPTRPGVIGETKSSLFGAFRFLAAMPRDIQEQLQALGKGEVDNPTPNGQPNIFHSEGRD
FT                   AVGSVKVPVNQQGGEVELKKGLGNTKSKGVQMSHRWIIDSIEAENLTPSGLALRKKIDL
FT                   FRRQQLLNPGVPPPYTRWVIMVTGRQKHLHDTAKQHEIQNPVITIPDRILKE"
FT   gene            108842..109894
FT                   /locus_tag="RPSI07_mp0096"
FT   CDS_pept        108842..109894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0096"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0096"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34457"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34457.1"
FT                   /translation="MLPILPPFSESDVQERRRDTMLNLSTYADIMEGVRQSFEIVTAET
FT                   ISAQMTKMNGSEDIIYAISDSTCRRSWDYLSAIHLQYSAGASLDSLRAFFPILLGSWEE
FT                   HAKYHVMFHGTSLAGGRKVPHLDLYDNDYWRAIRLTSFAICLGHTNLLPRVAALWDYEN
FT                   DDMDGLLERLVAPYVPGRGTSPDECSRHLPYFKTLKIFDAEPEQRPALMAKYLDEWYKA
FT                   SRREPYYDSHTKGRLHNYLGYWSFEAAAIAVELDIDDSTFRDKPFYPAELSDFGRSFKA
FT                   GQGARADDANRLSLRCEAGQPCPKSGYWLTPAKAGSRRYFQQGEVMPAVASDYGSTIWQ
FT                   WDSDQSDPTL"
FT   gene            complement(110217..111581)
FT                   /locus_tag="RPSI07_mp0097"
FT   CDS_pept        complement(110217..111581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0097"
FT                   /product="Putative signal transduction ggdef domain
FT                   transmembrane protein"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34458"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34458.1"
FT                   /translation="MARAVALLSLLVFIVVTPFAKVQLAQLPSFVPTYESALILNDLIT
FT                   AVLLFGQFAITRSRAMLALASGYLFTAAAATGHLLSFPGLFAPGGLLGAGPQSTAWIYM
FT                   FWHAGFPLFVMAYAVLKVREEREPDRFTPYTLTRRTTVSVIAAVLGAAGACVALATAGE
FT                   NWLPAIMAANRYTSVMWMVAGTTWCFCVVALAVLWRSKPHLTIDIWLMVVLCVWICDVA
FT                   LSAVFNHGRYDLGFYVGRIFGLSGASFILLLLLIENSVLHSRLAAAHAELKRLAATDPL
FT                   TGTANRRAFESSLSEVWRRGAHAESPLSALLIDVDCFKDFNDRYGQLQGDQCLIAVAEC
FT                   LAKHVQRDSDLVARYGGEAFAVLLPDTDMTTAEKIGQRLCGAVAALAIPHAGSAVAGHV
FT                   TVSVGVASGWAQDGVLPHVLTQAADSALGAAKVAGCNRVVVVPVPAQLVRGVVTA"
FT   gene            complement(111807..112007)
FT                   /locus_tag="RPSI07_mp0098"
FT   CDS_pept        complement(111807..112007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0098"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34459"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34459.1"
FT                   /translation="MQRVSGAVQGGRFEGLAGAIRDGLVRERVRGMERWRNASYRPTLR
FT                   ALRLSRSAALTSDYPMTINGE"
FT   gene            111981..112877
FT                   /locus_tag="RPSI07_mp0099"
FT   CDS_pept        111981..112877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0099"
FT                   /product="putative S-adenosylmethionine uptake transporter"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34460"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34460.1"
FT                   /translation="MNRPRHPLQGIAFLIAAVAFFAAFDTLTKYVSTTVPVVMALWFRY
FT                   LFQMVSTGVTLLPSRGRSLLRTRRPWLQVVRGLLLLLTSLFAFLSLRRMPVGEVTAIVM
FT                   LTPLVITLVAAMSLGEQVSVVRWIFMAGGFLGAMLVIRPGSAAFDWSMLLPLGMVAANA
FT                   AFQVVTSRLANVDEAGTTHFYTGAVGALLLTFALPFGWQALGGWTWWLLLILMGIVSSL
FT                   GHALLIMAYTRAPVAMLTPYLYMQIGFAMIGGWLVFSHVPDGWSVAGITTIAICGAAGT
FT                   WATARERRMATLAAVDM"
FT   gene            complement(112957..114042)
FT                   /locus_tag="RPSI07_mp0100"
FT   CDS_pept        complement(112957..114042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0100"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34461"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34461.1"
FT                   /translation="MSISISAPWASKLPAPLLYALRLVRDPHRRYHYARYIHATRVGLG
FT                   VLLSIAVTSGLGWPHGEWATISLLIVIAGLQHHGNIRKRAAERAWGTLIGAVAGLLIIV
FT                   QQTCFGQPSLTHALMAIACGICAYHAIGKGGYTALLAAITLVIVVGHGDNDLLDGAWRT
FT                   LNVLVGIAIALLFSFALPLYATYSWRYRLADALRECAKAYASLSKAGGATRGEHLKHLN
FT                   KLNALLVQLRSLMPSVSKEIEVPMERLERIQHSLRICISTLELLGAARASSDAPAARAT
FT                   ADVLSSMEDRRIRDTLIGISRALRFGTVARLTHNRPADSEPASRLPGPLTAESALALRF
FT                   SSEIEQLRGEFLATAPQWNIG"
FT   gene            complement(114282..115331)
FT                   /locus_tag="RPSI07_mp0101"
FT   CDS_pept        complement(114282..115331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0101"
FT                   /product="putative streptogramin lyase-related (vgb)"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="4.2.99.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34462"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34462.1"
FT                   /translation="MLTIERERVGATVKRMLESGLALSFASALVGAALTVTMGSAQAQP
FT                   SSFETFAVPTGSSPHDVAPAPDGTVWYTAQAQGAVGRLDPRGGKTDRIPLGAGSAPHGV
FT                   IIGPDQAAWITDGGQNAIVRVDPKTLAVTRFPLPKDRPNANLNTAVFDKRGHLWFTGQS
FT                   GIYGELDPAHASMRVFDAPRGPGPYGICVTPDGSLYFASLAGSYLGRIDPASGTAQVIE
FT                   PPTPDQGARRVWSDPTGRVWISEWNAGKVGVFDPATHQWREWRLPGHDPHAYAIFVDDR
FT                   GIVWLSEWSANALVRFDPRTERFDVLTLPRPHANVRQMMGRPGEVWLSESGTDHLLRYR
FT                   SRAADAGGN"
FT   gene            complement(115606..116688)
FT                   /locus_tag="RPSI07_mp0102"
FT   CDS_pept        complement(115606..116688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0102"
FT                   /product="putative cytochrome c signal peptide protein"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34463"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34463.1"
FT                   /translation="MTTARRFTLPLVVGLCIGLCAGTVIAQPPATLDIPAPRAGEAVDT
FT                   ARAMQLLKREAALPVLPWTAPDPATLPAGDAGNAIRYGKALLDQTSKLIGPNAPDPAKR
FT                   FAGNNLNCVHCHAAGPSGLPGTKPYSMPLVNVVYEYPKLDVKSMKVITLQERVAGMIGK
FT                   GPAGAIPADGPEMQAILAYLQWLGRSGKPDTRMAQTGLDDVAMPDRSANPGHGEQLYRA
FT                   HCIACHQQDGTGIKTPDYARGGGYSFPPIAGNDSYDDGGHMAMVPLLTRFLHVNMPYGS
FT                   SKPSPQLTVDEAYDIAAYVTHNLPRKHNPGRAKSYPAAALRPGGFVIPEQFPGDDAAYQ
FT                   RARLGPFIDPPALLQSAEAR"
FT   gene            complement(116685..116921)
FT                   /locus_tag="RPSI07_mp0103"
FT   CDS_pept        complement(116685..116921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0103"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34464"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34464.1"
FT                   /translation="MPPLPLPPLAPHDGGLSHRRVLARCSATALTAQAEAQTRAPATPA
FT                   LPAPVVLDKPLRAILLPDSRRATLTTGAIAGHA"
FT   gene            complement(117051..118247)
FT                   /gene="pme"
FT                   /locus_tag="RPSI07_mp0104"
FT   CDS_pept        complement(117051..118247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pme"
FT                   /locus_tag="RPSI07_mp0104"
FT                   /product="Pectinesterase"
FT                   /function="14 : Cell envelope"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="3.1.1.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2045776; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34465"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34465.1"
FT                   /translation="MHTKTLYLKAAAFLFLGGSPLVAATALAATSTATRPQLSNADARA
FT                   YTIASYMASFGTIGSLTTDNWDPTSGVGAVSGFRANYAVAADGTAQYRTVQAAIDAAVA
FT                   AGGVARKYISVKAGTYNELVCVPTSAPPITLYGLDANASNTVIVYNNANPTPASGAKTN
FT                   PCMGASSTATVGTLRSATAMVRASDFHARDLTFKNGYAEGTYADNNQSAVALAVRGDKA
FT                   ILENISVTGNQDTLYVGATDTTTVIRAYFKNSFIQGDTDFIFGAGTAVFHGCTIQYTAA
FT                   RLGAGATSYIFAPSTAPNNPHGFLAINSTFNATAGASNNSTYLGRAWDQSVSGTSAYVN
FT                   GSSPNGQVVIRDSSLGAHIRLANPWGPSTAGRPYCSANCAYSANRFFEYNNTGAGSGN"
FT   gene            118990..119439
FT                   /locus_tag="RPSI07_mp0105"
FT   CDS_pept        118990..119439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0105"
FT                   /product="putative acetyltransferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34466"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34466.1"
FT                   /translation="MQTTEDVQLRQASHVDCTEVAALLRRCGLPADDTHDIIGAFHVAL
FT                   EKGRIIGCAAVEEGGKSIVVRSVAVDPVYRDRGIASRLIETLLLRAHGAGAREVYLLST
FT                   SAPSYFARWGFSLFPADKAPAEVRASATFRNAERSSALCMRCDLR"
FT   gene            119795..121939
FT                   /locus_tag="RPSI07_mp0106"
FT   CDS_pept        119795..121939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0106"
FT                   /product="Putative type III effector protein (Hlk3)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34467"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34467.1"
FT                   /translation="MMRGRVDERNIRASAPPDVQPAPVGPDRAASPPAGGHQAVRPAAL
FT                   ANLAKAPTAGPSADGASSLSRRTALPAPDDPGVALNKALKRIDIWRGLLTAGREPGARE
FT                   WSPEEVVQYAGPVMKSARTGLDALAALKMQLRTTDSYADETENMLLSALAMASNDVLNV
FT                   RDDMVKERWEQRHAVQAEVAETASGPAEDPEPDFGQLPGWLGDLKQVRAALDEIARRFK
FT                   SAETSGGVRAQLRGIMPAVSVNQSICRTAMQTVHGIIILNRANRLAMLAEQKGLPDVVA
FT                   RASELRQACSHRREEVAAASSALEKEAEERWRRRQGGAQAVDCLTPEALIQHRDVLEEY
FT                   GGRLDQVGLDLCLDAAAMIEMNDADGLWQCMTDIAHAIAGYREGLQALCQAAGSVRPAR
FT                   VEPPPLQAAEPPAPAGSAGPSGSSRRKQDKSGKQPGAASAAAPAPRPAPVDKRTDAQKA
FT                   ADTLLKQYPVDRKTVSQFNGDPIQIAQSLGKDTRTLQRELKDPRSDAAMTADYLRSVVR
FT                   DWFGDARKSGRLRDAVAALPQKDVRVGQLTGRIKALEQIERRLDTLEADLLKRDACPRA
FT                   PHLDRLLNAKENQIRFVGQPVRLSAETRNDRQGTLFEMRIKFKPLSDGRQAAPWVVHIH
FT                   TREPTTADALSTKPFSDFTAVHLKTDQEKNLGPRWEAVMRALGYADAKVHRGPIGTALL
FT                   GKLFARAEQTGRSGRAVPQG"
FT   gene            complement(121983..123449)
FT                   /locus_tag="RPSI07_mp0107"
FT   CDS_pept        complement(121983..123449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0107"
FT                   /product="conserved hypothethical protein, PhoPQ-activated
FT                   pathogenicity-related protein, PqaA type"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34468"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34468.1"
FT                   /translation="MTLAAAMLACPLAQAKAYAPPCATDASGRFADAIACYRYQTEAQA
FT                   LQYAMADTARVADVEQRTYRLVSQSWSPERLVQPEEWLHDVTIYIPDEVAHRRALLVVN
FT                   NGTRRKKDGTGPVASTDLTPEALAGIAKATRTAIVSVSDVPNQSLVYADDGGNRAEDES
FT                   VAHSWSLFMNAPQQRATMPLQVPMVASASRAMTLAERELAPYRIHRFIVTGASKRAWAG
FT                   WLTAIADPRVDAVVSFAADVLGTRDTLKNMYRSYGGNWPIAFAPFYAEGIDKRIDTPEF
FT                   ASLTDIIDPLAYRQTRYGARLAMPKYIVNASGDDFFVPDNTALYYDRLPGRKALRMVPN
FT                   AAHRDIRGATVSSLTTFLNRFQADTSLPRLDARLRGTGADTSIVLHASEPPQKLLLWSA
FT                   TNPTARDFRYACGVRYTSTPIDVPANGILHVPVSQPEAGWSAYFVEATFADGFVATSQA
FT                   YVLGKQAYPTAAPPANGPACQTLPGRMPAS"
FT   gene            123850..125118
FT                   /gene="egl"
FT                   /locus_tag="RPSI07_mp0109"
FT   CDS_pept        123850..125118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egl"
FT                   /locus_tag="RPSI07_mp0109"
FT                   /product="Endoglucanase precursor (Endo-1,4-beta-glucanase)
FT                   (Cellulase)"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="3.2.1.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1735723, 2195024, 2738021; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34469"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34469.1"
FT                   /translation="MPLVAASVAAFMLAGCGGGDGDTSLSTASASGTDTTTLKTAATTS
FT                   ISPLWLTVANDGAAFTVSGTRTVRYGTGTTWVGKSMSGTGQCTAAFFGKDPAAGVAKVC
FT                   QVAQAKGTLLWRGVSLAGAEFGEGSLPGTYGSNYIYPSADSATYYKNKGMNLVRLPFRW
FT                   ERLQPTLNQPFDPNELLRLTGFVDTVTAAGQTVLLDPHNYARYYGNVIGSSAVPNSAYA
FT                   DFWRRLATQFKGNARVIFGLMNEPNSMPTEQWLSGANAALAAIRSANANNVVFVPGNAW
FT                   TGAHSWNQNWYGTPNGTVMKGINDPGRNLVFEVHQYLDGDSSGQSASCVSATIGAERLQ
FT                   DFTNWLRSNGYRGFLGEFGAASNDTCNQAVANMLTFVKNNADVWTGWAWWAGGPWWGSY
FT                   MYSIEPSNGVDKPQMSVLAPYLK"
FT   gene            125259..126005
FT                   /locus_tag="RPSI07_mp0110"
FT   CDS_pept        125259..126005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0110"
FT                   /product="putative 4'-phosphopantetheinyl transferase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="2.7.8.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34470"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34470.1"
FT                   /translation="MLCVWTVRSHEYADEVPRFLGQLPASERQRAEAFHFERDRVSYAV
FT                   SHYALRQVLAGHLGLDGFGHAFEIGPRGKPSLPRAFADSGLEFSLSHTHGLALIAVSRL
FT                   GAVGVDVERVVDTVDVHGLAASVFAESESRHLAGLDAAAARHGFFRLWVRKEAYVKARG
FT                   IGLADGLREPVLDPAALDAAGGAQVRHAGGSTWAEWPIAVPDGYCAALYQCLDNAASAV
FT                   RVVPEIRAWRPADRQDEAVRQQRAVP"
FT   gene            complement(125984..127375)
FT                   /locus_tag="RPSI07_mp0111"
FT   CDS_pept        complement(125984..127375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0111"
FT                   /product="putative multidrug efflux pump"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34471"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34471.1"
FT                   /translation="MTDGPIAGTLFALFLPILFGNLMQALNGSVNAMWVGHTLGEAALA
FT                   AAANANAVISFVVAVVMGIGMAASILIGQSLGAKDIAQAKRVVGTGATFFVGLAVLIAL
FT                   AAAVLTGRIVARMQAPPEVLPLAVAYLRVLFLAMPFQAAYIFLTILLRSTGDSKTPFRF
FT                   QIVCVGLDIALNPLLIVGWGPLPALGIAGSATATLMAQGIGLMALAGRLYRTRHILCLR
FT                   ADETHLLRPDPRILKALIVKGLPMGLHMAVVSLAMVMMMSLVNRFGAQLSAAYGACLHL
FT                   WNYIQLPVLAMGMTVTPMAAQNLGARRLDRVGRIALAGIALNVTMAGGMVLVSQCFSGA
FT                   VLGMFLPARMETLQAAQHINAMVAWSFIPFGVTFVLASIIRASGTAMPPLVILFVALWC
FT                   IRLPAAAVLMNAWGADALWASFGLGSVSAMLMSMAYYRWAGWRAAFTPIEVSAPVREDQ
FT                   GTARC"
FT   gene            complement(127445..127699)
FT                   /locus_tag="RPSI07_mp0112"
FT   CDS_pept        complement(127445..127699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0112"
FT                   /product="conserved hypothethical protein, MbtH-like
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34472"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34472.1"
FT                   /translation="MTTSNTTRFIDIQASKEYAMTTHTIEPVHACLVLTNAEEQYSLWP
FT                   AGIEVPAGWSVAHRAESREAAIAYVESHWTDMRPASLRT"
FT   gene            complement(127696..136650)
FT                   /locus_tag="RPSI07_mp0113"
FT   CDS_pept        complement(127696..136650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0113"
FT                   /product="putative polyketide/nonribosomal protein synthase
FT                   (Partial sequence) (fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10512"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10512.1"
FT                   /translation="MLQGTDNAARQPMTEPSIPALFEQQVARAPEAIAVTFGEARLSYA
FT                   ELNERANRLAHQLLALGVQPEDRVAVALHRCIDLPVAMLAIFKAGAVYLPIDPNYPAER
FT                   IAFMLDDARPALLLTASAARAGLPANAPQPLCLDELALDGLPLHNPALPIAPQHAAYLI
FT                   YTSGSTGRPKGVLVSHRGVPHLVSTHMRRCELGPGCRVLQFASPSFDAALSELLRPLLS
FT                   GATSVMASPDDLLPGTPLASLLLRERITHVTLPPAVLAVMPEDSLASVRYLIVAGEAVS
FT                   PALVERWHHGRRMINAYGPTEATVLASMSAPMAGADDLSIGTPIDNAQIHLLDAMLQPV
FT                   PIGAAGEICIGGPGVARGYLNRPGLTAERFVADPFGPPGARLYRSGDLGRWRHDGTLEF
FT                   LGRIDEQVKIRGFRIEPGEVQAVLEQHPDVAQATVIAREDQPGNRQLVGYVVAADNAQP
FT                   APAALRRYLAERLPDYMVPAAVVRLDALPLTPNGKIDRKALPAPEAGAYASKAHEAPQD
FT                   GTETELARIWGEILKRARVGRTDHFFELGGHSLLAVRTVTGMRQAFGVDIAVRDLFAYP
FT                   VLKDLAEHIQRAARVDRPVISKAERGAQVPMSFAQRALWFLAQIDGISQVHLVPIGVQL
FT                   RGNLDRPALRRALDRILARHEALRTTFALVDGQPVQRIMPAHEAHFALAETDLRQHGHP
FT                   HDALERLIALECDTPFDLGTGPAIRGRLIRQAEEAHTLLVTMHHVVTDGWSVGVFLREL
FT                   GTLYNAFSQAQDDPLPALELQYADYSLWQQRWMESDALQRQAAYWKTMLADAPEQLELP
FT                   TDHPRPLRRSYAGALLGVTLDETLTAGLKALSNRHGTTLFMTLLTGWAVLLSRLSRQRD
FT                   VVIGTAVANRGHAEIEPLIGFFANMLALRVDLDHAPTVGQLLRQVKARAIAAQQHEDMP
FT                   FEHVVELTRPVRSLARNPLFQVVFVWQNTPEERLTLTGLTATPLRLDTRTTAKFDLTLA
FT                   LQETGDRISGGIEYATSLFEPDTVERFAGYLRTLLQAMVDDDTRPVDRLPMLPPAERQR
FT                   LLAGPDAAAHAGSEATLPQLFEQQAAQTPDAIAVVFEAQTLAYAELNRRANRLAHDLIA
FT                   QGIGPGQFVAIALPRGLDLLVALLAVLKSGAAYLPLDPDYPQDRLAFMIDDAKPARVIT
FT                   HAAVAGRLPGSAPQLMLDAPQTQARLSRMPDVDPTDSHRLRPLLPSHPVYVIYTSGSTG
FT                   RPKGVVIEHRNVVRLLRVTEHPFHFGPSDVWTLFHSFAFDFSVWEIWGALAYGGRLVVV
FT                   PALCARSPGEFYALLCREGVTVLNQTPSAFQQLIAAQARSDETHRLRCIVFGGEALELH
FT                   TLLPWIQRNDPERTRLINMYGITEITVHATFCPIERADIEAGAGSRIGTPLADLRIHLL
FT                   DEALEPVPVGVLGELYIGGPGLARGYLNRPALTAERFIANPFGTPGTRLYKTGDVGRWL
FT                   PDGTFEFLGRNDDQVKIRGFRIELGEIEAKLAAQPGVRDAVVLAREDQAGDKRLVAYLV
FT                   PEAGDALHAATLRDGLARELADYMLPSAYVMLDALPLTVNGKLDRKALPAPQGDAYIRR
FT                   GHEAPQGAMETALAAIWSAVLQRELIGRHDNFFELGGHSLLAVRLLSQIRDALQLEMPL
FT                   GTLFSHPSLSGFAAAAGQTGRTTVTAIPPADRSVPLALSFAQQRLWFLAQMEGTRVSEA
FT                   YHIPGGFRLEGTLDQAALAASLDRIVARHEALRTTFGEHDGVAVQVIAPPDTGLALQTH
FT                   DLSGIDGPLAREAQLRQHLAQAARTPFDLERGPLVRASLFRLAPQAHVLFFCLHHIVFD
FT                   GWSMGVLMHELSVLYAALREARADGHDPLPPLPIQYPDYAQWQRRWIGGERQRHQAGYW
FT                   QQALAGIPSVIALPTDRPRPPRQDYAGAHCPVTLDATLSSRLGALSQRHGVTLYMTLMA
FT                   AWATLLSRLSGQHDIVIGSPTAGRTRSETEHLIGFFVNTLALRYRLAPGQTVAGLLAYS
FT                   RQQVLAAQQHADLPFEQIVDLVQPPRSLAHAPIFQVLFAWQNVPPGRLALPELTASPLK
FT                   GPGSVSAKFDLTLTLQEADGRIAGTLEYATALYDHATVERYIDHWRTLLEAMADDDSRP
FT                   LADLPLLTPAQRQQVLVDWNATQAPYPRHACLHQYFEAQVERTPDAIAVVHEARQLTYA
FT                   QLNTQANRLAHRLIALGVRPDARVALCVERGVEMVVGLLGILKAGGAYVPLDPSHPPAR
FT                   LAAMVEDCAPAAVVVQEASLPGLSAQGLPVVVLDGADTAQGPQAGNPDAKAIGLASHHL
FT                   AYVMYTSGSTGLPKGVMVEHRSVMNLWQALEQTVYAEGRHCTRVALNAAISFDASVQAL
FT                   VQLLSGRCLVIVPQAVRLDAAALSAFLKAQRIDVFDCTPAQLDLLVADGCFHDAQGLPQ
FT                   AILVGGDAMAASTWDTLSRTAGVRVYNVYGPTECTVDATLCALHGQAGRPSIGRPLANT
FT                   WVYLLDERQQPVPVGVAGELCIGGAGVARGYLNRPELSAERFLPDPFSREAGARMYRTG
FT                   DLGRWLPDGRIEYLGRNDHQVKIRGFRIEPGEIQAVLEQHPDVVQAAVIAHEDAAGGKQ
FT                   LVGYAVAAGAARPESAALRRYLAEHLPDYMVPAAVVRLDALPLTANGKIDRKALPAPDF
FT                   AAHASVREPLTPNEHALAALFAEALGLDKVGVDDSFFDLGGHSLLATRLVSRIRAELDV
FT                   ALPVRALFEAPSVAQLARRLNADEAAGDLDTVLPLRATGSKRPLFCVHTATGLGWPYAG
FT                   LVAHVGREVPVYALQSPFLDAGVPLHDDIGAVVDRYIAALRAVQPQGPYRLLGWSIGGV
FT                   IAHRIATRLEQLGHAVELLALLDSHPAQRTQAQPLTDAQLLRRFLGIIGWPAGEDEVAT
FT                   DCPLDTLARIHAQHDRLSVLTLAQIHRLFDVFKHHLRLWREPDLGRVHGRTVFFEATRT
FT                   VPRPDPLHALWTPHVASAMTVHGIPCTHDDMARPACLATIGQRLKDAL"
FT   gene            complement(136661..137278)
FT                   /gene="cysC"
FT                   /locus_tag="RPSI07_mp0114"
FT   CDS_pept        complement(136661..137278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="RPSI07_mp0114"
FT                   /product="Adenylyl-sulfate kinase"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /EC_number="2.7.1.25"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12072441, 2828368; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34474"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34474.1"
FT                   /translation="MQASISETQSPPDTQRFAFAPSEAFTIWMTGLSGAGKSTLAREIQ
FT                   YRLRQQGRACYVLDGDVLRDGLSSDLGFSREDRCEQVRRVAHVARILNEAGVVAIVALV
FT                   SPYRADRQLAREIIGAGAMHEVWVCTPLQVCQARDPKGLYRQANAGLLPAMTGVAAPYE
FT                   PPPESTLRIDTSRHDVSTCANRILDAVGAHPCMNGSDHDVRG"
FT   gene            complement(137324..138244)
FT                   /locus_tag="RPSI07_mp0115"
FT   CDS_pept        complement(137324..138244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0115"
FT                   /product="putative sulfotransferase protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.8.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34475"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34475.1"
FT                   /translation="MTAKFHFIAGLPRSGSTLLAALLRQNPRFHASMSSPLARMTSSVL
FT                   VEMTGEDGPLVSPDKRRGVLRGLFDAYYAEESATREVIFDTNRGWGTRLPLLTELFGDV
FT                   KMICMVRDVARVMDSFEVLVRKNVFERSGLFLDERERATVYSRTEALLLPNRTIGYALA
FT                   SLKEAVYGEHARSVLVVEYDHLVRFPAQTLRLIYQFLGEPLFEHSLDTLHYDEPGFDNG
FT                   IATPGLHLVRPSIQTIARRTVLPPDLHERLSQLSFWRQPGYSQAHLVRHANAGAGDADG
FT                   AAKLVIASADEVSEPDLLPELHRLP"
FT   gene            138811..139413
FT                   /locus_tag="RPSI07_mp0116"
FT   CDS_pept        138811..139413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0116"
FT                   /product="conserved exported protein of unknown function,
FT                   TPR-like"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34476"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34476.1"
FT                   /translation="MKRLTALFLIPILAGCASAVSERVSANYTRLGAAAQAQGDWDAAR
FT                   RAYAKAMLNADQAGLPADRRAIVHYEYGRSLGATCFFDQSERELHTAYELDKQAGHPVY
FT                   LSLVELARLMLDQQKFAQSVTYFERALPALDAAGAAAKAPAAYADILDEYAQALTGAER
FT                   PTEARTAAERAEALRGDHPGKRSITDRTPYGKFCRLV"
FT   gene            139652..139999
FT                   /locus_tag="RPSI07_mp0118"
FT   CDS_pept        139652..139999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0118"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34477"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34477.1"
FT                   /translation="MKHEMKTLLALLAATGFFAATAAQADTVAVTSVTNLSDPSTQSIV
FT                   SKGVASFVGTKQIVLALAGKTCTWVGSASAIGPVGCNYGITVNGANQLSNPESNSNPTC
FT                   TPASQMIAMCK"
FT   gene            complement(140149..140946)
FT                   /locus_tag="RPSI07_mp0119"
FT   CDS_pept        complement(140149..140946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0119"
FT                   /product="membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10514"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10514.1"
FT                   /translation="MKKPVLPTIAAYFLLLTATSALLTLYRMRVAGYAWNAPLIPHSSL
FT                   SVRSQWLWVAGAAAANVGIAIALMRGWSWAKPLLFASLVVNEAVGLFTSETNLLAILLG
FT                   LAFAAVPAIMVVLSRIEAPSRRTERIGRWAAARRAIGLCFYWAAAFVLFVVLTSLFSGN
FT                   TPPGATGSDAGAGLFVVAALAIMLAGGTVIGTFAVAAREAALVLISLPSYLIVYCIWTD
FT                   LSLKLVYPKHPWHFQWDDTGVWLAMLGMGGFGLMAVAEQREAA"
FT   gene            141273..141563
FT                   /locus_tag="RPSI07_mp0120"
FT   CDS_pept        141273..141563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0120"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34479"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34479.1"
FT                   /translation="MTRSYLEPCEVIEDVFVSTQASVADLGGRVVALSGFAACALSFVP
FT                   AGQRADLEGAFRRLIAAQLESAAASSRPEAFSDALMLQFSTLMRALRDVAG"
FT   gene            142134..143354
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0121"
FT   CDS_pept        142134..143354
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0121"
FT                   /product="fragment of conserved hypothethical protein, VGR
FT                   related protein (part 1)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CBJ34480.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            143311..144918
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0122"
FT   CDS_pept        143311..144918
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0122"
FT                   /product="fragment of conserved hypothethical protein, VGR
FT                   related protein (part 2)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CBJ34481.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            145053..145988
FT                   /locus_tag="RPSI07_mp0123"
FT   CDS_pept        145053..145988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0123"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34482"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34482.1"
FT                   /translation="MDAAVSQVADWPLQCADGSPWLLVDAALVEFDRILSSLKVWGCHT
FT                   YPVFARSRLAAFGDKGPHLVSLPREADALRSRLTQLLQAHAAAPAFSWLYSVRPADEIC
FT                   AALSLLGLVRVDGDLELHCRFADTRVLTALWAALTEQQRSWLAPCISAWGCPDRAGGVL
FT                   DLRVKSAMPGQPATPPPEILELDAMQFSAVLDASEPDTVFNALKESTPEFVRDGVRRSD
FT                   LHQQIAQALGRATALHVTQTPDRLQFVVLSLQCGELFFQQSALAQTWAEVAQGARLETL
FT                   MKLWPAEIWEALAPGETDAGALGILEGDWQ"
FT   gene            145985..146683
FT                   /locus_tag="RPSI07_mp0124"
FT   CDS_pept        145985..146683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0124"
FT                   /product="exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34483"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34483.1"
FT                   /translation="MSVWKAVRAIAVALAALCVLAACSKKDEIPDDKAMAKVASYNHTA
FT                   DYIHQFYVDDAGGGNSFAYGGGGSFVCCVVYPRVWHPGLKATVKWTTSSSDPNATGDAA
FT                   QPHWHEAVVPIDQYSKPGTRLNVHFLPGGKVRLIVTDMAAGFAGYPGPDYPVAPPDFHF
FT                   EPWKGAASEAEARARAQAKGAAEVEAQMRALEAASSVLPVPVVPPPSNQRAPDVPSDAT
FT                   VPPSEIHIQG"
FT   gene            146687..148813
FT                   /locus_tag="RPSI07_mp0125"
FT   CDS_pept        146687..148813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0125"
FT                   /product="conserved hypothethical protein, aromatic
FT                   compound dioxygenase domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34484"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34484.1"
FT                   /translation="MSTFRPGWYEVSFDAATRDRHCRYFKSPSVYTAECQVKSTGQQIL
FT                   LWSDPEGLDGAGPPAQWQPTYRPLAGAAADDWWNHLPGGANYRPELPPSGSRAQRKPTL
FT                   KELCERAGTADIAGKTSLSCSREIHVGLFFDGTNNNLVRDTPSQSHTNVVVLFNAHRND
FT                   QVETFRFYMPGVGTKFSEIGEAEELDAGKTYAAGGEARIHWGMLQVFNAVHTALCGTDL
FT                   LDEKEMKHMVTSTAGLSTWWRMGDEKMVRIFGDLQKRLLKAIEGKRPRITKVHLSVFGF
FT                   SRGAAQARTCCQWIRKATGMKVGEATLNMRFLGIFDTVASVGLADSSPVGQGFMDWADG
FT                   TMDIGEFERVAHFVAAHEIRQSFPLSTARIGGKRYPPNTKEFVYPGAHSDVGGGYAPRA
FT                   QGKAMGGRSELLSQIPLNDMYTEARNAGVRLLAKSEMRPEVQADFVVAQALDEAFSAYS
FT                   KWTAHMEKEDVAAGKGPPVQNRMHYQTQLYWRWRAHISSDAAFKALSSYTHATTQDKTD
FT                   LFESELDWRRDVSRAQEASKTRHVVRGRGAYVTLPAPATELQKQIVMQVNAAAQVPAGA
FT                   STFFDRHVHDSHAGFWLLGPITTAQRLAFIANIKAKKARYDALMRSAQTSGNPYANQQR
FT                   SAALAYELNGFERRVLVADAKAAGSVPVMSDADAADLRANAGIATSAALWILGTETRRE
FT                   PHGHGRYRRIFDHG"
FT   gene            148915..149235
FT                   /locus_tag="RPSI07_mp0126"
FT   CDS_pept        148915..149235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0126"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34485"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34485.1"
FT                   /translation="MGLPALAHPPLSHADTGRTGAGPPGAEVVSVPSKMVQKKAEDVVH
FT                   SAEAWMAKATRHLLKAGKELLGRAAMEALHMTATYGWHFSRAIGSKRMRMAGCGESRWS
FT                   CR"
FT   gene            149205..149927
FT                   /locus_tag="RPSI07_mp0127"
FT   CDS_pept        149205..149927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0127"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34486"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34486.1"
FT                   /translation="MRRVQMVLPVTQGVAVWDGVKQKVWGDKVKEWREVKAYWNDTSPL
FT                   DPRIGRICDDYIHDSRAWFKPFGAPSDSVWRMRQEARLEKLKQQDAAWKQVAVDLNRDL
FT                   IGTLKRYESTANGGEGDVPPNPVVGQDRIDLERYLKDGSVPMETKGREPSSMWGYLRWR
FT                   THFAPTPTLGERAQAAWNEVASVPGKVAQKAKDAAHDAEARLANTARKLLEAGQESLER
FT                   AAKEALQRFLGGSGVPRF"
FT   gene            150041..150823
FT                   /locus_tag="RPSI07_mp0128"
FT   CDS_pept        150041..150823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0128"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34487"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34487.1"
FT                   /translation="MTQYLYHITTTAVARIIRTKGLMPAAHPEALGRPVARRHGAFEVN
FT                   RAAQEPTRQVNRLKAYLKKGLEAGYSLEQIRAGQRPFTPIPVVPAGHRDDEQVEITRTE
FT                   EAEVKAFLALLGAPANKPGRLAVPLKTLAEQADDMLRTRKANALCRLAVHTVSLEYAIE
FT                   EGMTSRHVYFSRPERASDCYNSYTRQHGGAAQCSVLRVPRVAALPVLDDPSDFRAVMTQ
FT                   RRIPPHHIDIWSASPGAVFTNELHRAASGNWTSLTRWA"
FT   gene            150839..151318
FT                   /locus_tag="RPSI07_mp0129"
FT   CDS_pept        150839..151318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0129"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34488"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34488.1"
FT                   /translation="MEPQRMAAFEKTAVVALLALVLAAPALADGLKMIQQNEPARVSAS
FT                   GAQPYEVVPGTHIPLVLIHADPAMVIAQVSMDVFDFHRNIAIPKGSRLIGKELRKVNER
FT                   REVVWIGLQIPAASGTLRLDPPLQATMRDGSAGVMDLTPGALLGAMTSEPFIVPH"
FT   gene            complement(151373..151792)
FT                   /locus_tag="RPSI07_mp0130"
FT   CDS_pept        complement(151373..151792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0130"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34489"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34489.1"
FT                   /translation="MGAWSHESFGNDDACDFAADVAATDDLSLVESALDTVLAAGDDDL
FT                   EAPEASQAIAAAEVIARLQGRWGLRDAYSENVDAWAERTKIAPRRDIVHKAQQALDRIL
FT                   SEPSELLELWQESEDGDKWSDAVRELRGRLDGPAQ"
FT   gene            complement(151871..154606)
FT                   /locus_tag="RPSI07_mp0131"
FT   CDS_pept        complement(151871..154606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0131"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34490"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34490.1"
FT                   /translation="MKPASATPALPRPPGPSASRRRLLQAALSTSVLVSMGTTRPAAAS
FT                   VRSTSTTSKHMDLYAYVGSRTTRERNARGEGISVFRVDTRTAGLEPVQLVKDLVNPSFL
FT                   ALNPAGDRLYAVHGDLADISAFAVDRASGRLTFINRQSTQGKNPVHLAIDPSGRFVVVS
FT                   NHIGASLAVLPLAADGALGEVTQRVRLDGPIGPHRIEQKQAKPHFNRFDPAGRFVIVPD
FT                   KGLDRTFAFRFAEGRLTPAAPSFVESREGAGPRHVAFRPDGRFAYVVNELDSTVTTYGY
FT                   DAGTGTLTPLQVLPALPDTFTGNSRASEIAVDAAGRFVYASRQHRLRGAADEQGARAEQ
FT                   RGVRLCLGHLLHRLLPVRGAQQRHAQPPGGAPLDRADPGDVGAGRDGIGVRAERHAALR
FT                   AALPARRGGSGFLSRHHRVPDVLVPGTRAGDHRGALHGRDSRVAHHRRTALHLDHGQRP
FT                   LAAVERLALDAAARRRTGHDRRGALLRLPRRPPQGRALAVRGRTRLAAGGAGAGPQSPP
FT                   RCRASRHAQGHDPSEGAVPGVHLLRLPVRQPGHRLLDAADHQGLLVRAVAYRGGADRHA
FT                   ALCVCDGGDALVIAALRPARRAPPALGRAAGHGGPGLRGRRLHRPSGHRRGDDQPQPGR
FT                   AVCLQVAVLGVADAVPDPLHRRRLDRRHQLRGQSRRLRRTLRHRLPQGADAQHHGGPAV
FT                   PGGPAGRVVRHDDAAAGHGSERVRSAARLMTFHLALPRWAVAARSWPGAARPLCLRVSG
FT                   TSSDVPEYGRSATRRPLANPPAHKMMEPAAIRLTRTLPHSPTKVWAALTDPAIHATWWA
FT                   AGDVRPVVGHRFTLDMGKWGTQACEVLEAEAANRLSYAFAPGVLNTVITWSLAPEGDGT
FT                   RLSLEHAGFDLGSPMGKTAFEGMRAGWPMVIDRLAAVLAA"
FT   gene            complement(152437..152796)
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0132"
FT   CDS_pept        complement(152437..152796)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0132"
FT                   /product="fragment of Putative major facilitator family
FT                   transporter (part 2)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="PSEUDO:CBJ34491.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(152842..153612)
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0133"
FT   CDS_pept        complement(152842..153612)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0133"
FT                   /product="fragment of Putative major facilitator family
FT                   transporter (part 1)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="PSEUDO:CBJ34492.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            154689..157364
FT                   /gene="acnA"
FT                   /locus_tag="RPSI07_mp0134"
FT   CDS_pept        154689..157364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acnA"
FT                   /locus_tag="RPSI07_mp0134"
FT                   /product="aconitate hydratase 1 protein"
FT                   /function="6.12 : TCA cycle"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="4.2.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9421904; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34493"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34493.1"
FT                   /translation="MGNTYTPPQAVVSVGNVAYRVIDLPAMFGKTLERLPVVLRLLLEN
FT                   TLRNTEGRERQRAVEGLLRWLEVGASEEEIAFQPARVLMHDTTSTPALVDIAAMRDALA
FT                   EAGADPSVLNPVLPVDVSVDHSLAVEYSARADAAVLNLQTEMRRNAERYRFLRWASKAL
FT                   RGVRIHPPGTGIMHTINLEQLATVASVQTLDGVPWLVPDTLIGTDSHTPMINGVGVLGW
FT                   GVGGLEAQTVMFGMPVMQRIPDVIGVRLLGALPTGTSATDLALTVTKALRDIGVSGEFV
FT                   EFFGPGVATLSAGERAVVANMAPEYGATTGFFPVDAQTLAYLRATGRPQAHVARVEALH
FT                   RRAGLWFDPGNTPRYTRVVEIDLAAVRLHVAGPRRPQDLLPYTDTGHALSAFDRTDAEA
FT                   ADGLPGHPVAIAAITSCTNTSDPAQLIAAGLVARRARERGLRVPDWVKTSLAPGSPAAA
FT                   EYLRRAGLMDDLSAVGFDIVGFGCTTCIGNSGPLTAPIQQAIADGTAAPVAVLSGNRNF
FT                   PGRVHPDLSLGFIMSPPLVIAFALAGDAARDLSRQPLQTAPDGTPVHLRDLWPTRAEID
FT                   TLVRRGTSPADYRHAFAIATANPAWAAIDAPDAPRYPWDAGSTALRRPPFASADAGSQL
FT                   GDYEAHPLLVLGDDITTDHISPASVIPKDSFVADFLVARGDDRNDLNVFASRRGNWEVM
FT                   VRAAFYSKTLVNLLAPGLPVAHTLHVPSGQAMPVFEAAQRYRDDGASVVVLAGARYGTG
FT                   SSRDWAAKGQRLLGVRAVIAVSFERIHRSNLIGMGILPLRFPEGVSPRTLAIRPGDTIQ
FT                   VAARPERIGPRCAVPVRVRRADGSVETFIATAAVETQLETALLRGGGVIPAILDKTLQT
FT                   QRAAAQAEPQQAASPHSPMP"
FT   gene            157361..158257
FT                   /locus_tag="RPSI07_mp0135"
FT   CDS_pept        157361..158257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0135"
FT                   /product="putative transcription regulator, GntR"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34494"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34494.1"
FT                   /translation="MKHDRPIATQIVDLIQADGLEAGTHLPAQMLADRLRVSRSPVNEA
FT                   LALLHEKGILMREKNRGYFVARAVTAPATVVASELGLDEADLVSRAYFQIADDRLKGLL
FT                   PDQFSEQMIRTRYRLTTTQLNAVLGRIAQEGWAERKPGYGWAFSTMLTTPDSLLQSYRL
FT                   RLALEPAALLEPGYRLDARVIERLRAAENHLLGGGIETDTADQLHDRGVRFHESLVEAS
FT                   GNAFFIDTIRRVNRVRRLLSYRSMQHRERYPEHARQHLHILDLLARERNEEASDMMRAH
FT                   LRHTLDALAKISGILEP"
FT   gene            158263..159000
FT                   /locus_tag="RPSI07_mp0136"
FT   CDS_pept        158263..159000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0136"
FT                   /product="putative bacterial extracellular solute-binding,
FT                   family 3; ABC transporter protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34495"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34495.1"
FT                   /translation="MTIDPTLLADLAPTGALRASINLGNPILAGLDAQRQPAGVSVDLA
FT                   NALAQRLGVALQLVVVDAAGKSVDVVSQEQADVGFFAIDPRRAASIRFTEPYVLIEGWY
FT                   LVRADSPIRGNAEVDRAGNRVVVGKGSAYDLFLTRELRHAEIVRAPTSPAVVQTFLDTQ
FT                   CEVAAGVKQQLEADAAHRPGLRLLDERFMVIRQAMGVPAGRGLRAAQYVARFVEEMKAS
FT                   GFVERALQRHGVTGVSVAPAAAV"
FT   gene            159025..160191
FT                   /locus_tag="RPSI07_mp0137"
FT   CDS_pept        159025..160191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0137"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34496"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34496.1"
FT                   /translation="MNDRTIPTSATGPAAGRIAPSMLRAQRVAILYQALPPPLIDGIRK
FT                   NAKPGGYADSGADIGHCLRNAGFDIVTPHATPDPACALDWVFPDTPEGIAQAIGHGATM
FT                   LWANTVLFRGHPLERRAGEVWVVGQAPALQQDADDKYATNAHLRRHGLPVAASSLVGRE
FT                   ACGSLPPLEALREDDLQRAGLAFPLVVKPVRGRGSEGVTLVRDLPSMQRAAAGLLDSSA
FT                   FGDALIAETFLAGEELTVTVMPRQADLPAAFSSETASALPPVRRFNHVDGVAPYNGAVA
FT                   VTRNSVALSVEASMAPEARALVRACLLAYDVVGARAPIRIDCRADARGVYQLFDLNMKP
FT                   NMTGAGRPGREDQDSLSALAARAVGWDYRELLVRMMGAAWRGPGSGGG"
FT   gene            complement(160228..161472)
FT                   /gene="bcr"
FT                   /locus_tag="RPSI07_mp0138"
FT   CDS_pept        complement(160228..161472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="bcr"
FT                   /locus_tag="RPSI07_mp0138"
FT                   /product="Bicyclomycin resistance protein; Sulfonamide
FT                   resistance protein; MFS family"
FT                   /function="15 : Cellular processes"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8486276; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34497"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34497.1"
FT                   /translation="MSLNEPAAAPAVPTHGPRILAILSTLMAFASISTDLYLPALPAMG
FT                   AALHASAGTIELTISGYLIGFSLGQLAWGPVGDRYGRRLPIAIGLVLFIVGSAGCAMST
FT                   SAAMMIGWRALQAVGACASVVLARAMVRDLFTGHRAAQMLSTLMTVMAIAPLLGPSVGG
FT                   LILHVASWRAIFWTLVGVGLATLAALRGLPETLPPPQRSREPLRRALIRYAELLRHRRL
FT                   LGYAGAGGFFYGGMYAYIAGTPFAYITYHHVSPQVYGLLFGAGIVGIMVTNQINARLVA
FT                   RFGGDRLMRAGTVVAALAGALLALDAWADWGGLMGLVLPLFLFISATGFIVANSIAGAL
FT                   GSFPARAGSVSALIGSLQYGSGIVGSALVGAFANGTPWPMGCVIALAGLGSVLCARLVA
FT                   SPEPFGMRVVGPDAP"
FT   gene            complement(161555..162535)
FT                   /locus_tag="RPSI07_mp0139"
FT   CDS_pept        complement(161555..162535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0139"
FT                   /product="aldoketo-oxidoreductase, NADP-binding"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.1.1.65"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 16077126; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34498"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34498.1"
FT                   /translation="MQQRTLGKTGLEVSAIGLGCMGLSYGYGPATEKAAGIQLIRAAFE
FT                   QGVTFFDTAEAYGAANEELVGEAVAPFRDQVAIATKFGFKDGDVAQGLDSRPERIRAVV
FT                   EQSLKRLRTDRIDLLYQHRVDPNVPIEDVAGTVKDLIREGKVKHFGLSEAGAQTIRRAH
FT                   AVQPVAALQSEYSLWWREPEETVLPTLEALGIGFVPFSPLGKGFLTGAIDDKTTFDTTD
FT                   FRNIVPRFSEENRKANAGLVDVLGRLAEGKGATRAQIALAWLLARKPWIAPIPGTTKLH
FT                   RLQENVGAAAVALTPADLSAIEAALEQITVAGDRYPAHLQQRVGR"
FT   gene            162669..163574
FT                   /locus_tag="RPSI07_mp0140"
FT   CDS_pept        162669..163574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0140"
FT                   /product="putative transcriptional regulators, LysR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34499"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34499.1"
FT                   /translation="MLRAGLSELTAFIAIAEQRTFRAAAGVLGVSPSALSHAMRNLEAR
FT                   LGVRLLNRTTRSVALTEAGEQLLRRVRPAVADLEDAVNEVASERNRPSGSIRISASENA
FT                   ARPLVRHVLPDFLAAYPDIHVECVVDTRLVDIVADGFDAGIRLLEDVPRDMIAVRFGPD
FT                   MRFVAVASPAYLSRHAPPERPHDLTQHRCIRFRFESGALYRWDLERRGTAASVNVDGPL
FT                   TLGNLNLMVEAALAGIGIAWVPENLVAEPVADGRLVHLLPEWSPSLSGLCLYYPANRHP
FT                   PTALRLFAQAVREWAERNLA"
FT   gene            complement(163710..165746)
FT                   /locus_tag="RPSI07_mp0141"
FT   CDS_pept        complement(163710..165746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0141"
FT                   /product="conserved hypothethical protein, LysM domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34500"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34500.2"
FT                   /translation="MAILLLVQPAARAAGFGALRVRSNLGQPLQAEIDLISVTEEEGQH
FT                   LTARLASPDAYQRTGLTYNPIVSTLRASLVHQPGGGYVVRIRSAQPIGEPIVDILVDLT
FT                   WGSGRLSRAYTFLLDPAGPGNTIPNAAPIPVAQTTAPRMAESMPAPAAAPRPRASAPAP
FT                   QRAARPARQAARPQPAAAAADAAPGRTYTVRRGDSLYDIASNAVPGQDAASLNQTLLAL
FT                   HRDNPGAFIGGNINRLRVGSVLKMPPGNTLILTVREARHEDIAQPSGLAGDRSRPATAA
FT                   EAHAATEADAARQRVGGASARMQDPATPAAGAEQVAEDRALKAMESRVAQLEKSLVEMQ
FT                   HQLELKNAELARVAASAPPLPAASTPAPSAEAPSSAPATQAPAPAAPAAPIETTAGASA
FT                   PVAEASAPAAAPEQAPVAAAAQPRARKASWFSSLPGNLMALGLVALLGGWAVYRRRQQT
FT                   PVPAHGFQNSLLSRENTVIANTNSLFGPAGGQSIDTSQHSVFGADFRVGGGGGESNDVD
FT                   PIAEADVYIAYGRDVQAEEILRETLEQQPERMAIRFKLLEIYANRQDAHGFQAIAEAML
FT                   TRVGAASPEWAGAAALGRTFDPDNPLYLTVQGDAPPPQADAAPEPIAPVPQADTAAAET
FT                   PKPAVAEDDLPRPSNALVPQDQDTAPSAPPAKAQPSTDLELLP"
FT   gene            166197..166985
FT                   /locus_tag="RPSI07_mp0142"
FT   CDS_pept        166197..166985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0142"
FT                   /product="conserved membrane protein of unknown function,
FT                   DUF81"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34501"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34501.1"
FT                   /translation="MAHHVVLTGLTNLLLGMGLGVAGGLLGIGGGLIAIPILGYLYGMD
FT                   QHLAQGTALVMIAPNVLIGFLRYHQRHPVPLRSVATLCAFAMVSTYVAARFAAGLDADH
FT                   LHTAFAWFLIVLAVYFASQLRDKAHPDPAAGHPAPEAPRAVPPAALPLLGIASGGMSGI
FT                   FTVGGGLVVVPALVTLFGMSQTRAQGMALALVVPGSLIALATYAQAGHVSWGTGIPLAL
FT                   GGMASVSWGVALAHRFSPLRLRLVFCAVLVGAAVAMLVGG"
FT   gene            167349..168260
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0143"
FT   CDS_pept        167349..168260
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0143"
FT                   /product="fragment of putative type III effector protein
FT                   with ppr repeats (part 1)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="PSEUDO:CBJ34502.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            168361..171558
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0144"
FT   CDS_pept        168361..171558
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0144"
FT                   /product="fragment of putative type III effector protein
FT                   with ppr repeats (part 2)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="PSEUDO:CBJ34503.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(171651..172772)
FT                   /locus_tag="RPSI07_mp0145"
FT   CDS_pept        complement(171651..172772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0145"
FT                   /product="putative
FT                   3-oxoacyl-[acyl-carrier-protein](Beta-ketoacyl-ACP synthase
FT                   III)(fabH)"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="2.3.1.41"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34504"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34504.1"
FT                   /translation="MHDVVISGTGLWVAPEVITNEELVASFNAYARRYNEANAAAIAAG
FT                   ELAAVAESSVEFIEKASGIRQRYVIDKEGVLDPARMRPRLAPRGDDALSLQAEIGVAAA
FT                   REALAAAGRDAGDIDMLICSAANMQRPYPAMGIEIQDALGAGGYAFDMNVACSSATFGL
FT                   EQAINAVRTGSARVALMVNPEITSGHLAWKDRDCHFIFGDVCTAVVVERAEDARARDQW
FT                   RVLGTRMATRFSNSIRNNAGFLSRSEDRNPDDRDQLFRQEGRKVFKEVCPMAAEHIAGH
FT                   LQSLGHAPADVRRFWLHQANLGMNQLIGKRLLGRDASADEAPVILDEFANTASAGSIIA
FT                   FHRHRGDLQPGDLGLICSFGAGYSIGSVAVRKR"
FT   gene            complement(172898..173218)
FT                   /locus_tag="RPSI07_mp0146"
FT   CDS_pept        complement(172898..173218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0146"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34505"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34505.1"
FT                   /translation="MTKDALHAFLTTRFDLVTDPAERGNGRAYFLGRVVWHPASTTRVL
FT                   HVTCGADERVSHIRLCDSSDNNHSVFVPLPVTWPELRRIVADEIARHVRRSTAREARDR
FT                   HA"
FT   gene            complement(173291..174253)
FT                   /gene="pip"
FT                   /locus_tag="RPSI07_mp0147"
FT   CDS_pept        complement(173291..174253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pip"
FT                   /locus_tag="RPSI07_mp0147"
FT                   /product="Proline iminopeptidase (Prolyl aminopeptidase)"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.11.5"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11011150, 8870654; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34506"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34506.1"
FT                   /translation="MPELRTLYPAIEPYASGQLDVGDGHVVYYERVGTPGAKPAVFLHG
FT                   GPGGGVSADHRRLFDPARYDVLLFDQRGCGRSTPHAGLEANTTWHLVDDIERLRELAGV
FT                   ERWLVFGGSWGSTLALAYAQKHPRRVSELVLRGVYTVSQAELDWYYQYGVSEMFPEKWA
FT                   HFQAPIPEAARGNMIAAYRKLLTGSDPQQQIEAARAWSVWEGETITLLPDPSNSAKHAE
FT                   DHFALAFARLENHYFTHRCWLEDGQLLRDAHRLAGIPGVIVHGRYDMPCPVRYAYALHQ
FT                   AWPDAAFHLIEGAGHAWTEPGILDQLIAATDRFAASHGR"
FT   gene            174369..174989
FT                   /locus_tag="RPSI07_mp0148"
FT   CDS_pept        174369..174989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0148"
FT                   /product="putative chorismate mutase"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="5.4.99.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34507"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34507.1"
FT                   /translation="MALRHRHALDMKNTLKRPGLRQTAALACALWLTAGCAATGTGAQE
FT                   SAFAPLVRGLADRLTTADQVALSKWDTGQSVYDPEREAKVIANVSGLAPSYGLTAEDVS
FT                   SVFADQIEANKTVQYALLNGWRRDGAAPSGSRQSLRDVIRPRLDKLQVSILEGLRDTAS
FT                   LRRAPDCQTQAAIAVGQVAREQSLDALHRIALDRATARLCVKR"
FT   gene            175586..175741
FT                   /locus_tag="RPSI07_mp0149"
FT   CDS_pept        175586..175741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0149"
FT                   /product="putative transmembrane conserved protein of
FT                   unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34508"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34508.1"
FT                   /translation="MMVLPFLILFIGLCGILRGHRKIGLGLWALGVAAVLVLFRMHATS
FT                   TLNIVL"
FT   gene            175784..176335
FT                   /locus_tag="RPSI07_mp0150"
FT   CDS_pept        175784..176335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0150"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34509"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34509.1"
FT                   /translation="MSSSLSVRLNTAGLFGVSAILLYAFVHQLVLHDLPCPLCLLQRGC
FT                   FIAAGVGLALNLRFGSRPAHYALMILASLAGAVIAGRQILLHIVPGTGTYGEALWGLHL
FT                   YTLAFIAFSVMIAGTAVMLFLERSSEADEGPALVPPSRAALTAVVLLAVLTLGNVVGTF
FT                   LECGGGMCADDPVIYELLGR"
FT   gene            complement(176471..176965)
FT                   /locus_tag="RPSI07_mp0151"
FT   CDS_pept        complement(176471..176965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0151"
FT                   /product="putative acyl-coA thioester hydrolase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34510"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34510.1"
FT                   /translation="MNTQSHQLSMTVLMTPDMANFSGNVHGGHILKLLDQVAYACASRY
FT                   AGRYVVTLSVDQVVFRQPIHVGELVTFLASVNYTGRTSMEIGIKVVTENIRSKVVRHTN
FT                   SCYFTMVAVDDDGKPADVPPLTPANAEEKERFEAAQQRRTLRQEMEQRHKAIKAAYSAV
FT                   N"
FT   gene            177185..177976
FT                   /locus_tag="RPSI07_mp0152"
FT   CDS_pept        177185..177976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0152"
FT                   /product="putative Phytanoyl-CoA dioxygenase"
FT                   /function="3.2 : Degradation"
FT                   /EC_number="1.14.11.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34511"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34511.1"
FT                   /translation="MTSSASVLAQSHALDAEQQAFFHRHGYLILRALARPPECATLLAA
FT                   ARAALDNAVPPVELETDVGYAGAPASREAVGGHTVRRLLDADSRGTPFTDWARDARVVA
FT                   PIAQLIGAPVHLSLAHHNCVMTKHPAFGTATHWHRDSRYWSFARNELVSAWLALVEETV
FT                   DNGCLWVIPGSHTLDLPAGRFDDKLFLRQDLPENRELIDAARPVPLLPGDVLLFHCDTF
FT                   HAARANQTGAIKFSLVTTYYGTDNTPLPGTRSSARPDPRVG"
FT   gene            178097..178318
FT                   /locus_tag="RPSI07_mp0153"
FT   CDS_pept        178097..178318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0153"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34512"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34512.1"
FT                   /translation="MPIQEVVHGPHVILVDPLQRADHRWMARFQICRAGRVLCDWEDVE
FT                   MPEGFISPQLAISASVLLAEQRLSQLPH"
FT   gene            178550..179002
FT                   /locus_tag="RPSI07_mp0154"
FT   CDS_pept        178550..179002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0154"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0154"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34513"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34513.1"
FT                   /translation="MSTSSMPLRGARLAGAALALLQLGATASAATLTVTVEGARNRQGT
FT                   VRAALFRDAAHWLKPDGAARASVAALDSVTGDSVTFVYADLSAGRYALSVFQDANGDGK
FT                   LDTNPAGLPIEPYGFSRDVRGRFGPPSFDDAAIDVQGDQHVTIHLR"
FT   gene            178999..180582
FT                   /locus_tag="RPSI07_mp0155"
FT   CDS_pept        178999..180582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0155"
FT                   /product="putative carotenoid cleavage dioxygenase (ccd)"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="1.13.11.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34514"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34514.1"
FT                   /translation="MSATRPAMERRSFLTAAGLGLAAPFGLTLHDVMAMATESPDAWAA
FT                   GFAAARAERAWLAGFEGVSADLPPSTLTVEGRFPAALHGSLYRTGPARHQIGGLRYHHL
FT                   FDGDGMIQRYDIDARGARTRVTHRGVFVQTDKFVADTAAGRPVRGTFATLMPGMEPIDS
FT                   PDAINVANTSVVMRGDELLALWEGGSATRLDPDSLQTLGVKTWRADYAGMPFSAHPKVE
FT                   ADGTLWNFGVSSAAGLLTVYCVNADGTLRRVQSVRVPDIAMVHDFAVTERHLVFLLPSF
FT                   IYDVERARNGASFLDAHVWRPELGMRALVLDKNDAARMRWFELPAGFVFHVGNAWSSKD
FT                   GQRIHLDYVRSDDAAIVTTALRELMRGHIVHPAAPARLTQLTLDLRSGRAEQTVTPHAT
FT                   EFPKIDTRRTGLRHRALFCVANSASRPGADSPIGFDTLMRFDTESGRVQRYRFAQRALV
FT                   EEHLFVPARPDAPEGEGWLLGTVFDVEARRTLLTVFDARNVSAGPVAVAAREGVVPLGF
FT                   HGLFRSHMAA"
FT   gene            complement(180815..181162)
FT                   /locus_tag="RPSI07_mp0156"
FT   CDS_pept        complement(180815..181162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0156"
FT                   /product="Putative type III effector protein (fragment)"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10515"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10515.1"
FT                   /translation="MRALRSQAQTLHRRAVQELPNPRTDAASALLNSMFNLEADILRMN
FT                   PSAAQNQLTHLQSQLNNFYRTNPVSPDQFDQSDRFAISGQYDRFSDTASHASDIYQPDD
FT                   SFRYMGFRPGR"
FT   gene            complement(181722..183203)
FT                   /gene="amn"
FT                   /locus_tag="RPSI07_mp0158"
FT   CDS_pept        complement(181722..183203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="amn"
FT                   /locus_tag="RPSI07_mp0158"
FT                   /product="AMP nucleosidase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number="3.2.2.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2690948; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34516"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34516.1"
FT                   /translation="MTDTRASAHLYPAHDLAVCTDASTAVERITAIYERSAQTIRERFH
FT                   AFARGEDLDDDAPACYPYLGITVDPKTLVSDARPSWGTVAYPGVYGTTLTRPDLFREYY
FT                   RVQIERLLHYHNSPVVVGVSNRPIPLPFVVEASTIDITPEQARALGGAFPLPDLAQIDD
FT                   AIANGTYRPADNEPQPLSMFTAERVDLALQRLYHYTATHPKHFQRFVLFTNYQRYVDEF
FT                   AALGRKLMEEGNDEGYVRFVEPGDTVHELGTPAPDDSHRIKGLPQMPAYHLVRADRLGV
FT                   TLVNIGVGPSNAKTITDHLAVLRPHCWMMIGHCGGLRRSQQLGDYVLAHAYVRDDHVLD
FT                   QDLPPWVPVPPIAEIQVALQEAVARITGLSGSDMKARMRTGTVVSTDDRNWELKYQALY
FT                   TRFNQSRAIAIDMESATIAANGFRLRVPYGTLLCVSDKPLHGELKLRGMANLFYRQRVS
FT                   QHLAIGMETVRLLRENGVEALHSRKLRSFDEPAFR"
FT   gene            183586..185841
FT                   /locus_tag="RPSI07_mp0159"
FT   CDS_pept        183586..185841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0159"
FT                   /product="putative type III effector protein (Hlk2)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34517"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34517.1"
FT                   /translation="MPRGNITGRHIQGISTPPAPTPTPTVAGTSADASLSTGRPPVARS
FT                   TELEGLARLSVSESPAAASVSIQPQRGPVPLCVKFAQALQTPQAKAVQRAQNYGLVWRK
FT                   LANTGQADTDQQLDLARHGVQSADAGLDALGWLAKQSLITNAHEVRGELLVHLAEAAMA
FT                   GVKAYHQVVNTDMEDSSEAESDEPDESDESLAFSDAVMFAERMSADKQLKQDWADSPMQ
FT                   ELRNYRSVLDNIIDCSKPKPAGRPTETQAMLKDYVPAVTSSQARCRSAMQTLNAMNIMS
FT                   GALRLIPLIARAALPDLDDRVRDLLDAMNHRHDEVQAAMSALDAQAFWYPGAQDVARPE
FT                   PLPARVLAGHKALIREHSDRLDRVGERLCVDAAARIEKNDATALWQTMMDVAHVTTAYG
FT                   ACLREQCQSVRGGQPAPAATSGTSMEAPVSKPEASSPVPAPASGAPDRTRSKRGKPPAQ
FT                   PVHAAPAPVLSQPDSRTAEQKAADDLLKRCQVDLETAAWFHGDLVAVACAFGKDTSHIE
FT                   RLMNDPKRDAVVVATSARSQARDWFGTREHLEQAQGRLSADDPRHQRLTDRIRALDLIG
FT                   RYVDVWEADVAKCALHPKAKYLERLLDLGEIDRIDAPNQLRSSRNKRIRDRVFEIRIQP
FT                   RRLSSRDADADPGGDAGKRDERYRAWPLFVHLHTSRQVGAGELHKLKFRDVDAAHLKSD
FT                   AQKNLGPNWERAMHELGYADAKVERSEVSFTLLSRLLAFARRDEGSAGAASSAAEAR"
FT   gene            186192..188438
FT                   /locus_tag="RPSI07_mp0160"
FT   CDS_pept        186192..188438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0160"
FT                   /product="putative type III effector protein (Hlk2)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34518"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34518.1"
FT                   /translation="MAGGKVTERSIQGPADPVASPPPGAGTSTDAGQRAGRQPLGRPAE
FT                   LEGLSTRPASAPPAAPVAAFPLRRAVLPLLPLAAETLQTEPAKQVDGALRYGATWRTLV
FT                   HDGRASTEQRLNLARTGVKHAEAGLRALASLSEQGCLTNDDALRGELFNHRAEAAMAGI
FT                   QAYHRMLNEEWDAHAQGRGVHSDASAPAAFDGIRELLTRGQFQDAKLELKRYRAVLDTF
FT                   VEHCKPGGAPHPLQARLESNLLAVMAGRARCRGAMQSVNVLGIASCAYSLSRLALAMRL
FT                   PDLAARVAALLAAMRHQRDEVAVAVHTLDALAMWHPGAEGEAPPDRPTRPQLAACKGLV
FT                   RAFRDRLDRIGTHLCMDAAARIEMNDATGLWKAMLDVAQVIADYRANLDALCESVRGAD
FT                   FEPATPSSGEDGPGSASEPQPVATMPVPAATIEDRHPVEHGKQPVARPALAAPAPVPRP
FT                   PDSRTPAQREADDLLRRCQVDAATVSQFRGDVVAIADAFGKDASDLERLMNDRDRSAAV
FT                   TATAMRTSVESWFGKRERLEKAQRGLSAEDPRIGLLTDRLRALDMIGRYVDVWEADASK
FT                   RALVPKAKHLERLLAMNEVEQVDAPVRLRSSRDKRNRDRVFEIRIQPKPLSDRDQDKDE
FT                   DKADDRDRARPMFVHLHTSRRIGADALHTLDYRDFDAVHLKLDAQKNLGRNWEEVMRAL
FT                   GYPDMKVERSKVGSELLSRLFALAGRGAASTSAAAGRAGRIEASPGGRRPGGGS"
FT   gene            188713..190923
FT                   /locus_tag="RPSI07_mp0161"
FT   CDS_pept        188713..190923
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0161"
FT                   /product="putative type III effector protein (Hlk2)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34519"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34519.1"
FT                   /translation="MAGGKISGLHVRATAPAPANAGAPEPQQTPEPQQPGGRRVARSAE
FT                   LEGLAALPSPQAPASPVSAGQMRRAPLPLPAPAAEVPLEPLPAPVAEAPLDAAVIAEKK
FT                   AVETALKRGAIWKKLGGGAEMTAVRQLKLARDGLVSAKAGLAALDQLTKHAVVDEADEA
FT                   RAELMGYLAMAAISGIETYKRVLNEALKLERPQPRHASAQRESVSGPAFLRQQASLDDM
FT                   AAIFDELKGYRDALDDYMRLCQAPGTPSATRVSMEAILPAVLSNRAMQNEAVRIASAVV
FT                   VADSSGRLSRLAKQVTWPEFQQRVGELKAAASHGGEALSEAIGSLEVAADVGARHAGGA
FT                   LTQHLTPEKLAEYKAMAAEYGEGLHRVGVRLCLDAAARLEMDDTSDLWRAMLDVAHGIS
FT                   AYRTSLQALCDSVSTGKAPSRARSKTKGQAASPAQEPSSARLAEAPGASRKPRGKGNRS
FT                   AGSTSAAGKASAARDRRTGAQKHADTVLNGFPVDLKTARQLRGDIDQIAAALDQDVGEI
FT                   EAARKNPRYNAVQAADAIRELARKWFGEAERLSEAQTSLPRTDARSGQLADRLQALELI
FT                   RQRLDIQEADEIKRDALPWDQHLERLLQRGEIEHVSAPIRLPSEGDIGHQGTLFEMRIQ
FT                   PKPCSNEEQVAPWFLHLHTSELASAEGLHTLESDKFKAVHMKTSQEKNLGRTWEMLMRA
FT                   RGRFDAKVHRAPIGHALRDELFARVQVESASGRAVADPARAH"
FT   gene            complement(191374..193893)
FT                   /locus_tag="RPSI07_mp0163"
FT   CDS_pept        complement(191374..193893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0163"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34520"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34520.1"
FT                   /translation="MTTVRFAPSCPEKPFELSREELSRKLSRLNVNLKVPPPCESELHF
FT                   GFFFDGTRNNSDNDRPRKAHSNVARLFDLFDVERKRTELRQHRFASYAAGVGTPFYKEV
FT                   GDLGIGIHAVAGAAAGWGGEARINWGLLQLHNHLHAHYHDLPLTDRPADRELVKQMSAD
FT                   LNAPEIQLSNIGSTTIERELQGKYRAKGELDRDLRAGVGSLASLTAVARTNWREVNTKG
FT                   RRRVLNERKAALAKALGNLPKERKPIIKRIRLYVFGFSRGSAQARVFCNWLRDACDANG
FT                   DKLSLCGIPVQIDFLGLFDTVASAGMAQSMIETMVSGHGAWAQKRWMRIPGPDLVKRCV
FT                   HLVSGHEVRGSFPLDSAQGSNVEEFVYPGVHSDLGGGYEPGEQGRGCRIDWTPDDSAKP
FT                   SQIPLSHMYREAVISGVPLMSPSDATAELQKQFRVDPDLIKAFNAYRDATANTSAATTP
FT                   ALIHHHYGYFLRWRHRWLGKVASMPSVQHSEKTDQVDLLTADAELAEELKWVKRYANYQ
FT                   NLVPNWAKGHYTGWVMEGAQWSAETGATTLGALMAGVAGVGGRPALQNAVPEAPGGSVA
FT                   WIPAVGAVQGATLFYRAKQAIGIKFDSWGAVKQAWENPEVPDAVDTFFSRYAHDSRAWF
FT                   KPMGDDNDVWYRKQQRKLDAAAAKDAALRNPPPVKINAMTAKVGVPPPPPLTAEEQSLL
FT                   QLQTRLKQQRDAKGQTEEDALKDPAYTAQLPQQTSGRELWQMWGFLRWRTVYDDKYMDY
FT                   RAAYPQLAGLDASALKQRMKALDSQFKQQRTRSEAVGKALGQMASSGSVPQDLYIEFGG
FT                   LQQGLLATEEEMAAITAFMEDLDNGEP"
FT   gene            complement(193943..194530)
FT                   /locus_tag="RPSI07_mp0164"
FT   CDS_pept        complement(193943..194530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0164"
FT                   /product="exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34522"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34522.1"
FT                   /translation="MGLKMNTKTLKRLCAAALAGTLLGLAACSKAEAPKAVAVEEDDTL
FT                   GGYIGVLNYTDIPIGVVYVNGQWAGGMVANAGGTKWIGNISVPKQWDPNFKVTIRWSDD
FT                   ELFKKDENALYTKEVPVEKYPPTGGAYFYVAFYPNHEVKLYLTRGLPGYKGDPYNLEDP
FT                   KDACLKRRAEKDRDLCYRPDLRTPATSDVQAK"
FT   gene            complement(194756..195295)
FT                   /locus_tag="RPSI07_mp0165"
FT   CDS_pept        complement(194756..195295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0165"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34523"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34523.1"
FT                   /translation="MLLGLAACSKAEAPKAAAVEEDDSLGGSIGVLNYTDIPIGVVYVN
FT                   GQWAGSMVPHAGGTSWAGSISVPKQWDPNFKVTVKWSDDELYEKDKKALYVKEVPVEKY
FT                   PPKGGSYFYVAFFPNHEVKLYLTNWLPGWDGDPYHLEDPTEACLKRKAPQDRETCYAPE
FT                   YREEYRALQKQREQRQ"
FT   gene            complement(195581..196165)
FT                   /locus_tag="RPSI07_mp0166"
FT   CDS_pept        complement(195581..196165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0166"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34524"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34524.1"
FT                   /translation="MNATTMKGLVAAALAGLLMGLAACSKAEAPKAAVEEDDSLGGAIG
FT                   VLNYTDIPIGVVYVNGQWAGSMVPHAGGTKWIGSVSVPKQWDPNFKVTVKWSDDELYEK
FT                   DKKALYVKEVPVEKYPPVDASFFYVAFYPNHEVKLYLTKWGPGAADDPYHLEDPTEACL
FT                   KRKAPQDRETCYASEYREEYRALQKQREQRQ"
FT   gene            complement(196172..196339)
FT                   /locus_tag="RPSI07_mp0167"
FT   CDS_pept        complement(196172..196339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0167"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34525"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34525.1"
FT                   /translation="MTTVRFAPSCPEKPFELSREALSRKLSRLDVNLTCRLPAKKPCTL
FT                   KTVLSFAVTG"
FT   gene            complement(196389..196964)
FT                   /locus_tag="RPSI07_mp0168"
FT   CDS_pept        complement(196389..196964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0168"
FT                   /product="exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34526"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34526.1"
FT                   /translation="MTAKTMRGLVAPALAGLLLSLAACSKAEAPKAVAVEKDDTLGGYT
FT                   GVLNYTDIPIGVVYVNGQWAGGMVANAGGTSWAGSISVPKNWDPNFKVTVKWSDDELYE
FT                   KDKNALYTKEVPVEKYPPTGGAYFYVAFYPNHEVKLYLTRGLPGYKGDPYNLEDPKDAC
FT                   LKRRAEKDRDLCYRPDLRASTASGAQAK"
FT   gene            complement(196971..197870)
FT                   /locus_tag="RPSI07_mp0169"
FT   CDS_pept        complement(196971..197870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0169"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34527"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34527.1"
FT                   /translation="MYLAIDPCHPDTWLNGLLQTIESAPDAHWYALVDGVFDYGGKPFA
FT                   SSVQSVPLYGPASTLHALLPASPYLLPLNRRAGADQRALITALGMHCQGRPMLSFLASR
FT                   QPADELVRLWLPCLQPVVADDGSRYLLRFADTRVLPALPGALNPAAWAQLTAPLMHWCY
FT                   VDRAGTLATLRLAEPHAEPAAYPSEPLVLPQSDIDRMIDAAMPDAVLDLMDRESPGVLP
FT                   AEGKAEAYRRVAQACALAKAHRVDATPDIVQLAICSLATGGAGLRAPELLALLGDSHRA
FT                   PDALQDYLHSALSSARPG"
FT   gene            complement(197892..200771)
FT                   /locus_tag="RPSI07_mp0170"
FT   CDS_pept        complement(197892..200771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0170"
FT                   /product="conserved hypothetical protein; VGR-RELATED
FT                   PROTEIN"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11136451, 9696756"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34528"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34528.1"
FT                   /translation="MDIKTLLQNLFAPAHRLYALEGEGPLAELAVEGWLGREALSELFE
FT                   WRVVAVSANARIALDSLIGQRVTLVTTLADGTQARRTGLIRLAEQLGADGSLLRYQLTV
FT                   VPWFWLATQQRHSQVFQNRPLADLLEQVLAPYAPYAAWRFAAGAEDRMSAFGTRSHIAQ
FT                   FRETDYHFVTRLLAEAGLGFTTVEDEQAPSGHTLLIFADSAQLAEDTGSAADGGIRYHR
FT                   AHSQEERDAIQQLICHTRTSVGGVAVVAWDAQAKRAIRGHAPSRFGGIAGSPDAYLSIS
FT                   PSLAPNAANAQRIAEQVMESVEARVRLFTGRGTVRTLRSGTRLKVRDCPHLPQDVDGPY
FT                   PLLMDLVEHCGINNLTADTQAVLGQKLGGLEAALTFDTPPSPPESGPGPFGFVGLDEPV
FT                   ERLSPTIDLLTAARAHGYAGEFRACDARRPWRAVVAHSNTGRLYSEPTAKGVHSAIVVG
FT                   PNGETQASGDGEHHTNPQGQIRLRFPWQQGERPDDRSSRWVPVAQRQAGAGMGWQWLPR
FT                   IGQEVLVKFQEDDIDQPVVIGALYNGQGEAGIAPTPGGQAARGQSRNDPAALYRLGSDS
FT                   ASSAQGNLADGHSPAWHGMGTEAEGHRNAAAHSGFKSAEHGGRGSNQLVFDDSDGQLRT
FT                   QLATTQAASQLNLGHLIHQQDNRRGSFRGQGFELRTDGYGAVRGQAGLLLTTYRDAASG
FT                   KAVPTGDNAAGIALIKQAKQLTSSLSQGAATHQTAALSTGKDDNAPLARQEKAASGMVD
FT                   GKALDTAQQDASAGNTSTQGKVPHQGEAMVQLAGRAGLMMVAGQDLQMANGESLALASG
FT                   QDTNLAVGKQARVHAGQGIGVAAGLSKAGDDNIGLQLTAGQDHIDVQAQHDVLKLMAKG
FT                   DLKLVSANLHVDFAGAKRIRIATAAGASITLEGGNITVECPGPITYKAAQRSFRGPVNS
FT                   PYPLPAFPQSVCLECLLKAAAAGAPVASV"
FT   gene            complement(201197..202615)
FT                   /locus_tag="RPSI07_mp0171"
FT   CDS_pept        complement(201197..202615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0171"
FT                   /product="putative two-component sensor histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34529"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34529.1"
FT                   /translation="MSPLPWLADDPMYALLPAFVSSLFLFYGIYVLMTRGRARAGLAFF
FT                   GVTVLTCLWQGLWAFLFEASDVATARVLTKLGWVAILPLPTVLYHFAVEVAERPDDHRW
FT                   LIASYALAAVLVVLLLSSDLVIDGVRRFSFGFYPKAGPLEAVHIAQTTALVLRSIWLLY
FT                   AGQRHATAEKRRHLQLCLCGVALYSLSAADYAVTYGLAPYPPGVIVIAGSPVIMAFAII
FT                   QFDLMRPCALAATVAHEVSAPLATIRLQAAEIARAWPDLLHGYRLAVDPGLCEPPPHPA
FT                   TLERLPGPAGAIAAEVASTHSAIDMALASATLERLDQRTFAPHSLHACVDMALTRYPFQ
FT                   YGERDRVRVQAFSADWHFVGSDTLLMHVLFNLLKNALYAIQIARKGHIEISAWPDGDSY
FT                   VLAIRDSAMGIPPSVQRRIFDPFFSTKPADKGSGVGLTFCRRVMEAFGGRIQCESVVDE
FT                   YTLFTLRLPRQSAA"
FT   gene            complement(202793..203707)
FT                   /locus_tag="RPSI07_mp0172"
FT   CDS_pept        complement(202793..203707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0172"
FT                   /product="putative transcription regulator, LysR family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34530"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34530.1"
FT                   /translation="MLPKRLDLNLLGVFQAIYQTRNVTLAAKRHNITQPAMSNALARLR
FT                   EVFADPLFVPSPYGMRPTPYAQQLAVPIERALREVEQALAMSKGFDPASSDREFRMHLT
FT                   DFAQVAFLPALLERLRALAPRVVIRVEALAEEAILPALDEGRLDFAFGRMSKAAGQGVG
FT                   RYTLFKDRYAVLMRAGHPLAGAALSRQDFVASGQALVCTSGHQAIEDVLVKMGARIALR
FT                   LPSFLVVSRIVETSDFMVIIPARLAEQCAATGLFRVAALPIAMPAFDVSLFWSESRSAD
FT                   PAHAWMRGLLQQLFGQRDAALSA"
FT   gene            203831..204859
FT                   /gene="vanA"
FT                   /locus_tag="RPSI07_mp0173"
FT   CDS_pept        203831..204859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vanA"
FT                   /locus_tag="RPSI07_mp0173"
FT                   /product="Vanillate O-demethylase oxygenase subunit
FT                   (4-hydroxy-3-methoxybenzoate demethylase)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="1.14.13.82"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34531"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34531.1"
FT                   /translation="MFLKNAWYVACTPDEIADKPLGRRICGERMVFYRGQEGKVAALED
FT                   FCPHRGAPLSLGFVRDGHLVCGYHGLTMKADGKCASMPGQRVGGFPCIRQFPVVERYGF
FT                   IWVWPGDPGQADPALIHHLEWAESKAWAYGGGLYHIQCDYRLMIDNLMDLTHETYVHAT
FT                   SIGQPEIEEAAPQTKVEGDAVVTSRFMENIMPPPFWATALRGAGLADNVPCDRWQICRF
FT                   TPPSHVMIEVGVAHAGQGGYHAAPEHRVGSIVVDFITPETETSIWYFWGMARNFRVDDA
FT                   ALTDTIRQGQGKIFSEDLDMLESQQRNLLTYPERNLLKLNIDAGGVQSRRVLERLLERE
FT                   QQ"
FT   gene            204871..205815
FT                   /locus_tag="RPSI07_mp0174"
FT   CDS_pept        204871..205815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0174"
FT                   /product="putative vanillate o-demethylase oxidoreductase
FT                   protein (vanB)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34532"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34532.1"
FT                   /translation="MQVILRDKAEAAQDIAMFELAAPDGGTLPPFTAGAHIDVQVAGFV
FT                   RQYSLCNSPAETHRYRIGVLRDAQSRGGSAAMHALAVGATLEISAPKNHFALAPGARHS
FT                   ILLAGGIGVTPLLAMAEQLAADRASFALHYATRSPERMAFRDRLAAAHLAPHTRCYFDN
FT                   APAAERLDLAAVLSRPGEGTHLYVCGPGGFIEAALDQARALGWPEANLHREYFGAAPSQ
FT                   PAAGEDGTFRIRLAQRGETVQVGAGETAILALRRCGIDWPTSCEQGVCGTCLTQVLEGE
FT                   PVHQDHYLTDEERASGCFLPCVSRAKGLLVLDM"
FT   gene            complement(206025..207068)
FT                   /locus_tag="RPSI07_mp0175"
FT   CDS_pept        complement(206025..207068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0175"
FT                   /product="putative transcriptional regulator protein,
FT                   LacI-family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34533"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34533.1"
FT                   /translation="MSHRFLIKEIALQAGVGVATVDRVLNGRAHVREHTRKRVEQAIRE
FT                   LEKQALQLAMAGRKLIVDVVVEAPSRFANEILDALEAELPGLHPAVFRPRFLMRETMTT
FT                   EEVVGALQAIGRRGSHGVFLKARDTPEISNTIGDLQRQGIPVVTMFTDIPLSGRIAYAG
FT                   PDNRIAGATAAYLVGQWLGKRPGNVLITMSDERFRGEEEREISFRRALRTRFPQLTLVD
FT                   ASGGHGLDDPTGERVRSVLAKHADIAAVYSMGGGNLAILRALQTKQRYPACFIGHDLDR
FT                   DNVRLLREGKVQVILHHELRQDMRSACQQVMCFHKLLPAAAVSPSSSVVVVTPENIPEP
FT                   IASRFRQ"
FT   gene            207169..208365
FT                   /locus_tag="RPSI07_mp0176"
FT   CDS_pept        207169..208365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0176"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34534"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34534.1"
FT                   /translation="MNRSEEHPERWGQDWYTERGCSLDAFGRLVERHANTPLRFTEEVC
FT                   QKIPLYDCRTLLDVVADAPRRAALQAEWASVLRDGAGVLVLQRAFVDVAPVDEATAVFE
FT                   SIIRIEHANGNGAGDHFAKAGANDRIWNAQEKLCLQAPDVFTRYFANPMLAAVAGAWLG
FT                   PGYQMTSQVNVVRPGGQAQLAHRDYHLGFQTAQDAQHYPAHVHRMSAFLTLQGAVAHSD
FT                   MPVESGPTKLLPYSQRYAEGYLAWRRPDFREYFESNFVQLPLAKGDALFFNPALFHAAG
FT                   ANRTGDVQRMANLLQVSSAFGRAMETLDRRRMCQAVFPILRESRVAARMTGTEIDAVIA
FT                   SCAEGYPFPTNLDRDPPIGGLAPRSQQAVLRQALDENWSDATFGEALREHDWRRRAAA"
FT   gene            complement(208533..208997)
FT                   /locus_tag="RPSI07_mp0177"
FT   CDS_pept        complement(208533..208997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0177"
FT                   /product="putative transcription regulator protein, MarR
FT                   family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34535"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34535.1"
FT                   /translation="MKKTSQPKPRAAGKPTGIAYLIGRLDHVLSRRLRDSLLPLGLTVP
FT                   QYTTLSFLSTQGQLSNAQLAERSLTSPQSVNEMVKMMEGRGWIAREPDPSHGRIINIRL
FT                   TGEGQALLDRCDIAVAQVEKSMLAEMDPAEREQLHQQLRALVRILSAVTV"
FT   gene            209150..209983
FT                   /locus_tag="RPSI07_mp0178"
FT   CDS_pept        209150..209983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0178"
FT                   /product="putative enoyl-CoA hydratase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34536"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34536.1"
FT                   /translation="MATYAGRWNTVKVDVEDGIAWVTLNRPDKRNAMSPTLNREMIDVL
FT                   ETLELDTDAQVLVLTGAGESWSAGMDLKEYFRETDGQPEIMQERIRRDCSQWQWKLLRF
FT                   YSKPTIAMVNGWCFGGAFSPLVACDLAIAADDAVFGLSEINWGIPPGNLVSKAVADTMG
FT                   HRAALYYIMTGETFTGREAAEMGLVNQSVPRARLREAVTELAGKLLAKNPVVLRFAKHG
FT                   FKRCRELSWEQNEDYLYAKVDQSNHRDPERGRQHGLKQFLDDKTIKPGLQTYKRA"
FT   gene            210081..211535
FT                   /gene="vdh"
FT                   /locus_tag="RPSI07_mp0179"
FT   CDS_pept        210081..211535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vdh"
FT                   /locus_tag="RPSI07_mp0179"
FT                   /product="Salicylaldehyde dehydrogenase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.65"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34537"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34537.1"
FT                   /translation="MFESQLLIGGNPRAASGGATYDRINPGTGDIASRAAAASPADADA
FT                   AVQAAHAAFPAWSATLPGERRRLLLKAADVMERRAGDFIARGVAEAGGMPGWYGFNAAL
FT                   AAGMLREAAGMTTQVGGEVIPSDVPGSLAMGMRQPCGVVLGIAPWNAPLILGTRAIAMP
FT                   LACGNTVVLKASEICPALHSLIGAVFEEAGFPAGVVNVITHAPADAPAIVERLIAHPAV
FT                   RRINFTGSTRVGRIIAGQAARHLKPVLLELGGKNPLVILDDADLDAAVQAAAFGAFFNQ
FT                   GQICMSTERIIVDQAIADRFVERLTHKATGLRAGQPGQDGAVLGGMVDAGAAQRIRHLV
FT                   DDAVGKGATLRTGPLQIDGNIVQPAVIDGVTPAMALYGEESFGPVVTVLRAADDEEAVR
FT                   LANDSEYGLSAAVFSRDIARAMQVARRIESGICHINGPTVHDEAQMPFGGVKASGYGRF
FT                   GGKAAIDAFTELRWITVQTGERHYPI"
FT   gene            211551..213422
FT                   /gene="fcs"
FT                   /locus_tag="RPSI07_mp0180"
FT   CDS_pept        211551..213422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fcs"
FT                   /locus_tag="RPSI07_mp0180"
FT                   /product="coenzyme A ligase, putative
FT                   long-chain-fatty-acid--CoA ligase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="6.2.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34538"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34538.1"
FT                   /translation="MHMESMKQATARYRPVSIGAGAVQVRRGEGGTWHLRSAEPIGAYP
FT                   ARMTDCLVRGAGQYPDRVLAAQRGADGQWERITYAQMLRRARGIGQALLGRGLSPERPL
FT                   LILSGNDLQHLQLALGAMYAGIPYCPVSPAYALVTQDYSRLAYLVRHLTPGLVYATDGT
FT                   LFASAIQAVVPPETEIVTDHGEVEGRAATRLASLLDTEPVDVDAANARVGPDTIAKFLL
FT                   TSGSTRQPKAVTTTHRMLCSNQQMLLQTFPCFGEAPPVLLDWLPWNHTFGGSHNVGIAL
FT                   YNGGSYYIDGGKPTPQAFEQTLRNLRDVQPTVYFNVPKGWEMLTDALERDPALRAHFYA
FT                   RVRLFFFAGAGLSQAAWDRLERVTETHCGERIRIMAGLGMTETAPSCTFTTGPVMMAGY
FT                   IGLPAPGCEVKLVRVDGKLEARFKGPHVMPGYWRAPELAAQTFDEEGYYRSGDAVRFVD
FT                   EARPEIGLMFDGRIAEDFKLSSGTFVSVGPLRARIISEGAPYVLDAVIAGMNRDDLSVL
FT                   VFPRLEHCATLAGLGAGASPAQIVDSPAVRACFAALLDRLNRAATGSANRIARLRLLEE
FT                   GPSLDHGEITDKGSINQRAVLGRRAALIDAIYAGGDGKVMLAAPAER"
FT   gene            complement(213446..215308)
FT                   /locus_tag="RPSI07_mp0181"
FT   CDS_pept        complement(213446..215308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0181"
FT                   /product="Putative transcriptional regulator"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34539"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34539.1"
FT                   /translation="MAQLPRISLAEVARSTGTVLSSAGSDRWSADSQPTLADISECLYF
FT                   SPGDGRIWLNDQRMLLLHSRAMGTLRRELIDSLGIDRARGLLTRAGYVSGAHDARLVCE
FT                   RWPDAEPSAIFIAGTRLHTLEGMVKVVPVSFSYEPENGRYQGEFLWHNSSEDDEHLEAY
FT                   GVGTSPACWLQLGYAIGYVSTLLGHLVIFREVECRAMGAGACRVIGKSAELWDDASDDL
FT                   RYLNAHDFVDSGMLAASAPEPAQPHNETPPSGIDRPPDERDAQDSPAAALVGASSAFNA
FT                   ACHLLRRVAPTDATVLFTGESGVGKERFARMLHQIGTRHDKPFIAINCAAIPETLMEAE
FT                   LFGVERGAYTGATHSRAGRFELAHEGTLFLDEIGTLSLVAQGKLLRALQEGEFERVGSS
FT                   RSLKVNTRAVAATNEDLAQAVREGRFRQDLFFRLNVFPIHLPPLRERRDDIPLLMSHFL
FT                   KSYAHKHGLAVRGFSPRAIKALLNYSFPGNIRELQNLVERGVILAQEGLVDLSHMFISG
FT                   ETLNQEVLSLAIAGEVGTLTHGREAPTPSAAPPYPATLLELVHDWGRHTQGASVSLPAL
FT                   EQRLLEEAVQRANGNLSSAARTLGITRAQLAYRLQRRGADAPEH"
FT   gene            215596..217074
FT                   /gene="xylC"
FT                   /locus_tag="RPSI07_mp0182"
FT   CDS_pept        215596..217074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylC"
FT                   /locus_tag="RPSI07_mp0182"
FT                   /product="Benzaldehyde dehydrogenase [NAD+]"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="1.2.1.28"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1989592, 7868591; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34540"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34540.1"
FT                   /translation="MNAPQAMRFLDDAQWDGLLFHGNWVPALRRQTLDVVEPATGRKLT
FT                   RVGLADAQDVDAAVQAAAAAQPAWVAMPPRERAKVFHRAAMLFEQHFDELALAIARETG
FT                   AALFKGEHEVREAITLCHVAAGMPLAAQGQVLASPAGRLSYARRAPFGVVGVISPFNFP
FT                   LFLTLRSVAPALAAGNAVVVKPDARTPVSGGYLIARVFAEAGLPAGLLHVLPGGAEAGE
FT                   ALVVHPRVPMIAFTGSPGVGRRIGELAGRHLKKVSLELGGANALIILDDADLDLAVSNA
FT                   AWGAWLHQGQICMASNRILVHVSLADELTARLVEKAQHLPVGDGASGQVALGPLIDQTQ
FT                   LQRVHAIVQDSVAAGAKLLAGGSYEHLFYRPTVLGGVRPGMRVFDEEVFGPVASIITFQ
FT                   DDDEAVALANDSQGGLAAGVISASVGRAMALGQRLRVGMLHINDQTVNDDCVNPFGGPG
FT                   IAGNGTSMGGPADWEAYTQWQWVTVKESAPRYPF"
FT   gene            217181..217948
FT                   /locus_tag="RPSI07_mp0183"
FT   CDS_pept        217181..217948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0183"
FT                   /product="putative 3-alpha-hydroxysteroid
FT                   dehydrogenase/carbonyl reductase oxidoreductase protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="1.1.1.50"
FT                   /EC_number="1.1.1.184"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34541"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34541.1"
FT                   /translation="MQLDNKTIVVTGVSSGIGAETARLLRFHGARVIGVDRNAPGTTLD
FT                   GYLQADLSTAQAIEAAVAQLPSRVDALCNIAGVPGTAPVDRVARVNYLGLRHLTERLLP
FT                   RMPEGGAIVNVASILGAEWPQRVEQHKALAGTAGFEAGAAWLEAHPVPQPTCYQYFKEA
FT                   LIVWTLTQSQPWFLQHAVRMNCVAPGPVFTPILGDFVTMLGAERVERDAHRMKRPAYPD
FT                   EIAPVIALLCADETRWVNGVNLPVDGGLASTYC"
FT   gene            218073..219020
FT                   /locus_tag="RPSI07_mp0184"
FT   CDS_pept        218073..219020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0184"
FT                   /product="conserved exported protein of unknown function,
FT                   predicted protein involved in meta-pathway of phenol
FT                   degradation"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34542"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34542.1"
FT                   /translation="MNLKTTLLAACLSACACTAWAYDQPSVNMGGTSFFDGAPLPGGPG
FT                   FYFVEYLSHYSASRMMDNGGNTAAFPPSQKFDVTVPVSQLIYVPEGAKWGNKQLGFQLL
FT                   LPWVAQARIDDGMGNAVLKGARGIGDLAAGVSLQFDPIMGEQGPLFSQRFELQVIAPTG
FT                   HYDRTAAVSPGSNFWSFDPYWAVTAWASPKLSFSGRFNYLWNARNNDPNAAFGNGATST
FT                   QAGQALHGNFAVEYEIRQGLVAGLSGYWLKQISDTRVNGVAVPGRREQVVALGPAAMVA
FT                   LSPKDFLFFNYYKEFAVRNRPKGDKFQIRYDHHF"
FT   gene            219083..220015
FT                   /locus_tag="RPSI07_mp0185"
FT   CDS_pept        219083..220015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0185"
FT                   /product="putative esterase/lipase protein"
FT                   /function="3.2 : Degradation"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34543"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34543.1"
FT                   /translation="MLDIQMQSLLQGMQQAGVPDMADLPPQAARQVYSRIMAAAAEPVR
FT                   AVHIADRTIAGPGGGLALRIYSPRQPDPQRGVVLYLHGGGFVVGTPRDYDSVASALCEQ
FT                   SGCVVVQADYRLAPEHPFPAPVEDAWAAACWVAAHAQELGAQPRIAVVGDSAGGNLAAV
FT                   LALLARDRAGPAIVQQTLIYPLVAARPETTGSYQRYGSGYTLTTRLTHYFHDLYLGGQP
FT                   AEGDPRLAPLAAPDVSGLPPALVMVAGYDVLRDEGIQYAHRLAQAGTPVTLVEYSGMVH
FT                   GFIGMAGALEAGRQALAQVADAVGRALAG"
FT   gene            220564..220806
FT                   /locus_tag="RPSI07_mp0186"
FT   CDS_pept        220564..220806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0186"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10516"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10516.1"
FT                   /translation="MKSLFPVPAAVPQAVLGALLGQQTRQITLETALASDNLVVERFTA
FT                   REAVSASFVLQVDCLSPSAHLDTVRLASHRKPRCA"
FT   gene            220806..223067
FT                   /locus_tag="RPSI07_mp0187"
FT   CDS_pept        220806..223067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0187"
FT                   /product="conserved hypothetical protein; VGR-RELATED
FT                   PROTEIN"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11136451, 9696756"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10517"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10517.1"
FT                   /translation="MLADGRRRAWHGYVVDCATLGGDGGLARYRLRIVPWLDRLHTRGD
FT                   CFVYQDKTALEIIEDLFADYPVAHYKLAVSQPCAKRSICCQYRETDYAFVMRLLAEEGL
FT                   SLRIEHEQSDERHDSSAQSRHCVVIFDNDAERPACAQPEIRFHRVDATERDDAIERLSL
FT                   TRTVGTNAVTVASWDYKALAATAAQATASDPGGELPTLEAFEASGPYRFANTEGASRAA
FT                   RLRMQAHEGAYLRYAGIGSVRQLGAGQRFTLTQHFDTRHSAFVTLSVEHEAANNLGADL
FT                   ARLLGTTAIESGSYRNRFVAVPAEAPIVPPYQRRPTAPEGQAAVVIADDGAPLTTDRDH
FT                   RVRICFPWLRAPSVNAFSDPAGSDRSQVTAWVRVATASAGPNWGAHHLPRAGTQVLLTF
FT                   VDGDIDRPLATQQLHNAQDALPWPAADAPLGQALSGWHSQNLGGDGYNQWVVDDHPAQL
FT                   RMRLASSAASSQLNLGYVVSHGPTGGERGEWRGTGAELRTDAWAVVRAGGGLLLSTTAR
FT                   AQAGGTLLDAKEARGQFIAAQRTAQRLSDAAASQQALPLAANEAFDPLTQALDPAQDGH
FT                   YPSRVNGQDATQPGSQSPVDKFAQPLLVAESPTSLALASQATTTVYAGRHLHGTAQGDW
FT                   HLAAGNVVAAAAAKGVSLFAQRNGIRVIAEGGSVSIQAHTDALAVMADQAVTVTSSTES
FT                   VEILAQQNIVLRGGDSVIRMEGRAITFETQKLSVKGAGHPLIGPGGGSPSASMGYRIAE
FT                   "
FT   gene            221846..223267
FT                   /locus_tag="RPSI07_mp0188"
FT   CDS_pept        221846..223267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0188"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0188"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10518"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10518.1"
FT                   /translation="MAARAVGQRLLRSGRQRPLAGHRLGTRGDRIRRPELGRPSPAARR
FT                   HPGAADLRRRRHRPSAGHPAAAQRAGRAALARRRCAARAGAVRLAFAEPGRRRLQPMGG
FT                   RRSPRPAAHAAGQLGRQQPAQPRLRGLARPDRRRARRVARHRRGAAHRRVGRGAGRWRP
FT                   AAVHHGTGAGGRHAARCEGSARPVHRRPAHRAAPVRCGSQPAGAAAGGQRGVRPAHAGA
FT                   RSGPGRPLPEPRQRPGRHPARQPITGRQVRPAAAGSGIAHQPRPGLAGHDHGLCGATPA
FT                   RHGPGRLAPGRRQRSGGRRGQGREPVCAAQRHPRHRRGRVGIDPGAYRCAGRDGGSSGD
FT                   GDLVHGVGGDPRAAEHRAAGWGFGDPDGGACHHLRDAEAVGEGGGASVDWAGGGQPFRL
FT                   DGLPDSRVKLFEQQIRAIDERTGDPIAHLPYKIVTEGGDVHYGTTDIEGKTIRVPTIKS
FT                   EKVTVFWGKSPPYNS"
FT   gene            224498..224875
FT                   /locus_tag="RPSI07_mp0189"
FT   CDS_pept        224498..224875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0189"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34547"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34547.1"
FT                   /translation="MSGQPNIFHSEGRDAVGSAKAPVNQDGGEGELKKGLGNTKTKGVQ
FT                   MSHQWIVHSIPKENLTPAGLALSKQVRRFFREYTMNPKTTPPYTRWIIMVTGRQKNLHE
FT                   QKQMHEIQNPVITIPDSILVK"
FT   gene            224879..225931
FT                   /locus_tag="RPSI07_mp0190"
FT   CDS_pept        224879..225931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0190"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34548"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34548.1"
FT                   /translation="MLPILPPFTGKELFVKRRDSMIDFSSYADNMDEVAQSYELVTPEV
FT                   IAKRIKEAEDPEEALTAVMGGTRQRSWDYLAGLHLQYSAGASLPSLREFFPILLSSWEE
FT                   YAKYDKAFDQTSRAGGRKVPHLDLYDDYYWFAIRLASFAICLGHTNLLPRVAALWDYEN
FT                   DDMDGLLERLAAPYVLGRGTPPDECTRHLPYFKTLKIFAAEPEQRPALMAKYLDEWYKA
FT                   SRREPYYDSHTKGRLHSYLGYWSFEAVAIVVELNIDDSSFRNKPFYLAELADFGRSFKS
FT                   GHGAGAAETDRLSLRCEAGQPCPKSGYWLTPAKAGSRKYFQQGEIMPDIASDYGSTIWQ
FT                   WDNDQSDPKL"
FT   gene            226086..227180
FT                   /locus_tag="RPSI07_mp0193"
FT   CDS_pept        226086..227180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0193"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34549"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34549.1"
FT                   /translation="MIVVSLDVLGMVADGQPWSEAQAMPQPNGPMTDVPANDPHFPKPR
FT                   PQLRVVPPPEVPAGGGGAAARAAGRGLAALLAEGGAVVLFAVVLVLIPGNAFQKNTEDE
FT                   DLRRMRAEYEKKRQLPIPLDQPQADATVDTTNNACKKQIEDNQKNGAVCENDGYVLMEA
FT                   ALKYKRLVNPPKGRGLDGLFEKLPALDQPNPMPQTVTQPKPGKLVFIPAGKRPPLPDYD
FT                   YVANELKKPAAPTYPKFVVFEAKHISKAFDATDTEGIKKETKNRLGNTCDGTQLGEKWT
FT                   EQRIPRALQRKDSGLTTAQQKAKQDEIGIHRYARWIFVCLPGFVGGVNSSKLYVLIDVV
FT                   TTGMNLESRPPKARNTQPTGGNEL"
FT   gene            226183..226359
FT                   /locus_tag="RPSI07_mp0192"
FT   CDS_pept        226183..226359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0192"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34550"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34550.1"
FT                   /translation="MYRPTIHTSPSPGRSYVSYRHPRFRLGAVVPQRGLPAVGWLHCWP
FT                   KVARWCSSLSCSY"
FT   gene            227191..228174
FT                   /locus_tag="RPSI07_mp0194"
FT   CDS_pept        227191..228174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0194"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34551"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34551.1"
FT                   /translation="MAFKDTRRQKFLSEKDYVANQDWFEDSVRRAQHILREQELIPSAK
FT                   SSFRWRIASDGLQLLILRYTAGRPIEELRAQLPAVIEDFDVYIANEISPRSANPPRNEA
FT                   DTLEITQLEAYVYVFWLLALCKLLGHDALIPKVMGWVDKTFEFNRGRDILFENVVQALT
FT                   GKHVETEKVLLHPLPYRPLGRATVYAPEERSALVKELVETWYKHMKPCYWHGTHTEGSS
FT                   YFGYWAFEAALVTVLWDIDDSSYRDHLVYPKDLVDWYRSRVDSVPDNRSPRTPAGQPCP
FT                   KEGWWFTPAVAGSRRFFKQGEVMPEVKSDYGSTFWQWDGEPAEPEL"
FT   gene            complement(228181..229089)
FT                   /locus_tag="RPSI07_mp0195"
FT   CDS_pept        complement(228181..229089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0195"
FT                   /product="putative hydrolase, Amidohydrolase 2 motif"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34552"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34552.1"
FT                   /translation="MPTRRAFNTGLLAMLGSTALAGCASSGMPDQAARITGIDTHAHVF
FT                   ERGLPLADARRYAPSYDATLPAYLAQLDAHGLSHGVLIQPSFLGVDNSYLMAALRQAPQ
FT                   RLRGVAVIDPAAPETFLAQLNTEGIVGIRLNLIGAPDPQLRSPVWQAALRRLHALGWHV
FT                   ELHAQARRLPTLLPPLLEAQIDVVVDHFGRPDPALGVEDPGFAALLAAGRTRRVWVKVS
FT                   GAYRNGDDGRGEAIALAAMPRLKEALGTDRLVWGSDWPHTQYESRIGYDRAWAFVDKLL
FT                   PDVRDRHQVLVDTPARLFRFA"
FT   gene            complement(229134..230390)
FT                   /locus_tag="RPSI07_mp0196"
FT   CDS_pept        complement(229134..230390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0196"
FT                   /product="putative muconolactone transporter; Major
FT                   facilitator superfamily MFS_1"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34553"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34553.1"
FT                   /translation="MFGWFKEISAGEKRTFWACFGGWALDALDVQMFSLVIPTIIAAWH
FT                   IGKTEAGLVSGVTLVASALGGWIAGAMTDRLGRVRMLQITVAWFSLATFASAFAQNFEQ
FT                   FLVLKAVQGFGFGGEWAAGAVLMAESIRASHRGKAMGTVQSAWAVGWGAAVLLYALTYS
FT                   LVDPDLAWRVMFAAGVLPALLIIYIRRGVREPVPAQTTAQADARPDGMPVSRFPLLDIF
FT                   RPQVLRMTLIGALLGVGAHGGYYALMTWLPTYLKTERHLSVLGTGGYLAVIIFAFWCGC
FT                   VASAWLLDVIGRRGNILLFSCCCVVTVLVYLLLPLSDGAMLVLGFPLGFFAAGIPASMG
FT                   ALFNELYPHGVRGTGVGFCYNFGRVVSAAFPVLVGKMSASMSLGTAIGIDAAIAYSIVA
FT                   VAVLMLPETRGRDLAAVTA"
FT   gene            complement(230529..233351)
FT                   /locus_tag="RPSI07_mp0197"
FT   CDS_pept        complement(230529..233351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0197"
FT                   /product="putative maltooligosyl trehalose synthase (treY)"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="5.4.99.15"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34554"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34554.1"
FT                   /translation="MTTPASPTAVPRATLRLQLHRAFTFDHARALLDDVAALGISHLYV
FT                   SPITTAQPGSMHGYDVVDPTRVNPELGGEAALGRLVEALHARGMGLIVDIVPNHMSVGG
FT                   AHNAWWLDVLENGPASAWAHVFDIQWQPPQPALHNKVLAPFLGEPYDAALRGGRLTLHY
FT                   DPEAARLAIAYYDHRFPIALADYASILRGAGEPGKRGAQAALDAVADRFASLQSTRAVH
FT                   ARREHADAAREALRHFAATDAGRARIDRAVAAINADPERLHALMARQSWRLAHWRCAND
FT                   EINWRRFFDIGSLAGLSVERADVFEATHALIFRLYRQGWIDGVRIDHVDGLADPAGYCR
FT                   QLRQRLAADNAHRPADRRPGRPWIVVEKILAADEPMRTGWGVDGTSGYDFMNQAGALLH
FT                   AASGEAALTQGWLDWTGRPASEAHFRATALAGRRQILHEHFAAELDTAVCALHAVAQQQ
FT                   RETHDVTWHVIRRTLAELVVHLPVYRTYADTHGRDAQDTAIMRRAIHDAMPHLRRVDQP
FT                   VLAQLDAWLGGEPAGHDRLRQLALRRCQQLSSPVAAKAVEDTACYRFGRLLSRNEVGAD
FT                   PGEFALDAAAFHHAMEARARLWPRAMLSTATHDHKRGEDVRARLAVLSERPTHWLAAAQ
FT                   QWRAAHAHWVRPLPDGPAPAPDAQWMLYQTLVGAWPPGLDWRDADGVRAFAERVTQWQR
FT                   KALREAKLRTDWFAPDIGYEQACHDFVFTLLTGEAAPAFLPSLAAFVRTIAPAGAVNGL
FT                   AQTLLRVTVPGVPDLYQGADFWDTSLVDPDNRRPVDFAVRHRSLRALQANPGHSLAPLL
FT                   AHWTDGRIKQAVLARALGVRAAMPEVFASGRYLPLALSGSGDAHALAFAREHAGRWVVA
FT                   IVPLHAAALLGPAATPAFPAGAWRDTTVCLPAPLASMPLHSVFDGQTVRGARLALGQAL
FT                   AALPVALLHG"
FT   gene            complement(233348..235669)
FT                   /locus_tag="RPSI07_mp0198"
FT   CDS_pept        complement(233348..235669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0198"
FT                   /product="putative 4-alpha-glucanotransferase
FT                   (Amylomaltase)(malQ)"
FT                   /function="6.14 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="2.4.1.25"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34555"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34555.1"
FT                   /translation="MSQRPAPPSSPHAASALHQLARSAGLLVDWEDAAGRPMRVSDDVL
FT                   RAVLRCLGLPADSAADQADSQSRLHAEATEYAVPPLVSGVVGHTVLLETALPWAAALGG
FT                   RPYRIGFEHGGGAEGTVDASIERDRTTLQLAPVQVPGYHRLRIDTGSCTAIETTLAIAP
FT                   ARCYAVSDALKAHGRLPDARLWGGSAQLYGLRHDGERAALAAGLGDYTSAGLLARSLAQ
FT                   HGADALALSPVHAMFSADTHRYAPYSPSSRLFLSAWMIDPAALLGTEAARQAVIDTGLA
FT                   DDYARLEANALIDWPASAAARLTVLRALHRRLPMQVAAGDSTARRLHEDRLAYCADRGR
FT                   SLLDHAHFETLDAHLHQAHPPRHHWKQWPAPYQSPSYLAVRAFARDHPDTVDFHRFLQW
FT                   AAARQLAAAQRTAEDAGMAIGLIADLAVGTDGAGSHAWSRQQDLLIGVTVGAPPDVFNA
FT                   HGQSWGLTTFSPRAMRAQGFAAFIEMLRAVMAVPGGVRIDHVLGLMRLWVIPEGARALD
FT                   GVYLRYPLRDLLRLIALESWRNRCIVIGEDLGTVPTGLRERLAEDGLLGMRILWFERDY
FT                   AQPEAPFRPPRAWSRASVAMTSTHDLPTVEGWWTGHDLHWQARLGLLPIGMNETEARTH
FT                   RMADRQALVDAFAQHHRTVPAPGEDAARRIAALQTALAQARTATPAEADTLLAATAGDF
FT                   ATAAIAYTAAAPVPLAIAPMEDLLGLLEQPNLPSTIDTHPNWRRRLPALAAGLLAAPAV
FT                   RARLAALARARAQATPDSPP"
FT   gene            complement(235679..237538)
FT                   /gene="treZ"
FT                   /locus_tag="RPSI07_mp0199"
FT   CDS_pept        complement(235679..237538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treZ"
FT                   /locus_tag="RPSI07_mp0199"
FT                   /product="glycosidase hydrolase, Malto-oligosyltrehalose
FT                   trehalohydrolase (treZ)"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="3.2.1.141"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8605217; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34556"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34556.1"
FT                   /translation="MTDTTSAPPARHAHDLPFGAVCLGPDRTRFRLWAPDAVEAWLDID
FT                   QGEAVHMAAEPNGWYAATVPVGAGTCYRYRVANREGLTLTVPDPAARAQWQDVHGPSLV
FT                   VDPLRYAWQHPGWMGRPWHETVLYELHVGALGGFDGVRAHLPELARLGITAIELMPVAE
FT                   FSGARNWGYDGVLPFAPEASYGPPEALKALIDTAHGLGLMVFLDVVYNHFGPDGNYLHH
FT                   YARRFFRDDVHTPWGAAIDFRQPEVRAFFIQNALMWLMEYRFDGLRLDAVHAIGARDWL
FT                   GELASRVRLAVEPGRHVHLVLENEHNTASLLRGAVLPGAHACGTFEAQWNDDGHNTLHV
FT                   LLTGEHEAYYAAYADAPAQRLARVLQDGFCYQGEPSVIHDGAPRGEPSGFLPPTAFVLF
FT                   LQNHDQIGNRAFGERLTRLAHPDALHAAQALLLLSPQIPLLFMGEEWGCLRPFLYFTSH
FT                   HGALAEAVREGRRREFAKFAAFADPHQRERIPDPNDERTFLASRPGSADPALPEHLDWL
FT                   NRTQGLLALRHARIVPRLPGARSLDAVPLGATGALARWRLGDGSVLTLAINLGALPVAV
FT                   PTALAGNPADLLHESRDGAAAGLAAHSVPARACIALLHTPPSP"
FT   gene            complement(237535..239793)
FT                   /gene="glgX"
FT                   /locus_tag="RPSI07_mp0200"
FT   CDS_pept        complement(237535..239793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgX"
FT                   /locus_tag="RPSI07_mp0200"
FT                   /product="glycosyl hydrolase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2975249, 8576033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34557"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34557.1"
FT                   /translation="MLRVPSNLSPGKPYPLGAQWDGLGINFAVFSANAARIELCLFDPT
FT                   GRKELARLPLPECTDEVWHGYLPGVESGLVYGYRADGPWEPLRGHRFNPHKLLLDPYAR
FT                   RLVGALRWSDALFGYRLNSARADLSFDRRDSAPACPKGVVTDESFNWGNDVRPGTPWSR
FT                   TVIYETHVRGASMLRDDLLPPERGTFAALADPVFIEHLQTLGVTAVELLPVHAFLQDRF
FT                   LVERGLRNYWGYSTLAFFAPEPAYLSTPTLHEMKVAIRRLHAAGIEVLLDVVFNHTCEG
FT                   NELGPTLSFRGLDNASYYRLVPGQERYYINDTGCGNTLNLSHPRVLQMAMDSLRYWVNA
FT                   CHIDGFRFDLGVTLGREGLGFDPGSGFFDAVRQDPVLSTVKMIAEPWDLGPDGYQLGNH
FT                   PPGFAEWNDRFRDGIRRFWRGDAGQRPELAARLTGSGDLFGRRYRRPWASINYAASHDG
FT                   FTLLDVVSYADRHNEANGEDNRDGHHDNCSANWGVEGPTDDAAILAQRAQVVRALLATV
FT                   LLSNGTPMLLGGDEFGRTQQGNNNAYCQDNAISWLDWPMRAQAEGRALFAYTARLIALR
FT                   KTCPALRWPHFVHGETEILPGVPDIDWFDERGRPLTPDAWNDSEARALALRRACIETLD
FT                   GEARPHVALTLINGAATDLTFTLPAPAMDWRLAIDSAAPEREARPHAEATVRVPGRSVV
FT                   VLLATQLAAIAQIASPPEREAAGQTVGRVPDTPVEAGAGAQPRPRETAPATGQGDTSP"
FT   gene            complement(239973..242294)
FT                   /gene="glgB"
FT                   /locus_tag="RPSI07_mp0201"
FT   CDS_pept        complement(239973..242294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgB"
FT                   /locus_tag="RPSI07_mp0201"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /function="6.14 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="2.4.1.18"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12196524; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34558"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34558.1"
FT                   /translation="MTAAHDFATPTRPATPAAAAPEPPPALPPGVDQNTLDALTHGRLG
FT                   DPFAVLGPHRLETAEGPHRVVRAFHPGARRVQAIDPRGQVMAELAPVGRTGLFHGRLPA
FT                   DVPDTFGHPGSYRLRVIWPAGTGHEAVQEAEDPYAFGLLLGDLDLHLIAEGRHWKLARC
FT                   LGAQSVQQDGVAGVRFAVWAPNARRVSVVSDFNQWDGRRHPMRLRHGAGVWELFVPAGL
FT                   GASPGSRYKFELVGADGHLLVKADPVARCTEPPPATASVVADPLPFRWSDAAWMEARAA
FT                   RQQPDAPIALYEVHAGSWLRDVEDGSRSLNWDELAERLIPYVTGLGFTHIELLPVAEHP
FT                   FGGSWGYQPLGLFAPSARFGPPEAFARFVERCHQAELGVIVDWVPAHFPTDPHGLACFD
FT                   GTALYEHADPREGFHQDWNTLIYNFGRHEVSGFLIASALEWLEHFHIDGLRVDAVASML
FT                   YRDYSRQTGTWVPNRYGGRENLEAVAFLRQMNTVVHARCPGAITIAEESTAWPGVTAAI
FT                   EFNGLGFDYKWNMGWMHDTLHYMQRDPVYRQHHHDGLTFGLVYAFSEHFILPLSHDEVV
FT                   HGKGSLLGKMPGDDWQRLANLRAYLAFMWTHPGKKLLFMGGEFGQIGEWNHDASPEWHL
FT                   LDDPRHRGVQRLVHDLNALYRSEPALHARDCAPEGFNWVIGDDRANSVFAFLRRDAEGT
FT                   PMLVAANMTPVPRDGYRIGVPDVDGAVRWREVLNTDSAVYGGTNLGNGGVVDVEDVELH
FT                   GWRRSVVVRLPPLAVVVLKV"
FT   gene            complement(242291..245773)
FT                   /gene="TreS"
FT                   /locus_tag="RPSI07_mp0202"
FT   CDS_pept        complement(242291..245773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="TreS"
FT                   /locus_tag="RPSI07_mp0202"
FT                   /product="Trehalose synthase, Maltose
FT                   alpha-D-glucosyltransferase; Alpha amylase, catalytic
FT                   subdomain"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="5.4.99.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34559"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34559.1"
FT                   /translation="MTRNPTVLLVDDALWYKDAVIYQLHVKSFCDSNNDGVGDLPGLIS
FT                   KLDYIAELGVDAVWLLPFYPSPRRDDGYDIADYRGVHPDYGTMADARRFIAEAHARGLR
FT                   VITELVINHTSDQHPWFQRARRAKSGSALRDFYVWSDHDKKYAGTRIIFIDTEPSNWTW
FT                   DPVANAYYWHRFYSHQPDLNFDNPRVLKAVLGVMKFWLNLGVDGLRLDAVPYLVEREGT
FT                   ANENLPETHAVLRKIRAAMDAEFKNRLLLAEANQWPEDTQEYFGDGDECHMAFHFPLMP
FT                   RMYMAIAREDRFPITDIMRQTPEVPSACQWAIFLRNHDELTLEMVTDAERDYLWEVYAS
FT                   DRRARLNLGIRRRLAPLLERDRRRVELMNSLLFSMPGTPVMYYGDEIGMGDNIHLGDRD
FT                   GVRTPMQWSPDRNGGFSRADPEQLVLPAIMGSLYGYESVNVEAQTRDAHSLLNWTRRML
FT                   ATRKRHRVFGRGSIQFLHPANRKVLAYVRALEGEAPILCVANLSRASQAVELDLAAYAQ
FT                   RVPVELIGGTAFPPIGQLPYLLTLPPYAFYWLELRENEPGPSWAQPAAEQLPEFTTLVL
FT                   RAGLDALSDTRQREAHRQLIEREILPSYLPKRRWFAAKDSVLRGAHFVWGATVPVDASS
FT                   TNRPLAGATRPEIFINEIAVTLGDADGTERTERYLLPLSIAWESATLPALPIQLALARV
FT                   RRGRHVGYLTDAFTTETFARALLAGLVRGVTLEANEGTVRFEPEPNLVEPAEPAPEADA
FT                   GAARPAPLPLAPDAPVRWLAAEQSNSSLVIGESIIVKLIRRVAAGVHPEVEMTRHLTRI
FT                   GYANTAALIGEIAHVSAAGERSTLAVIQSFVPNQGDAWTWALDYLRRTIDELAVLTEAV
FT                   STGDGEAAPAAVSEARTDTDEALAGYLAFIGGIGTRLGELHVALASPSKDAAFGTSAAN
FT                   ADDAAYWIACVSEQVTRALDHLAAWQAINGSNADLDWLLSQRDALLAAARERAQGGLGA
FT                   LLARIHGDFHLGQVLVAQGDAFLIDFEGEPSRPVEERRRKTSPLRDVAGLVRSLDYVVG
FT                   AMRQGPEHVAGPAQERRDQLLERFRNASTERFLDAYAAAVQAPESDDGACALDMDLLDL
FT                   FLLEKAAYEVNYEAANRPSWLPIPLTGLARVARRLLHAEVPSPAVQDPPGGPP"
FT   gene            complement(245770..249270)
FT                   /gene="glgE"
FT                   /locus_tag="RPSI07_mp0203"
FT   CDS_pept        complement(245770..249270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgE"
FT                   /locus_tag="RPSI07_mp0203"
FT                   /product="glycosidase hydrolase, weak Alpha amylase
FT                   catalytic region domain"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10542168; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34560"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34560.1"
FT                   /translation="MEARRARPEVQRGAAVFTPAICYLHPLQHGPLDQWGGLLDRIASL
FT                   GFDHVLIPPPFAVSAGGNVFVTRNHALLHAALGGEPADAALGRLADDCRQRGLTLLMDL
FT                   VIDRVATDAPLRADHPDWFTRHAEHGDALDPRLPPSHLEVASFRHDDAHCADAIGAWWT
FT                   QQLRAWAALGIGGFRCEAPARLPPARWRPLIAVTRESAGARPVRFLAWTPGLDGRAVDA
FT                   LAEAGFDATFSSLRWWDFRAGWMVEEHARLAAIAPPIATAEVPFGTRYGQAFGDAMTRE
FT                   RAYRRMLDVADVLGAGWLMPFGFERGALLPMLPERGDPTDQQWIDAHAAFDLCDAVRDV
FT                   NATLRAAQAAGTVALRADLRMLTGPDARMSALLRADGPDLRADDAATLLVINPDLHAGV
FT                   SAHADRFLPGVAGGFTRGVALDLLTEPAGSHDDALRAEAHPLAEIDLPPGGVQVWRVFR
FT                   SRPVRRQPVIAPGGPRTRAVPGDAGNAHADAAIAAPRIAIEHVTPAVDDGRFAVKRLVG
FT                   DDILIEADVLMDGHDRLAVELLWRADDTTTWQRVPMVPLGNDRWRGAFRPERLGRHAYA
FT                   VAAWRDAFDTFRAELEKKHAAGVDVSVELEEGAQLVAQAADHAPKDAPVGALHQLADLL
FT                   KATAQDAPHRLKLLLDPATAHVMAQASHFRPFHVRSAPYPLEVERSGAAFANWYELFPR
FT                   SASGDERRHGTFGDVARRLGAIRAMGFDVLYFPPIHPIGRTNRKGRNNSLRAEPGEPGS
FT                   PYAIGAEEGGHDAIHPQLGTLDDFRRLRDAARDQGLELALDFAIQCSPDHPWLREHPGW
FT                   FAWRPDGSVRYAENPPKKYEDIVNVDFYARDAKPALWLALRDVVMFWADEGVRLFRVDN
FT                   PHTKPLPFWEWMIGEVRARYPDAIFLSEAFTRPKVMYRLAKVGFSQSYTYFTWRHSKQE
FT                   FIDYLTELTRTPVREYFRPHFFVNTPDINPVFLQTSGRPGFLIRAALAATLSGLWGVYN
FT                   GFELCEGQALPGKEEYLDAEKYQLRAWDHDRPGNIVAEIALLNRIRRANPALHSHLGVH
FT                   FQPASGEGILYFSKSTPAPLPTHPAELAQLTDTQPDRFGDNTLLIAISLDPDHPQEANI
FT                   ELPLWQWGLPDHGALMAENLVDGTRFVWRGKWQHVRLEPEHPFAIWRVRPALPSEEQPS
FT                   "
FT   gene            complement(249530..251224)
FT                   /gene="glgA"
FT                   /locus_tag="RPSI07_mp0204"
FT   CDS_pept        complement(249530..251224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glgA"
FT                   /locus_tag="RPSI07_mp0204"
FT                   /product="Glycogen synthase (Starch [bacterial glycogen]
FT                   synthase)"
FT                   /function="6.14 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="2.4.1.21"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3097003; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34561"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34561.1"
FT                   /translation="MPAQRHAGTGFGPAPVAFAGSTILSLNVLFVASEAVPLAKTGGLG
FT                   DMVGACAGALQRAGLHVTVMLPGYPAARMQLRDARVACALPDLPGGPARVLLGAMPDTG
FT                   VPVLLLDAPALFDRPGSPYLDACGEPYADNALRFAAFSQAAALVAGGVRGLPAFDIVQA
FT                   HDWHAALVPLLVKRAGLPVRTVLTVHNLAFQGNVPLRVARDLGMPADAVREAEFFGQFS
FT                   FLKAGLLWADRITTVSRAYAREILTDTFGYGMQDVLRARRHDLVAILNGIDNTVWNPSK
FT                   DAYLSRPYFTADLSGKHAAKRQLQALLRLPEDPHTPLLALGSRLTHQKMADVALRALPQ
FT                   LLEADPRLQVAVLGCGERSYERGMAALAARYPRQMAATIGYTERNAHMLHAGADLLLHG
FT                   SRFEPCGLTPLYAMRYGTVPVASRVGGLVDTIADRGSPEAALRGATGFLFDGDTPEAMI
FT                   GAVERALRVFAQPRAWRILQYNGMTTDFGWSQPAREYLALYATLAPRATPMPHLQHWPM
FT                   RATQPPLALPASRLDTAPVRKPTHRRRTTALSDAARAHAVAYAAPRE"
FT   gene            complement(251442..252269)
FT                   /gene="hmuV"
FT                   /locus_tag="RPSI07_mp0205"
FT   CDS_pept        complement(251442..252269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuV"
FT                   /locus_tag="RPSI07_mp0205"
FT                   /product="Hemin ABC transport system, ATP-binding protein"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9026634; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34562"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34562.1"
FT                   /translation="MTSTLGPMLRCQALTLFRRARRVLDAIDLAIRPGEMVALLGRNGC
FT                   GKTTLLRALAGDFCEPSGGAAITGELTIDGRPLAALPPLQLARRRAVLAQQGERGFAFS
FT                   ARELVSLGCFPHAAAGEIHTGGVIDAALALADAAPLARRDVTTLSGGEFARVQFARALA
FT                   QIHPAHASQVDARYLLLDEPTAALDLAHQHRLLATVRDLTRDWHMGALAIVHDINLAAR
FT                   YADRLVLLADGRVLADGPVAGMLQPALIEATFGVPVRAVDVPGARHPAIVAAM"
FT   gene            complement(252266..253372)
FT                   /gene="hmuU"
FT                   /locus_tag="RPSI07_mp0206"
FT   CDS_pept        complement(252266..253372)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuU"
FT                   /locus_tag="RPSI07_mp0206"
FT                   /product="Hemin ABC-transport system permease protein hmuU"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9026634; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34563"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34563.1"
FT                   /translation="MSTASSPGTWTDHTAATHAERGAAPLRLPPRWLLGGLAAGLVAVT
FT                   VAALCIGAYAVTPAELWTALSAPASDPAGLQTRAVLAEIRLPRVVLALLLGGTLGVSGA
FT                   ALQAIFRNPLADPGLIGVSSGAALGAATAIVGLPLLGGAALAHAVGPALLPLAAFGGAL
FT                   LVTVMVYRLAAERGRVSLPLLLLAGIAINALATALIGLMLYLATDAQQRTLTFWSLGSA
FT                   GGAQWRTLAMVAPPALLGSAWLLRVRGALTALQLGDEAAAHLGVPVRRVQKQVLAAAAL
FT                   AVSALVSCTGVIGFIGLVAPHGVRLLCGPDQRIVMPGAMLLGALLTVGADLAARTLAAP
FT                   ADIPLGVLTALFGAPFFMLLLARRRGTL"
FT   gene            complement(253369..254307)
FT                   /gene="hmuT"
FT                   /locus_tag="RPSI07_mp0207"
FT   CDS_pept        complement(253369..254307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuT"
FT                   /locus_tag="RPSI07_mp0207"
FT                   /product="Hemin-binding (Fe3+-hydroxamate) periplasmic
FT                   protein hmuT"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9026634; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34564"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34564.1"
FT                   /translation="MPSAWPRDGGLGMSAIRSGRRRWLAAAGGAALFAPWQAWAQKAAP
FT                   MPRRVVVIGGALAECVYALGMEHVLVAADTTCTYPRPVLALPKVGYLRTLSSEGVLSLR
FT                   PDLVLMSTDAGPPEALAQLRGSGVRIAAIAEQHDARTARSKIVEVARLLGAQSAATRVL
FT                   ADFDAAMQTTEQQVAARRARQAPVRAAFLLGHAGMQTMVAGRDTAADAMLRYAGASNVF
FT                   GDDRSGFKGYKPLTAESMVVVAPDVLVTTPDAVAAAGGTAAFLSASGLAATPAARHRRL
FT                   VAMDTLYLLGFGPRLPQAIDALSRQLAEARA"
FT   gene            complement(254268..255407)
FT                   /gene="hmuS"
FT                   /locus_tag="RPSI07_mp0208"
FT   CDS_pept        complement(254268..255407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmuS"
FT                   /locus_tag="RPSI07_mp0208"
FT                   /product="hemin transport and degrading protein HmuS"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34565"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34565.1"
FT                   /translation="MNPSAHSLPTGTPDERIARAARLRERHRALLAERNLRQRDAAAEL
FT                   GVSEGELVAARIGADVTRLHAGADGHFIGLFEQLGALGRVMVLTRNAAAVHEKDGAFTN
FT                   LSHEGRVGLALGTEIDLRMFYAHWAHAYAVTDTSPRGTLRSLQFYDACGEAVHKVYLRE
FT                   HSEHAAYDRLVAQWRAEDQSAGDAMQSRPAPDAPRPDSAIDVPALLSAWEAMTDTHQFF
FT                   GLLKAHEVARTQALRLAEGRFTQAVAPTALHTVLEDAASAGLPIMVFVGNRGMVQIHTG
FT                   PVTSVRLLDSWVNVLDPGFNLHVRADLIDRAWVVCKPTSDGVVTSLELFDAQGETIAML
FT                   FGARKPGEPERPAWREVVRRLLGHRSTCLPLGPATEASA"
FT   gene            complement(255428..257665)
FT                   /locus_tag="RPSI07_mp0209"
FT   CDS_pept        complement(255428..257665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0209"
FT                   /product="outer membrane hemin receptor signal peptide
FT                   protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34566"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34566.1"
FT                   /translation="MAPIVTAAALLCAPSAGAEPPAPTYAPTLATRADLTLDPVIVTAT
FT                   RSRTALSRTPASISVVTDTDLEEQQADNIKEALRYEPGITVRRSAFRPTSAASSGSTGG
FT                   FGGNQGINIRGLDGNRILLMEDGIRLPAAFAYGPLNAGRGDYADMALLRSIEILRGPAS
FT                   SLYGSDGLTGAVNFITKDPQDLLDVFGKASYFGLRSSYDSTDRSFGTTVSTALGGEQFQ
FT                   GMLIADGRRGHEVDNQGSNGSVGAARTTPNPQDTYNTSLLGKLVFKATASDTFKLTGES
FT                   VRQRINSDALSAVTSTLRGLRSADTLENQRVSLDYDYADADNRWFQSAHTLIYFRRAEI
FT                   EQAQDETNAASRRSRDNHYRDRTFGLSSQLESHVQTGTLSHKLVYGVDASFSRIDSDRS
FT                   GTGPAASDNFVNKVFPDTEYALLGAFVQDEIRRGSLSIIPALRYDTYRLKPRNPNDPLY
FT                   TGAQAGSSDGALSPKLALMYAFAPAATAYVQYARGFRTPTPDQVNNSFTSTAGSRVYYR
FT                   SIGNPDLKAETSDTVEVGLRGQFDTTRGSMRYSVAAFAGRYRNFIDQVTIGGSITSPAN
FT                   PLTYQYVNVSRAFIRGVEARGEWRLPVGVKLRAAAAYTRGTAEDASGASTPLNSVNPLQ
FT                   AVFGVRYEPGERWFAQTDMTWQMAKSPSTIRPPSAGTTADFATPSSFVVDVSGGYRLNK
FT                   HATLYLAVRNLFDRKVWNWSDVAGLGLAGSTILDAYTAPGRTFAASVKIEF"
FT   gene            258055..258618
FT                   /gene="ahpC"
FT                   /locus_tag="RPSI07_mp0211"
FT   CDS_pept        258055..258618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpC"
FT                   /locus_tag="RPSI07_mp0211"
FT                   /product="Alkyl hydroperoxide reductase subunit C
FT                   (Peroxiredoxin) (Thioredoxin peroxidase) (Alkyl
FT                   hydroperoxide reductase protein C22) (SCRP-23) (Sulfate
FT                   starvation-induced protein 8) (SSI8)"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number="1.11.1.15"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8555198; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34567"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34567.1"
FT                   /translation="MSLINTQVQPFKAQAFHNGKFVEVSDQTLKGKWSVLIFMPAAFTF
FT                   NCPTEVEDAADNYGEFQKAGAEVYIVTTDTHFSHKVWHETSPAVGKAQFPLVGDPTHAL
FT                   TNAFGVHIPEEGLALRGTFVINPEGVIKTSEVHDNAIARDVKETLRKLKAAQYVATNPG
FT                   QVCPAKWNEGAKTLKPSLDLVGKI"
FT   gene            258724..260298
FT                   /gene="ahpF"
FT                   /locus_tag="RPSI07_mp0212"
FT   CDS_pept        258724..260298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ahpF"
FT                   /locus_tag="RPSI07_mp0212"
FT                   /product="alkyl hydroperoxide reductase, F52a subunit,
FT                   FAD/NAD(P)-binding"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number="1.8.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8555198; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34568"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34568.1"
FT                   /translation="MLDADVKAQLKAYLERLVQPIELVASIDDSEGSRDMMDLLRDVAG
FT                   QSGMITLNEQRDDAERKPSFLIRRTGTDVGVRFAAIPTGHEFTSLVLALLQVGGYAPKL
FT                   DDDTIEQIRGIEGDFRFETYMSLTCQNCPDVVQALNVMSVINPRIQHVAIDGALFQDEV
FT                   EARKIMAVPTLFLNGEVFGQGRMGVEEILAKIDTGAAARDAEKLNAKAPYDVLIVGGGP
FT                   AGAAAAVYAARKGVRTGVVAERFGGQVLDTLAIENFISVQETEGPKFAAALEQHVRQYG
FT                   VDIMNAQRAVKLTPADEPGGFSEVTLANGAVLKGRSIILSTGARWRNVNVPGEQEYRNR
FT                   GVAYCPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSHVTLLEFGDQLKADAVLVRK
FT                   LESLPNATILTNAQTTEITGNGEKVNGLRYKNRTNGVEHDVALEGVFVQIGLVPNTEWL
FT                   DGVVERNRFGEIIVDARGHTSVAGVFAAGDSTTVPFKQIIIATGEGAKASLSAFDHLIR
FT                   VPLAEAA"
FT   gene            260733..261188
FT                   /gene="fur"
FT                   /locus_tag="RPSI07_mp0213"
FT   CDS_pept        260733..261188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fur"
FT                   /locus_tag="RPSI07_mp0213"
FT                   /product="Ferric uptake regulation protein (Ferric uptake
FT                   regulator)"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7798143; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34569"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34569.1"
FT                   /translation="MPNSTDLRRAGLKATSPRVKILEILAAGTDHGRHLSAEDVYRQLL
FT                   SSDIDIGISTVYRVLNQLVDAGVLLRHTFEAGHAVYEINEGAHHDHLICLSCGRVEEFH
FT                   DDAIESRQESVAAERGFVLREHALALYGVCPACQARAGALSAVGLNA"
FT   gene            261310..261558
FT                   /locus_tag="RPSI07_mp0214"
FT   CDS_pept        261310..261558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0214"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34570"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34570.1"
FT                   /translation="MRRRLKSEDELKTLLARCVQQHPECAHCELRAMCIHRPDHTGCNW
FT                   SAEFDFLTDDDDAAMRGLSVAKRLLMRARTQYNVASS"
FT   gene            complement(261598..261903)
FT                   /locus_tag="RPSI07_mp0215"
FT   CDS_pept        complement(261598..261903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0215"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0215"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34571"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34571.1"
FT                   /translation="MTEDLLVQLFAEVEKEDPVDFANLPFDEQMLRNLVCKLVTHQLSQ
FT                   MEAAHFSQDDVIASLSASIAKLVLENLVLNARLLTLQGHGESARELLERIARQARG"
FT   gene            complement(262008..262325)
FT                   /locus_tag="RPSI07_mp0216"
FT   CDS_pept        complement(262008..262325)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0216"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34572"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34572.1"
FT                   /translation="MSVYHVVETGVVATLVALSALSITGRYAPAMRARTVARMAGWCDR
FT                   PSRPGWVRAFGQRLLAPGTAPSCHADPLSGSACGSGCSGCASGESTVQVVEQPIRIVRR
FT                   P"
FT   gene            complement(262322..264181)
FT                   /gene="feoB"
FT                   /locus_tag="RPSI07_mp0217"
FT   CDS_pept        complement(262322..264181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="feoB"
FT                   /locus_tag="RPSI07_mp0217"
FT                   /product="Ferrous iron transport protein B"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8407793; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34573"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34573.1"
FT                   /translation="MHASSSPSSAPALRVALVGNPNCGKTALFNLLTGSRQKVANYAGV
FT                   TVERKEGRFVAPSGRHVQILDLPGAYSLVATSPDEAITRDICLGTFRGEPRPDLIVCVV
FT                   DATNLRLHLRFVLELQRLGLPMVLALNMVDAAARRGIRIDRAKLEQALGMPVVETVAIK
FT                   RNGAADLVTHIDHERLPAVPTALPADADPHVEVKRLLDAAVTMPRSTAELDDRLDRIVL
FT                   HPVLGLVLLAVLMFFMFQAVFSWAKPLMDGIQAVVEDAGVWIGALLPDGMLKSLLVDGI
FT                   IAGTGSILVFLPQILILFLFILALEESGYLPRAAFLLDRLMAGAGLSGRSFIPLLSSFA
FT                   CAIPGVMATRTIQDPRDRLVTILVAPLMTCSARLPVYALLIGAFIPARQVWGTFNLQGL
FT                   VLFGLYMAGIVSALLVAYVLKYLKRDRSEHPLILELPSYRLPSPRNLAIGLIERARIFL
FT                   RRIGTVILKMMVLLWFLSTFPSPPAGATGPAIDYSFAGYIGHALEVVFAPIGFNWQMCI
FT                   ALIPGMAAREVAVGALATVYSLSATREDAAAQLAPVIAAQWPLATALAFLAWYVYAPQC
FT                   ISTLATIRRETNSWKVMASTAGYLFALAYLAAFATYQIARVLT"
FT   gene            complement(264227..264538)
FT                   /locus_tag="RPSI07_mp0218"
FT   CDS_pept        complement(264227..264538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0218"
FT                   /product="putative ferrous iron transport protein A (feoA)"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8407793; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34574"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34574.1"
FT                   /translation="MRLSELSRRATAVVDHVEDREPADPISQRLRELGFVTGEQVCVVA
FT                   IGPFSGDPLVVQVGFTRFALRKQEAARVRVHTEAATQPTQPVAAASETAPPAQVRKAA"
FT   gene            complement(264880..267330)
FT                   /locus_tag="RPSI07_mp0219"
FT   CDS_pept        complement(264880..267330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0219"
FT                   /product="putative signal transduction protein, GGDEF
FT                   domain"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34575"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34575.1"
FT                   /translation="MSTAQPPSAPRRLLFRLLPGVVLAALLPFVGLIAVAVSTVYDDTR
FT                   REIDSRLEQAITQAARPLEAHLTDAIDRLSAATDDAAAPVSTAEGQAWLDAHPDLRGAF
FT                   DHLLIVGATGTVLADAPALPQRRGDNMALHPIFKTVRESHRLYIPEPFLTPAGQRPVAS
FT                   FAVPLHGPDGSFAGLVIGSIELARNPILADLENTRIGRTGHLLVVSEQGRYIVGPDRAH
FT                   LLQQAPDLADGQPAARARTQGWNDSTEFHPLGQSPVIVSYRPLNTVPWSIGAWWPAQEA
FT                   YAGAARTTRTLVATGIAFGAACLLFAWFWLERATSPLERLRHEVEAGMPIHTPPAPVGR
FT                   PALGEPPAPGPLARLADLAHPDARMFDPATEVGALAGSVGRLVQYWEQALGAAEQEAAF
FT                   FRAIAEQAPVGLAFLDRSLAVPFANVRFERLVGASSATIVRALQDGGSTTTSPAAQAVA
FT                   AVLRQLPRVPLALADRPVVIATGEGAGSGAVLLTARPAGGAGAPPVGWIIAVVDATAEQ
FT                   RAKEVLEQEVRAALLVLDAIQEPLLTIDSDGTVTHASRAIETLTGTHTASAIGQSINRL
FT                   LHLIEHETNRRVIPTQLLRAGGTLPGGLRMETADGRRHDVELSWGPLPGTSGAGVLVLR
FT                   DVSATRETVQRIAWDATHDVLTSLLNRRGFDATLRAQVDAHRGTRGAPRAPLALLMIDL
FT                   DGFKAINDCYGHAAGDDVLRGIAERVVQNTRTQDHIARLGGDEFAVILPNCDLQTAVTF
FT                   ADRIRAALARQPVLAAGARAQIALSQGVVELQAGDADAAAFLARADAACYRAKNEGRNT
FT                   IATG"
FT   gene            267609..271145
FT                   /locus_tag="RPSI07_mp0220"
FT   CDS_pept        267609..271145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0220"
FT                   /product="putative signal transduction eal-ggdef domains
FT                   transmembrane protein"
FT                   /function="16.3 : Control"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34576"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34576.1"
FT                   /translation="MPKHAFIPTTLRGRLLALAAVAALPAVVVAIAGVALYRDRLTDHL
FT                   EQRLSYETQSAATRVGMVLSNADQLLSVVVADESVLRLDRDECTRFVSRVIHNQSDFAT
FT                   LGVADARGKLVCTPVPGAIGLDIADRDFFRELIATGRPSLSNFLTGRTSHQPVMVATRA
FT                   VVGPDGAILGVAYAAIRQSALMVAAGSTTAGPVYLVDSAGTVLSGAHATQPGDGPGVTR
FT                   SDLVSAAGPEPGATVFETDPDGTLRAYAAMAVPHATSGRLRLVRGIDATDMARQQRDVT
FT                   LAGGGAIVLMLVLLLALIQMAMRRLVLPRVDALVDAARHYAAGDFSTRVAEQGGARDEL
FT                   SLLERTFNEMRMAILRHDETVHHLTERFQRVARATNDWIFDWDIATGESWANASLHRLL
FT                   GSDALLASGDEDGVSRTLTFQQFVHPEDMEAFGWGLRAALHSDRNAWHHVCRVIDASRA
FT                   VRTVEIRASIYRGKDGRAMRMVGGVTDISQRSAMEADLRASEANLRVAEQIALLGSWRW
FT                   DVLRDTATWSSGMYVLTGVPPGPPPSFAQQAQFFTGDSYNRLREAASRAVTEGEPYSLE
FT                   LEMIRRDGEHRWVLSRGNIERNEREEVVALFGTMQDITERRESDEQLRLLRRVVESVPS
FT                   GITVADALQPDLPLVYVNPGFERMTGYRAEEVLGRNCRFLHSSEPGQPALNEVRAALRD
FT                   ASEIRVLLRNFRKDGHSFLNNFLLSPVRDSQGAVTHYVGIQDDVTEQEMTRARLAQHAT
FT                   ADPLTGLPNRTLLADRVQQAVEMAARQRSRFYVALINIDRFKVVNDSLGHLLGDEVLRR
FT                   VAERLRDAADTVDTVARFGGDVFALVISHAGSHGVDLGFDLFAEPIRVEGHEVFVTASI
FT                   GVAEYPAHGSNSETLVRHAEMAMYYAKQNGRNRLEFFAPEMDIGVSYRLNLEHQIRAAL
FT                   EQGQFRLLYQPQIDSRTGRICGLEALIRWIHPTRGQLPPAAFIPVAEESGLVVEIGNWV
FT                   LAEAAQQRAAWHARGLGEDLTIAVNVSPLQFKRGTVLPTLLRLQRQHGLGSGFLELEVT
FT                   ESMLMEGTERTIEDLTAIRQLGVRIAIDDFGTGYSSLAYLKRLPIDLIKIDRAFVKDID
FT                   RDSNDAAICTTVVVLAHNLGVKVCAEGVEDAAQSAFLASHQCDVLQGYYFSEPLLPDAV
FT                   TALLERDARFTV"
FT   gene            complement(271170..272759)
FT                   /gene="aer"
FT                   /locus_tag="RPSI07_mp0221"
FT   CDS_pept        complement(271170..272759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aer"
FT                   /locus_tag="RPSI07_mp0221"
FT                   /product="Flavoprotein, mediates positive aerotactic
FT                   responses; signal transducer"
FT                   /function="13 : Signal transduction"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /function="16.12 : Sense"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34577"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34577.1"
FT                   /translation="MRNNLPVADTETPLAPADYLISRTDPSGRIVFANPAFVRISGFTE
FT                   AELIGAPHNVVRHPDMPEAAFADLWATLRSGQPWRGLVKNRRKDGGFYWVQANVTPVLQ
FT                   DGAITGYTSVRSMAMPAQIARAGRAYAAIRAGDTSYAVRSGRILRTGWRRLFNLFRGDS
FT                   LRLRVIGLQSLIAVAILIGTLWAHVALEAADLRGTPWLVLSRDWLWLTGVGCAGLATLS
FT                   GVLLARTLISPLEQAAALATRLAAGDLTSTLEARGNDEIGDVVRAMGTMRASLWSIVRD
FT                   IQDGAANVAHSTLQISAGNHDLSARTEQQAAALQETASSMEQLTSMVARNADHARDASA
FT                   LADQASAIATDGGQVVQRVVDTMGAIRGSSQHVTDIIATIESIAFQTNILALNAAVEAA
FT                   RAGEEGRGFAVVAGEVRSLAQRSAQAAAQTKEIIQASDQSVRDGVALVQQAGATMQQIV
FT                   ASVQTVTQLMSEISASSREQSSGIAQINASVSQLDGVTQQNATLVEKAAAAASVLAGQS
FT                   EALKRAVAVFRA"
FT   gene            272948..273202
FT                   /locus_tag="RPSI07_mp0222"
FT   CDS_pept        272948..273202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0222"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34578"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34578.1"
FT                   /translation="MQKIVGDVEIVPSVIPVGPRGWQARIDVVFRDAAGQSICGSRPVP
FT                   PCCTFGSPREALDAARLYGQRLLREWGRDAAAADGHAAR"
FT   gene            complement(273217..274050)
FT                   /locus_tag="RPSI07_mp0223"
FT   CDS_pept        complement(273217..274050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0223"
FT                   /product="putative type III effector"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34579"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34579.1"
FT                   /translation="MFVFNRTQGLMSQLLAPFKPATRRVRVRAIHALSPRMRRVIFAGD
FT                   TPADLADLADAPPGAAIKLMFPLDAASGAQRTIGRAYTIRRYHAGRAELEVDFVVHDET
FT                   PADQHGPAARWLERAAPGDTVEFAGPKRGFSLDPGTPWVLLIGDETAMPAIFAILETLP
FT                   ADVPARAFIAISDARARLPLETAAQATGAPARSGDLHWIESDTVHAGAMMVGALNTQAL
FT                   PAGTPQVLLAGEASLLKQVRTLLEGPWSIPHDAISAKGYWTAGLSREARRALEGR"
FT   gene            complement(274170..274826)
FT                   /locus_tag="RPSI07_mp0224"
FT   CDS_pept        complement(274170..274826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0224"
FT                   /product="putative transcription regulator protein,
FT                   PadR-like family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34580"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34580.1"
FT                   /translation="MHGWFGRHRKMWMEAQWMMGRHHGGRPGFGRGFGGPGGFGEGDEG
FT                   DGGNPWRGRRLSSADLQLVLLALLKDAPRHGYELIKAVEEHSLGFYAPSPGMVYPALSY
FT                   LEDHGFASVVAEGNKKRYAITPEGEAWLAERQQAADAILAQLRAMGERVQRMNEAMAFD
FT                   RDTEAADWSDAGSDPLRTARWRLKFVLMEKRFASREEQQRVADILLRALKEITGR"
FT   gene            complement(274936..275583)
FT                   /gene="pcp"
FT                   /locus_tag="RPSI07_mp0225"
FT   CDS_pept        complement(274936..275583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcp"
FT                   /locus_tag="RPSI07_mp0225"
FT                   /product="Pyrrolidone-carboxylate peptidase 2
FT                   (5-oxoprolyl-peptidase 2) (Pyroglutamyl-peptidase I 2)
FT                   (PGP-I 2) (Pyrase 2)"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.19.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34581"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34581.1"
FT                   /translation="MTTVLITGIEPFESDPTNPSWEIARALDGERIDGATLVARQLPCV
FT                   FGRANLELVAAIEATQPSLVLALGLASGRSEISVERVAINVIDARIPDNAGNQPVDVPV
FT                   VADGPAAYFSSLPIKAIVQALRAAGVPAAVSQSAGTYNCNHLFYGLMHHIATRTPRMRG
FT                   GFIHVPTTPELAARHPGRPSLPLDTQTAGMRVAVRTALATQSDLTLSGGTLH"
FT   gene            complement(275663..276082)
FT                   /locus_tag="RPSI07_mp0226"
FT   CDS_pept        complement(275663..276082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0226"
FT                   /product="putative transcription regulator protein, MarR
FT                   family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34582"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34582.1"
FT                   /translation="MFDHCLYFNTTALARAVEREWTAAYAPFGLTPPQGFVLRVVLKQP
FT                   GVLNRELADALGIARPTATRLVDGLIAKGLVERRPSADDGREWNLFPTAAARALAAPLQ
FT                   AASAKVAHKLREHVGAEAFDSTVKAIREVRTTLSD"
FT   gene            276528..276908
FT                   /locus_tag="RPSI07_mp0227"
FT   CDS_pept        276528..276908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0227"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10520"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10520.1"
FT                   /translation="MAALTGNAYATVISCPSLSDIKQAPGEFGGFAYTATLPNGQQWSG
FT                   ENPMADEADLGKVVFQEAYIVNAKNFVACDYVGKKAAGMRMALKTASPMRPVGTAWKWQ
FT                   RQADGTVLPHCVGPNPAQCAFE"
FT   gene            complement(277137..278750)
FT                   /gene="opgD"
FT                   /locus_tag="RPSI07_mp0228"
FT   CDS_pept        complement(277137..278750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opgD"
FT                   /locus_tag="RPSI07_mp0228"
FT                   /product="Periplasmic glucan biosynthesis protein, MdoG
FT                   family"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15175282; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34584"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34584.1"
FT                   /translation="MVTRRHLLASASLSATLAALGITPEALAASRVKLGNAAPFSFDAL
FT                   IERARAMAGQPYTPAATAPADILAKIDYEAHGKIKFDTAHALFADGPGQFPVTFFHLGT
FT                   FFRSPVRMHVVDKGQAREVVYDESYFDMPADSPARKLPRGSGFAGFRFQESRLGDQGKL
FT                   DWKKNDWVAFLGASYFRAIGELYQYGLSARGIALDVAQAGKPEEFPNFTHVWFDAPAGD
FT                   RADSVTIYTLLDGPSITGAYRFVMHRGKGVVMDIETAIFLRRDVERFGIAPATSMYWFS
FT                   ETAKGTATDWRPEVHDSDGLALWTGSGERIWRPLNDPPRTMASAFGDNNPRGFGLLQRD
FT                   RDFNDYLDGVHYERRPSLWVEPLEGWGEGAVQLVEIPTDDEIHDNIVAMWVPKAPARAG
FT                   SQYRLRYRLHWLADEPYPTPLARCVATRLGNGGQPGQPRPHGVRKFMVEFKGGPLEKLP
FT                   FGVKPEAVLTSSRGTFSYVFTEAVPNGVPGHWRAQFDLTVDGKEPVDMRLFLRVDGKPL
FT                   SETWLYQYHPFQSPMGPVAG"
FT   gene            complement(278880..279788)
FT                   /locus_tag="RPSI07_mp0229"
FT   CDS_pept        complement(278880..279788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0229"
FT                   /product="putative Transcriptional regulator, LysR family"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34585"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34585.1"
FT                   /translation="MNIDPLNSRAVAYLHEVAAYGGVRVAAEALGVNASVVSRQIALLE
FT                   RALRMSLLERRGRSVVVTEVGRTLVDFHREQQRRVRQLHAQLDEYRDLERGRIAVGVGE
FT                   GFVEGFITGALRRFSVKHPQIAIDIRSGPTLEVVTMLRNDEIDIGLCVGAGREPGCKTR
FT                   TFALGPLCAVVTPDHPIAALSKVPLAELAGHRLIFMSDHFAVQKLMQVMMHVEGLALMP
FT                   AYRCDLFSTAQALAAAGLGVAFMSAAAARRRIEQAQLIAVPIDHPVARNFRSQLMTRSG
FT                   HRLSPAADHLWKQLAQAMTSA"
FT   gene            279912..281105
FT                   /locus_tag="RPSI07_mp0230"
FT   CDS_pept        279912..281105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0230"
FT                   /product="amidohydrolase; putative hippurate hydrolase
FT                   protein (similar to hipO)"
FT                   /function="1.5 : Serine family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="3.5.1.32"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7730270; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34586"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34586.1"
FT                   /translation="MTDQGEHAHVADQARDHEELVAIRRHIHRHPELSFEEADTAALVA
FT                   DKLEAWGYQVTRHVGGHGVVGTLKAGTGTRSIGIRADMDALPIHEQTGLPYASVHDGKM
FT                   HACGHDGHTTVLLGAARELARTHRFDGTVHLIFQPAEEAGADSGAERMIADGLFERFPC
FT                   DAVFGLHNHPGAPTGTFLFRSGPFMAACDTVKITVHGKGGHAARPHLAVDPIVMASSLV
FT                   MALQTIVSRNIDPTETAVVTVGSMHAGHVANVIPERATLELSVRSFNDEVRRTLEARIR
FT                   ALADSQVAAYGGRAEVEVVRGYPVLVNSDAETELARQVAVELVGEAHVVAPFPAIAGSE
FT                   DFAYFLQQRPGCFLRIGNGVGAPMLHNAHYDFADDNLTIGATYWTRLVERYLAADRP"
FT   gene            281144..282481
FT                   /locus_tag="RPSI07_mp0231"
FT   CDS_pept        281144..282481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0231"
FT                   /product="General substrate transporter:Major facilitator
FT                   superfamily MFS_1"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34587"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34587.1"
FT                   /translation="MQPHKNNPLQHAAETMAVGAGAVSVLGAAPAPAASSRKVVVAAVI
FT                   GNLLEFFDFTVYSYFALTIGKLFFPADDPVTSSLLAFAVFAVGFVMRPLGGIVIGRYAD
FT                   RAGRRAALTLTIVLMALGAAIIGCAPTYAQIGLAAPALIVFARLMQGFAQGGEFGAATA
FT                   TLLETGADRNRGFRASWQLASQGAAALLGSGTAAALAYLLDDAQLHTWGWRVPFLMGTL
FT                   IAPVGIYLRRHIVEEPQVAGTGARSWRAVDVRNWFLVIFSIMGMTVASYLLMYYLPTYC
FT                   IQYLKLPAKLSMLVGVGASAVSLIMCPLYGAWSDRMGRRKPLTVAGRVALLLLIYPAFW
FT                   WMTHFPTLPAVLAMMLVLMLCYTMGSAPAYALMPESFPKAIRASFMSSAYAIAVSLFGG
FT                   TAQLVAGWLIRVTGSVMAPAWYMMACVVISLVAVSLFEETGGKALQ"
FT   gene            282653..283012
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0232"
FT   CDS_pept        282653..283012
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0232"
FT                   /product="putative Beta-lactamase (fragment)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CBJ34588.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            283210..283758
FT                   /locus_tag="RPSI07_mp0233"
FT   CDS_pept        283210..283758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0233"
FT                   /product="putative acyltransferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34589"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34589.1"
FT                   /translation="MADGNAIVIRPLADSDAAAFKALRLKAIQDSPSAVQPTYEEEAAR
FT                   TLDDMRHRIRVTEHEVVFGAFRGDALIGVTGLRRHVPVQAAHKAVLWGVFVDPAHRRGG
FT                   VARRLLDAAIGHARSARVLQIQLCVNTENPRALALYRGVGFEAFGVEPRALCVGGRFYD
FT                   EAHMVLRLDAGGGAAVPVR"
FT   gene            complement(284224..285492)
FT                   /locus_tag="RPSI07_mp0234"
FT   CDS_pept        complement(284224..285492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0234"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34590"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34590.1"
FT                   /translation="MTQTGTPDSSHARLQRLLGGAELSSLRQRIRNYFVRVANGTAGAN
FT                   LSLTQLNPTEREALALLVGRPTRTSRSMQINVEQLDRSLRDAGIAVSLRAALEVIDGPI
FT                   VNHPAHKAIVRSQWDHLAAQDQWCTPLRIWLKNPVSIGLLKRLSRQNPTAGQQLLERAD
FT                   AVLRRLPTQAIARAQLAAETLGDAHALDSGEPTATIVLATWRNREAALALDGEREDADQ
FT                   SDDRARNIWVRAGVLVNELARPALFLNLPIANGALVEGSPGEPTYASLRKLLRTPPAWA
FT                   VRNQTVFVCENPNLVAIVADRLGVASAPLVCTDGRPAAAQRVLLNQLVSAGAQLMYHGD
FT                   FDWPGIQIGNQLMSAWEAQPWRFTSLDYEAAIQKDSPLRHPLNGASVPASWDETLTAAM
FT                   HHHGIAIAEEAVAPVLLGDLDRG"
FT   gene            complement(285489..285938)
FT                   /locus_tag="RPSI07_mp0236"
FT   CDS_pept        complement(285489..285938)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0236"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34591"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34591.1"
FT                   /translation="MARALDYRRWHRFRVQRQRDKSSNWQKLSGPASSGERALGLTVPL
FT                   FAAIASFYGRGGNPYAPRLMLLDEAFAGIDDAARAHCMGLIREFDLDFVITSEREWACY
FT                   AELPGVSICQLQRREGVDAVFVSRWTWDGQAKLREGDPDRRFPDA"
FT   gene            286062..286451
FT                   /gene="insC"
FT                   /locus_tag="RPSI07_mp0238"
FT   CDS_pept        286062..286451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insC"
FT                   /locus_tag="RPSI07_mp0238"
FT                   /product="transposase"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10522"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10522.1"
FT                   /translation="MTSSKQEVMEVLTGPERRRRWSVDEKLAMVRESFEPGKTVSMVAR
FT                   QHGVNPNQVFHWRKLSQGGSLSAVSAGEEVVPASELAEALKQVRELQRMLGKKTMENEI
FT                   LREAVEYGRAKKWIARSPSLPGDDQ"
FT   gene            286409..287296
FT                   /gene="insD"
FT                   /locus_tag="RPSI07_mp0239"
FT   CDS_pept        286409..287296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="insD"
FT                   /locus_tag="RPSI07_mp0239"
FT                   /product="transposase"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10523"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10523.1"
FT                   /translation="MDSALAIVAGGRPVKQVCEVLGVARSNVAAKRARPADWCDGRTAR
FT                   QTDDAGLVDEIRHAIADLPSYGYRRVWGRLRREREGRCEAPVNAKRVYRVMRVHGLLLE
FT                   CRPTPSRPQRRHDGKVAVSKSNQRWCSDGFEFRCDNGEPLRVTFALDCCDREAMSWVAT
FT                   TGGYTGDVVRDVMLAAVEQRFGNVPKAPAEIEWLTDNGSGYIAGKTREFATDIGLKPLT
FT                   TPVCSPQSNGMAESFVKTMKRDYVAFMPKPNAATAARNLAIAFEHYNEQHPHSALKYRS
FT                   PREFRRRTESSTQV"
FT   gene            complement(287282..291010)
FT                   /locus_tag="RPSI07_mp0240"
FT   CDS_pept        complement(287282..291010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0240"
FT                   /product="conserved hypothetical protein; putative ATPase"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34596"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34596.1"
FT                   /translation="MTGTLFDSPQTAKPALPEPQRERWQPLRIGVVELFHYDSEEFWFR
FT                   DGHLLLRGNNGTGKSKVLSLTLPFLFDAQLRSSRVEPDGDNSKRMAWNLLMDGYQRRIG
FT                   YTWIEFGMRQADGSARYLTLGAGLSAVNGKTHVDSWFFLIEGQSPGQDPRIGQDLWLTS
FT                   EQRIVLTRERLRELLEGQGQGIVFENAHSYRRAVDERLFHLGPKRYEALMDTLIQLRQP
FT                   QLSKKPDETSLSHALTEALPPMPQELLVDVAQALNQLEEDREQLDKTRQLEQAVRHFEH
FT                   RYRIYAGTLTRRQARELRQAQTAFDNASEDRNRTQGALREAELAKDAATQAHDTAKSAL
FT                   ASARERLETLQSDPANQDANRLGQAEKDAKDREEEAAKSVSQHSLALQNLKREEERREQ
FT                   SERRTETARIEITTARSQCESEAQTAGTSFALSNNPAIELPVEEIAVLPAADVGTAIAK
FT                   LRIAANDRRNDIRHMERRHAALATKQSTLQTLQTTQHERRAELEDATERRAEADMAAET
FT                   EGNRLVDAWTTYCAGLEQLQLDVEQPLSQLATWVIRPDGPNPAQSALSVAYSDASVRHA
FT                   NRQAVLEARQASVEQEQTDLRAERERLIAGHDAVPPAPFTRSTDARQGRQGAPLWQLVD
FT                   FRPHVEPAGRAGLEAALEVSGLLDAWISPDGEVTQAEGAPIWDTQWRRRPPPIGESLLT
FT                   HLHPVTPDRCPIEPALVETLLASVACGREDDPSLESWVATDGRFRLGTLTGAWLKSEAI
FT                   YIGHTARTQARQRRLQAIDQRLHELGADADILSQDFENLANHRVRAKDELDGLPSDDAV
FT                   REAILATAGAAREVLQARKRFDNADSQCQAAEIDLQREREELANDATDLQLPVAQADLT
FT                   PIAHALDRFTETHHALSQAIREWQSAWPDYLQQREREAEARNTLTQREEEVRNANSRAE
FT                   QARARHSVLQEAVGAKVETLRHQLGEASQTVQRIDAEAELKQKALTDAATAYGVAQTHF
FT                   VGAENVLAERTAARALAIERLQRFTESSLLASALPDIPIPLGTATWTIDPALQLARRAE
FT                   QALANIADDDNSWARVQRQVSEDLTELQRSLSALGHQATSEPNDWGFTVHVTYQNRSER
FT                   PDTLAAHLADDVAQRSELLSAKEREVLENHLQAEIAAEIQRLMRAADKQVETINEELYK
FT                   RPTTTGVRYRLQWLALSSEEGGPIGLEIARERLLNTSSDLWSAEDRRVVGTMLQQQIAM
FT                   ERDGFAPAPPDTASHLS"
FT   gene            complement(291007..292281)
FT                   /locus_tag="RPSI07_mp0244"
FT   CDS_pept        complement(291007..292281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0244"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34597"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34597.1"
FT                   /translation="MNARSDRRRDNQRIGELQRAQQQDEFRQALRALLMRPLMAPDHEA
FT                   FSAVRRQADRLREWFAREAGWPLHVEREGARLFKRPANLVDDTRGLPNYDRQRYVLLSL
FT                   ACAVLERADPQITLQLLGERLMELAGDPVLTSYGFQFTLTSAAERRDLVAVCRTLLDLG
FT                   ILQRVAGDEENFVHESGWMQSDALYDVQRRLLAGMLAAVRGPSTWRTEEAPIDFKDRLH
FT                   SLVQEHVADSEQGRRDSLRHHLARRLLDDPVIYSATLSPEHFVYFVNQRGAMAARLCEA
FT                   AGLNPEQRAEGLALTDESGELTDISMPAEGTEAHATLLVAEFLANHLRDTPQTPDVSKD
FT                   AVADFLRSAVDRYGRYWRKSARQPGAETELADVALDRLEKLQLITRTQGKIFPLPAIAR
FT                   FALGNPEMRARSTDDISPKRSRATA"
FT   gene            complement(292278..293810)
FT                   /locus_tag="RPSI07_mp0245"
FT   CDS_pept        complement(292278..293810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0245"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34598"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34598.1"
FT                   /translation="MQANRMAAELFRHLSAEKSVFYRSIMEVFAAAKRQYRLQLRPDEV
FT                   LHEANWPEEPPRLEEVNAALAQLTEWGNLESQPDTARVSTLNDFYRARFLYRLSHGGEA
FT                   VETSLAVFFQTLQRRAELQTVALEDIAQRLQALQQLIDSDTPENGLDVAKIHQLLRDLV
FT                   GVFHDLAENAQAFMAGVARSLELRQAEASAIIAYKRRLIDYLDRFLGDLVRRSDSIARL
FT                   IQQLTPRVDAVFLQVAEREARDAAPGDLPHQTDEKLRRWRAWRERWKGLRGWFLATGSE
FT                   PPQVELLRARARAAIPQLLGAIAALNERRSGRSDRSADFRVLAYWFAACNSDSEAHQLA
FT                   RAAFALHPARHYSLNPQSDDDLPATTPWADAPPLQISPRLREYGEIAPRGPLARVRDRS
FT                   AERALMAEQLSEESRQVDMARERLATGRPVRLSELGDLDTHAFGLFLNLLGEALAEQAH
FT                   PDQTIERQTGDGLLHIRMEPLDAATQASITTPTGIFTGRDHLLTITSTQKTA"
FT   gene            complement(293825..294070)
FT                   /locus_tag="RPSI07_mp0246"
FT   CDS_pept        complement(293825..294070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0246"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34599"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34599.1"
FT                   /translation="MHTHCHLPVASTVQGLIGLLGRRYLKAGLQSPTSVSNMGKCRISA
FT                   ACATAVNKSTMLAYEMSIVQFALKGATGSAVDNGPY"
FT   gene            294503..294970
FT                   /locus_tag="RPSI07_mp0247"
FT   CDS_pept        294503..294970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0247"
FT                   /product="putative excisionase (DNA binding domain)"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34600"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34600.1"
FT                   /translation="MTAIAPSRMTLPAEREVQAAVQGQRALAAYLATRVETQQIQIFDD
FT                   QNQAHQVELPTSALRLLVDILAELADGNAVQVVPVHAELTTQEAADLLNVSRPHLVKLL
FT                   EEGELPFHRTGKHRRVRFADLMQFKEARDQASEQAIADLSRQAQELGMGYE"
FT   gene            294967..295542
FT                   /locus_tag="RPSI07_mp0248"
FT   CDS_pept        294967..295542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0248"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34601"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34601.1"
FT                   /translation="MRHSPFTAIYDACVLYPAPLRDFLMWLGLSGRFRARWSQNIHEEW
FT                   KRNLLLNRPDLSREQLDRTSAFMDRAIPDGLVEGYEELIEGLVLPDPGDRHVLAAAIRC
FT                   GASVIVTFNQKDFPEAALAPFGIEAQHPDEFVDNLFDLDAAAIVAAARRQRAHLVNPPM
FT                   ETDRYLEMLLRQGLVQTAKALGTYRLIL"
FT   gene            295937..301567
FT                   /locus_tag="RPSI07_mp0249"
FT   CDS_pept        295937..301567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0249"
FT                   /product="DNA helicase related protein"
FT                   /function="8 : DNA metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34602"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34602.1"
FT                   /translation="MEPVQGQAASAAGEDQSIFQSNLPLAEKLERARVELLDLSARNRL
FT                   LNMPRGARGGRSIEIIDEKAGEIFRLLVREGKAFTFVAGRAAETKDLVPEGADGASAEA
FT                   ASDKVPVEPDEIEELAQPDDDSTDERGVLRRHADTRLQTRLTGKGLQKRLLELYLDART
FT                   LEEEQGVNVLFLAIGALKWVDPNNAENIRYAPLLLIPVQLDRGNAGERFNLTVRQEDFA
FT                   SNLSLEAYLDRVHALRMPAFEASDTFEPLGYMELVRKSVETKDTWEVFPDHMSVGFFSF
FT                   AKFLMYRDLDQAVWPKGAAIGDRPLVRSLLADGFAGGEDLAHEDANIDALIPPSEMLHI
FT                   LDCDSSQALAIHEVRRGKNLVIQGPPGTGKSQTIANIIAAAVKDGKSVLFVAEKMAALD
FT                   VVKRRLDDKGVGDACLELHSNKANKRVVLDELRRTWELGAPKVTDPGSLFARLTEARDS
FT                   LNAHARNLHAVDSKSGLSPFQVIGHLVRLREQGERPNDIQLESPEQWGKDGFATRQDLL
FT                   ADLASRVIEIGRPADHAWVGVGLAAISPMDAERLVARVQQLLERVLAAQQQFAIAAELL
FT                   ELEPPLRLSDIHPMVELLQRIAVAPRLSAPAMGHDVWQNSDPTLHLLEIGQRYAAQREA
FT                   LTGRVVEDAWDADLGEILRAFTELPETFGAEQFERLARVSEELPRLLAEAAALARQLGR
FT                   EPGSTFGDFQTLTRIGERVASAPPASPETFASDLWNGGVERAGEVAQAVADFEAAKTAI
FT                   GSQLTEMAWSLSLAPARATLASRGSSVFRFLSGEWRAANRLVGSVLTTPNQPLPVVLGL
FT                   LDTLAKGQDAKKTIEAEDAFGRSAFGDDWRGARSQSAPLLALVEWMRSLKGLGAEPRLI
FT                   AARSPEKTEVAARAKQLSAVCLQIERGLKEAWEDLGAARGPIFDEVAAVERADLSSLLQ
FT                   LAVRYTRAHSAAGALIPAGVSSAGEVRTVLAALAAGQRDRQVVREGLTLGRAAFDGEWQ
FT                   AEQSNWAALKSAADWIGQNPDIRALAGRVGEREHLVPRAKVLAASRALIQTSLKGLADE
FT                   LQLDLEASIGGTILDARMEVLVWRLRRWSEEHEQLFRWVNYRDRSARARAQGCSDLVDR
FT                   LDDGRLAPEALASAFEMAYFEATYARMVRLEPDLARFDGATHGRLVQEFAALDRQRILA
FT                   ASAEVVRAHYQNVPPRDGGALGPLGVLRGEIQKKKGHMSLRKLVERAGPALRALKPVFM
FT                   MSPLSVAQFLVPGAMEFDLLVMDEASQIQPVDALGAIARSRQVVVVGDPKQLPPTAFFA
FT                   KMTSSNEDEDDEGATAVADIESILGLFTARGLPTRMLRWHYRSRHQSLIAVSNRQFYEN
FT                   KLYIVPSPYTAQGGRGLRFHHIHEGLFDAGNKRNNLIEAKAVAQAIIAHARTYPKLSLG
FT                   VAAFSAAQRRAIIDELELLRRGLSPEVEEFFKAHRSEPFFVKNLENVQGDERDVIFISV
FT                   GYGRSVPNGRVPMRFGPLGTAGGERRLNVLISRAKQRCDVFASMTDEDIDPAYAAERAG
FT                   VNAFRIFLQYARTGRLSMVEVTGRDHDSVFEAQVASVLRTRGYEVQAQVGLAGFFIDLA
FT                   VLDAERPGRFLLGIECDGAAYHSARSARDRDRLRQTILEEHGWTIHRIWSTDWFQRPTE
FT                   QLDVLIRRIEALKAEFDELREDVALTEQLDAEAPYVERETVTDEEDAAGFAPYEEVTLV
FT                   RPRHLIGELHEAPQGALTELVVQAVEVEGPVHRDHVITRMREAWGLKRAGGRIEDVVGR
FT                   SIDIAITTGRITRSGEFLSAPNRLPVPRDRSGVNAIALRRADMLPPAEIEVAALQLIER
FT                   SFGATRDQVIQAVSRGFGIRNTSSQVRSVLEQAVDTMIARRQLKEVAGVLTATDESRRS
FT                   AQ"
FT   gene            301799..302011
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0250"
FT   CDS_pept        301799..302011
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0250"
FT                   /product="putative transposase (fragment)"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CBJ34603.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            301920..302426
FT                   /locus_tag="RPSI07_mp0251"
FT   CDS_pept        301920..302426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0251"
FT                   /product="transposase, IS4-like"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34604"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34604.1"
FT                   /translation="MPRWPATGISRKSSSTRAHQHAALARPKKGEQALGRSRGGLSTKI
FT                   HALVDGLGMLARFRLTGGQAGDSPEALPLLGELRPGSVAADKAYDIDALLAQWKQQAAQ
FT                   AVIPSRAHRRERRPLDRHLYRSRNLVERFFARIKQFRRIATRYDKLAQRFSAFVSIAAA
FT                   FIWLR"
FT   gene            302460..302642
FT                   /locus_tag="RPSI07_mp0252"
FT   CDS_pept        302460..302642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0252"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10525"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10525.1"
FT                   /translation="MLEVAGSQRTNGRKSVDKETKRARISELFCQNFGIQWTPMELNIG
FT                   AQERTRTSTELPAST"
FT   gene            complement(302591..302675)
FT                   /locus_tag="RPSI07_mptRNA1"
FT   tRNA            complement(302591..302675)
FT                   /locus_tag="RPSI07_mptRNA1"
FT                   /product="tRNA-Leu"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            302891..304627
FT                   /gene="ggt"
FT                   /locus_tag="RPSI07_mp0253"
FT   CDS_pept        302891..304627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="RPSI07_mp0253"
FT                   /product="Gamma-glutamyltranspeptidase precursor [Contains:
FT                   Gamma-glutamyltranspeptidase large chain;
FT                   Gamma-glutamyltranspeptidase small chain]"
FT                   /function="4.10 : Glutathione and analogs"
FT                   /EC_number="2.3.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1360205, 7765305; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34605"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34605.1"
FT                   /translation="MNPKPGLRWCAAITSLWLTTSFVPSSYAASVAPVAAENGMVVAAQ
FT                   HLATRVGVDVLKRGGNAVDAAVAVGYALAVVYPAAGNLGGGGFMTIQLADGRKTFLDFR
FT                   EVAPKGATANMYLDKDGNVIKGASTKGHLAVGVPGTVSGMEYAREKYGTMRRAELIAPS
FT                   LRLAEKGFTLDQGDVDMLLTSTKDFQEDPASGAIFLNKGQPYQVGEKLVQRDLARTLHA
FT                   ISVKGTDGFYKGWVGKAIVASSQAGKGLITQEDLDSYKTRELAPVECDYRGYHVVSAPP
FT                   PSSGGVVICEMLNILEGYPLKDLGYHSAQAVHYQIEAMRHAYVDRNSYLGDPDFVKNPL
FT                   DRLLDKNYAAKIRAVIDPKKAGVSKDIKPGVEPHEGSNTTHYSIADKYGNAVSVTYTLN
FT                   DWFGAKVTAAKTGVILNDEMDDFTAKVGVPNLYGLVQGEANAIAPGKRPLSSMSPTIVT
FT                   RDGKPVMVVGTPGGSRIITAVLQTMLNAIDYGMNVQEAVDMPRFHQQWLPDLTNVENYA
FT                   LSPDTRQILEGMGHKFGPPQPANHLAAIIVGAPSLEGKPVGKNRFYGANDPRRNTGLAA
FT                   GY"
FT   gene            complement(304747..305904)
FT                   /locus_tag="RPSI07_mp0254"
FT   CDS_pept        complement(304747..305904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0254"
FT                   /product="putative glycosyl hydrolase or chitinase,
FT                   carbohydrate-binding family"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34607"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34607.1"
FT                   /translation="MKLRVSPRLAARAIAALCLSAAASASHATGVYAPYIDITLNPTPL
FT                   IDQIGVRQGIQQFHLAFVVAGTGCTPSWGGIQAIGGGASGDLLTTLATSIERYRARGGE
FT                   VSVSFGGAAGTPLMKACTTVPALKTAYQTVIDTYQLTHVDFDIEGSVQQDTAAVTRNFQ
FT                   AVAQLQSDFAAKGKTLHVTLTLPVLPSGLTQDGINTVNAAIANKVAFDTVNVMTMDYGP
FT                   ADIDMGAAAISAAQSLYAQLDTAYKAVGQVKTDAQLWRLVGVTPMIGMNDVQGETFTLP
FT                   NALSVLGAAYANGYGLVANWSVGRDQACPDNGAVVSPTCSGIVQRPYAFASIFRQLHGH
FT                   WGTGVLRDPNYGNETGGSTPASSATAAYRIGQCLTYQDAKYCTRW"
FT   gene            complement(306169..307143)
FT                   /gene="cysK"
FT                   /locus_tag="RPSI07_mp0255"
FT   CDS_pept        complement(306169..307143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysK"
FT                   /locus_tag="RPSI07_mp0255"
FT                   /product="Cysteine synthase (O-acetylserine sulfhydrylase)
FT                   (CSase) (O-acetylserine (Thiol)-lyase)"
FT                   /function="1.5 : Serine family"
FT                   /EC_number="2.5.1.47"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3062311, 3290198; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34608"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34608.1"
FT                   /translation="MAIRDGFTGSIGNTPLIRLAKLSEETGCEILGKAEFLNPGGSVKD
FT                   RAALYIIQDAERRGALKPGGTVVEGTAGNTGIGLAHICAARGYRCVIVIPETQSPEKMD
FT                   LLRVLGAEVRPVPAVPYKDPNNYQKIAGRLAQETDNAIWANQFDNLVNRQAHYETTGPE
FT                   IWRDTAGRVDAFVCATGTGGTLAGVARYLKEQNPAVRTVLADPHGSGLYSFVKTGSIQA
FT                   EGNSITEGIGSTRVTANLEGTPIDDAVRIDDQACVTMVYRLLREEGLFVGGSTGINIAA
FT                   AAQLAREMGPGHTIVTLLCDRGNLYFARLFNAAWLAQKGLMAG"
FT   gene            307441..309096
FT                   /gene="treA"
FT                   /locus_tag="RPSI07_mp0256"
FT   CDS_pept        307441..309096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="treA"
FT                   /locus_tag="RPSI07_mp0256"
FT                   /product="trehalase"
FT                   /function="6.11 : Sugars"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.2.1.28"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1710760, 8892826; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34609"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34609.1"
FT                   /translation="MLEPLRLARPFRSRAPSGLASATIVRRVTAAALLAASLCALPAGA
FT                   DVGVGAALPPSPDKLYGELFVAVQTAQVYPDQKTFVDTVPKADPAVILQAYRAQKDVPG
FT                   FSLKAFVDQYFTVLPETSVTPPAGLSLRAHINWLWPALTRTTTTAPDNSSLIPLPKPYV
FT                   VPGGRFREGYYWDTYFTMLGLQAAGRDDLVDGMLDNFAYQINQFGHIPNGNRTYYLSRS
FT                   QPPFFALMVELAARKEGEAAYTRYLATLRKEHAYWMRGSAGTAPGQASGNVVVLRDGTV
FT                   LNRYWDDEATPRPESYLQDVSTAQQAPDRPAAEVWRDLRAAAESGWDFSSRWFGDNATL
FT                   ATIRTTSILPVDLNALMFQLETTIAKGCAAARDFACTVEFAGHARKRAVAVERYLWHPA
FT                   GYYADYDWKLGKVRDNLSAAMTYPLFVQMAPWGRAWQTLRWTQTSLLQAGGLSATTLRT
FT                   QQQWDAPNGWAPLQWIALQASQHYGWQPLAQSIGERFLGSVERLYAAQQKLVEKYIVDG
FT                   SGTGGGGGEYPLQDGFGWTNGVTLKLLDAYGRGQ"
FT   gene            309212..309586
FT                   /locus_tag="RPSI07_mp0257"
FT   CDS_pept        309212..309586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0257"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34610"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34610.1"
FT                   /translation="MSSLRFYLDNAFRWRRGRQGTGYDKMLLATAAWPIRFDSYLVRYP
FT                   EGSEIPPHTDPVSDGRHYRLNVVLKSPRSGGEFVCANPIFQTRRIKLFRPDACEHSVTR
FT                   VQGGSRYVLSVGWVVGKRAV"
FT   gene            complement(309677..311104)
FT                   /locus_tag="RPSI07_mp0258"
FT   CDS_pept        complement(309677..311104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0258"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34611"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34611.1"
FT                   /translation="MRLPFSITRLAAGAALAALGTAALANCVVNPPSQSNASFPASLTG
FT                   KLAYHSYVSYGDGTSQLFIYDFAARTLTQVSKSTWGIQDPMNAVFSPDGKWLAFMGITN
FT                   NAWNVFLWQVGSSSLPVNMTNSTGQTRNEDPKFSADGKSLFFKQSGDVMQATLSYTSTG
FT                   PIFTSVVDITNTAPAIESSMPFATPDASAVYFATGSGASMGLYKETIATHTKVAFDTPA
FT                   GLQTYYPIVRADGTVFYARWKDATSQADQIYTKVNPGDTPNQLSLNDCNSNNSDPAPVN
FT                   GTNYVFFSSTTAGGYQLYLGDASTGQRWSLSQFGVNADTTKAKLGSSYYAGGTTASTST
FT                   QTTRLLSQGMPASASSSYNSSLGADKAFDGDTVNTRWDSIEGSAAGTQWLMVDLGTVRT
FT                   INGVDLYWDAGAKTYAIQTSSDGVNWTNIYTTSNGIAYGHAVLSNLRGSGRYVRMYGTQ
FT                   RATQWGYSIDEMQVWGY"
FT   gene            complement(311619..313592)
FT                   /locus_tag="RPSI07_mp0259"
FT   CDS_pept        complement(311619..313592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0259"
FT                   /product="Putative amino acid transporter-like"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34612"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34612.1"
FT                   /translation="MATIGRMWQLIVGKPLDPLDPRTRHAIAVSPLLAWVGLGADGLSS
FT                   SCYGPEEAFLALGQHTPLALFLALATAATVFIIALGYNQVIELFPTGGGGYRVATALLG
FT                   SRPGLVSGAALLVDYVLTVATSLASGVDAFFSLLPVGAQAFKLTTELTLVVLMTGLNFR
FT                   GMRESILVLLPIFLGFVVLHLGLIVYGVAVHGSALATVVPAAVGEAHTMSRTLGPLVML
FT                   ALLMRAFSLGGGTYTGLEAVSNNVNMLAEPRVPNGKWTMLYMATSLAFTAGGIILLYML
FT                   WHARPVEGQTLNAVVFGSIIDHLGLGAPFARNALLAAVLAFEAGLLLVGAQTGFLDGPA
FT                   VLSNMAHDSWVPRHFRDLSARLVRQNGIIVMGAASLVILLWTHGEVAVLVVLYSINVFL
FT                   TFSLSLLGLCTYWWRRRHGDERWWKHFALSAWGLSVTSTVLVITLVEKFTAGGWLTVLV
FT                   TSAVVVLCFLIRRHYDATRALIAKEDALFASAPPEVNATDAPDKPDPSQPTAILLVGKH
FT                   RGASMHALLWVHRLFPGHFKNVIFLAVGEVDAQSYDGAEHLDQLRQSITAALTYYVAFC
FT                   RRHGTAADYRIAFGTHPVGEFTRLAEATMAEFPDSVCFASKLIFKQVNFLTAWLHNQTP
FT                   LEIQTRLHMQGKQMVLLPMNVG"
FT   gene            complement(313779..315572)
FT                   /locus_tag="RPSI07_mp0260"
FT   CDS_pept        complement(313779..315572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0260"
FT                   /product="putative Diguanylate cyclase (GGDEF domain) and
FT                   c-di-GMP phosphodiesterase (EAL domain))"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34613"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34613.1"
FT                   /translation="MTALPSLLALPPGLDPATLRAVFQPIFHLSTSEVLGYEALLRGPA
FT                   GSAIESPAALFALARDAGNAIALEIAAAQIAIHAFSSLRLPGKLFLNFSAEAMRRLLEA
FT                   RARLLHTIADHDLHPSRIVFELTEQSPIDDLPAFARELSVMRDFGLQCALDDFGTGNAN
FT                   LNLLIELAPDFVKLDKYFVHDIATHPAKLDVARSLQQILKSAATSIIAEGLETEDELSV
FT                   VRDLGIRFGQGFFLGRPQDQPAGDISARAARVLQSSQIAVFPQAVRIGWRAITASKLLR
FT                   VAPTLSIRSTNDDMLTLFNRQPDLHAVALLDEHERPLALIARRAFIDRYAMPYHRELYG
FT                   KKPALVFANRQPVLVEKSASLEDMSALLMSEDQRYLTDGFIITEHGRYLGLGTGEELVR
FT                   TVTEIRIEAARYANPLTFLPGNIPLNLHIERLLEARAEFIACYVDLNHFKPFNDQYGYW
FT                   QGDEMLKMAAAVLATACEPTRDFLGHVGGDDFLVLFQSADWRPRIQRAMAAFNDNALAM
FT                   YTPADRAAAGIHAEDRKGLPAFFRCVTMAVGALQVRPGAARSSDDIGAAAALAKRRAKQ
FT                   NDHGFHFETMPPAGTRTGHSA"
FT   gene            complement(315730..316881)
FT                   /locus_tag="RPSI07_mp0261"
FT   CDS_pept        complement(315730..316881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0261"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34614"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34614.1"
FT                   /translation="MTRTPIPPADDTPPDTRRRLALDTYTLADLERATPRTLACVKASL
FT                   ARHGAIILTAEGAHRLHMRSLDAARSFFHADAAIKAAVDGRRHYAARHGDATLAFRHAG
FT                   IEHRCSLAELLGAERGWIPRGTSPSGANKEYLQYGVFGRRVADGLPGLKHNLWPCWPDR
FT                   AQTRAFRAAKIQQTRFHARLHRAMLALLDSELSPPGQPAAPAHPPYEIICRDTFYHPHP
FT                   AAPMAGAADRQAPRPIRNPAHVDLSNGTLVHYREGLQLYAGRQRERAAICRDEAGWFDL
FT                   DGASLPPDALIYLIGLATEITTHGRYLATWHRVVCGGPPGMHTPRLSIVSFCNAGIDDV
FT                   LPGGADLRASGIVYPPIERALLPVIGNVAYLESARGAEMCAVR"
FT   gene            complement(316878..317801)
FT                   /locus_tag="RPSI07_mp0262"
FT   CDS_pept        complement(316878..317801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0262"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34615"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34615.1"
FT                   /translation="MRARRPPCGATDMRAELIAYARQQVAAHGGNAADLATLVLIGSQA
FT                   YPEFARPNSDIDLIAVDAGPTAEEGVVLDHVCVDGRERLVEFRRFSPDGFRAYALTCET
FT                   PKLFAFVRGYRILLDMPGSGSAATIDLAIGRYFTDASRLLAGLLETGLEAHLHSARFMM
FT                   TDARNALSSERVRRQLLLVQLRLCEIAKDFIAVVWMALLLRKASPLERVGVDRTCPLLQ
FT                   EAGLLSVFLGARGGRMVDPEKYPKSPEIAAVIVQVSHAATDIARGDIDAFFVALASIFA
FT                   MQFQRELFIALESVRPATPVAVGLPS"
FT   gene            complement(317750..318799)
FT                   /locus_tag="RPSI07_mp0263"
FT   CDS_pept        complement(317750..318799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0263"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34616"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34616.1"
FT                   /translation="MVRLAQFDSLASTDVRCSWYGDVRHRWINDRTIALACPWYSVEIR
FT                   LAAGIGPAGRRAQAIEALPASLVELPLVLIRPCRARPAATHREGDAADITAVRAIPALP
FT                   ENPPPGVTPPTICSSPAAIREIAAEAEIDGQIHALCAYSAIRRGIFSALADDAASAPPD
FT                   LALITHCLQQSHYLTSRSVAALSQGRHAEAGSAYRDLLMSYIAQERGHHLLIREALAAI
FT                   GQIPRLERVSRFTRYALELLAWSARHHPFAFANALGYFEMSGFLEADPIADALIDLGYP
FT                   EAARPVQRHFDINRRQGHAAVGLHLADKLGGIGLSDLSVAAHTLERLAFALRCALADRP
FT                   AAQPTCEPN"
FT   gene            complement(318812..319204)
FT                   /locus_tag="RPSI07_mp0264"
FT   CDS_pept        complement(318812..319204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0264"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34617"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34617.1"
FT                   /translation="MLRRQATAVIGYIIEGDKPGYFYNRLGQWHQYKAVAEGYVWSDEE
FT                   VAAIRQASDSATTKWEIQPQTAHPAIYDDRSGATVVTGKGVPIGSLTVHLLQGVTVPLT
FT                   NGSLFNLEQVSGRLGVNHIASVMVSL"
FT   gene            complement(319599..321626)
FT                   /locus_tag="RPSI07_mp0265"
FT   CDS_pept        complement(319599..321626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0265"
FT                   /product="conserved hypothethical protein with TPR repeat
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34618"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34618.1"
FT                   /translation="MTTNSSRTTQNTPPRAGSSKTQSALPFLQMLLGSGRFKEAFLAAA
FT                   SISQQESNPVILNIAAIAAREANDLASADLYWSRCIEQFPQDGNAYINRGNLLAESGDA
FT                   EQAEHAYLKAIELNPDTPDAWYNLGNLYSRSRQYQAALGPYREALKRVAGRPDLHNSMG
FT                   CACSELGLTDEALQHLQRAVQLAPRYAEAWLNLGLLHRDTRQLKAAVDALQHAAIPGDP
FT                   SEAQALSELAMVQMSMCDWAAAARSEARLLGLLRAGRATGVAPFVTLALPNCTASDQRM
FT                   AAAQATRQAAPAITPVTGDPAPRSPGRIRVGYLSADFHAHATAYLLAGVLEHRDASRFE
FT                   TFLYSYGPQTDDDMQRRLRAACEHFVHIAPLSDGQAAQRIASDDLDLLIDLKGFTKHAR
FT                   LDIGAMRPAPVLVNWLGYPGTLGSKRLADYLIGDPVVTPVSQQAQFEETLALMPHCYQP
FT                   TDRRRETLPPPDRADVGLPADGFVFCCFNQAYKITEARANTWFTILSRTPGSVLWLLEP
FT                   DASAKAALLESARRHGVESHRLVFAPQVAQREHIARLQLADLALDTFPYTSHTTASDLL
FT                   WAGVPLLTRMGDTMASRVAASILQAAGLHDLVVTTEEDYVDAAVRLAGDAQALASVRLH
FT                   AQAARNTPLFDTRTFARDLETLFGRIVERSADTMPDPIVL"
FT   gene            321916..322320
FT                   /locus_tag="RPSI07_mp0267"
FT   CDS_pept        321916..322320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0267"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34619"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34619.1"
FT                   /translation="MKKPTLLEVAILPWDWDEPVQLLQSLREQLQAVDPMFGVDWSASP
FT                   QEQAPDEPVGFVFLLALEPGLAQPLAQGIYSWLTVHEKNTVILRNEGQAVELTEGLGFP
FT                   AVYRGIQLMLPGEPGQTPTQFPLPPESDGD"
FT   gene            322471..323649
FT                   /locus_tag="RPSI07_mp0268"
FT   CDS_pept        322471..323649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0268"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34620"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34620.1"
FT                   /translation="MFTGLSKLVDKSFVLGFFLPALVGTLAFLFLNHDIGPLKTLLGDV
FT                   AQEKVFSNLTVMLLSVWTFAVLLMAGNHSMYRVLEGYVWPLKQPRLRERQLERRKQQRQ
FT                   GARDAFAAIAAAETLLGSMTDEAKRAEQERRLAGLRLRYLGLRRKLALEYPEQRELVLP
FT                   TRFGNVLRAFEMYAGNVYGVESIHAWPRLLAVVPKDYQETLADARAPVDFFVSLVFVSF
FT                   VLGGVALARCAAEFPSGLHGIQPWWFAGVCTMAFVVSRLCYLAAVSTAIAWGETVKSAF
FT                   DLYLPLLATALGYALPATTTERRRFWEDLANQFQFHEPLDPSRWLPVATAQASGEAPTP
FT                   KVSSPEDNGSEGEDTPGDDSEDTGAGGEAARETGATDPKSAPSLAECPASST"
FT   gene            complement(323771..325402)
FT                   /locus_tag="RPSI07_mp0269"
FT   CDS_pept        complement(323771..325402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0269"
FT                   /product="putative amino-acid permease"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34621"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34621.1"
FT                   /translation="MEKHVQRNLGAWPLMLTGLGSIIGSGWLFGAGHAAQVAGPAAIFT
FT                   WVIGAVVILAIALTYAELGAMFPESGGMVRYARYSHGSLVGFVAAWANWIAIVTVIPIE
FT                   AEASIQYMSSWPWPWAQGLFQHGELTPLGLALSAVLVIIYFLLNYWGVKVFAKANTTIT
FT                   VFKFVIPALTAVALIGAGFHPSNFGGTEAASFAPYGWSSVLSAIATCGIVFSFNGFQSP
FT                   INLAGEARNPGRNVPLAVIGSIVLAAVIYVALQIAFLGAVPAESLAKGWHGIDFHSPFA
FT                   QLAIALNLNWLAIVLYLDAFVSPSGTGSTYMATTTRMIYAMERNNTMPAIFGRVHPIFG
FT                   VSRSAMWFNLAVSFIFLLFFRGWGALAAVISVATVISYLTGPTSVMSLRKSSPGLHRPL
FT                   RLRGLSVIAPFAFVCASLILYWAKWPLTGEIIVLMLVALPVYFYYQAKAGWPDFKRELK
FT                   GAWWMIGYLPAIAALSYCGSTEFGGLGLIPYGWDMVVVSTVSLFFYYWGVASGWHTRYL
FT                   DEVEQVYEEIAAPAGEQMPGGMPQGV"
FT   gene            325752..327116
FT                   /gene="dinF"
FT                   /locus_tag="RPSI07_mp0270"
FT   CDS_pept        325752..327116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dinF"
FT                   /locus_tag="RPSI07_mp0270"
FT                   /product="DNA-damage-inducible SOS response protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34622"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34622.1"
FT                   /translation="MEYSSAIPAAPGRPAQWHRRVLALAFPIVLANLTQPLLSAVDTAV
FT                   AGHLPGPAYLGGVALGGVFFNFVFWGFGFLRMGTTGLVAQAHGAGDARALRANVVRALL
FT                   LALGIGLALLVLQVPAIRITLALLGASEAVTRMAEIYCHARIWSAPFALANYVVLGTLL
FT                   GRQQVRLALLLQVFINLVNMVAVLGLVLGAGMGVGGIGAATAAADILGFVLGMALLWLL
FT                   RRDGMRGLPPMTRAELLARDAWRRLMGLNADIFLRTACLLAAFGWFAHAGAQQGDVILA
FT                   ANALLLNFLTFMAYGLDGFAHAAEALVGAALGARDGRALRSAIRVSTLWSVLGAALFSL
FT                   VYAVAGGTIVGWLTDQPAVREAARHDLVWAALLPVVSVWGFQFDGVFIGATRTRELLLT
FT                   MAFSAIAFWLLAVALQPRWGNPGLWFAMLAFMALRGMTLGLLLPRVLHAVPPRAA"
FT   gene            327421..327507
FT                   /locus_tag="RPSI07_mp0271"
FT   CDS_pept        327421..327507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0271"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34623"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34623.1"
FT                   /translation="MLHMAAVLIFMVGAIDSLFLFFYTRRKP"
FT   gene            328088..328978
FT                   /locus_tag="RPSI07_mp0272"
FT   CDS_pept        328088..328978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0272"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0272"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34624"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34624.1"
FT                   /translation="MKAVLLENHPLLRAGLAQVLAHPTLGLEEVSAPEWPHEPLDPADL
FT                   LVVGIDDANVPLDAARLRGLIAQSTPRHVVVLAARVTAEEVHAAMACGADAYVAKTQPT
FT                   GVLLATLQLVLAGGQAYPALMPRAPQDVAEPPAIRAAEAAQRLNVSQRQYEVLVLLSRG
FT                   HSVKGVGRLLGISEATVKTHACTLYRRLNVRNKSEAVYAVMRLGIPLELHGNPAMAPAG
FT                   DRLPEAVARAGVPRAAIEAVEAPACVPSSRPAGNEPADETRWAAMTRAFGVTAAPKGGR
FT                   SPVRVANGAHRPGMG"
FT   gene            329151..331589
FT                   /locus_tag="RPSI07_mp0273"
FT   CDS_pept        329151..331589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0273"
FT                   /product="putative hemin-binding outer membrane
FT                   transmembrane protein associated with biofilm formation
FT                   (hmsH)"
FT                   /function="16.5 : Explore"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34625"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34625.1"
FT                   /translation="MTVPAPVSPLARAGRPDPADLLDSRRCAIAAATVVLVGAAPLAAN
FT                   AARPSAGSAGDAASAATRRLIDAELGELNGTAAPATATAQSDADGLPASPARTVLVAQQ
FT                   TAPAATPPQTQTPAPAAEMAPASPPEETPPPSPTVILPPAAQPPAPAVVTPPGPSLQGP
FT                   APGALTPLPVAPAAPGAEAASPPQPTPTAPMPTERDAYRAEVLRESREGAATLALAHLR
FT                   EHPDWFTDSESWHVEHAAVAQRIRWGRQQLKSLSGPERFVIIDQAVAETEALLKKVPET
FT                   PENAAFRQEIVADEVVALASRGRMKDATQRYEAMSQAGKMPAYTRVSAGDAYAYLEKPD
FT                   RAAAAYAQALKDAGPGEIETGDVQEGLFYADLDTGRYEDARALLDKMKAGNPEYVRLAP
FT                   EAGTPNPDYSRVKRLEAQYLVLTGRTHEGIAALDQWRHEAPFAASFVSARADGAMVQAE
FT                   PYTARTMYKTALSEHPDDLSVMSGYGRASLALDDLKTAKDVADGLDERFPENGSVHALR
FT                   KDLDVYQSPQLIIQAAGDKGNAVFADQEFGVDTKAYSGPFVDHYRLFVHNFSGRADFQG
FT                   ASQSRVRNGAGVQWFDTGIEVNGEVHQSVGAAGKTGGTLDASWIPSDHWKVSGLVTNDD
FT                   LEVPYKAYAAGVTGKTATGNVRYTWDETRYASLTYGLSRYTDNNLRQRWDANFYQQVFS
FT                   SPRHTVGVLFGAGTSSSTINTVSYFSPSRDYSGQATAIWSWTPWRYADKSFTQRVYLTG
FT                   GVYNQQSFGTSPMVEARLEHVWQINRKTQVSYGVGLGRHRYDGQPETRKFIYLNLNIPL
FT                   "
FT   gene            331640..333778
FT                   /locus_tag="RPSI07_mp0274"
FT   CDS_pept        331640..333778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0274"
FT                   /product="putative polysaccharide deacetylase associated
FT                   with biofilm formation; putative lipoprotein (pgaB)"
FT                   /function="16.5 : Explore"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34626"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34626.1"
FT                   /translation="MAVLAMALLAFARPAAALPVDFLPKPDSADGKTFRVLCFHDIRDN
FT                   LRASFETLPDPFAIDTKMLTNMFSWLQANGYHPVTLAQIGEARRGGKPLPSRPILLTFD
FT                   DGYESHYTKVFPLLKQFRFPAVFALVTEWTDAPRGAKVKLSDKQIVERDFFMNWDQIRE
FT                   MQASGLVEFATHTHDMHHGTLGNPQGNEMPTASTHAYLPKLGRYETDDEYRKRVRADLQ
FT                   RSIDIIQKNTGAKVQSVVWPYGAHNLMLDQEAANVGLKYMLTLEPGPNTPDVPLTDIRR
FT                   SLMGYDTDTGNLERSLREPVTHHGEINPVQRVVQVDMDYIYDPDPRQQEANLGRLIERI
FT                   KDLAPKVVYLQAFADPKGNGAVDSVYFPNRHMPVRADLFSRVAWQLKTRAKVEVYAWLP
FT                   VLAFKLPDQNPVSTHLVQAVPGAPQKQKAGKPPRLSPFDPEARRMIRDIYEDLAKYAIF
FT                   DGILFHDDGVLDDYEDAGPAALKAYEAMGLPGDINAIRRSPERMQKWTRGKTAALIAFT
FT                   HELIGVVQGYQNGRDMLTARNIFASPILDPDAETWTAQNYDDFLQAYDYVALEAMPYME
FT                   NARDPKDWMAKLVAAVGKHRDGLRKTIFELQAVDWREHDKPVPTPELRDQMRRLRAAGA
FT                   LNYGYYPDDFIAGRPDTEVLRDVMSMKTTIETRRVPSRAEELKAIPPTTAPGAANKTSE
FT                   APRNPVAESGGQAAGTGG"
FT   gene            333782..335056
FT                   /gene="pgaC"
FT                   /locus_tag="RPSI07_mp0275"
FT   CDS_pept        333782..335056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgaC"
FT                   /locus_tag="RPSI07_mp0275"
FT                   /product="Biofilm PGA synthesis N-glycosyltransferase pgaC"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34627"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34627.1"
FT                   /translation="MDLLLVKRWISGFVFYYPFFMSYFWMIGGLLHFFLLERGTQGVRY
FT                   PLALLGVKVYPKVSIIVPCYNEEANVREVISHLARMRYPNYDIIAVNDGSSDRTGERLN
FT                   ELAARYPQLVVIHQSSNQGKAIGLTTAAQVTDAEYLMCIDGDSILDVDAIAWMIRHLLE
FT                   NPTLGAVTGNPRIRTRSTLLGRMQVGEFSSIVGLIKRTQQVYGRLLTVSGVVVMFRKHA
FT                   LEEVGYWSNDMLTEDIDISWKLQVGGWIIRYEPRALSWILMPETFRGLYKQRLRWAKGG
FT                   IQALIKYAPAMLSLRQSMMWPIFFEYALSVVWAYNMLFVIAWSVLGFFIDMPPEWRFEA
FT                   FPRWHGTLLFITCVLQLLVGCYIDRRYDDGILRYFIDTVWYPVAFWILNLITTVVGFPA
FT                   VAFQRERARARWTSPDRGIQQGNPP"
FT   gene            335053..336018
FT                   /locus_tag="RPSI07_mp0276"
FT   CDS_pept        335053..336018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0276"
FT                   /product="putative transmembrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34628"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34628.1"
FT                   /translation="MTMLVIDVSRNSIRQSFSDKGIVGTVQHVLWFRIFRPLLVISIWG
FT                   LLGLYVGYSISSVGPSGLPFEQLRLYGNIIAGMGAVLLMWMILSRLDRAIRRKTARAPA
FT                   SAASRSTASRAPSWQRPRNTRLLVVDHDEDGGITRVRSWHEWAGRPAPAGTATPPAPFT
FT                   RSPEYDPEEPTLSGSGIIVVEHGRTEPSLARTLPPVTQAQTVSEVEAVTEAEVEAVTAD
FT                   AAGFHRFGYRGKIGRTDWQDPAPVGFGMHPGMVRHYGGVSAVAHGRPVIVATRPTARNL
FT                   HAFGAHAQLVDPYAEMMRPEARVDPLHGFGRRANVVADGV"
FT   gene            complement(336048..337262)
FT                   /locus_tag="RPSI07_mp0277"
FT   CDS_pept        complement(336048..337262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0277"
FT                   /product="putative Glycosyl transferase related to
FT                   UDP-glucuronosyltransferase-like protein"
FT                   /function="6.14 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34629"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34629.1"
FT                   /translation="MSRILFAWELGANLGHLARDLPVAQRLREQGHDVAFAVKDVRVAE
FT                   QILSPAGFPFVQAPILTAGRLSRHTPASYSEILIGAGYGDIAGVSARVNAWASLFALHG
FT                   TRTLVVNHAPTALLAARATGLAAVLTCIGFELPPMVSPLPSIRAWEDIAPERLHRADAV
FT                   VLNTLNTILTRHGRSALKRVADLFSGVAAALTTFPELDHYGARKDAVYVGPLSSINHTA
FT                   AFPWPDASGKRVFAYLRPSVPGFEPLLSALADIDAWTICVIPGISRDTMQRFASPRLNI
FT                   LTRPVTLGTTLTEADLAVVYGTGTMTDALMAGIPQLMTPQVVEQMLAAQRIEAIGAGIL
FT                   WKAPRSRETASALLKAALCSTSLRQNAERFAARYRNHSPERALSTITDMIHAAGSSVRG
FT                   QAGLP"
FT   gene            complement(337316..338800)
FT                   /locus_tag="RPSI07_mp0278"
FT   CDS_pept        complement(337316..338800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0278"
FT                   /product="putative Outer membrane efflux protein precursor"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34630"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34630.1"
FT                   /translation="MHGRVCVSGKPNPGIGSARWWLLLGSLCCGLVSTQAWGRSLGGLV
FT                   DDPLFARPPVLDTGAVLPSDAQPIPCPARGDLTAPLALGEAVDLGLCNNPQAKAAWAAI
FT                   KIQAGAVGEARAAYLPTLTGSLSAMRTRNEFPERPEANSTSSGHTVYLGFNWRLFDFGA
FT                   RSANREAANLLLAAAISGHDAALQKVLASVVGAYFDALTQQAAMQARAEATRLARDTVE
FT                   ATERRERRGAAGQSDTLQARTAFAKAQLAEQRAMADFRKALSALAYALGLRPGTAFQLA
FT                   ELNDATDSQSVGELARWLDEAAARHPGIAAARAQWDAANARVAKTRAEGLPTLDFTANF
FT                   YQNGYPNQGLQSTRNNVSTVGVTLTIPLFEGFSRTYKIRGAEAQAEQSEAQYEDTKNQI
FT                   LSDVIKVHADAVAAVDNLQASDVLIRSAQAAMVSSEKRYAKGAADVLELLSTQSALIDA
FT                   MQERVRCLSEWRSARLRLMATAGVLGREHLDSPLAR"
FT   gene            complement(338772..340115)
FT                   /locus_tag="RPSI07_mp0279"
FT   CDS_pept        complement(338772..340115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0279"
FT                   /product="Type I secretion adaptor protein (HlyD family)"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.9 : Pathogenesis"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11755084, 2184029; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34631"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34631.1"
FT                   /translation="MSLRHRWEAWSELWQRYRDIFRHYWKQRDALSLPRLEVHEAEFLP
FT                   AALSLQAQPVSPVGRWVARILILLIVVLLAWSILGKVDIIVNATGKIIPSERTKTIAAV
FT                   EVATVRKLHVEEGQVVKAGDVLIELDARASDSERDKAVGNAQLARLQAARSRALIDALG
FT                   HGRTPHLPTLEAIPPERWHEAEQHLVDQWRDYTAKLNRLDGEIRRYAEELPIATQRARD
FT                   YADLAKDRDVSRHAYLEKEQARIDIEGQLRDARDQKAALTAETRRVAQDSLTDAKKILG
FT                   ESSEDARRASAHSEQLKLVAPVSGTVQQLTVHTVGTAVPLAQPLMQIVPEQSVVEVEAF
FT                   LENKDVGFVQEGQEAQVKIDTFEYTKYGTIPARVTHVSRDAIEDEKKGLIYSVKVTLDR
FT                   TSIDVDGRKIKLSPGMSTSVEIKTGTRRVIEYVLSPLIQHARESLRER"
FT   gene            complement(340112..342286)
FT                   /gene="cyaB"
FT                   /locus_tag="RPSI07_mp0280"
FT   CDS_pept        complement(340112..342286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaB"
FT                   /locus_tag="RPSI07_mp0280"
FT                   /product="type I (cyclolysin-type) secretion system
FT                   ATP-binding component, ABC transporter, transmembrane
FT                   region"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="16.4 : Excrete"
FT                   /EC_number="3.6.3.43"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7830567; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34632"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34632.1"
FT                   /translation="MTSTSIDTPAPPGPEPTRADIDTALACILMMARLHGIAAEEAQLR
FT                   HEFGHRAFDTQTALLAAKHLGLSAKVVRQPMERLHRAPLPAIAIDQSGQHFILAKYDAT
FT                   NADEPKLLIQRPGHPPSVLTLQDFLAVWSGELVLCTSKATFAGDMAKFDFTWFIPAVVK
FT                   YRKLLGEVLLVSLTLQIIGLVTPMFFQVVMDKVLVNHAMKTLNVIAIGLICAILFEVTL
FT                   TGIRTWVFAHTSSKIDVELGARLFRHLLSLPLAYFQSRRVGDSVARVRELENIRSFLTG
FT                   NAMTVVLDLLFSFVFLAVMLWYSVWLTLIVVVSIPLYIGLSAVFTPIIRARLDVKFNRN
FT                   AENQSFLVETISGIDTVKAMAVEPRWTHKWDQQLAAYVTAGLAVTNVATVASSGVTLVS
FT                   KLVTAAIMWLGATLVIDHKMTVGELVAFNMLAGQVSSPILRLAQLWNDFQQVGISMSRL
FT                   GDILNARTEVAGQKSRLPKLAGAIAFDQVGFRYRPDAPDVIRGISLAIMPGEVIGIVGR
FT                   SGSGKSTLTKLVQRLYVPERGRVLIDGQDIAIVDTTSLRQQIGVVLQENTLFSRSIRDN
FT                   IALTNPAAPLEAIIEAARLAGAHEFICELPEGYDTIVGEHGTGLSGGQRQRIAIARALL
FT                   TNPRILIFDEATSALDYESEKIIQDNMRRICQGRTVLIIAHRLSAVREANRIIVMERGQ
FT                   VAEMGSHDQLLQNPQGIYAHLYALQQGGAA"
FT   gene            343524..345788
FT                   /locus_tag="RPSI07_mp0281"
FT   CDS_pept        343524..345788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0281"
FT                   /product="putative hemolysin-type protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34633"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34633.2"
FT                   /translation="MTDRFNFETGFPGGRDPKQPGVTGVLPPGLYTVDALLDFYGIPED
FT                   KRTQSVRLYYQGVFAVLPGQRAQVSGFRTVVTDAAGNRSIHSLTQDARGDRIETIYQAA
FT                   GNWQTTVQDRAGNRTTTYYSAAGVLVGDEWSKVNGTHGTDAFFADGSSIRTSDSNATGH
FT                   TVVKDDGQGHVTHIYQSTGKNQRLVGSGTNDTFVVDHQGVTIDEPAGGSNALVQTSLEF
FT                   FKVPDRVDQIVLTGSGSGEQIVVGNSADDSFAVNRAAGSYTELYLGDGNNTVSSGDGDI
FT                   SVLVGAGNNDLILGNGNNVVEANRFLRNPKAGDGNNQAYLGNGDNDVTLGNGNNIVGVG
FT                   TGDNTITVGNGSNTLYAGHGAGTNTITFGDGANVVTVGDGDNTVAGGNGRNTIWGGQGA
FT                   NYVTVGNGDDTIGLGNGDNAVTAGNGANDVSVGNGDNQITLGGGHNTVNTGSGANTVIA
FT                   GDGGNAVYAGDGANTIALGAGDDTIGVGIGNNTIDAGGGDNTIYAGRGAGNNAIKAGDG
FT                   RNVVTVGDGANSVRLGNGNSAVYVGNGNNQIALGRGDNAVNGGNGANVLAAGDGNNTIW
FT                   MGSGSNLIVVGNGNNAIGAGSTIGSRNTIQVGNGVNAIEVGAGVNDIYVGNGADTVKTG
FT                   NGVNSLHLGTGQVTLTNYGGQDTVYLSSSVQEDQLWFAQDGNDLLVTVDGTSSNLRLTD
FT                   WFNGAAHATLVASDGHQLIDSQVASLVQAMAQFAPPPAGQTSLSPEQRENLMPVIASSW
FT                   K"
FT   gene            345967..346476
FT                   /locus_tag="RPSI07_mp0282"
FT   CDS_pept        345967..346476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0282"
FT                   /product="putative acyltransferase with acyl-CoA
FT                   N-acyltransferase domain"
FT                   /function="16.8 : Protect"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34634"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34634.1"
FT                   /translation="MVRIRSFHPGDEPALHAIFYSAVHQLAATHYTAAQLAAWAPADHD
FT                   AAQWAERIRRIQPFVAEIDGRPVGYADLQSSGYIDPFFVCGAYARQGVGQALMNHLLRQ
FT                   AGARDIRALSVLVSRNAEPFFLRNRFTVAVRQQVAVRGVILPNAWMTRTLPLIPSNQVV
FT                   PRNEGM"
FT   gene            346603..348150
FT                   /locus_tag="RPSI07_mp0283"
FT   CDS_pept        346603..348150
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0283"
FT                   /product="MCP: methyl-accepting chemotaxis protein"
FT                   /function="12.3 : Protein interactions"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34635"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34635.1"
FT                   /translation="MKTLSIKARLALVLFVLAAFLAGVGALGLVGNLRSNAALKETYSN
FT                   NLASTRTLGQAESKLAQARTALDRAIFETDPAKMADAISRIDAQLRNSEKAWTEYLNLP
FT                   FSTPEEEKVAGEAKKQRDLIIKGNIAAAVEALKRGDKDAARQLAVEQLPMNFRTYATQS
FT                   DRLNAIQTEVSGAAYEAAQSFFKGLVWTFVIVIAVGLALAAGCYLILSRAISLPLAEML
FT                   VHFREIASGNLTTDVRVRSRDEMGVLMEGLQQMQGKLKETVLTVRRGSESIASATQQIA
FT                   AGNTNLSQRTEEQASSLEETASSMEELTSIVKQNADNARQASTLAENASGIAMQGGAVV
FT                   QDVVTTMGQISESSRKITDIIAVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEV
FT                   RTLAQRSAGAAKEIKSLIEDSATRVESGSSLVARAGKTMDEIVVAVRRVTDIMGEISAG
FT                   SAEQSTGIEQINEAVTQMDDVTQQNAALVEQAAAAAQALEEQADELRRAVSVFRVAA"
FT   gene            complement(348211..350133)
FT                   /locus_tag="RPSI07_mp0284"
FT   CDS_pept        complement(348211..350133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0284"
FT                   /product="putative type III effector protein (AvrPphD
FT                   family)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34636"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34636.1"
FT                   /translation="MGNLQIKASSTPYALLSDAGPESPGSQPPTPKLTRVASPPQALAD
FT                   LPTKGAGKRPQVSAQPSSPKATAGPSRASSAELPLSTPAPLPLTSLLPSPESDETPEKL
FT                   GAVTISGNLQIKNGQLTSNNETIRSLIHYLGATADLFANRADLNGMQVTIRPNPYAVAG
FT                   HEALKEHCSVDEAFVRADKLPRRKPASNAQQAPLLPTQLKSEEIEGNVLMPLLTGVIES
FT                   GPAAFGTNDRIKLGDKNQEVTVHALLAALAPRVEVNDPELQLEFNNKLSANTYASAKLG
FT                   AATLLQMETHKTFALKELAMSLGVSSGLGTLWELGGAEAIKNALKSLNLSPTRYALAAA
FT                   GVDSVPPIVIETMDSAIVLSAVKAMNRAAASFLQRVRDALPDAAVAGLKSALGSYPNNL
FT                   LQYLSTGSYSADLALNTAATEVAILSAASGIPGEVKGNEANMKAAILEKIRDGLLAIPP
FT                   REPHMSPEQYTAIVEKHVQTLTRRALDMSPGDGIAQKSLAFASMVGLIPLLLSNKVTNL
FT                   VPENVLRIVRSTVFNPIESIGMNFLVLTSKIDIPGLMSSDATKHAQTMGRILQEAALGK
FT                   PLQDGEVHKTFHQWDGLTRGGRAILNGMSATMDAPPQKVMSMIKQAPPPLSQRIAYESI
FT                   NYDPV"
FT   gene            complement(350564..351331)
FT                   /gene="fabG"
FT                   /locus_tag="RPSI07_mp0286"
FT   CDS_pept        complement(350564..351331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="RPSI07_mp0286"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="16.2 : Construct biomass (Anabolism)"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34637"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34637.1"
FT                   /translation="MSHSPSTLSNPRLAGRTAIVTGGSRGIGAAIARRLAADGARVAVV
FT                   YRSNGAEADAVVRAIRGTGAEAIAVQADVSDAASVHTMVDTAQRAFGSIDILVNNAGIL
FT                   ASQPVGGIDQASFDRQFRTNAFSTILVSQAVLPQMPARGGRIVNVSSSLVFRPRAGLAV
FT                   YAASKAAVSALTQAFALELGPRNITVNAVAPAMTRTDMTAPLPDELKARMRDATPLGRL
FT                   AEPDDIADAVAFLASDDSRWITGRTLLTDGGFI"
FT   gene            complement(351453..352040)
FT                   /locus_tag="RPSI07_mp0287"
FT   CDS_pept        complement(351453..352040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0287"
FT                   /product="conserved hypothethical protein, DUF1470"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34638"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34638.2"
FT                   /translation="MPTATPTPASNMPASIADHPVLDMLNTVANVNGQLRDSWQTDEDV
FT                   SAWLLRDGGADGPLAGRYPPGALLAVARHLREVIRTLVRSRKAGKRANPDALNVFLRQS
FT                   PSHPVLLWQGDTPRMERRRPADSVEQCLAPLAESAAQLLADGDFRRIRVCEHPDCTLWF
FT                   YDRTRSHKRRWCSMAACGNRHKVAAYRRRQQG"
FT   gene            352200..353288
FT                   /locus_tag="RPSI07_mp0288"
FT   CDS_pept        352200..353288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0288"
FT                   /product="putative 2-nitropropane dioxygenase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="1.13.12.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34639"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34639.1"
FT                   /translation="MGTWPDTRLLALFQIDVPIVLAPLAGVGGVELAVAVARAGGLGSL
FT                   PCAMLNADQIREQVGQFRAAVRAPINLNFFCHVPPRPDPEREARWRAHLAPYYAEFGID
FT                   PTATAPFVNRAPFDEAACAVVESLKPEVVSFHFGLPEAGLLARVRATGTRILSSATTVE
FT                   EARWLEAHGCDAVIAQGAEAGGHRGMFLATAVESQVGTFTLVPQVADAVRVPVIATGGV
FT                   ADARGMAAAFALGAAGVQIGTAYMLSPEAKTSAIHRAALKRATDGDTALTNLFTGRPAR
FT                   GIVNRLMREVGPMSPFAPAFPTAGGALAPLRAKTEPAGSGDFINLWSGQAPRLATEDSA
FT                   EAITRRIAAQALERLAPATGPA"
FT   gene            complement(353492..354409)
FT                   /locus_tag="RPSI07_mp0289"
FT   CDS_pept        complement(353492..354409)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0289"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34640"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34640.1"
FT                   /translation="MKRFDDLYLFTRVVEAGGFSAAERATGIPKSRLSRRIAELETQLG
FT                   TRLLQRSSHRVSVTPVGEAVYRHAREMADASAAIETLAGAARSEPAGVLRVGTSPLLAE
FT                   TLVSGWLAEFAQAHPKLRIELDVSNTYVDLIEQRIDVAIRAATGPLPSRDVVARHLAAS
FT                   PRVLVGSPALIARVGEPDTPAGLDALPCLGQGTLVRSRDWVLLDARGHRHVIPIRPRMA
FT                   ADNLIALREAAIAGLGLAVLPLHCCHAALSEGRLRTVLHAWPPEPADLHALYPSRAGVP
FT                   PSVRTLVSFLRERFAGEPTMRAIA"
FT   gene            354543..355085
FT                   /locus_tag="RPSI07_mp0290"
FT   CDS_pept        354543..355085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0290"
FT                   /product="Putative transcription regulator, PadR-like"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34641"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34641.2"
FT                   /translation="MSIQHALLTSLLEKPSSGYELARRFDKSMGYFWSATHQQIYRELG
FT                   RMAEVGWVSVEEEEDGRKKTYTVLPSGREELIRWALEPTVSSDNREELLVKLRAEAVIG
FT                   PIGLADEMQRLIEQHRARLATYREIEQRDFSAAELTRVQRLQHIVLRRGIVYEEGWLTW
FT                   ADEVLPLLESSAVPVPA"
FT   gene            complement(355090..356103)
FT                   /locus_tag="RPSI07_mp0291"
FT   CDS_pept        complement(355090..356103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0291"
FT                   /product="dioxygenase oxidoreductase protein related to
FT                   2-nitropropane dioxygenase, NPD"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0291"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34642"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34642.1"
FT                   /translation="MSLPPILQNRLSVPVVGSPLFIISNPDLVIAQCKAGVVGAFPALN
FT                   ARPAELLETWLQRITTELAEYDAQHPDTPSAPFAVNQIVHKSNDRLEHDLALCVKYKVP
FT                   IVITSLGAREEVNHAVHSYGGIVLHDVINNTFAKKAIDKGADGLIAVAAGAGGHAGTTS
FT                   PFALIHEIREWFDGPLLLSGAIANGNAILAALAAGADLAYVGSAFIATEEANAVEAYKQ
FT                   AIVESTAGDIVYTNLFTGVHGNYLRKSIVASGLDPDALPESDPSKMNFSSGDGAKAKAK
FT                   AWKDIWGAGQGVGAVKRVVPAAELVRRFAKEFEMARRRLGHIEALRAPAGASTTTA"
FT   gene            complement(356166..356609)
FT                   /locus_tag="RPSI07_mp0292"
FT   CDS_pept        complement(356166..356609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0292"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34643"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34643.1"
FT                   /translation="MTQPIPAGLAAPARATLSAWHAMLESGDLDALDTLFAEDVVFRSP
FT                   VAHTPYPGRNVTTLVLRTVTTILEDFRYHRSFATDDGASVVLEFNATVAGKSLKGIDMI
FT                   RFDADGKIIEFEVMVRPATGLQALGAAMGATLGDTVGLLKTGA"
FT   gene            complement(356732..357199)
FT                   /locus_tag="RPSI07_mp0293"
FT   CDS_pept        complement(356732..357199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0293"
FT                   /product="putative universal stress protein"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34644"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34644.1"
FT                   /translation="MHQRILAAFDGSHEARLAVDEAAAVARAFGGRVRVVWAIGSPRMP
FT                   EGVGIYSVEQLREEEHRTATASLAGLQRQFDADGTAAETGVLMLDDRDDDIGGALEHEA
FT                   VRWQADTIVVGSQGKRGLARILLGSVAERTVKVSRRTVIVVRAQHPDHADG"
FT   gene            complement(357459..358799)
FT                   /locus_tag="RPSI07_mp0294"
FT   CDS_pept        complement(357459..358799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0294"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34645"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34645.1"
FT                   /translation="MIYGHRVAWISIALIVIHQSLVAASTVFLTQVIERFQAGGDYLPF
FT                   LYLYLAAMTLPYIPGCGSFVFLQRWINDAHHAFVSLLSEQIRGKVAQYRNVSQRERVTA
FT                   TLARNSLPVLREYITFIHDLVSFTLNSSLSMAVIIFLLPSKLALGYITSFMLCLGFIFL
FT                   LRKTIAASSSDYEIRYLAYTDSLNRAWDNVALGNSYNETIWRRRKEEAGRNFYNAAIAL
FT                   QIRKQLGNSLLAGASLLPTIFLIVMIFRDGHASPPVVAAVVVNLTRIFLILNSLSALVY
FT                   KVLDFSAMRAKLEVLFAPVSAPLDGASASADHVGTIYVNGAKVQGSSQVIDCVSNVEHG
FT                   RLRITGPNGSGKSSALLALKAQFGDRCFLMPTNRASLAWEGVNEALSTGQQMIASLREV
FT                   VSIEDVKYILLDEWDANLDQDNATGIDVILDALASTKVIVEVRHMRG"
FT   gene            complement(359312..359737)
FT                   /locus_tag="RPSI07_mp0295"
FT   CDS_pept        complement(359312..359737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0295"
FT                   /product="hypothethical protein, peptidase domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34646"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34646.1"
FT                   /translation="MVDITGWTWRTARTTWSSAPTPRRASRWSCRIRRSGLRSRLITAD
FT                   HARAVADTGGGVWLNAADYPSLDAMAEGIKRLADAVGIAHIGLGTDMLGFIRPPVFDSY
FT                   AQLPALADALPKSGFAPAEVGQILGGNYRRVFEAAVG"
FT   gene            359997..362351
FT                   /gene="cadA"
FT                   /locus_tag="RPSI07_mp0297"
FT   CDS_pept        359997..362351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cadA"
FT                   /locus_tag="RPSI07_mp0297"
FT                   /product="cation (cadmium)-transporting ATPase (Cadmium
FT                   efflux ATPase)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2524829; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34647"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34647.1"
FT                   /translation="MTSHDHANAKPAQTGCGGCCGHDHPAAQDTAARPAQAHEPHPGHD
FT                   HAHEPHAAAASVDAAVLARASGRTRLRIAQMDCPTEERMIRARLGNAEGVVALDFNLLE
FT                   RHLTIHHTVDDVTPFLEALRAIGMDGEVLEAHDRAAAEPEAATGGVSRRTWLLGIGGVA
FT                   AFGAEAIAWSLGDHAWPVLGLALASIGLAGGQTLRKGWIALRAFAFNIHFLMAVAVIGA
FT                   LLIGKWAEAAMVIFLFAVAEAIEARALVRARDAVRALTAIAPDTADVSDGAGGWRAVAV
FT                   EAVAMGTRLRVRTGSRVPVDARIVAGRAALDESPVTGESLPVEKAVGDAILAGTIVTDG
FT                   VIEAEATAVAADSTLARIAAAIQQAQAQRAPTQRFVDKFASIYTPAMMLLALAVAVIGP
FT                   QVTADGWLTWAYRALVLLVIACPCALVISTPVTVVSGLAAAARRGIVVKGGVYLESGRR
FT                   LRALALDKTGTLTAGRPVLDTVALPDGVHRAVAALNAATDAAQLRALGVAAALDAHTTH
FT                   PIAQAIVQAAAAHGAAQARRVDDLSVLPGRGVAGTLDGVRWHLGNAALVAERGLDTSAW
FT                   RQAAERLQAEGMSAVTLCDAGGAVALFGVRDRERAESAEAIAGLRALHVQPVMLTGDDR
FT                   RAAQAIARAVGIDAVHAEQLPADKQRVIGELAAQYGFVGMVGDGINDAPALARADIGFA
FT                   MGAAGTATALEAADVAIMDDDPRKLAAFIRISRRTVAVLRQNIALALGIKAVFLALAVA
FT                   GEATLWMAIFADVGASLLVVFNGLRVMRVRA"
FT   gene            complement(362352..362828)
FT                   /locus_tag="RPSI07_mp0298"
FT   CDS_pept        complement(362352..362828)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0298"
FT                   /product="putative transcription regulator, MerR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34648"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34648.1"
FT                   /translation="MKIGELAQRTGVSIETIRFYEAQGLLPPPARAANNYRVYTPEHAE
FT                   QLAFIAKCRSLDMAHAEIRRLMELQTNPQASCKEINRLLDEHLRHVEARIAELTELKRQ
FT                   IEAIGQRCTTAASVAECGVLQSLHEEPLPLKGADHHADPADAEHAHRHIRGVHR"
FT   gene            complement(362870..363271)
FT                   /locus_tag="RPSI07_mp0299"
FT   CDS_pept        complement(362870..363271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0299"
FT                   /product="conserved hypothethical protein, DUF326"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34649"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34649.1"
FT                   /translation="MIHRPTAKENAKRFAGVIQALHTCETACLHCATECGKNGHAEAMA
FT                   RCISLCTDCARFCALARDFLERNSEFAELLLEDCAEICQQTMEECAHHGEGHCRKCAEA
FT                   CDQCKKACLEVAGAAPLSPAQQKELLATL"
FT   gene            complement(363399..365129)
FT                   /gene="leuA"
FT                   /locus_tag="RPSI07_mp0300"
FT   CDS_pept        complement(363399..365129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuA"
FT                   /locus_tag="RPSI07_mp0300"
FT                   /product="2-isopropylmalate synthase 2
FT                   (Alpha-isopropylmalate synthase 2) (Alpha-IPM synthetase
FT                   2)"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="2.3.3.13"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34650"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34650.1"
FT                   /translation="MLKTPATKYRPFPPIALPDRTWPSKTLTRAPIWMSTDLRDGNQAL
FT                   FEPMNAERKMRMFKMLVQIGFKEIEAAFPAASQTDYDFVRELIEGGHIPDDVTIEVLTQ
FT                   AREDLIRRTMESLRGARRAIIHVYNATSPVFRRTVFNTDREGVKRIAVESAKLIREIAE
FT                   SMPETQWTYQYSPEVFSGTELDFALEVCNAVTEAWDPTPAHKIIFNLPATVEMATPNVY
FT                   ADQIEWMHRHLARRDSILLSVHPHNDRGTAVAAAELAVMAGADRVEGCLFGNGERTGNV
FT                   DLVTLALNLYSQGIDPGLDFSHVNDVARTCEDCTQLPVHPRHPYVGDLVFTAFSGSHQD
FT                   AIKKGFAVQQPDAIWEMPYLPIDPADVGRTYDSIIRVNSQSGKGGIAYLLESGYGIAMP
FT                   RRLQVEFSSTVQKLTDTSGREATAADIWTLFQETYLQARGPIGYVSHRLTERDDGSQHI
FT                   RLVVNIADREHVCEGVGNGPLDALVQALSAVLAAPVSIHHYEERALGQGANADAIAFAE
FT                   LAAPGVAGSVFGVGIDANLTTASIRAVVGGVNRLATRHAQAQPGQSLLRRGMAPAMEIA
FT                   "
FT   gene            365926..366384
FT                   /gene="iorA"
FT                   /locus_tag="RPSI07_mp0301"
FT   CDS_pept        365926..366384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="iorA"
FT                   /locus_tag="RPSI07_mp0301"
FT                   /product="Isoquinoline 1-oxidoreductase alpha subunit"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="1.3.99.16"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34651"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34651.1"
FT                   /translation="MVTLNINGKPVEVDADPSTPLLWALRDNLGLTGTKFGCGVASCGA
FT                   CTVHLNGQPTRSCVLPISAVVGAQITTSEHIADDKVGKAVLDAWVKHDVAQCGYCQSGQ
FT                   MMSAVGLLRSKKTPTDADIDSAMAGNLCRCATYQRIRAAIHDAAKALA"
FT   gene            366407..368656
FT                   /locus_tag="RPSI07_mp0302"
FT   CDS_pept        366407..368656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0302"
FT                   /product="putative isoquinoline 1-oxidoreductase subunit
FT                   beta (iorB)"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.3.99.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34652"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34652.1"
FT                   /translation="MRIRNLEALAGGGAQHLAASAPADAGVATLDRRSFLKLTSLAGGG
FT                   LALGVVPALAGAQDAQAKPPSPPQAFLVIAPDNTVTVAVNRLEFGQGVHTALPMALAEE
FT                   LDVDWRNVRAMLAPAGDPYKDPTFGIQITGGSTALNHSFAQYRELGARARAMLIAAAAE
FT                   RWKVDPSTCRTANGVVTSGSHRATYGELAQAAMALPVPQQVALKNPSQFRIVGKPTPRL
FT                   DARAKLDASLKFGIDTRLPNMKVAVVARPPRFGGKVAKYDVAAAKAVKGVVDVVQIPTD
FT                   RGGMGVAVIADGYWPAKQGRDALQVTWDDTGSRVSSAALMSEYKTLADQPGIVAEAADV
FT                   SAIQSAAKRIQADYEFPYLAHAPMEPLNCTIDLQSEGGKVSGAKVWVGSQFQTVDQGAL
FT                   AKTLGVAPEKVELNTMMAGGGFGRRAVPTSDYVVEAASVAKAYAAAGHSGPVKVIWSRE
FT                   DDIRGGYYRPMHLHRVDIGLDGDGKVLGWNHVIVGQSITKNTLFEPYTFKNGVDATMAE
FT                   GVIENDYGFPMQVSVHHPNVDVPVLWWRSVGHTHTAFVMETLVDEVAHAARQDPVAYRL
FT                   ARFTGKAHERHRQALQLAVNKSGYGKRKLPKGQAWGVAVHESFNSVVAYVVEVSIDQGK
FT                   PRVHRVTAGVHANRVINPMGAQAQIQGGCVFGLGMIAPGFAIEIENGATKNSNFTDFPP
FT                   VRMPDAPPVDVFFVPSDDNPTGLGEPGVPPIAPAVANAVFALTGKRLRKLPFDAV"
FT   gene            368771..369205
FT                   /gene="ohr"
FT                   /locus_tag="RPSI07_mp0303"
FT   CDS_pept        368771..369205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohr"
FT                   /locus_tag="RPSI07_mp0303"
FT                   /product="Organic hydroperoxide resistance, osmC family"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="1.11.1.15"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14627744, 15054099; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34653"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34653.1"
FT                   /translation="MALNILYTAHATATGGRNGHTQTADGQVSHDLSIPKSMGGPGKPN
FT                   TTTPEDLFAAGYAACFGSACDFVAKSMLKLNPGSVEIHCDVGIGTRPEGGFGLKVGLTA
FT                   RIGGLSRAEAEALVAKAHEVCPYSNATRNNVEVTLKTEVI"
FT   gene            369205..369864
FT                   /locus_tag="RPSI07_mp0304"
FT   CDS_pept        369205..369864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0304"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34654"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34654.1"
FT                   /translation="MRRQSVVGVLLAAGRGSRFDPDGTVNKLLAALPDGTPVAVQAARH
FT                   LRAVLDDVVAVVPAAATHGVEVERLAALLAEAGCDVLRCTHAARGMGASLAAGVAARPH
FT                   ASGWIIALADMPWLAPRTIARVGQALDAHHCVAPFHQGQRGHPIGFGADYFAGLAALDG
FT                   DEGARRLIDPARLIRLDVEDAGTLRDVDTPADMALAQPPDLSTGHPNPPAKPAATD"
FT   gene            370231..370434
FT                   /locus_tag="RPSI07_mp0305"
FT   CDS_pept        370231..370434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0305"
FT                   /product="putative osmotically inducible lipoprotein b2
FT                   transmembrane (osmB)"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34655"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34655.1"
FT                   /translation="MTRVLTILLATATLLTATGCASWTPRQRNTAIGAGVGAVAGAALI
FT                   GGPGATLGGAALGGLVGNVATR"
FT   gene            complement(370503..373190)
FT                   /locus_tag="RPSI07_mp0306"
FT   CDS_pept        complement(370503..373190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0306"
FT                   /product="putative signal transduction protein eal-ggdef
FT                   domains"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34656"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34656.1"
FT                   /translation="MQDDLSYPLSAQSLPVPFYVVLEGRIVYANAAGVCMVRALSVDQL
FT                   LGEPFSRFFLDAPESLQLDADHPQGAHATPPVADPFHAAQMAPDMPGAQSGAPSVVRLT
FT                   ITPTRFDGMPAQQVVVHGLPLPLDAQLPGKPGERVLSPEAIGAALPHEHLDHLLSTLPS
FT                   VASLGERLYAALRALEAALPLMLCVVARVVSNHVRLYGTRAARAQLAGGQDTATRLSTA
FT                   AQSELDAELARAAPALNDLPPVELTRLANAPAALRNILARVPGIAPPAWVCRIPAQHGG
FT                   AHPNEDLFCLFYASPSETHGPPDDAAQHHTCNGYVSALAKLLRLEGEYRQARDLRDQYR
FT                   LVVNHLSEGVLTLSTDGRVLSYNRSAAEILRLSGTSWKNRTRLMLGDIMLAEDGSILPR
FT                   AAWPSTLAARTGRAVNNVVVGMPAGNGQIVWLRESVLPMFSQDSASPHAVLVIFTDITA
FT                   ERSTYEQLRLLETKDSLTGLPNRAAFIERLDARLALPSTGQAALLYVGLDHFKTVNEAM
FT                   GHHIGNQVLNVAAQRIRADVGQRALLARLGGDQFCVAIDTPDRAETLAQQVLDALAKPF
FT                   SGGEREVHLSASIGVAMFPEDGSDAATLVSRAEAAMYRAKENGRNRMARYSRALETQLL
FT                   RRFTLNERMRRALARGQVRLVYQPKYALDTRELVAVEALMRWSDPELGAVSPTEFIAVA
FT                   EESGYIVELGRWALQQACAQGQAWERDFGFTGRIAVNVSARQCDAGVIERDVDDALGTS
FT                   GLRPSRLELELTESVLLADRLSTQRLLTSLAARGVRISLDDFGIGFSSLSYLRSLPIHN
FT                   IKIDRSFISGVPAVADCVALTKTIIAMAQALNMTVTAEGVETLEQTAFLAAHACDEVQG
FT                   FLFGRPLEVPAMEGLLRARGAISI"
FT   gene            complement(373317..373685)
FT                   /locus_tag="RPSI07_mp0307"
FT   CDS_pept        complement(373317..373685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0307"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34657"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34657.1"
FT                   /translation="MDETTMFHPDLAVFQPAFVRWIAGMRAVCGHYLFFPECSIDRVIA
FT                   YFILTMGTSVLKRATGTALTLQRIEQRFTASGAIPEPARPACAMTAPDVSLARGHATRV
FT                   CRIGHKTRVCAAGDFCAS"
FT   gene            374007..374297
FT                   /locus_tag="RPSI07_mp0308"
FT   CDS_pept        374007..374297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0308"
FT                   /product="Histone-like nucleoid-structuring protein H-NS"
FT                   /function="8 : DNA metabolism"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34658"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34658.1"
FT                   /translation="MPTYKELVAQKAKLEEQIEAARSKELEAVIQQVRQTVAEYGLTAE
FT                   DLGLAPRRGRRAGAKAPVPPKYRDPKTGATWSGRGRAPAWIGKNRDRFLIA"
FT   gene            374392..375120
FT                   /locus_tag="RPSI07_mp0309"
FT   CDS_pept        374392..375120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0309"
FT                   /product="putative transcription regulator protein, GntR
FT                   family"
FT                   /function="12 : Regulatory functions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34659"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34659.1"
FT                   /translation="MTPRLPKYLELADRIRLDILHGGLPAGSVAPSENEVAQRYGVSRL
FT                   TARRTLNELAQRGLLKRSRGQRSVVLDPVGPHRPVLYAPGQSDAALEYVPGAVYSVSAF
FT                   RLETADATVAAALDLQVGASVAHVERRAQVEGAPIMLLRTWLTSRLAAMLEARDFEDRL
FT                   FVQVFQRANLTIARSREAPLACVADAHQARELDVALGTPLVRVRRIGYSVADVPISLTY
FT                   CDFSPERYTREVDIRVLQTD"
FT   gene            375398..376459
FT                   /locus_tag="RPSI07_mp0310"
FT   CDS_pept        375398..376459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0310"
FT                   /product="Outer membrane porin protein 32"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34660"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34660.1"
FT                   /translation="MQLKRRFNLAVLAAAAGLTMGVAHGQSSVTLYGQVDAWVGAQKGF
FT                   NSSRAWVVNPGGMSTSYWGLKGSEDLGNGLKGIFALEAFFRPDTGRAGRFDGDNFFARN
FT                   AFVGLSSNTWGTIKLGRNTPPYFVSTILFNPFIDSYTFSPAVFHTYLGNGLSGAAGISG
FT                   LVGDSGWNNSILYSTPDFNGLTANLIYGAGEQAGHNGQNKWGGSLLYFHGNFAATAAYQ
FT                   QVRFDANPGDLNTIVAGFTRQDAALLGATYDFGVVKLYGQYQHIKNTISTGDTKANGGQ
FT                   LGVSVPVGAGSILASYAYTKTSGAADVKRNSWAIGYDYALSKRTDLYAAYFRDKVTSLS
FT                   AADTFGVGMRAKF"
FT   gene            complement(376549..377235)
FT                   /gene="epsR"
FT                   /locus_tag="RPSI07_mp0311"
FT   CDS_pept        complement(376549..377235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="epsR"
FT                   /locus_tag="RPSI07_mp0311"
FT                   /product="Negative regulator of exopolysaccharide
FT                   production two-component transcription regulator protein"
FT                   /function="9.3 : Transcription factors"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0311"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34661"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34661.1"
FT                   /translation="MVRAGATHVLQSLPAVSQVISVEPGEALFENLAAHADAELALIGL
FT                   PLPGIDDIPALTRLLQQPHPRHIAVLGESDSPAHVRAVMQLNISAYLLKSYAGKLIAAA
FT                   LELVLAGGRYVPASIVLARPDSPLAATRAGNDDCALLGLTQRQYEILVLLSRGHPVKTI
FT                   SRMLGISEATTKAHINALYRRLEVRSRTEAIFVATQRGAMLMSHPRLGLVEAPVHGAPA
FT                   RLARTG"
FT   gene            complement(377749..378210)
FT                   /gene="flgN"
FT                   /locus_tag="RPSI07_mp0312"
FT   CDS_pept        complement(377749..378210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgN"
FT                   /locus_tag="RPSI07_mp0312"
FT                   /product="flagella synthesis protein flgn"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34662"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34662.1"
FT                   /translation="MDNTLLIRTLSDEQALLRAATQTLEAETRALHDGDMAELERITET
FT                   KQQQLSRLAEADRERRLWWAQHSAADPYGLVKYLRSDETASRLFDENLALAAALRQRNL
FT                   ENGTLIALRLRATQNALAVLHAANNGGGTPYGRDGKQPLSMPRFSIVAQ"
FT   gene            complement(378326..378646)
FT                   /gene="flgM"
FT                   /locus_tag="RPSI07_mp0313"
FT   CDS_pept        complement(378326..378646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgM"
FT                   /locus_tag="RPSI07_mp0313"
FT                   /product="negative regulator of flagellin synthesis
FT                   (Anti-sigma-28 factor) protein"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1482109; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34663"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34663.1"
FT                   /translation="MKINQVNNSPAITPTKDAASGSTRTAGTASTSATRGTRSSSQNDG
FT                   TPSLSVQQVSRQVGSGDFDAARVEQIRSAIQNGTLKMDASKIADGALSDAQSLLSAQTK
FT                   AA"
FT   gene            complement(378749..379630)
FT                   /gene="flgA"
FT                   /locus_tag="RPSI07_mp0314"
FT   CDS_pept        complement(378749..379630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgA"
FT                   /locus_tag="RPSI07_mp0314"
FT                   /product="flagella basal body p-ring formation protein"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34665"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34665.1"
FT                   /translation="MSTRPARSTDDPTLAVARRPGAIARAQAAPLAARRRGLLLVLALG
FT                   LLASVVHPMRAHAQQMMRVGYAPPGSATAQPATTIQGPTAIQMQIQQQLQSQLDILSGT
FT                   TDGGGSRASVEVGAVDPRVANQPCDQVELMLPAANRLRGRIQVGVRCRSPHAWAAWVPA
FT                   TIQISGTYYVAARQLPPGKTLDMGDLEARTGDLSILPASVVQQPADAVGRVLLTSLAPN
FT                   QPLRAESLRMPIAVQAGQTVKLVAEGGGFQVTSDGRALNQAAVGQVAQVRTANGNVISG
FT                   IAQSVGVVAVQF"
FT   gene            379978..380505
FT                   /gene="flgB"
FT                   /locus_tag="RPSI07_mp0315"
FT   CDS_pept        379978..380505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgB"
FT                   /locus_tag="RPSI07_mp0315"
FT                   /product="flagellar component of cell-proximal portion of
FT                   basal-body rod, protein flgb"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1482109, 2129540; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34666"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34666.2"
FT                   /translation="MPQEQEYPAGGSQGATREDMTDMVDKLDQLFGFQEQALRLRSQRH
FT                   QLLASNIANADTPSYKARDFDFQSALQKAVGQQSGSSLPMTATAAGHLTAAGAPAADVT
FT                   PMQASLSAQSQADALQGEVQYRTSQQPSIDGNTVDMDGERMRFADNTVRYEADLSIVTA
FT                   KIKSMLAAIQSS"
FT   gene            380667..381074
FT                   /gene="flgC"
FT                   /locus_tag="RPSI07_mp0316"
FT   CDS_pept        380667..381074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgC"
FT                   /locus_tag="RPSI07_mp0316"
FT                   /product="Flagellar basal-body rod protein flgC (proximal
FT                   rod protein)"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2129540; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34667"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34667.1"
FT                   /translation="MSLFKVMDVAGSALTAQSKRMNVVASNLANAESVTGPDGTAYRAK
FT                   QVVFSPEQETDGYATGVSVDRVVEDTVTPMKRMHQPGNPLADADGYVTMPNVDVVDEMV
FT                   NMISASRSYQANVEVANTTKTMAAKALTLGQ"
FT   gene            complement(381088..381546)
FT                   /locus_tag="RPSI07_mp0317"
FT   CDS_pept        complement(381088..381546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0317"
FT                   /product="membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34668"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34668.1"
FT                   /translation="MVVPAETWPRSTVRTVVPAEFLMVTTASSAPFGTEMPKLAVLDDS
FT                   DSVDDGTSTVRPISDEACEAALCVAMLDIVVFSCAMPLTVLICASCDVSCELSIGLSGS
FT                   WFFSWATSSCMKVFCRSVPVCEVMPVLLVELVVLLVLVVELTVMVVSR"
FT   gene            381104..381760
FT                   /gene="flgD"
FT                   /locus_tag="RPSI07_mp0318"
FT   CDS_pept        381104..381760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgD"
FT                   /locus_tag="RPSI07_mp0318"
FT                   /product="flagellar hook assembly protein, basal-body rod
FT                   modification"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1482109; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34669"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34669.1"
FT                   /translation="MTVSSTTSTSSTTSSTSSTGITSQTGTDLQNTFMQLLVAQLKNQD
FT                   PLNPMDNSQLTSQLAQINTVNGIAQLNTTMSSMATQSAASQASSLIGRTVEVPSSTLSL
FT                   SSSTASFGISVPNGADDAVVTIKNSAGTTVRTVDLGQVSAGTTNYTWNGKDDKGNTLSD
FT                   GTYTISVAATLSGSTTTASALGTDKVTGVTINSGTTLLQLASGGTTKLSNVTTIQ"
FT   gene            381800..383005
FT                   /gene="flgE"
FT                   /locus_tag="RPSI07_mp0319"
FT   CDS_pept        381800..383005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgE"
FT                   /locus_tag="RPSI07_mp0319"
FT                   /product="flagellar hook protein FlgE"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1482109; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34670"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34670.1"
FT                   /translation="MGFQQGLSGLDAASKNLDVIGSNVANANTVGYKKSTAEFGDVYAR
FT                   SLVGASDNQIGQGVDVTKVSQSFTQGNVTVTGNPLDIAINGTGFYRMVDASSGQVSYTR
FT                   NGQFQTDKNGYIISATGQNLTGYGVDATGKINTAVLTNLQIPVNDLAPLATTNTAFTIN
FT                   LDAAATVPTTTPFSATNSATFNHSVSEQVYDGTGTSHMLTNYYVRTATGWDVYSQVDGA
FT                   NPTGGNPVTSLTFNSSGTLTSSPSKVAVAFAGMSIANMDFTGTTQYGGGFNDTTVSQDG
FT                   YATGRLASYSVGTDGTITGRYSNGRTSTLGQIAMTNFKAPDGLQNIGGNQWVETAESGS
FT                   PQMGTPGMGSFGLLQSSAVEQSNVDLSAELVNMIVAQRSYQANAQTIKTEDQLLQTLVS
FT                   MR"
FT   gene            383019..383756
FT                   /gene="flgF"
FT                   /locus_tag="RPSI07_mp0320"
FT   CDS_pept        383019..383756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgF"
FT                   /locus_tag="RPSI07_mp0320"
FT                   /product="flagellar component of cell-proximal portion of
FT                   basal-body rod"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1482109; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34671"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34671.1"
FT                   /translation="MDRMIYVAMTGAKHLFDQQAASANNLANSSTTGFKAQIDAFHTVG
FT                   VQGDGSPTRSFVMASAIGTDMTPGPIETTGRSLDVAIDGQGFFAVQTADGGEAYTRAGA
FT                   FQVGADGTIQTLSGQPVLGDGGPVTLPPDTTVQFAKDGTINAISADNRTPPVSLGRLKL
FT                   VNIDPSNLDRGTDGLFRQRDGQDANVDERVRITGGALEGSNVSLTDSLVNMIEISRQLE
FT                   LQMKALHTGDTNAQSANELLRHA"
FT   gene            383797..384579
FT                   /gene="flgG"
FT                   /locus_tag="RPSI07_mp0321"
FT   CDS_pept        383797..384579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgG"
FT                   /locus_tag="RPSI07_mp0321"
FT                   /product="FlgG: Flagellar basal-body rod protein"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2129540; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34672"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34672.1"
FT                   /translation="MIRSLWISKTGMDAQQSQLDVISNNLANVNTTGFKRSRAVFEDLL
FT                   YQNVREPGAQSSQQTTLPSGMQIGTGTRIVATERLHTQGNLQQTGNSTDAAINGNGFFQ
FT                   VQMPDGTLAYTRDGSFQINAQGQLVTSSGYPVQPAITVPQNATSLTIAKDGVVTVTTPG
FT                   SVNSTQVGTFQLANFINPAGLRSMGENLYAETEASGTANLAAPGANGIGVLNQNYVETS
FT                   NVNVVEEMVNMIQTQRAYEINSKAVQTSDQMLEKLAQL"
FT   gene            384612..385346
FT                   /gene="flgH"
FT                   /locus_tag="RPSI07_mp0322"
FT   CDS_pept        384612..385346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgH"
FT                   /locus_tag="RPSI07_mp0322"
FT                   /product="flagellar protein of basal-body outer-membrane L
FT                   ring"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1482109; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34673"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34673.1"
FT                   /translation="MHPPPVFSLLHGGRAVRTVRLAVLGTATLLATACGMLPPPEPIVQ
FT                   GPTSARPPMPVMAQRQNGAIYQEVASGSGGFRGMFEDRRAHMVGDTITIVITENTAASK
FT                   QTSGTVDRSGSKTTSVPTFAGMNPGVLSLLGVSASDANKFDSKGANGAQNNFTATITVT
FT                   VVEVLSNGNLVVSGEKQMAVGQGTESIKFSGVVNPTTVNNQNTVLSTQVADARMEYRGT
FT                   GYVAEAQQMGWLSRFFLTVSPF"
FT   gene            385369..386478
FT                   /gene="flgI"
FT                   /locus_tag="RPSI07_mp0323"
FT   CDS_pept        385369..386478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgI"
FT                   /locus_tag="RPSI07_mp0323"
FT                   /product="FlgI: Flagellar P-ring protein ; signal peptide"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3549691; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34674"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34674.1"
FT                   /translation="MKKLHRFIGSALLALSALAGTAHADRIKDLTTIAGVRENALIGYG
FT                   LVVGLDGSGDQTTQTPFTIQSFNNMLTQFGINVPAGASIQLKNTAAVVVTATLPAFVRP
FT                   GQTIDVTVSSIGNAKSLRGGTLLLTPLKGVDGQLYALAQGNVVIGGAGASANGSKVQIN
FT                   QLGAGRIANGATVERAVQATVGEAGGIQLDTGTTDFGTVQNIVNAINKQFGADTAEAAD
FT                   GRTINVRAPALAADRVGFVAKLQNIDVTPAQAAARVVVNARTGSVVMNQQVKLEPCAVA
FT                   HGNLSVTISTEPVVSQPAPFSQGQTVAGARSNIEVKQQGGSLINVKGGTNLADVVKAIN
FT                   AIGANPQDLISILQAMKAANALRADLEII"
FT   gene            386506..387594
FT                   /gene="flgJ"
FT                   /locus_tag="RPSI07_mp0324"
FT   CDS_pept        386506..387594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgJ"
FT                   /locus_tag="RPSI07_mp0324"
FT                   /product="FlgJ: Peptidoglycan hydrolase (muramidase),
FT                   flagellar protein"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34675"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34675.1"
FT                   /translation="MNRTDISNRLALDAQGFESLKQTARTDPTGAAKTVAKQFDAIFVN
FT                   MMLKQMREASPQSGLFDSASSKMYTSMFDQQLSQTIASRGVGVADQLLKQMLRQAAKTN
FT                   PDASGPVNTALSRTTATNTALPGAAGSTATDAAKAIARASLNGLAASAAAGTEDDGSGI
FT                   STVPRPGLDERVQRALAALRKQAEAEAQSGGTLPEADLSSVASQPAGDRMSSFYSKLID
FT                   HATQASQDTGIPANFMIGHAALESGWGRREIRAKDGSNTHNLFGIKAGGSWTGPTAEVT
FT                   TTEYVGGVAHKVKEKFRAYGSYAEAFKDYANLLSSNPRYSNVVAAGAGKDAASFARGLQ
FT                   RAGYATDPNYANKIMAVLRQIA"
FT   gene            387712..389640
FT                   /gene="flgK"
FT                   /locus_tag="RPSI07_mp0325"
FT   CDS_pept        387712..389640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgK"
FT                   /locus_tag="RPSI07_mp0325"
FT                   /product="flagellar hook-filament junction protein 1"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34676"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34676.1"
FT                   /translation="MSSSLLNIGATGLRVADINLQVTGNNIANASTPGYSRQEAVQTEN
FT                   TPMATGAGYLGQGVNVTTVKRIYDQFLTAQVQSGQASTSAADQLNSLVSGLDSYLSDSN
FT                   SGLGSALTGFFNAADSLASNPSSTSARQVFLSAASTLQTRFNAVAGQMNSLSTQVNTQV
FT                   QTQVNSVNSTAQQIAALNDQIAKAEAASGGQPANDLRDQRDQLVQTLNQSIKTSVVQTG
FT                   DGQYNIYVGNGQALVQGNQSYQLTTVASQYDPTQLSVGYKSPAGTVTIDDSQLGGGALG
FT                   GLMQFRQNTLIPAQNSLGRLAAAITADVNTQNKEGMDLNGKLGTDLFSAAGPSVAASSS
FT                   NTGTGSLTATITNANAGQGYDYQVKYSGGAYTVSHYPDGSGAVTVSSWPTTIDGVTLNL
FT                   TGAMNSGDSFLVRPTANAASTMQTLTTDYHAVAAASPVVVNQGSNNTGSTSVASIGVDS
FT                   TYAGSPLASAINLTYSGGSLSGFPGNVTVTVNGTSTTYSGTAPYTQGATYSFNGIQMSL
FT                   TGTPASNDTFTVSANTANSTDGHNASAFAQLRNATVLDGGTTSLGSAWTNLVTQVGIQA
FT                   SQASANLTSQKALLASSTSQQQSVSGVNLDDEAMNLMKYQQAYQASAKVMQTANSLFDS
FT                   LLSIANG"
FT   gene            389720..390670
FT                   /gene="flgL"
FT                   /locus_tag="RPSI07_mp0326"
FT   CDS_pept        389720..390670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="flgL"
FT                   /locus_tag="RPSI07_mp0326"
FT                   /product="flagellar hook-filament junction protein protein
FT                   3"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34677"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34677.1"
FT                   /translation="MRVSTAQFFAASTVSMQNTQSNLVKLQQQISTGIALNSAGDNPAA
FT                   MGQVLQLQQSQDSNDQFQVNRDATDARLTNVSSALSDVITTLQQGKQSTIAANTTLLTD
FT                   SQRVGILAQVKQQYQQLLSTANRRDASGVALFGGANGTTDPFTSTAGSVQYVGSGQPPT
FT                   VQVAQNISMPNSVSGDSVFVRVPNSDASNPNANQSVFKTYENLITALSKPITTSADVTT
FT                   IQTAVQTAQGNLDSAYQVALQAQVTVGTQQAQITTLNSSGSNFGEQLKEQISKLQSVDY
FT                   TSAISQFSQQQVSLQAAQKTFTSMQGLSLFQYINP"
FT   gene            390743..391486
FT                   /locus_tag="RPSI07_mp0327"
FT   CDS_pept        390743..391486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0327"
FT                   /product="putative transmembrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34678"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34678.1"
FT                   /translation="MPIQYLRRLTSPERTDEANRRLGQSLAFVAGAANAGGFLAVKQYT
FT                   SHMSGIVSAVADDLVLGDFALVLAGLASLLAFLGGAACTAVLVNWGRRRSTQSAFALPL
FT                   LLEAALLLGFGLMGASLSQYRVVFVPVTVALLCFMMGLQNAIITKISRAEIRTTHVTGL
FT                   TTDIGIEIGKALYWNRGHRHLHAVVADRPKLRLLSSLLGMFFLGGLTGAMGFKHIGYVA
FT                   TIPLASILMALAVVPVMDDLVARRP"
FT   gene            complement(391626..392414)
FT                   /gene="fliR"
FT                   /locus_tag="RPSI07_mp0329"
FT   CDS_pept        complement(391626..392414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliR"
FT                   /locus_tag="RPSI07_mp0329"
FT                   /product="FliR: flagellar biosynthesis inner membrane
FT                   protein. fliR/mopE/spaR family"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8282695; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34679"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34679.1"
FT                   /translation="MIQFTAAQLNGWIALYWWPLVRVLAFIAVAPPFANTEIPSSIKVA
FT                   FGVVLTVALAPMLPVPPGVSVGSYEGLWITLLQVAIGMALGVCVQLVFAAISGAGELMS
FT                   IQIGLGFATLLDPQQTESSMLLGRFISLTAITAFIAGDGHLVLMHALFDSFTALPVSAA
FT                   PLAGGGWQTLAGGGTAVFALAVRIALPIIAIMMVVNLAFAVLSRTAQALNPFAVGIAAT
FT                   LVVGLMLVMVMMTSLAPVVERSVMDALELGGRAFGQFGGR"
FT   gene            complement(392442..392711)
FT                   /gene="fliQ"
FT                   /locus_tag="RPSI07_mp0330"
FT   CDS_pept        complement(392442..392711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliQ"
FT                   /locus_tag="RPSI07_mp0330"
FT                   /product="FliQ: flagellar biosynthesis protein.
FT                   fliQ/mopD/spaQ family"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8282695; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34680"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34680.1"
FT                   /translation="MTPEYVLNMARQAMQVAMMIGAPMLLVSLIVGLLVAVFQAATQLN
FT                   EQTLSFIPKLLAVAATMILAGPWVLGVIVDYTRDVLINIPNYVN"
FT   gene            complement(392722..393471)
FT                   /gene="fliP"
FT                   /locus_tag="RPSI07_mp0331"
FT   CDS_pept        complement(392722..393471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliP"
FT                   /locus_tag="RPSI07_mp0331"
FT                   /product="fliP: flagellar biosynthesis protein.
FT                   fliP/mopC/spaP family"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8282695, 9324257; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34681"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34681.1"
FT                   /translation="MKLPALLRSLAALALLCAAPAVFAQAQPGLPLLTGTAGGQSYSLP
FT                   VQTLVFLTSLGFLPAILLMMSSFTRIIIVLSLLRHALGTQTTPPNQVLIGLALFLTFFV
FT                   MSPVLDKVYTDAYVPLRDSKISVEQALDTAATPMRQFMLKQTREPDLALFAKMGNLPPI
FT                   ASPDQVPMRALIPAFVTSELKTAFQIGFAIFIPFLVIDIVVAAVLMSMGMMMVTPSIFS
FT                   LPFKIMLFVLVDGWHLLLGSLAQSFTQ"
FT   gene            complement(393468..393803)
FT                   /gene="fliO"
FT                   /locus_tag="RPSI07_mp0332"
FT   CDS_pept        complement(393468..393803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliO"
FT                   /locus_tag="RPSI07_mp0332"
FT                   /product="flagellar flio transmembrane protein"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8282695; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34682"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34682.1"
FT                   /translation="MIVAAGWLLRKLQQRAGMGPAGRRSQVLSVVAQQMLGAREKVVVV
FT                   EVQGTWLVLGVTPQHVQTLHTLPRPADAGTPVADEPPADGPPGGKPPAFADALALQLKR
FT                   RLTGKLQ"
FT   gene            complement(393916..394425)
FT                   /gene="fliN"
FT                   /locus_tag="RPSI07_mp0333"
FT   CDS_pept        complement(393916..394425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliN"
FT                   /locus_tag="RPSI07_mp0333"
FT                   /product="flagellar motor switching and energizing
FT                   component. fliN/mopA/spaO family"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2651416; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34683"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34683.1"
FT                   /translation="MAANLPRSQKMTSESTQPDQTASADDFDTEMTMEEAMALEAAQRA
FT                   AAAPAPAPAPASAPVNDINSVFKPLVVDDSKKPSPTQRNDIDMILDIPVQLTVELGRTK
FT                   VPIKNLLQLAQGSVVELDALAGEPMDVLVNGYLIAQGEVVVVNEKFGIRLTDIITPSER
FT                   IRKLNR"
FT   gene            complement(394385..395392)
FT                   /gene="fliM"
FT                   /locus_tag="RPSI07_mp0334"
FT   CDS_pept        complement(394385..395392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliM"
FT                   /locus_tag="RPSI07_mp0334"
FT                   /product="flagellar motor switching and energizing
FT                   component"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3519573; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34684"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34684.1"
FT                   /translation="MLKEEFLSQEEIDALLKGVTNEVDDEPAQTEAAGVRTYNLGSQER
FT                   IVRGRMPTLEIINERFARNWRMGLFNFLRRNAEISVGPVKVQKYSEFIRNLVVPAAINL
FT                   VHVKPLRGTALFVFDPNLIFIVVDHLFGGDGRFHMRVEGRDFTQVEQRIIQRMLQLMFD
FT                   HYGKAWQPIYPIEFEALRMEMHTEFANVATPNEVVVSTSFSMELGSNGGDVHVCMPYTM
FT                   IEPIRDLLTSAIQGEALEVDKRWVRLLSQQVQTAEVELVAHLANANVQVSDILNMKVGD
FT                   VIPLELDDSVTAKVDGVPVMECAYGTFNGQYALRVNRMLNMNGSEPAPEPENDK"
FT   gene            complement(395394..395885)
FT                   /gene="fliL"
FT                   /locus_tag="RPSI07_mp0335"
FT   CDS_pept        complement(395394..395885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliL"
FT                   /locus_tag="RPSI07_mp0335"
FT                   /product="Flagellar basal body-associated protein FliL"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3519573; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34685"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34685.1"
FT                   /translation="MAEAAAATSVPAPAKGGSTKLLLIILIVLVLVGMGGAAAWFFLGG
FT                   GSHAAASAPPKPKEPFFVPMETLTVNLQPEEGNDRYLQIAITFKSYDKHAEEAIKSYTP
FT                   ELRSRVLMLLSSKAPAELYSNEGKAKLAKEIVEQCEQAYKAVGKESPVADVLFTNFVIQ
FT                   "
FT   gene            396360..398096
FT                   /locus_tag="RPSI07_mp0336"
FT   CDS_pept        396360..398096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0336"
FT                   /product="putative modulator of Rnase II stability, signal
FT                   transduction protein eal-ggdef domains (gmr)"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11260472; Product type pf : putative
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34686"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34686.1"
FT                   /translation="MVNALTEGLMVCDAQRRITYANPSAARLLGVRLDTLVGMRLSDVV
FT                   ASAFDEFDTPIREVDWPDGEVLADGQPQLNQIFGLRCLDGRTVWMSTNWTPLYAEAGEP
FT                   MTAVPAARHAQPYAVLVSLVDITQIREAQQRIRHLATHDTLTGLLNRSALEDRLEHALA
FT                   LARRNRSRVSVMFLDLDRFKNVNDTLGHQFGDQLLREVATRLQACAREADTVARLGGDE
FT                   FVVMLESLDSMGTRRVAERILAAIGAPFHIDGQELFLGVSIGIAVAPHDGDDPNTLLRK
FT                   ADAAMYLAKERGRNNFQTFTSDLDDRVSRRFRIESGLRRASDRNEFYANYQPRVDVRTG
FT                   RIVGAEALIRWNSTDFGRLMPGQFIQDAEETGLIVEIDRWILRAACDQLARWRRIGLPH
FT                   LRMSINLSGQAFSSGQLSGMVRGALTRSGLPGEAVELEMTEGILIRDDPSLHALLTELR
FT                   ALGVSLALDDFGTGYSSLSYLHRFPIDTLKIDRSFVQDLPHVAERAAITRAIIMMAQAM
FT                   GMKTVAEGVETVGQLEFLREIGCDEYQGYLLTRPLEPAAMHDLVREHERRYGAVRQGFL
FT                   PL"
FT   gene            complement(398115..398747)
FT                   /gene="vsrD"
FT                   /locus_tag="RPSI07_mp0337"
FT   CDS_pept        complement(398115..398747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vsrD"
FT                   /locus_tag="RPSI07_mp0337"
FT                   /product="response regulator, LuxR family similar to vsrD"
FT                   /function="13.1 : Two-component systems"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7868600; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34687"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34687.1"
FT                   /translation="MLNVLIVEPHDIARTGLRQILKDSRLARQIEAVPDLYGMPGLLDQ
FT                   REWDVMLFSVESATGDEFQTIKAIRQQHARLAVLALGRHPEALLAVRALKAGASGYLPM
FT                   DATQPQLLAAVNAISKGKKYLPPDLVEVLADNLNVDWDRPRHDVLSDREFQTLRMLGSG
FT                   RTLGEIAEALQISAKTVSVYRGRVLSKMKLRNNAELTMYVVSNGLQL"
FT   gene            399151..399972
FT                   /gene="fliC"
FT                   /locus_tag="RPSI07_mp0338"
FT   CDS_pept        399151..399972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliC"
FT                   /locus_tag="RPSI07_mp0338"
FT                   /product="flagellar filament structural protein (flagellin
FT                   protein)"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1482109, 2659972, 3536885, 6305924, 89181349, 90299842,
FT                   9298646, 9600841; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34688"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34688.1"
FT                   /translation="MSLSLNTNISSLQTQQALSQSQSALQKSLQRLSTGMRVNSAQDDA
FT                   AAYASASSLTTTLNAQTQGIQNANGANSYLQTADSYLGQVENNLQRMRQLAVESNNGGL
FT                   SAADQTNLDKEYQQLATANKNIETNANYNGNKLFDGSVASTTFQYGQNAATDAATVTNV
FT                   NMSTFGTLAGTSVTSAANATAAQAAIDTDLTSLKAARASLGAQQSGLTSTINTLTSNNT
FT                   ALSAAKSTLVDTDYAAETSNMTRQNILQQAGTAMLAQANSAPNSILNLLKG"
FT   gene            400162..402222
FT                   /gene="fliD"
FT                   /locus_tag="RPSI07_mp0339"
FT   CDS_pept        400162..402222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliD"
FT                   /locus_tag="RPSI07_mp0339"
FT                   /product="flagellar hook-associated protein 2 (Filament cap
FT                   protein)"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1482109, 1527488, 2659972, 6305924, 89181349,
FT                   90299842; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34689"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34689.2"
FT                   /translation="MTMATTTSTTSTSSSNAGTISFPGIGTSIDVATLVTNLMSVESRP
FT                   LTLLQNSQTSYQAQLSAVGTLKSSLSTFQSSLSSLTSLSGFTSMKASGYDTSILNASVT
FT                   SSAKSGSYAVNVTQLAQSQVLAAQGQASTTTAIGSGTSTTISFQFGTVSGGTLSNGTYS
FT                   GATFTQNGNLSGGSITINSSNNTLAGIRDAINSANLGVSASIVNDGSSTPNRLVLTSTA
FT                   GGSNSEMKISVSGDSTLASLLSNDPAGTQNMSEVTTGQNALATVNGIAVQSPTNTLSNV
FT                   VDGTSFTLSKTGSTTVSVANDSTATTTGVVNFVKAYNALRVSLNSLTNIDTTTSANNGP
FT                   LAGDVSTKTLVNQITDVLGQAIGSGTYQSLGSIGVTMGSDGTLSIDDTKLSAAIAASPS
FT                   QVAGLFAGAGTGTDALVSVPSFSDSTQAGTYAVNVTQLATQGSLKGSAAANTTITQGVN
FT                   DTLAITVSNITTNITVPAGSYTASSLAAQVQSQLNASTGLQNAGITASVAADSSGVLTF
FT                   TSSQYGSTSNVSISGNGASSLVGSSPTSVTGQDVQGTINGVAATGSGQNLYGATGTAVD
FT                   GLTVKVAGGTVGSRGTVTVQRGYAAQLNTVMTNLLSSTGMVQNETDAINSSLTSLASRI
FT                   STMQTQLNAKQALYYTQFNTLSALVASMSNTSTYLTTQLAAIAKQTSSSSN"
FT   gene            402282..402704
FT                   /gene="fliS"
FT                   /locus_tag="RPSI07_mp0340"
FT   CDS_pept        402282..402704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliS"
FT                   /locus_tag="RPSI07_mp0340"
FT                   /product="Flagellar protein potentiates polymerization
FT                   fliS"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12620624, 1482109, 89181349, 92407478; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34690"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34690.1"
FT                   /translation="MYAAHRAIGAYSQVGIETSVVDANPHRLIAMLFEGARSAINLALA
FT                   AMQRGDVLAKVRAFDKAISIIGQGLQASLDRQRGGEIAEQLDALYDYMLRRLLVANATN
FT                   DVAILEEVDRLLMPLQEAWAEIGKPGVVAGHLSVVS"
FT   gene            402764..403120
FT                   /gene="fliT"
FT                   /locus_tag="RPSI07_mp0341"
FT   CDS_pept        402764..403120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliT"
FT                   /locus_tag="RPSI07_mp0341"
FT                   /product="flagellar protein flit"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8195064, 8550529; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34691"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34691.1"
FT                   /translation="MFRNLPIKDSESLFVCYEAIARLTAEMVAAADVGNWEVVSTLERE
FT                   SATYVDVLRRSEPHPPLSHADLERKRALLVRILEDDARVRAVVHPRLDRLQKRIDTARR
FT                   ASSASLAYGTMARF"
FT   gene            complement(403154..403597)
FT                   /gene="ohrR"
FT                   /locus_tag="RPSI07_mp0342"
FT   CDS_pept        complement(403154..403597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ohrR"
FT                   /locus_tag="RPSI07_mp0342"
FT                   /product="Organic hydroperoxide resistance transcriptional
FT                   regulator, MarR family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11418552; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34692"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34692.1"
FT                   /translation="MTDALALDQQLCFPLYAAGHLLTRLYRPLLDELELTYPQYLVMLA
FT                   CWQQAPCAVGDLGRTLYLDTGTLTPLLKRLEEQGLLTRTRDRDDQRRVVIELTEAGRTL
FT                   RARAVKVPDALVCRIPLEPGEIGATRDVLRKLLEALAAADDRT"
FT   gene            complement(403844..404959)
FT                   /locus_tag="RPSI07_mp0343"
FT   CDS_pept        complement(403844..404959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0343"
FT                   /product="putative glycosyl transferase, family 2;protein
FT                   prenyltransferase (lgtF)"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34693"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34693.1"
FT                   /translation="MRKQPKPGGRSDIALVVIARNEAACIERCLRSAKPHVDRMIVLDT
FT                   GSTDETVAIAEGCGAKVHPFTWVDDFSAARNAALQLANADWNLVMDADEWLESGAGELR
FT                   EACTFGPLLGVVCIQSLDDAGGAAQRTNTWIPRLLPRGVRYQGRVHEQPVASLRRVRLP
FT                   LVFGHDGYVSAKLEKKRGRNAALLHAELADRPDDPYVLYQLGKETEINGKDPARAADLY
FT                   ARAVAGAPADAPYRHDACIRLLLCLRQSGRLEEAITRAGEWMDAWNASPDYFFVLGHLM
FT                   FDSAVKHPAQAAEQWLPMAERAFLRCLEIGDQPKLDDSVFGRGSFAAAENLAVVYQAQS
FT                   SALSAKANEYQALAERLKANLAAPGGAGSAR"
FT   gene            complement(404965..406350)
FT                   /locus_tag="RPSI07_mp0344"
FT   CDS_pept        complement(404965..406350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0344"
FT                   /product="putative mannosyltransferase och1 and related
FT                   enzymes"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34694"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34694.1"
FT                   /translation="MIPKTLHFIWIGDEAKRPDNCIQTWATLNPDYQIKIWGNATLGQH
FT                   KWLNARHMDAMLDREFNGVADMMRWEILYREGGIVVDADSICIRPLDDALLDCEAFACW
FT                   ESEIARPGLIAAGYFGCQAKNPFVHQIMQDIHQEPSVVHDLAWKTVGPQRLTESYRRYQ
FT                   YHPLRILPSHYFIPEHFTGVKYSGPGPVYANQMWGSTKNTYQSLHLQQFDADGNIVAQA
FT                   GTAETAPPPAQQQAAQEEAASAPTPAPAQPQAQPAPSRSPLEAAHDPYFVQRVPISTDI
FT                   MNLSRVDVFRKLCAGQRVLHIGCADWPITDPKTSLHLALESVCAKLDGFDIHAEALEAL
FT                   APYTCGKLFSRFEDIVDQYDIVLVPEVMEHVPNTGEFLAQLNALDAASYAITVPDAFQC
FT                   RGRHFDYLHDSQTFVEVVHPDHNCWYTPYTFANTIKKYTPWAIDGMWFFNSISLFMLAS
FT                   KRH"
FT   gene            complement(406452..406784)
FT                   /gene="fliE"
FT                   /locus_tag="RPSI07_mp0345"
FT   CDS_pept        complement(406452..406784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliE"
FT                   /locus_tag="RPSI07_mp0345"
FT                   /product="Flagellar hook-basal body complex protein fliE"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1551848; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34695"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34695.1"
FT                   /translation="MDITNANSVVSLMNSVLAPSSKVGSLDGSAGDSAKVSIDFGAVLK
FT                   SSLDKVDASQQKAETLSRSFELGNNDVDLHDVMLSLQKANIDLQTAVQVRNKLVSAYQN
FT                   IMSMSI"
FT   gene            407021..408856
FT                   /gene="fliF"
FT                   /locus_tag="RPSI07_mp0346"
FT   CDS_pept        407021..408856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliF"
FT                   /locus_tag="RPSI07_mp0346"
FT                   /product="FliF: Flagellar biosynthesis protein, M-ring
FT                   protein, Belongs to the fliF family"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1551848, 2544561; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34696"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34696.1"
FT                   /translation="MPTTADSVAVADTLGTVEMPAVGQGAIVRQNAGALGALGPFGRLS
FT                   PRMLAMIAGAALIAVVAAAMLWSRTPNYGVLYSNVADSDGGAIIAALQQMNVPYRFADG
FT                   GSAIMVPEANVHEARLKLAAQGLPKGGLAGFELMENQKFGTSQFAEQVNYQRALEGELA
FT                   RTIQAMQEVQSARVHLALSKPSVFVREQAKPSASVLLKLYPGRMLDRSQVQAIGHLVSS
FT                   SVPNLPLANVTVVDQSGRLLSSSFQDNASGLDPTQLNYVRDIEQGYIKRIEAILGPVLG
FT                   EDNVRAQVTADVDLDNTEQMAETYRPNQDPSNGVVRSTHTSESTQNKAGAQGGVPGALS
FT                   NQPPSAPRMLPTAPAPASQQAAAGQNGQNGQNGQQQAAAATGQTAANGVESSARDTTIN
FT                   YEVDKTVRRTRAAVGTVRRLSVAVVVNYRADGKAWKPLSDAEMVKLNALVKDAVGYDAK
FT                   RGDSVNVVNSQFSGTLPVAKDDLPLWKQPEMIHYAIQAAKYGALAIGFLILVFAVIRPL
FT                   IRSMNKKDEHAAATFVGREGEDPNAPIITGAAAPAGPELEGPSAASAQGDEVQIEVPQL
FT                   KMNHDFEQKLETMRRIAQQNPRAVAAVVKQWVSSE"
FT   gene            408853..409845
FT                   /gene="fliG"
FT                   /locus_tag="RPSI07_mp0347"
FT   CDS_pept        408853..409845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliG"
FT                   /locus_tag="RPSI07_mp0347"
FT                   /product="FliG: Flagellar Biosynthesis protein; motor
FT                   switch protein"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8224881; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34697"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34697.1"
FT                   /translation="MSAEGLQRSAILLMSLGENEAAEVLKHLGPREVQKLGATMAALKN
FT                   VSRDRVLDAFDAFFVEAEDLPLDIDSNEYIRSVFRKALGDDRAANIIDRILSGGDTSGI
FT                   EGLKWMDASSVAELIRNEHPQIIATILVHLDRDQASEILTYFTERLRNDTILRIATLDG
FT                   IQPSALRELNEVLTALLQGNDHRKKSTMGGVLTAAEILNLVPSAVESSVIEGVRSRDPE
FT                   LADAIVEKMFVFDNLIDLDNRSLQTLLREVGQDVLVVALKGAKQEFRDKVFANMSQRAG
FT                   QMLKEELEVLGPVKVSEVETQQKEILQITRRLADEGEITVGRKAEDAYV"
FT   gene            409881..410627
FT                   /gene="fliH"
FT                   /locus_tag="RPSI07_mp0348"
FT   CDS_pept        409881..410627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliH"
FT                   /locus_tag="RPSI07_mp0348"
FT                   /product="flagellar assembly protein flih"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34698"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34698.1"
FT                   /translation="MPRPPIIPRDTLVDYQPWEPTDFVRQAALAAAAAAPPPPPPEPEP
FT                   PAEPAISEEEWQAMLEAELANARDEGRRDGFAQGFQDGFEQGRRQGEEDSRQIAALMQS
FT                   VREAIDQMNGSIAEELVGLALQLAQQFLRGALHAQPERILPLVREVLGDAPTAPAPAML
FT                   RVHADDAELIHRTLGTELAAASWTLVTDAAIERGGCRVQTRFGETDATLQTRWAEMTRA
FT                   LGRDTAWIASERIEAERAAGGALHVA"
FT   gene            410617..412062
FT                   /gene="fliI"
FT                   /locus_tag="RPSI07_mp0349"
FT   CDS_pept        410617..412062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliI"
FT                   /locus_tag="RPSI07_mp0349"
FT                   /product="FliI: Flagellar Biosynthesis protein;
FT                   flagellum-specific ATP synthase"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1646201; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34699"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34699.1"
FT                   /translation="MSPEIVRTGSPAPGPLANPNVHLWQAHLHQTAQRARLARPVVTCG
FT                   KLTRVAGLVMEAVGLKLPVGSACRVELPYGRHVLAEVVGFAEERAFLMPQTDLVGVVPG
FT                   ARVFPLEPQHLPLNTADPTIAHSKFLPVGPRLLGRVVDANGEPLDGKGPLGTHEELAWG
FT                   SLAPAPLNPLKRKSIEHVLDVGVRAINGLLTVGQGQRLGLFAGSGVGKSVLLGMMARYT
FT                   QADVVVVGLIGERGREVKEFIDEILGDEGLARSAVVAAPADNSPLMRLQGAAYAHTIAE
FT                   YFRDRGCNVLLIVDSLTRYAMAQREIALAIGEPPATKGYPPSAFAKLPALVERAGNGMV
FT                   DATGRGGSITAFYTVLAEGDDQQDPIADAARAILDGHFVLSRKLAEQGHYPAIDIEQSI
FT                   SRVMSAIVPREQLDAARRFKQLYARYQRNRDLIAVGAYARGSDPMTDQAIARYPNMEGF
FT                   LQQGMFENESRERTLEKMNAVLS"
FT   gene            412156..412620
FT                   /gene="fliJ"
FT                   /locus_tag="RPSI07_mp0350"
FT   CDS_pept        412156..412620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliJ"
FT                   /locus_tag="RPSI07_mp0350"
FT                   /product="FliJ: flagellar biosynthesis protein , belongs to
FT                   the fliJ family"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1646201; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34700"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34700.1"
FT                   /translation="MTTHKPFRLETVLELAQKDTEKATQEVGRLMNTRELAAQKLALLS
FT                   DYRNNYRQQMLTNAEGGIDATRLHNYTAFIDRLGSAVDQQRGTISALEAQLQRSRDNWL
FT                   EKQRREQSFDILRQRHVEEERQVQERRAQRENDEHAAKLIRMRAAQAGSN"
FT   gene            412641..414176
FT                   /gene="fliK"
FT                   /locus_tag="RPSI07_mp0351"
FT   CDS_pept        412641..414176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fliK"
FT                   /locus_tag="RPSI07_mp0351"
FT                   /product="flagellar hook-length control protein"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1646201; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34701"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34701.1"
FT                   /translation="MGLSATPNTAATDLGAMLSAASTAADKSQTASSGADTFGNLLSDR
FT                   LNQEAARRQADAQSASSSAAARRTDTAKKDVAKANAASNDQGTRPADRDANAAPATSAS
FT                   ASATQDAQVAKPTSGDDAKDKTDAAQAAVDPAAQLAAQIEAARQAAQQATAPASQPGAQ
FT                   AAAADAAAAQLAAGKAGTTDAAALAALSAANAAAGKMTDPAAAVAQPQAAQAEALKAAV
FT                   GKDAQPTSLPDANAFAQTLARTRASADNTPAAVRRLGSTSSSAQGAGSERGTAAHRTEA
FT                   AHGTQTQTTTAVAAETGRNADTSGNTSTQADAQGTGAKFDGVLTRASGDAAATAPTFAV
FT                   GGAGTAGSAAGTAVAPAQTHTLPTFGDAAWPHTMASQLAYMQVHRQSSAELQLSPAELG
FT                   GLHVKLEVDNGAVNASFVCQHQAVAELVQDAMPRLRDAMQQGGMQLAQTSVSTGDFSQQ
FT                   GASQGSSAQGNGTGGGGRGGNRFAGTQGQADTGTVAVSASRVASHAGAIDTFA"
FT   gene            complement(414529..415509)
FT                   /locus_tag="RPSI07_mp0352"
FT   CDS_pept        complement(414529..415509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0352"
FT                   /product="putative transmembrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34702"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34702.1"
FT                   /translation="MHDLFPLIAEYGVFAVFANVFLTQAGAPLPAVPTLLVAGALTANG
FT                   ALPWLELLPAALTGALLGDGLWYLAGQRYGRHVMALLCRLSLSPDSCVRRTRTQFERWG
FT                   APMLLIAKFVPGLSTVSSALLGTTRTPFGTFALYDLLGSALWAAGWMLLGRVAHGSIDQ
FT                   LLTQLDQLGGHAVVLVTLLAAVYIAARWLQRWRFRKMLEMVRISPDELHALIESGDAPV
FT                   IIDVRAGSSRMSQPHRIPGAMLYDMSARDTPIEIEGPDREIVIYCACPNEASAVMLART
FT                   LRGRGFKRVRPLHGGIDAWMERGYGVEHVVSVTPATLAAAEAAGG"
FT   gene            415683..416234
FT                   /gene="pat"
FT                   /locus_tag="RPSI07_mp0353"
FT   CDS_pept        415683..416234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pat"
FT                   /locus_tag="RPSI07_mp0353"
FT                   /product="Phosphinothricin N-acetyltransferase (PPT
FT                   N-acetyltransferase) (Phosphinothricin-resistance protein)"
FT                   /function="16.8 : Protect"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number="2.3.1.183"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34703"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34703.1"
FT                   /translation="MSSATSAAVSLPIAGASGAIVVRPARLADLPAVAAIYAHHVRTGT
FT                   ASFELDPPDLAEMTRRFQALQDTGMPYLVAEADGNLLGYAYAGPHRARPAYRHTVEDSI
FT                   YLDTAAQGRGVGTLLLDTLVRECTARGFRQMVAVVGGGQENLGSMRLHARCGFREVGVL
FT                   AKVGYKFGRWLDIVLMQREL"
FT   gene            416527..417594
FT                   /locus_tag="RPSI07_mp0354"
FT   CDS_pept        416527..417594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0354"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34704"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34704.1"
FT                   /translation="MVKISENEAVEALASIVAAVPALELGEWSSELSSGRTLFDFVLEV
FT                   SASGRERHLVCAVTDNGQPRMVRQRVWPLLQALATRGSNATAVLIAPYLSPEARAICVD
FT                   HHVGYLDMEGNCRIAFDGVYIERAVPTKPAAERRELKSLFKPKAAQILRVLLREPGHRW
FT                   RGTDLADQADVSVGLVSNVRKALIAKEWAEVAEQGLTLTRPDALLDAWQASYEPPPGER
FT                   LTFYTPLHGAAFDEAAKHAFAEPANVLSHAMLGSYSAARWLAPFAKSGTQYLYADAVGL
FT                   QRLVKHCKLKPASSGSNVEVCLLVDDGLFRDVDLPAPGIVTTGPVQTYLDLMVSGERGQ
FT                   EAAAFLRETKLRWKE"
FT   gene            417591..418493
FT                   /locus_tag="RPSI07_mp0355"
FT   CDS_pept        417591..418493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0355"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34705"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34705.1"
FT                   /translation="MMPADLPLVPPDPQSATDYDDRTTVAVKSVLIEIGQLLGSFKGKF
FT                   AVVGGAVPWLLLDNADMRHVGTLDVDLSLDAHALAEDDEYVNLVRVLQANGYHQPAGCR
FT                   RFQLVRTVPATDGGAAIDVVVDFLMPRAVNLEKHKPPVLDDFAVQKADGVELGFEFATR
FT                   VKLDGAMPDGGTNRVEVHVASIPALLAMKGYALNNRLKRKDAYDIDYCIRNYRGQGEAL
FT                   AEECRPLLASESALQGYRLIASKFNGVDDFGPTSVRQFLEDSDALGAMTPEQCQRDAFE
FT                   QVDAWLKAIGLRQLDPPPE"
FT   gene            complement(418534..420003)
FT                   /locus_tag="RPSI07_mp0356"
FT   CDS_pept        complement(418534..420003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0356"
FT                   /product="putative signal transduction ggdef domain
FT                   transmembrane protein"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34706"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34706.1"
FT                   /translation="MLKLLLNQPKRLIGLALLFSLTVSVAAMLSLHEMRVDAFERAKDA
FT                   GANIALVIEHDITRNLEFSSLSLQNVADRLADPEVHRLSDHVQRMVLFDGRIQAQDLGS
FT                   ILVTDREGHVILDSKAEPARKLDFGDRDYFLRQAENENMGVYLSKPFEARTGLGLAIAL
FT                   SLRLNDADGKFSGVVSSGLRVRYFDRLFSGVTLGKNGSIALLYADGTLATRRPVLESAA
FT                   ATAKRSAHLGLFANTTGGTYLDASVRDGVERLYTYRRIGNYPLFVAVGTATEDIYANWK
FT                   ARAWWIGVLVVLFNMVTLAMAYLFAQHLDRRIEEQRRHAELAATDALTGLANRRALDER
FT                   LDAEWRRAARERQPLSVLMIDVDHFKAYNDHYGHPDGDVAIQAVARCIQANLRRPGDLA
FT                   ARYGGEEFCVVLPGSDLGSANVIAETIRHAILALNIPHTQSASAVLTVSIGAASGTPTS
FT                   SGEQQRAATLTKAADAQLYRAKTLGRNRTVS"
FT   gene            420591..422183
FT                   /locus_tag="RPSI07_mp0357"
FT   CDS_pept        420591..422183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0357"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34707"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34707.1"
FT                   /translation="MTTETLAHSIAEEATPATLLQMAGWHAQSGDPEQAERCYRWVLER
FT                   DPRHVPALLQLASLLQSDGQRVSEALPLLDTAIALQPRASALHVSRAIVLNALERRLDA
FT                   LESFAQACCLAPGDPGALYNLGLQYADLCCPAQTEVIARHLIGLRPDWPAAHYMLLRAL
FT                   TALEADPAEIEPLYRYLIKSDPMNVSLRFAHGLMQLKAGNYAAGWDAQEWRWDIEPAKS
FT                   AQQVFRQPRWAGGPLAGRRLLIVGEQGFGDILQFARYLPMLVERGAQVILLLDDNRAAL
FT                   ARLLGRIEGIEVVVGAQALPAFDLYCPLASLPYVFDTAVDSIPVPSYLSVDEADVAAWK
FT                   QRLAHLPRPWVGLCWAGSSEHVHNVRRSLPLCTGSRYYAERQARERRIMAVASRVAAAC
FT                   GVDGLDVAAARDALPSGWTMAPLLERTAGTFVSLQVGAHAADIDTLSASLRARVAAPLP
FT                   AQPDFYETACLIRALDEVITVDTSAAHLSGAIGQRGRIITPMAPEWRWIERNGRSAWYP
FT                   EMQLIPQGAIAGQ"
FT   gene            422579..422752
FT                   /locus_tag="RPSI07_mp0358"
FT   CDS_pept        422579..422752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0358"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34708"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34708.1"
FT                   /translation="MAYPDLQRFHHVSAAFDSADEAISAGVEEGRVIIEGWLGAGRVPA
FT                   GRRGESRVAQRV"
FT   gene            complement(422783..424321)
FT                   /locus_tag="RPSI07_mp0359"
FT   CDS_pept        complement(422783..424321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0359"
FT                   /product="putative signal transduction ggdef domain
FT                   transmembrane protein"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34709"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34709.1"
FT                   /translation="MSIFSINTPKRLIGAALLFSLTVSAGAALSLYEMRLDALKCAKDA
FT                   GANIALIIERDVARNLELYSLSVEAVLERLADPEVHQVSNHIRRLVLFDGIAQARDLGS
FT                   ILVTDTRGQVILDSKAEPARNVYIGDRDYFRQQARIDSTAVLISKPLEARTGFGASITV
FT                   SRRLNDAHGKFAGVIAGALRVNYFDRLFSGMTLGPKGSIALFYADGTLIARRPAPSATG
FT                   VATKRDADAPKPVIDTTDGLYLGKSVRDGIERLYTYRRIGHYPLYVAVGAATEDIYANW
FT                   TSRAWAIGLLVAVFNLVTMALAYEFAKQLEKRLAAGRRHAELAITDALTSLPNRRALDA
FT                   CLDKEWKRALRERWPVSLLMIDVDAFKLYNDHYGHLGGDTALKAVARCIQAHACRPGDL
FT                   AARYGGEEFCVVLPHTDLEGAAAVAEHIRQAVLALHIPHAQGPAGILSVSIGVASDTPA
FT                   LSGDRAETLTQAADTQLYRAKTQGRNRTMPALPEAENGPEETPGSQATLARRSG"
FT   gene            complement(424550..424615)
FT                   /locus_tag="RPSI07_mp0360"
FT   CDS_pept        complement(424550..424615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0360"
FT                   /product="putative lipoprotein (fragment)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34710"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34710.1"
FT                   /translation="MVPLVGHVAAAPTDACADIID"
FT   gene            424716..425321
FT                   /locus_tag="RPSI07_mp0361"
FT   CDS_pept        424716..425321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0361"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34711"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34711.1"
FT                   /translation="MFVEAKNAEGAVAGGKSRPGLSQSLARPARRICAHCLKLAICAAM
FT                   PVAFAQMPSASGPSGAPGRDLRNGFNDPFIQISKDVPDCPVPRGPFLTEAQMRGQSHDR
FT                   IERGNSCYHAGLCRHASAYAYDPEIADAAQKRLRNDPRLRDSALWITVQRRFITLQGCA
FT                   ASARQTDYVAEVLRQLPDVQHVTVDVGVRRPSAPVMDR"
FT   gene            425631..425933
FT                   /locus_tag="RPSI07_mp0362"
FT   CDS_pept        425631..425933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0362"
FT                   /product="conserved hypothetical protein; putative exported
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34712"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34712.1"
FT                   /translation="MKAQRTLIAALIALATVPALAATRFDVDTQGAKAGERFDVYTQGA
FT                   KVNGKFDTYTEGAKAGSKFDPYTDGALARVGRFDTYTEGAKAGSKFDPYTDGALA"
FT   gene            complement(426169..426441)
FT                   /locus_tag="RPSI07_mp0363"
FT   CDS_pept        complement(426169..426441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0363"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34713"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34713.1"
FT                   /translation="MSKKVLRYAVNVVLSLVLADALARYVARLPYELAPLNGAVDGFCR
FT                   AIGITAPEDVELVGLAFIYLVALVIVGLAVWLANAAIRRRTASSA"
FT   gene            complement(426438..426923)
FT                   /locus_tag="RPSI07_mp0364"
FT   CDS_pept        complement(426438..426923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0364"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34714"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34714.1"
FT                   /translation="MPVSCTYTLNNSPLSTFVCLGMGSFTAFSGMPKDRNNPTATDHPD
FT                   SGPLLAGKYYIVDRESGGNLGWLYDSFRTHAYGTDRDTWFALYREDDLINDQTFVKGVK
FT                   RGAFRLHPIGPARRSAGCITFTDPKQYDQLRAHLVKNGATMPVPGTTLKAYGTVEVK"
FT   gene            complement(427022..427258)
FT                   /locus_tag="RPSI07_mp0365"
FT   CDS_pept        complement(427022..427258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0365"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34715"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34715.1"
FT                   /translation="MATIMTNWWRRFRDLLPDSPRLVGTVTTNHGDGTVTVSLQGGGTL
FT                   RVRGTTTAGASVYVRDGAIEGAAPTLPTYGVEI"
FT   gene            complement(427262..427426)
FT                   /locus_tag="RPSI07_mp0366"
FT   CDS_pept        complement(427262..427426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0366"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34716"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34716.1"
FT                   /translation="MLPEVGLLAPGAVVQLRDTAYWRGIVRATDVSARWGRDHALTVAQ
FT                   TVEIERRYR"
FT   gene            complement(427513..427881)
FT                   /locus_tag="RPSI07_mp0367"
FT   CDS_pept        complement(427513..427881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0367"
FT                   /product="conserved hypothethical protein(fragment)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34717"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34717.1"
FT                   /translation="MYDLDWRLADWLVPANSWSYQDLTPIGVISRIAEAAGGYVNAHPY
FT                   ENRLIVQPEYPEPPWNWGALQLDADLPVDLVKVIDHRFEETPAFNGVYVQGDRNGILAR
FT                   VFRSGTAGDQLAPTVVDS"
FT   gene            428165..428512
FT                   /locus_tag="RPSI07_mp0368"
FT   CDS_pept        428165..428512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0368"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34718"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34718.1"
FT                   /translation="MMPVRPIQCPKTRTQRQAQRRPRAALAASVVVAAMLAAGCATVTP
FT                   GPFQITVRDADDSVLEQFQFQAGSQASLENAMIGMCRVYPDATVVAEQLQTHEQLRERC
FT                   KRSLASMLSAS"
FT   gene            428607..429281
FT                   /locus_tag="RPSI07_mp0369"
FT   CDS_pept        428607..429281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0369"
FT                   /product="putative transmembrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34719"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34719.1"
FT                   /translation="MKEPVEAVEPTAVQRFVATRPRLLAALMLGAAAGILAPIESSRLT
FT                   RILLGWDVAVWTYLVLAGAMMLRANPRRIQAVARREDERAAAVLAAVCVGVIASMVAIV
FT                   FELATARSAGHAQAVHYAFTGVTVLGAWLMVPMMFTVHYAHLYYRTDGEPPLKFPDEQI
FT                   APDYWDFLYFSFTIAVASQTADVSIRSRAMRRAVLGQSLLSFFFNTSILALSINIAAGL
FT                   FS"
FT   gene            429278..430306
FT                   /locus_tag="RPSI07_mp0370"
FT   CDS_pept        429278..430306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0370"
FT                   /product="putative permease transmembrane protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34720"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34720.1"
FT                   /translation="MTKLPPQPLPSRTVDTASYVLVAVMIAAVLWLHLLPAAIAGFLVY
FT                   ALARRLEARLRARRALSKRAKSIAVLGVFLIAALILAGMGLGIGRLVEHGHGLDGMLLR
FT                   VADVLDNLRDSLPPTFADYVPQSVSELRARLVEMLKEHGHQVSTLGIDGLRASAMALVG
FT                   LILGAMMAWSETPDPARSKPLSAALLQRLGRLETAFEAVVFAQVKISALNTALAAIYLM
FT                   GVLPVLGLHVPYSKSLVLLTFVAGLIPVAGNLISNTAIVLMSVTVSLELAVASLAFLVI
FT                   VHKLEYFVNARIIGSRIDARAWELILALIVMEALFGVGGVIAAPVLYAYLKRELSEAGL
FT                   IG"
FT   gene            complement(430417..430749)
FT                   /locus_tag="RPSI07_mp0371"
FT   CDS_pept        complement(430417..430749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0371"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34721"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34721.1"
FT                   /translation="MDRRTMPCTDAGDRTETMHAWGMRHAAHDDPHPEPATRDRRQPPA
FT                   NPREGSMHVLLTGTIRRAVGDHFCQAPLDGRAIGCFVIAEAVDTTGDATRPPPQAPLPA
FT                   YRPSAR"
FT   gene            431038..432273
FT                   /gene="fsr"
FT                   /locus_tag="RPSI07_mp0372"
FT   CDS_pept        431038..432273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="RPSI07_mp0372"
FT                   /product="fosmidomycin efflux system, member of the major
FT                   facilitator superfamily, fosmidomycin resistance protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 21450803, 8917080, 97074653; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34722"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34722.1"
FT                   /translation="MDTTANGAATEQARAQAGTTGFGVIGAISFAHFLNDMMQSLILAI
FT                   YPLLKGNFHLDFTQIGLITLTYQITASLLQPMVGLYTDRHPKPYSLSVGMGFTLVGLLL
FT                   MSVAPNFGTLLLAAALVGTGSSIFHPESSRVARMASGGRHGLAQSLFQVGGNVGSAMGP
FT                   LLAAAVIMPYGQHSLGWFSIAALIAMVVLYHVGGWYKRERAAGQGRKAGARAQAAERLP
FT                   AGKVAMAMLLLVVLLFSKYFYLASLNSYYTFYLISKFHLSAQVSQLFLFLFLFSVAVGT
FT                   IAGGPIGDRFGRKVVIWVSILGVAPFTLLLPYANLFWTAVLTVSIGLVLASAFSAILVY
FT                   AQELIPGKVGMVSGLFFGFAFGLGGIGAAVLGRLADATDIYHVYHLCSFLPLIGLLTVF
FT                   LPDLERRASRPA"
FT   gene            complement(432279..432719)
FT                   /locus_tag="RPSI07_mp0373"
FT   CDS_pept        complement(432279..432719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0373"
FT                   /product="putative transcriptional regulators"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34723"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34723.1"
FT                   /translation="MHADLSYCVALRPAAFFMPSEEVDADHVRRLADTIRATGLWTTPI
FT                   PIERDTGIVMDGNHRVRAAALLGLHHLPCVLLDYADPRVSVTHWSSGAPFSVASIRQRI
FT                   VAERRLFPYKTTRHRFAPALPGTEIPLTVLGAAHGARVAALA"
FT   gene            complement(432709..432792)
FT                   /locus_tag="RPSI07_mp0374"
FT   CDS_pept        complement(432709..432792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0374"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34724"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34724.1"
FT                   /translation="MRTSRIEATGVLADPFANLAQEMANAC"
FT   gene            complement(432869..435106)
FT                   /locus_tag="RPSI07_mp0375"
FT   CDS_pept        complement(432869..435106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0375"
FT                   /product="putative ferric siderophore receptor protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15289555; Product type prc : putative
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34725"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34725.1"
FT                   /translation="MLSSLRRQAASAMPLPARSSGAPFRPLALTARMAFAGVLTSGLGL
FT                   PAFAQSAPKSATDTAEHAIQLPETVATGRTSDDLLRPYAGGQTARGGRVGLLGNKDTMD
FT                   TPFSVSTYTAKRMEDQQATTLADVLNKDASVRFTGQTGGVTDSFYIRGFPVGEGNLSEV
FT                   AFDGVYGVAPNYHIFPEYVERVEVIKGPAALLYGMSPNSGVGGVVNIVPKRALPQDLTR
FT                   FTATYASDSQLGGHVDLSRRFGEGRAFGIRFNGVVRQGNTPLDHQRSRTDIGALSLDYQ
FT                   GDRLRASLDVITQHEAVDAPTRPFLLASGVAMPSAAEGRRNVSQPWGWWKSDGQSALTH
FT                   AEYDVSDRVTVFANAGGSQTSIGRLSDQTPTILDAAGNTRSTPGYYKFQVNRLTADAGV
FT                   RTRFDTGMVKHALTLQASTYHDRVATANNMGTAILSNLYAPVSAPEQFIAAPAAVPKTS
FT                   SSQLSGVALADTMGVLNDRLQLTLGLRQQKVSSDNFSASTGAVTSSYDKSAVTPMAGIV
FT                   VKPWQNVSLYANYIEGLSKGDIAPTTASNAGQVFAPYKTKQYEAGVKVDHNGLLATLAV
FT                   FQITKPSGQLTGTVYGVDGEQRNRGVELNLSGEPVRGVRLLGGVTVLDAVLTKTNSAAT
FT                   VGNRPVGVPGLMANAGAEWDLPWMPGLALNSNVTYTAKEYINQANTQSVPSWTTVDIGA
FT                   RYTTKLQGKSTTFRATVLNVFDRKYWSGVASFGTISLGAPRTALLSASVDF"
FT   gene            435389..435979
FT                   /locus_tag="RPSI07_mp0376"
FT   CDS_pept        435389..435979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0376"
FT                   /product="putative extracytoplasmic function sigma 70
FT                   factor transcription regulator protein"
FT                   /function="9.3 : Transcription factors"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34726"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34726.1"
FT                   /translation="MTMTGPHCDSACSLLITAFVDHYEELVDHVRHRFGDRAFACDVVQ
FT                   DVCVQLLHRPPAEPICTPLAFLRHLSIHRAIDRWRSDETHATYAELAGQAVPDTDDVDG
FT                   ERIVASRQTVHQVEQAIDGLPARCREVFILHKLHDLSQDEVAVRLCISRNMVAKHLARA
FT                   MLAMHPISPAHRMPERRAPMLAAHSRSPDPCGP"
FT   gene            436162..438627
FT                   /gene="aleB"
FT                   /locus_tag="RPSI07_mp0377"
FT   CDS_pept        436162..438627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aleB"
FT                   /locus_tag="RPSI07_mp0377"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8808942; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34727"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34727.1"
FT                   /translation="MSGTGRHWGVGHFVCVAVAGSCVSTLAWGQEAPVPVDIPAQRLDR
FT                   ALTALAQQSGVQIQFADALAGQRTAPAVHGRMAVSDALERLLAGSGLQARSTGANTFTV
FT                   EAQAPDVPPKVAAGEPKALPVAELEATVVSTDRTRSDLVRPTRQVTQISHDELSDLQAG
FT                   SGTLATALSKVVPGMADSSRTITDYGQTLRGRSTLVLLDGIPLNTNRDSARNLASLDPN
FT                   NIERIEVLRGSSALYGSGATGGIVSITTRPAGGEPRAETTFSMTSPLSHPGAAGLGGAV
FT                   QQYVAGSKGPVDYEFNVGTQHIGGSYDARGHRIAPEPSQGDLFDSNIYSIGGKLGLRID
FT                   PDQRVVFSASHYDAKQNTDYASDPSVAKLPAGSAVARAINGLQLADQNRIKNTLLNLQY
FT                   ENKDVFGSQVGAQFYYRDYFSRFAPFDARAVSTRGNNVDQVMQDTTVFGSRLTVTTPLD
FT                   KAARTKLLWGADFNQERSDMPDDIFSPTAYDASGGLVYRKIGTVTYLPPLTTRSVGGFG
FT                   QLQHKFNDRWSAEAGVRYEHASASFDSFVPLSQSRLAQKYTVPGGETGFGAWLFNAGVT
FT                   YAPVRGQEVYASFSQGFQLPDVGLQLRNATAGFNINSSSLEPVKTNNYEIGWRGNLGNH
FT                   TRGTLALFYTTSELGDVQSFNNGLVLTRTAERIAGVEAGIDYASDDEKWGAGGTLTYME
FT                   GRERPQGAANYQNMTGYRIPPLKLTGYLEYRPTARWSNRLQATFYAARDYRLNGRTSFG
FT                   RIDVASYTTIDLISTYQITKKDKVRVGIENLLNRYYLPLYSQLMRNSNNTSRLPAAGAV
FT                   LTVSYTHRW"
FT   gene            438724..439740
FT                   /gene="cysM"
FT                   /locus_tag="RPSI07_mp0378"
FT   CDS_pept        438724..439740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysM"
FT                   /locus_tag="RPSI07_mp0378"
FT                   /product="cysteine synthase (O-acetylserine sulfhydrylase)
FT                   (O-acetylserine (Thiol)-lyase) (CSase)"
FT                   /function="1.5 : Serine family"
FT                   /EC_number="2.5.1.47"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8867384; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0378"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34728"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34728.1"
FT                   /translation="MIAKSIVDCIGGTPLVQLARLYDGRKAEVFAKLEMLNPAGSIKDR
FT                   PARYIIERGLAEGSIAPGAHIIESSSGNLAIALAMVCRIKGLRFTAVVDPKISPTNLKI
FT                   LRCYGAGIERVTRKDSQGGYLETRIERVQQMLAREPGAVWINQYGNPRNWESHFYGEGD
FT                   EIARALDRPADMLVLGVSTSGTVLGIARRLRREWPGLKVVAVDAVGSVLFGAKPGPREL
FT                   PGIGASRVPELLCRDDIDDVIHVDDYDAAMGCRRLLEREGIFAGGSSGAVVVAIERLLA
FT                   RATRPLRIVTLLPDRGERYLDSVYDDEWLARIAASRAGGAVSAASPSLHVPSLEEVL"
FT   gene            439647..440762
FT                   /locus_tag="RPSI07_mp0379"
FT   CDS_pept        439647..440762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0379"
FT                   /product="putative ornithine cyclodeaminase protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="4.3.1.12"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34729"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34729.1"
FT                   /translation="MARAHCCIPGGRRCLRRLAVSPRPISRRGSLNMTHPADTGLLYLG
FT                   RQDLVALGGDRSQPYVDAITEGLALHAKQDFVQPLKPYLRWPGADHIADRIIAMPCYVG
FT                   GETPIAGLKWIGSRQHNPSRFQLERASAVIVLNDADTNYPVAIMEGGLISGMRTAAISA
FT                   VATRHLAREGFTDVACIGCGPIARMQMQTLVEQFPGIRRVHLFDVSREAMRAFSDALTA
FT                   RFPQVACEQADSAEQAVRAADVIVTCTVTDAPYLEYAWLRRGAFVCNVSIMDVHKEVYE
FT                   KADKVVVDDWDQSNREKKIINQLVLEGRFSRERLHAELGEIVIGERPGRENDDEIILLN
FT                   PMGMAIDDMVCARHFYQLAARAGVGTRLPLL"
FT   gene            440759..442660
FT                   /locus_tag="RPSI07_mp0380"
FT   CDS_pept        440759..442660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0380"
FT                   /product="putative siderophore-iron transmembrane
FT                   transporter, siderophore synthetase"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34730"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34730.1"
FT                   /translation="MTDVVEERLDAPDAAADGSAGLADRIDRGLAQDLLDALWLEDLYG
FT                   FRGRAQWRTDAAGEAVLAVPLADDASLQWRGARLSGMRALRLAQAGPAVVLQRAATRRS
FT                   LSAVETLDALQHAPWWPAHSERLAQLLALAQRQMVRTFTVEADLLARVAGAPRSLAAWE
FT                   AVCCLRDRPFHPLARAKVWPDLPGDAFEVESGRPVALHWVAVARDALFSGDGAASGGDG
FT                   GEGAHAAQPVAAALLSDDDYDRLARCAVERGANPAALWLPVHPWQWRYLQQHRAAPARQ
FT                   CTDLGSGPGAAMPTASLRTLSVADGERLHLKLSLNVQALGAARTMPPRYLHNGVLAERC
FT                   LEMLRARDAWLGGHLALCSERAWWALGNAASLIEAQGELACMLRRYPAHDGWLLPMAAC
FT                   AAVTLDGRLPAFEALCGDAALQALAGPAAEAPAERAWRVFGRIAHLLIELGLRCFAHGV
FT                   MPELHGQNVMLRIGADGLQGLVLRDHDTLRICPPLMAAAGVEAPDYAIDLGTPNTLILD
FT                   APEALLAYFQTLAVEVNLYAIIAAIGECYRSDESIGWRIVGQALRESVDRVFGEGGAEA
FT                   LRSHVAHALFDAPHWPFKQILAPLAARASLGTGMPSGLCTIGNPLRLAMTPQEVPRR"
FT   gene            442657..443874
FT                   /locus_tag="RPSI07_mp0381"
FT   CDS_pept        442657..443874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0381"
FT                   /product="Efflux transmembrane protein (Permeases of the
FT                   major facilitator superfamily )"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34731"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34731.1"
FT                   /translation="MRSRPNLAVVTLIGCQAVITLGLMVLVPIMPFFLRDLMGGSVSAA
FT                   DAVRWTSIALAAPGVGALLCAPFAGRWCERFGYRRALLLALSLFVASMAMMALSRGVAV
FT                   FIAGRVLQGASTVGVIVTAFIARVSDPAGRGRALGWQESAVAAGALAGPVLGGVLQDVW
FT                   SVRPLLLAVAVCTGCAVLGLALSLREPAAPAHHDAPHEAGDGTPARSLLADPAFARWLM
FT                   AGALTQAGAFALVNVFALFVEARLAGTAAVASKVGVLHALGWCATLVAGPLWGAWNDRR
FT                   DPARQFAGASLACALALALMPLAAHLWQIGLLRVLQGACYAALAQSMLLICCRAVPPAL
FT                   QGRATVVAKSAMTLGQLLGPLAVLVVLPFTGPAATLWLTAAMFIAAAAIARPTLVVRFS
FT                   PVSDSR"
FT   gene            443871..445715
FT                   /locus_tag="RPSI07_mp0382"
FT   CDS_pept        443871..445715
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0382"
FT                   /product="putative siderophore synthetase component
FT                   protein, siderophore-iron transmembrane transporter"
FT                   /function="16.1 : Circulate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34732"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34732.1"
FT                   /translation="MSAMTFSSTQRVSPVRDAALHAPQASRATHRVDAPAGSDTLPALD
FT                   RRLLEQYFNTYCRETGGFDPRVTDDASLAGDLRRTAQAWRDEGHAVACVTFPHDGSRLY
FT                   VAIERFSQMGFHRLAPHAALQSADGTVMPFDSPEALTGRIAGALAFRQPPADAVWPQRF
FT                   AALMHNSIERVRYYHDHVPRRERPGTPFVRAEQSLLFGHVFHVTSKASEGFGEDDMQAY
FT                   APELGASFRLHYFAVSSRLFDASTIDASQPPIDPEAMHAATALLGDSEYRLLPCHPWQA
FT                   DHLLRQDAIKALLARRELISLGALGEVVWPTSSVRTVWLPLQRQFLKLSLDVRITNFVR
FT                   NNPPEQVARALDASRYIAALPAACRSSETFEILLDAGSASLSVVDDALRASTTVVYRQA
FT                   MRDAVGDDARVLATVLEEPVCGASPLQGLLQEALGQAPSFERVAAWWTRYLDATLMPLL
FT                   RLFACHGVSLEAHLQNAMVAFQAGWPVRGYVRDMEGASISRMRCARPELLAPQSPALYS
FT                   DEAAWKRFRYYVLVNHIGHVIASIARTGACDEAALWRVTAQVWARDAEPAVAALLDDVR
FT                   RRPTLPAKANMLSCFGGHGEAPAWVEIPNPLADEEHRA"
FT   gene            445712..447481
FT                   /locus_tag="RPSI07_mp0383"
FT   CDS_pept        445712..447481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0383"
FT                   /product="putative siderophore synthetase component
FT                   protein, siderophore-iron transmembrane transporter"
FT                   /function="16.1 : Circulate"
FT                   /function="4.14 : Siderophores"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34733"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34733.1"
FT                   /translation="MTLTEFDALLDSSAYRDAAQRVVRQLLEALLFEGALPEVTWSGDA
FT                   LSIAATREDGAPLVYRCRARRTVSFGRVRIVSPVRRICGTQESEADDVARVVAELASQL
FT                   GADPLRLAQFGAELLATHIKDAQTRAAQAGRLLREAGYDDIEAGLTGAHPYHPGYKSRM
FT                   GFTLDDNRRYAPECATGVTPLLLAARRDRCRWSASRDVEQGEPRHLLSAPEQAAFDARL
FT                   AQRGLDPSDYLPLPVHPWQWDALVETAYHNAFARHELVPIGALSDRYAPQQSIRTLANA
FT                   DRRDAPSLKLAMSLVNTSTSRVLAPHTVRNAALMSDWLADLAARTDWPEPLARPVILKE
FT                   VAGVGYVPQTPVAGQYGALACIWRESVHRHLRAGEAALPVTAITHVDADGRPLVADWVA
FT                   RHGVQAWVRRLVERVWLPVLHMLWRNGTALESHAQNMVLLHVDGLPERVALKDFHDGVR
FT                   YSRRWLRVAPPVLEAPPAEHARVNPNSFIETDDADELRDFTGDALFFVNLAEIAWFFAC
FT                   HFELDETTFWEIAAGAIRDYQARCPDLAESFARFDCFAPTMQIELLASRRFLPEIRLRT
FT                   RAADNPLAQMEYA"
FT   gene            447478..448269
FT                   /locus_tag="RPSI07_mp0384"
FT   CDS_pept        447478..448269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0384"
FT                   /product="putative 2-dehydro-3-deoxyglucarate aldolase
FT                   (hpch/hpai aldolase protein)"
FT                   /function="1.4 : Pyruvate family"
FT                   /EC_number="4.1.2.20"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34734"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34734.1"
FT                   /translation="MSAPQSLKARLKQADGRTLVGLFCSTPAPLMVELIAAAGYDFVVI
FT                   DLEHTLLDGATLTAMLLAARASGMAALVRTAAPFQIVQVLDAGAQGVVIPRVRSADEAR
FT                   EAVAAAHHAPLGRRGLNATCASRFGRDDLARAVGRAAADTLVVAMIEDRAGLDALDAIA
FT                   AVDGVDVLLGGAADLSQDLGVPWQTGHVDVRAAIARVAAAAHRHGKVFCALPRHPDDIA
FT                   DMHRAGVRLAIAGDDRGITRRAMAAQLQALSPDLEHEGAAQ"
FT   gene            448266..449507
FT                   /locus_tag="RPSI07_mp0385"
FT   CDS_pept        448266..449507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0385"
FT                   /product="putative diaminopimelate decarboxylase protein
FT                   (lysA)"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34735"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34735.1"
FT                   /translation="MNRELIERYLHGATSPVCAYLYDLDHLRERARRLSAMLPAGCELF
FT                   YAIKANSDAPVLAALDGAVAGYEVASLGEVVRAREVGGHARIVFGGPGKTDDELQGALE
FT                   RGVELIHAESELQLRRLDAIARRMGRRARVLLRVNPNPLSADAAGRRPEGTLTMGGQPT
FT                   QFGIEEDAVPGLIRLARTLPGVEVVGLHLHALSNNLDADSHLALMRHYLSLALRLHREH
FT                   GLTLDTLNVGGGIGVDYAQPSHAFDWRRFCDGLGVLLAEARAGCRIVFECGRFIAADCG
FT                   YYVTEVVDIKRNHGKWFAVLRGGTHHFRLPASWQHNHPFAVLPNAQWSYPFARPSVQAQ
FT                   AITLCGELCTPKDVLARDVVVDRLSVGDRIVFQLAGAYGWHISHHDFLSHPHPERRFVG
FT                   TLHEPHDARLEVVA"
FT   gene            complement(449760..450731)
FT                   /locus_tag="RPSI07_mp0386"
FT   CDS_pept        complement(449760..450731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0386"
FT                   /product="putative transcription regulator protein, LysR
FT                   family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34736"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34736.1"
FT                   /translation="MPINELRAIATFAKAVELGSIRRAAAAQGVTPQAASQALAQLEVH
FT                   LGVRLLHRTTRSLALTDEGQRFLETAQPALAALERALNQVRESKDEIAGPLRIVGPKSS
FT                   FAAILMPVIDEFCRLYPQVQPDVQLDDGKSNWVLERVDVGFRIGTSPDEGVIARRLFPV
FT                   QLMICAAPSYLERHGAPKSLEELATHRCSAFRHPAKDQVLPWYLNIDGEIVHRHISPTF
FT                   STNDTELELQAVLAGQVVGQIANLAAAAHIRAGRLVPLLLQHMSDHIGVHLYYGSRTAQ
FT                   PRRVRAFIDLAIQRLLETPTYVLSAKELALAAARQGKTKRSR"
FT   gene            450841..451029
FT                   /locus_tag="RPSI07_mp0387"
FT   CDS_pept        450841..451029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0387"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10532"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10532.1"
FT                   /translation="MNSPHHHRAHGASLDSGDAVLAGDLMPMIVLGHFDRHHRLAEGSQ
FT                   LLGFSTAAPRGFGAAGR"
FT   gene            451074..451928
FT                   /locus_tag="RPSI07_mp0389"
FT   CDS_pept        451074..451928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0389"
FT                   /product="NADP-dependent (Cinnamyl)-alcohol dehydrogenase
FT                   (Zinc-binding)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.195"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34737"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34737.1"
FT                   /translation="MPYAVKSYAAHSPTSRLGLFECDRRSPQPDDVVIEILYCGVCHSD
FT                   VHNVRNDWGSAQYPMVPGHEIVGCVLEVGSEVTRFKAGDHVGVGCMVESCRHCNACGKG
FT                   WEQYCENGATYTYNGTDPIDGTRTYSGYSEKIVVAEHFVLKVPDGLDLAGAAPLLCAGI
FT                   TTYSPLRHWKVGPGSKVAIVGLGGLGHMGLKLAKAMGTEVTLFSRSPGKEADARRLGAD
FT                   HIVMSTDTAQMAAAVDGIDAIVLTHGSDGGGHGACARARRPGAALGRRTFFSPPDPSLR
FT                   RLH"
FT   gene            451925..452467
FT                   /locus_tag="RPSI07_mp0390"
FT   CDS_pept        451925..452467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0390"
FT                   /product="putative Cupin 2, conserved barrel domain protein
FT                   precursor (exported protein)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34738"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34738.1"
FT                   /translation="MKPLIAAAAMALSVLEPAGAAEPDLQITRAGTRAVNVAPAQNFTG
FT                   NVTVEMLYTPVGTERASAGTVRFSPGARTAWHSHPLGQTLIVTAGIGRIQRWGGPVEEI
FT                   RVGDVVHIPPNTKHWHGAAPDSAMTHIAITEALNGTTAEWMERVTDAQYGATPARSSLR
FT                   PSPDASRSPPPNEMTAC"
FT   gene            452461..455667
FT                   /gene="agrA"
FT                   /locus_tag="RPSI07_mp0391"
FT   CDS_pept        452461..455667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrA"
FT                   /locus_tag="RPSI07_mp0391"
FT                   /product="Cation/multidrug efflux pump, Acriflavin
FT                   resistance protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34739"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34739.1"
FT                   /translation="MLIGVVRVALRRPYTFVVMALLLLIVGPLAALRTPTDIFPEIRIP
FT                   VIAVAWQYTGLSPDQMSGRISSPFQRILTTAVNDIEHIEAGTYSGVGIVKIFFQPGVNI
FT                   ATANAQVTAATQVALRQMPAGTQPPVILNYNAATVPILQLALSGEGLSEQQLFDLGMNT
FT                   VRTPLVTVPGAAIPLPYGGKQRQVQIDLDPAALQARGLSAQDVSAALAAQNVLVPIGTQ
FT                   KIGSLEYTLQLNSAPSAIAEIGRIPVKVVDGTTVLLRDVAQVRDGSAPQTNIVHVDGGR
FT                   SVLMSVLKNGSASTLAIVDGVREKLAQMRAALPGALKVLPINDQSVFVRAAVKGVALEG
FT                   ATAAVLTSLMILLFLGSWRPTLIIAVSIPLSILGAIVAMAALGQTLNLMTLGGLALAVG
FT                   ILVDDATVTIENINWHLEQGKDVETAILDGAQQIAVPAFISLLCICIVLVPMFFLEGVS
FT                   RFLFVPMAMAVILAMVCSFILSRTLVPTMAKFLLRAHHGHAGAGSPRNPLARQQRRFEA
FT                   GFERMRAGYRGLLRQALAHRGRFLIGFAAAVLASFALLPFIGSNFFPSVDSGQILMHAR
FT                   VPVGTRIEETAERFARIERAIRRVIPAVEIETLVDNIGLPPSNINLTYNSTGVSGSHDG
FT                   DFQIALRDGHRPTADYVRQLRDVLPDAFPDTQFWFPPADIVSQILNFGAPAPIDLQVRG
FT                   RDLDANFAFAQRLAARLRAVPGVVDVRIQQSNKAPVFNVDIDRTQAQLLGLTARDVTNS
FT                   LVVNLAGSGQVAPTFWLNPANGISYPIVMQTPQHELDSLAALQNLPVGNGSTPNATTLG
FT                   GIASLGRSTGSTVISQYDVQPMVQVHAAAQGRDLGAVATDIRRVLAELAGDVPKGASVQ
FT                   LVGQVQTMDRAFTGLFVGLAGAVLLIYLLVVVNFQSWRDPAVIVSALPAALAGIVWMLF
FT                   ATQTTLSVPALTGAIMCMGVATANSVLVVSFARERLAELGDAAAAALEAGHVRFRPVLM
FT                   TALAMVIGMLPMALGLGEGGEQNAPLGRAVVGGLITATVATLIFVPVLFSLVHARDARM
FT                   SEPGPEPIPRLPEPNASSHA"
FT   gene            455660..456820
FT                   /gene="agrB"
FT                   /locus_tag="RPSI07_mp0392"
FT   CDS_pept        455660..456820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrB"
FT                   /locus_tag="RPSI07_mp0392"
FT                   /product="RND efflux pump, membrane fusion protein, CzcB
FT                   subfamily"
FT                   /function="16.4 : Excrete"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0392"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34740"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34740.1"
FT                   /translation="MPENTLPTRRSAAVLTACAALIAVVAVVTAGLLSRRSQARDLQVR
FT                   AAAQAVPAVKLVEPTALAAETLELPARLEPWARAPIHARVSGYLKRWSIDIGGSVKAGQ
FT                   VLGEIETPELDEQLAQARAELATARSNAALAASTARRWQSLLATDSVSRQEADEKAGDL
FT                   AAKQSVVHALQANVDRVQATKQYARLLAPFDGVVTARNTDVGALIGAGGSPGNELFVVS
FT                   DIRRLRVYVNVPQRQATAVRMGSEAQLIVPERPAQVYRARVESLAHAIQSGSGAMLVQL
FT                   VVDNQAGELLPGGFATVRFPLSEQERRIGVPPGALIFGKDGVRVATVQGGDRVLLKPVT
FT                   IARDLGSVVELEAGLGRADRVIDSPPDGLASGDRVRITSAPKKATS"
FT   gene            456817..458244
FT                   /gene="agrC"
FT                   /locus_tag="RPSI07_mp0393"
FT   CDS_pept        456817..458244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="agrC"
FT                   /locus_tag="RPSI07_mp0393"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34741"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34741.1"
FT                   /translation="MRRTMRLCAWLPPLVSIAACAPMPPASLPEVSVAATFKEAPTAQG
FT                   ASEAALAGRWWTLFGDAELDALQQRLSDNSPDLAAALARYGQARAASDLLRAAQVPSIG
FT                   ASLDVQRDRQALLRPLRVLGPGSPDDYTSATLALDVSYEVDLWGRVRQRVEAGAAEARA
FT                   ARADLAGARLALQAQLADTWIALRGLDAEVALLRETEASYSRAAELIGHRYQAGTASGL
FT                   DLARAQTQLYSTRSQLRQALAQRAVLEHAVATLVGANASAFASEPRVVAAVVPAIPVGL
FT                   PSTLLQRRPDIVAAQERVASANASVGVARAAFFPSLTLAAQGGFQTSDFARFIEAPNLF
FT                   WAVGSGLAATLFDGGRRQADIARAKVVLDEAGQRYRGTVLAAFQQVEDQLALLARYGEA
FT                   AADERSAVAASQRALDLATNRYRDGMASYLDVVTAQTANLQARRNELDLVTRQRRATVQ
FT                   LVRAIGGGWLAGGDGDV"
FT   gene            complement(458474..458644)
FT                   /locus_tag="RPSI07_mp0394"
FT   CDS_pept        complement(458474..458644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0394"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34742"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34742.1"
FT                   /translation="MVRRPCAEVTAPMPMAVGPLPIRERTQSWPHWLALAEVERPLQVD
FT                   CVEKRSSDDGL"
FT   gene            complement(458617..459444)
FT                   /locus_tag="RPSI07_mp0395"
FT   CDS_pept        complement(458617..459444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0395"
FT                   /product="putative short chain (glucose/xylose)
FT                   dehydrogenase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34743"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34743.1"
FT                   /translation="MKEVVVVIGSGSIGQAIARRVSAGKHVLLADLREENASAAAKTLS
FT                   DAGFEVSTARVDVSLRESVQALVEMAQAIGPITGVIHAAGVSPTQASPATILKVDLYGT
FT                   ALVLETFGDVIARGGSGIVIASQSGHRLPALTPEQDKALAVTPTDELLALPMLQPEQVT
FT                   DPLHAYQLSKRGNALRVMAEAVRWGKRGARVNTISPGIIITPLANDELSGPQGTGYRRM
FT                   IELCAAGRAGTPDEVGSLGALLMGPDGTFITGSDFLIDGGVTAAYWYGDLAPK"
FT   gene            complement(460057..460731)
FT                   /locus_tag="RPSI07_mp0396"
FT   CDS_pept        complement(460057..460731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0396"
FT                   /product="putative phosphoribosyltransferase protein"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34744"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34744.1"
FT                   /translation="MSANFRDRTDAGRQLAAELATLDLPPPRIVLALPRGGVPVGHAIA
FT                   QALDAALDIVLVRKIGAPGQPELALGAIADCGAGVPPYIEWNTTLLHLAGPLQAYLDRT
FT                   VADERDELERRRIRYGATQPPQAGSLADATVIVTDDGVATGATMRAALAAVRRAHPARL
FT                   VLAVPVAPDDAWLTLRGLADESICLLTPPADLFRAVGLYYRDFEQTGDAEVIALLADRR
FT                   AP"
FT   gene            complement(460755..461315)
FT                   /locus_tag="RPSI07_mp0397"
FT   CDS_pept        complement(460755..461315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0397"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34745"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34745.1"
FT                   /translation="MLHVLSKLWWVLALRGVCAIAIGIGAFVVPAATLAALILVFGAYA
FT                   LVEGLLLLVTALGNHRAAPDRWPLLLQGLLGVAVGTLTLFSPAVTALALLFYIAAWLLA
FT                   HGVLQIVVAVRLREELTGEWWLIAAGAISVLLAIWLLWQPQAGVLAVLWWIGAWALVWG
FT                   VALVGAALRIRRWARSGSARAFT"
FT   gene            complement(461556..462176)
FT                   /locus_tag="RPSI07_mp0398"
FT   CDS_pept        complement(461556..462176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0398"
FT                   /product="putative amino acid (threonine) efflux protein"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34746"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34746.1"
FT                   /translation="MTELLAVAVITLLAVISPGPDFAMVTRNSLLHGRRAGLWCAMGIA
FT                   LGVQVHVFYTMFGVAVLMAYAPMLLGAIKLAGAAYLIGIGWKTLTANTMPSGNEPADGP
FT                   ATLATWAALRTGLLTNALNPKTTLFVVSTYTQVVHPGTTHAAQFGYGLFMSAAHAVWFA
FT                   LVATVLTSGTLRHALLARQRVVDRVIGAILIGLGMMLGVARLA"
FT   gene            462283..463149
FT                   /locus_tag="RPSI07_mp0399"
FT   CDS_pept        462283..463149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0399"
FT                   /product="putative transcription regulator, LysR family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34747"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34747.1"
FT                   /translation="MALPPLNTLRVFEAAARHGSFVRAAQELHVTHGAVSRQIRQLEQA
FT                   LGVPLFERRNRAVFLTAAGEQLRGTAADVFALLTDTFDRIARRATPAALVVSCEPTLAM
FT                   RWLIPRLARFQARCPAVQVHLFTAGGPIDFNRTGVDVALRRNDFPWPAHVHAAQVCEEW
FT                   IGPVHAPQADAPARRRLLHTATRPDAWQTWWRVSGTPRSRGRSQEARYEHFYLSLQAAL
FT                   AGQGTAIASKLMAGDDLADGRLEAPEGFLRDGSAYCLLAPVPIEPSSPAGMWLAWLREE
FT                   TAATLAG"
FT   gene            complement(463153..463428)
FT                   /locus_tag="RPSI07_mp0400"
FT   CDS_pept        complement(463153..463428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0400"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10535"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10535.1"
FT                   /translation="MDDLIRIENAYDHQTVAWLRERLGEQALCEVVLRMQGHGKPYASA
FT                   VCRALGLVPPPRRHVSGAINRAVGEAYLASIRALLAGHRAGGHAAA"
FT   gene            complement(463543..463818)
FT                   /locus_tag="RPSI07_mp0401"
FT   CDS_pept        complement(463543..463818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0401"
FT                   /product="hypothethical protein, low similarity with
FT                   transposase/integrase"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34749"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34749.1"
FT                   /translation="MNSGLLASIEIIETIRQELRADGITASISKLCRWFEGSRRTVYCR
FT                   SVKAQPKVQARFAEPIKFKKPSMPLRWSRPTGLLLLARRDMVAAQP"
FT   gene            464387..484660
FT                   /gene="rhiB"
FT                   /locus_tag="RPSI07_mp0402"
FT   CDS_pept        464387..484660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiB"
FT                   /locus_tag="RPSI07_mp0402"
FT                   /product="polyketide synthase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34750"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34750.1"
FT                   /translation="MHMQESQIISGWNDTYRKYPLDKGLHQLIEAQVERSPDAVAVRFE
FT                   DQVLSYGELNRQANRLAHYLRELGIGPDSLVGVLMERSVELSVALLAILKASGAYLPLD
FT                   PGYPEERLALIIEDASVTVMLTQQRFRERLAAYDGEVLCLDEPGHAALSGNDANPAPIN
FT                   GPDDLAYVIYTSGSTGRPKGCMLPHRAICNRLLWMQRHYGVGPVDRILQKTPFTFDVSV
FT                   WELFLPLLSGACLVMARPEGHKDPQYLVACIKAEQITICHFVPSMLRFFLKHPEVSECA
FT                   SLQKVFVSGEALTHDLLLQFRQAMGAELHNLYGPTEAGVDVTYWHGESREDQRVPIGRP
FT                   IDNIQIHILDAEARPVAIGDTGELCIGGVGLARGYLNRPELTAEKFIRDPFSGDAGARL
FT                   YRTGDKARFLGNGEIELLGRFDSQVKLRGFRIELGEIENTLRSHPAIDDAVVLVKDSGS
FT                   EDPKLVAFVVGKGLDRKGVRDFVKSRLPEYMAPNLVHFIDRIPVTVHGKADRKALLAGD
FT                   VEATAQSREQAVHPQALAAWLQQYFIGVLGVDELAVDDDLFDQGATSFTLVQAVHSIQQ
FT                   QYRVALPVDVFLEQPTIAAVAAHILGAKGITPGEAEAAPRSAAPVRQQAELDPVPVPLE
FT                   GVRFDSRAYRRPDGGSSANRERLGSLLSLLREVPLDGQGKYLYSSAGGLNAIQCYVYVA
FT                   EGRIDGLAGGIYYYQPRLNRLLPVSVPAGLDPHVVRPGQRAQFAEAGVALFLVAESDAI
FT                   APLYNNAAPSLLVLEAGYIEQLLLSRQGDFDIALSPAYGVDFAAIAERFRLRPSHRFLH
FT                   CLIEGTAPAALAADGQGLNAHWHQPGPLFADFLNEKNNGFALPGRETLAQLHQEARQLR
FT                   RDLPEHGEGVIELPAVPISADALRLRAAKRQYRDGPLSLGQLSRLLSLLRADAGDARLY
FT                   HADFGIVLKIYLHLAEHSVLRGCEGHDLPAGIYRYRCDSHTLSRISDGDAAAIDNCYTP
FT                   FNRKHAQQARLRMFVVAGRSAAYGEESRYFNLLQAGRIGQLLLEKQGEFGLGLCPIGSM
FT                   YFDKIRDAFDLEAGDELVHSFVGGAVAQSLPVGWPRLEIREQTRAVTAPFNRDSDSDSD
FT                   AMAIIGISGRYPGAANPDALWHNLSAGRSTIGTLSREALLHGDDATGDSPQWAVGALAG
FT                   KQLFDPLLFKITPAEAKTLDPQERLFLQAVWHCLENSGYTAAGLRRQVERIGVFVGAMW
FT                   GDYQHHPPTGQGERTTSFLSAIANRVSFFNDFNGPSVAFDTSCSSAMTALHFACGSIRQ
FT                   GECRAAIVGGVNVISHPSHLELLTSLALLSGDSQSHPFGRDANGWVAGEGVGALLIRPL
FT                   EDALRDGDPILGVIRATAIGHSGKTSRYGAPNADSQAMSMRRVLQQAALPAEAIGYIEA
FT                   AAPGASLADGAEFAAISKVFGAHRRDAPLMVGSIKANIGHLESASALSQITKVLMQLKH
FT                   RQIAPTLGCAPLSPMIRLEGGHLAIADRLSDWRGPQRALINAFGASGSGGHLILEAPPP
FT                   RAAERQSEGAWLFPFAAASREQLDQLVAAFADDLQAGRFGDATLGDISYTLCVGRAELH
FT                   HRLAVVADSQDALVGLLKGQQPDALLRGSLARAPQPGRIEGDLRGLDRQGLAAIAGQWV
FT                   AGESSLAEVARHRHRRVALTAYPFAAVDCHIAAPAASDAVEAPQPARDEALQRALEGYL
FT                   KRQFSKVSAIPERGIDCEDTFDRYGLTSLMITTLNQRLAQAFGELSTTLFFEYQSIAAL
FT                   AGYFAAAHPQRSRQLLGMQASAAQPAPAVRTPHRPTAARRHERDEPIAIIGLAGRFPGA
FT                   EDLDRFWDNLKNGVDSITEIPAERWAHSKYYSSDRGLKGKINTKWGGFIDGVDRFDPLF
FT                   FNISPRDAERMDPQERLFLETAWQTLEDAGYDRAGLQRHYQGEMGVFVGVMHGEYLLYT
FT                   RSAAPDCTDDAVDSSFGSIANRVSYVFDCNGPSMAVDTICSSSLTALHLAVESLKRGEC
FT                   QVALAGGVNLSLHPNKYFIQSQLTMSSSDGRCRSFGEGGDGFVPGEGVGAVLLKPLSRA
FT                   EADGDQIYGVIRATSVNHNGKTHGYTVPSPNAQGAMIAASLDKAGLDPRELSYIEAHGT
FT                   GTALGDPIEISGLQLGFARRSATLGSEATPVRQCAVGSVKSNIGHLESAAGIAGVAKVL
FT                   LQFKHGQLAPSLHSRQLNPGIAFADSPFYVPQQLEAWRRPVLSLEGRERTYPRVASVSS
FT                   FGSGGSNGHVIIAEYIAPDRDVEAAGQTVMIPLSARTPDQLQQQVERLQQFLYRAGADG
FT                   TLPRLADLAFTLQQGREAMDYRLAFCASSIGEVQDRLAQSIALLARQSEPFGASDGIHV
FT                   GRVKDNKAAMAVLAHDEDMASTLTAWADKGKYDKLLELWVKGLALDWTAMGQSSGAARR
FT                   TRLPGYPFARERIWVCGASHFPQLDRQGGEGWVHPLLHTNVSDLSQQKFVSVFSGDEFF
FT                   LRDHRVHGHKVLPGVAYLEMAREAVIRSLGERTPAGVLSLHNLVWSQPVRLDAQSDDPV
FT                   EVEIRIDSPDEHRLAFEIRARGQQAMCCQGEARWGRETGEPAESLDSLQAAIGGHLLDA
FT                   DALYRLFDGMGIDYGLGHRSVQALRVDGGQVLARIALPHALRSGHERFVLHPSLMDGAL
FT                   QATVGLLVADQLDQGAAPELKQTWVPFSLTRLQLGSAELGEQIWAWVRPCADHAEAGQS
FT                   TFDIDLYNQRGEHCAALRALALRVMKTPSPLETMLDDRSERDCYLVEKWRRIRPQDLTP
FT                   PTGRLLLVGNDPQGHQQLAARYPQAASLLLDGNESIEQLTELLREAGTVEHLVWLAPVA
FT                   PARDDDLDGTIRAQQRGVLGCFRLIKALLVLAFDQRPLAWTVMTRSALTVFGEADSHHQ
FT                   AVTEPVAPAHASVHGLIGVMAKEYSHWRVRLVDLPAGDGWPSLDPLGLPAEPCGNALAC
FT                   RNDVWYSQYLAPCLPLPRSGADAAGEAGEVECLYRDGGVYLVVGGAGGIGRLWTEYLIR
FT                   TRRAQVIWLGRRAQDGRIDAAIAELARLGPAPRYISADAGNHAALRQAVAQICAEHGRI
FT                   HGVVHAAIELQDQSLARMDQQRFSAGLAAKVDVCVRLAEVFAHQPLDFMLFFSSLQRFT
FT                   KSAGQSNYAAGCTFKNAFGHYLAQRRAYPVKVINWGYWGHVGSVASEDYRRRMAAVGLG
FT                   SIEGEQAMAALEVLLARPLAQLTFLRTSRRLSDAFSGLALPAHPAGPFGEYGEMRPQAY
FT                   PSLIARVKKQLVVDSSGVRAATQQVAVHKAAIDALQGRLLYAQLQQLGWFGREREVIAE
FT                   MKQRSGLLPLYDRWIDQSLDELAQRGYLHMEGGSRPTAYRVADPQPLAVAPLWAEWEAQ
FT                   QPDWLEQASLKAEVILAEATLRVLPEILDGRIAATDILFPDASMAMVEGIYKHNPVSDF
FT                   FNEVMLDAMVEFVRGRLEQAPQTPIRILEIGAGTGGTSALAFEKLRPYQRQIGEYCYTD
FT                   VSQAFLMHARQAYGPGTPYLIDRLFDVERPLAEQGITLGGYDLVIATNVLHATRDLRRT
FT                   MKNAKAALKHNGLVMINEICRNGLFTHLTFGLLKGWWLFDDPDLRLPGGPALAPKQWKE
FT                   VLESEGYRHVHYPSLADHDLGQQIVIAESNGVIWQDRRSEAEPAKVVPPQALAAQASRA
FT                   PQQSVSAAAPTGAVTRQGLKDQTVRYLKQVVGGLFKIRPEQIDAREPLETYGIDSILVV
FT                   QLTNLLRDKLQGISSTLFFEYQTLDALADHFVASRKAQLTALLGLDRAPTAGQPAPADT
FT                   ADIPVKPAVRRWVDGTADSAAQGPRGTDVAVIGLAGRYAKADNVRELWQCLKNGEDCID
FT                   EVPADRWDWQQYFDPTPGKKGRIYTRWGGFLREIDTFDPLFFHISPREAEKMDPQERLF
FT                   LEEAYHCISDAGYTPGRLAERYRVGVFVGVMNGTYARQSSYWSVANRVSYQFNFQGPSM
FT                   AVDTACSSSLTAIHLALESLHSRVSDCVLVGGVNLVVDPVHYVGLSEMKMLSPGRQCKA
FT                   FGIDADGFVDGEGVGALLLKPLAQAEADGDRIYGVIKGSMINAGGKTNGYTVPNPLAQS
FT                   RLVADALTRAGVDARAVSYVEAHGTGTSLGDPIEIAGLARAFSTGTGMPARQSCAIGSI
FT                   KSNIGHCESAAGIAGVTKVLLQLKHRQLVPSLHAGEPNPEIDFAGGPFVVQQSLAEWRR
FT                   PTVEIDGRGQECKRIAAVSSFGAGGANANVVIEEYEDNRPRPVIAVSAQRPAIIPLSAK
FT                   TEAQLLQQASLLLGALEQDALGDGDLPALAYSLQVGREALEYRLGLLATSMAQLKTQLR
FT                   GWIDNPSQGIHARGRLKDRDKALSLFAEEDMQGAIAGWIDRGQHGTLLEAWLNGLTVDW
FT                   RLMYREGTPAPISLPAYPFARERYWRIEDAPAMLAAEGALLHPLLHRNVSDLRGLRYFS
FT                   RFSGQERFLSGHRVNGRGVLPGAAMIGMIHAALTDASGGALPAGKALVIRDLAWRQPFS
FT                   VDAANHGELFLELAAQPDGECQVGICSYDRAGQLQLHCQAQVGTAEAQPEPLDFVTAGA
FT                   RQVDVEACYQRFSAMGIEYGTGHRGIRSLLRREDRALARIALDDAAAGEGYAIHPGLLD
FT                   AAMQGVMALLPDALGERPPLLLPTGLAELVLFGDCPAALQVQIRSAGHTADGYRFDLAL
FT                   FDESSRCCAIVRQLTFKALTASRDAASEGLLCERQWRDAEPAAATKVPAMSHLVLILGR
FT                   HPAFAGLPARLQAQGTPSLTLSAEDYQQAALALVEQLKPRLAAGRPCLVQLVIPAADPQ
FT                   GYRGLGGLLSSAGREQPALIGQLIEVSSEVDAPQLARQLSAEAAAPAQGQLRYLSEAGN
FT                   LRRQALTWRHRPLGSGPAPWRPDGVYLITGGLGGVGMIFARAILDAAPGANVVLCGRTA
FT                   ADAPAVAGKLAQLGERCHYHAVDLGDAAQVERLIDGMLTRHGGLHGIIHCAGITRDTLL
FT                   LHKTQADLEAVFAAKVAGVRHLDRFSAAVALDCFVLCSSTASVLGNAGQGDYAAANGYL
FT                   DVFAGLRNQQVAAGARHGRTLAINWPLWREGGMQMRDAARRVLAESTGIEAMASATGVH
FT                   ALYQALQTDADQLMVLAGDTDRLAALLSGQPAPAAAAPVDRGALLVALRRLLASTVKIA
FT                   ESRLDNDEPFEKYGIDSLMIMDMTAALEKRFGPLSKTLFFAYPSLQSLADHLAEQLPQR
FT                   PIANPANPATPVARDALMAELRAMLASTLEIPPDRIDDARCFEQYDIDSLTIMAMTRRL
FT                   EKRFGALPSTLLFEYASLQRLADYLAGRQLEPQAAPAREPALAMTPVSTASVSQPRRLF
FT                   ERAADAAGERVQHSREKGDIAIVGIAGRYPEAEDLEAFWRNLSEGKHSIREIPAERWDW
FT                   REYYSEQRSKRGVHNSKWGGFIDGVDQFDPLFFNISPLEAELIDPQERLFLQTAWTAME
FT                   DAGYSRRIGGGQVDDGMQVGVYAGVMYGEYQLFGAEASLRGQRMGFAGCTASIANRVSF
FT                   CLNLQGPSMTVDSMCSSSLTAIHLACQDLRNGRTSMAIAGGVNLTIHPNKYLMLSSGQF
FT                   ISNQGHCASFGEGGDGYVPGEGVGVVILKRLADAERDGDQIYGVIKGSYLNHGGKSTGY
FT                   SVPNPRAQQAAISGALQDAGVDPVTLSYIEAHGTGTRLGDPIEIAGLAGALGAREPGQT
FT                   CWIGSVKSNIGHCEAAAGVAGLTKVLLQLKHRQIAPSLHSQALNPFIDFATTPFEVNQH
FT                   LRAWPQPLRDGQAVSRVAGISSFGAGGSNGHLIVAEYSRAEPVPGDSGKPEMILLSARE
FT                   PAQLRLCAGRLLTRLARAQATDSLAAVAYTLQVGREAMEHRAALIVHDTASLLDALHRL
FT                   AGGDSSGWICGDATTASERVERFKARFQAQWREQLARLFADGEQQQLLALWSEGLPIDW
FT                   TALWAASGERRRRISLPGYPFATSRYWAPTADRRLSLPPTQLHPLLHQNQSGFDRQQFM
FT                   TAFRGNEPWLLDHRVGGRKTLPGAACLEMIRVAVARSLPDGEAGAMVIEQVNWLAPLTV
FT                   ESAPRGMQVSLTRLDGRIGVRLLGDDGNPPVLHCQAKVTTGLPCSEDRLDLPHWRGRDW
FT                   QRRLDGGEVYRLFESMGIAYGDSHRGIRQLMVAEHGGRREVLAELALDGALPGAADDWW
FT                   LDPGITDSALQAAIGMLLPLDGSAAALSSPWMPFALERLEISAPCRRRMWALLRADAGD
FT                   HPTGRIDIDLCDDQGRICVRLLGLRSRQSAPGTRLPAATVRPTEQSVPRQQPEACQLLA
FT                   PVWSVVDDAVGERRERHGATLVFGATPARRQALAELYPAAALALEAVDSEAGYRAELNA
FT                   WPDLAEVIWLTPPSDDGSTGSPELIAAQQHGVLALFRLIKALLSLGYGRRPLRLTLVTE
FT                   QAIKALPGESCRPAHAAVHGLAGSLAKEYPHWRVQLADLADEQLAPLANAPFDGVASGE
FT                   LVALRQHRWWARRLARVTADAPSAGRPAYRDGGLYVVIGGAGGIGAVWSRHVISRHRAR
FT                   VIWIGRRAPDREIEAKLDALTTLSLRHHAPAPVYLQADAADAQQLGEVRRQIIERFGEI
FT                   NGVVHSAIVLKDQSLANMDEPTFTHVLNAKVATSAALARTFGQDAAALDFVLFFSSMMA
FT                   FSTAAGQGNYAAGCAFADAFADRLRADWPCQVKVINWGYWGSVGSVSAARYRDRMAALG
FT                   LGSIEPEEGMQALEPLLGGTLDQLALLKILQGGAIDGLDSLAGLLCSEHIRLYPDNPGG
FT                   MAAMRDRLADRLAALAPPFGTDAAAPGSETTMDGRQTRHEEIETC"
FT   gene            484285..500325
FT                   /gene="rhiC"
FT                   /locus_tag="RPSI07_mp0403"
FT   CDS_pept        484285..500325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiC"
FT                   /locus_tag="RPSI07_mp0403"
FT                   /product="RhiC polyketide synthase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34751"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34751.1"
FT                   /translation="MGKRRLGERRPLPRSDGRAGTGFDRAGGRHAGAGAVAGRHAGSTG
FT                   LAEDPARRGDRWPGQLGRTALQRTHPALSGQPRRHGCDAGPAGGPARSAGAAVRHGRRR
FT                   ARQRNNHGWTADASRGNRNMLTDAMQTTAPVSGELDALACRLLAIQLRGLGLHRNEDLH
FT                   RLAARHGHATPAYFHPWLAESLRYVAGVVDGDADALWRQWHERLIHWRQDADLAARAQL
FT                   LDACLKSLPALLTGERQATSVLFPGGSMALVEGVYKNNRISDYFNQVLIEAALAYVESR
FT                   PADAEPLRILEIGAGTGGATAGLLAALAPWRRQIGEYCYTDLSHAFLQHGAQAFGPDNP
FT                   FLQTRLFDVCRPCAEQGIAADHYHLVVANNVLHATPEIRQSLRNAKAAMRKGGLLMLNE
FT                   ISEAALFTHLSFGLLEGWWRYRDGALRIPGCPGLSPAGWQAVLEQEGLGPVLFPARRAH
FT                   GLGQQIILAESDGIVRQPAAGTQRQAVPQTVAGERDADVVPAQDQPAPDNWRRQVGEYL
FT                   RGLVASTLKIPADRMNLARPLVDYGLDSILVVRLTTAFNERFDAIDSALFFEMPTLAAL
FT                   IDYFIRHREDELRTLLAQRAAEPDKTAAVVAQPVPAARPIQAADCTPDSNSPRATATAA
FT                   FAGQDGSNRIAIVGLDGRYPGAESMTAFWRNLAGGHCAIDEIPADRWDWRRYFDPEKGK
FT                   AGRIYTRWGGFLQGIDRFDAAFFHISRREAERMDPQERLFLEVAYRSIEDAGYNPATLH
FT                   RQGEVGVFVGVMNGGYNPIGNDWSIANRVSYQLDLHGPSLVVDSACSSSLTAIHLAIES
FT                   LANGSCDVAIAGGVNLIVNPHHYLGLCEMMMLSPGERCSAFGSDADGFVDGEGVGAVML
FT                   KPLDKAIADGDHIYGVIRGSAINAGGKTNGYTVPSAGAQQRVLEKALSRSAIDASRISY
FT                   IEAHGTGTALGDPIEISGLSRAFANRNGVASPGCAIGSVKSNIGHCESAAGIAGLSKVL
FT                   LQLKHRQLAPSLHAGQPNPKIEFGHTPFRVQQQLAPWTANGATRVAAISSFGAGGANAS
FT                   LIVEEYAGAVDRRPAAIGPWLIVLSARDQQGLAESASRLLEYLDSEDGLRIEMADLAFT
FT                   LQVGREAMAARLALVAESAPDLQRRLARWLAGEPVDEVCYGHVDPFDESLDAQWSDTGA
FT                   QQQIGRWLEQRQFAGLAAWWVRGGPIDWARLDPDRAHRRPMRVSLPGYPFARNSYWMPR
FT                   LSHPVSRNGQADAQAATSLQPLSEARADSDLAGCCYLPRWQPQAAVEPAAAAGPGAVVL
FT                   VAAERRGTATALLLDALADHYRDSRSVVRIDCGAGATAELAAARWRCGNDDPQGFARIL
FT                   AALGEVAQIIVIGPEPEAGSDLAPQPLADSLRHNELPLLRLFKALQQQLAADASVDCFL
FT                   LSQGRYAFAGEPRPGNPLGAGMAGLGYAMAQGEHRVRLRNLDINPAELGTPSSRQRLLA
FT                   QILAEPVSERGEPVKLSRGERFVQQLMPLALPAGGDSGSALKPQGVYLILGGSGVIGQV
FT                   ISRQLIVHHQARVVWLGRKAADSREVQQSLSSGHFRGRVDYIQADATDLSQLQRAVAQV
FT                   NQRYGRIHGAVFSGMVFDFENSIQQTTEAQFLQILEIKSRGGIHFYQALAGQPLDFLCY
FT                   FSSGQGFAFSGAAKLSAYACGITFADAFAEAVCPSAAFPVGVINWGFWRASLQAQAVSR
FT                   HMDALDDDEGFACFSRFVANLAGGSLQRLLCIKASPAVRQLMAVPQGRQYRLEPIAAPV
FT                   RAPQSVRLAPDELARLQQIFDPRILDQSIAVLLLIQLQTLGVFTAPGQQSAEAWRQQAG
FT                   VSDRHRRWWAECLAILVEHGYLQQRGEAFGLAVHIAEDRHDAIWAAWREQCGRYLEDRE
FT                   RRVQVVLIDDCLRQLPQILTGRIQATDLLFPDGSMDKVEGIYQHNTLSDVFNDQLALLV
FT                   TGHVRSLVEADPARPVRILEIGAGTGGSTARLLAALEPLAGQLGEYCYTDLSRAFLQHG
FT                   ESRFAAGRPYFTTRILDISQPVDDRNPAAVGYDIVVATNVLHATADMRRTLAHVKAMLR
FT                   GGGLLALNELTRKTTAATVTFGLLDGWWLYEDDALRIPGSPLLDEDSWLALLRSEGFRQ
FT                   AGLCIEQGVTLGQQIITAHRDGWILEGIGQQSPAAPALEPEGMNSMTDAHHAGGAGHAE
FT                   DTAARLQQWIIDALAKTLKADRDSISLRTPFSDYGVDSILGVGFVKQLGNRLGIKLNSA
FT                   ILFEHATVTKLRDYLRNTYGEQIHRMLAEPIAADPVAAVADGTPEMSPQAACVAAAAMS
FT                   PVVAAALGDAGRTSAIGGPPTVKPVANAAASGRIAVIGMSGQFPGADHADALWDHLLAG
FT                   RNSVEVLPERYLDPRAYSADRQPGKSYCNRAGILEDRDCFDPLFFNITPHEAESMTPHQ
FT                   RLVMQESWKALEDAGYNPIALAGRAVSIYVGAEPGGYHHDSFTGSSEAIVASRLSYFLD
FT                   LRGPAMVVNTGCSSSGVAIHQACESLRHAESTMALAGGVYALLDQRGLVSLSAIDMLSS
FT                   SGQCHAFDAAADGTVISEGVGMVVLKRLEDAEADGDPIYGVIEASGVNQDGASNGITAP
FT                   NGEAQAQLICDTYRKFAINPSQISYVEAHGTGTRLGDPVEANALIRAFRRFTDAQGYCA
FT                   LGSAKANLGHAAAGAGVIGLIKILLSMRHRRLPAMPGFERLNPLIELEGSPFHINRQAI
FT                   DWQPSGGGRLLAALNSFGHSGTNAHLVIGEYQAEQAGGRCPAPPSVSRIVPLSAKTADS
FT                   LRDNARALACWLDKRVSPTEGLLADIALTLQTAREAMRVRAVLVAADLPELQAQLARLA
FT                   DGDTPALPADETGRLAAEWAGGAPIDWAARWPAGSARRIHLPSYQFAKERYWIDQTAQR
FT                   AVVVGHDAVEQPDATDTADASTDDTPPQPATGLFLARPVWQVPSGGTAGDEPGQRLLLL
FT                   VGFSSEQAAQLQALSISTGGGVRCETLAAASGKLAAAARYQALALALLQRLQQLSGRVQ
FT                   IELLIAEPTPDSLLDAGLDGLLKTACLEQPTLSARCLLVKVDAGKRLPASQLSQLAAVL
FT                   AETLHGGRSVLQRSAPEGGCLALQWQALDEDAAGGQGAGSFGAKTVWKDQGVYLITGGV
FT                   GGLGLIFAKAIAEQCRGARLILIGRSALDHGQEARLQAVREAGAEVSYHRVDLTDADAL
FT                   EQLIDEVCARHGGLNGVLHSAGINRDRLLVRKTPQDMVDVFAAKVVGTELLDRACRRLY
FT                   LDFFVLFSSCSAVLGSVGQADYAAANAFMDHFAGLRNRRVELGQRFGRTLSINYPLWRD
FT                   GGMQVSAADREAIRRKTGMAPMQSAHGVKALQLGLSAGLERLLVIEGDLPRIRAHFAAV
FT                   PSAEAPAAAGSGTGDSVARADVTVDRERLAAATLERLKAVFCDVTKLPAGRVESDAPLE
FT                   QYGIDSIMITRLNRALEDVFSRMTALDPVERQLSKTLFFEYHSLNALTGYLVERHHRAC
FT                   LSWTGLAEARDSGRAQAPAPGQGAAVVAEVTTIAAEPVATSAVEPIAVIGISGRYPQAA
FT                   NLDEYWRNLQAGRDSITEIPADRWPLDGFYVDSVQEAVKQGRSYSKWGGFIDGFADFDP
FT                   LFFNISPREAVNLDPQERLFLQSCWQALEDAGITRSDLAGQYQGNVGVFAGITKTGYGL
FT                   YGPVLREQGHLVFPRTSFGSTANRVSYVLGLNGPSEPVDTMCSSSLTALHRACESLRRG
FT                   ECRMAFAGGVNLYLHPSNYVELCAGQMLSKDGRCRSFGEGGNGFVPGEGVGVLLLKPLS
FT                   QALADRDNIHAVIRATAVNHGGKTNGYTVPNPQAQAGVIRLAIEQAGLHAGQISYIEAH
FT                   GTGTELGDPIEVSGLGQAFAMDGVEPGRCALGSVKANIGHLEGAAGIAGVSKVILQLKH
FT                   RQIAPSLNAARLNPNLSLDATPFYLQQALGDWRPADGGPRIAGVSSFGAGGANAHVLLQ
FT                   EHAEYREPPDSSRAEAILLSARDGERLREYAEALLAYVDARPQMSGADLANLAYTLQTG
FT                   RETMAARLGLVAESPAALAIRLRAFIDSDGQAGEGIHVGVVKRSGSAGPADADRVPAIR
FT                   DRVDEGTLDQLLERWVDGESVNWSLPHAGRPGPRPYRISLPVYPFARETFWLPDREPPS
FT                   KGRIDGDNRQAVAAAKVPAQAAGATEAASAACDRLSYLARWQADGQGGEPQIGEHRCVL
FT                   IVAGTSVGAAAAAEAIAGQYLAGAGFAGGGGRVIRLEPGQRTGSQATDHWSLDVADPQA
FT                   LDRCLGGYPAIDCLYFIGAEGEPTDWQALLDSPQYNEILLLRLIQWLKQHSRSQTIDSY
FT                   IISQNNFDLADEPVSAFGGGLTGMAYAIAQGEHRFRVRNIDVDSRELADSRRLPQWVRQ
FT                   LQGERGLARGEVLCLRGGERYRRRIFRLAWQPRQPAPAEGAFVTPALKRGGVYVILGGG
FT                   GTVGGIISRYLLADYQARVIWLGRSRADDPKVRRRLDRCLRSVGGAVDPARLDYHQADA
FT                   NDPASLQRAVAQIKQRHGAIHGAIFSGVVFGHEVPITRTAEPQFREILEVKSRGSIAFY
FT                   RAFAGEPLDFLCYFSSAQSFAFSGAAKLAAYAAGITFADSLVRSLRRHAAFPVGAINWG
FT                   FWLSSLTEQQAADPSAQPMSRHAGALADREGFECFARFVEALRKGQLDHAICMAASAPV
FT                   QQLMQLQPEPIVLADGGDHGPADGFARYRAAAAPLLEAHDPMPFDEAMAGMTFVQLCRM
FT                   GLFGQPGRFEDSEVLRREAGIGDHYGRWWSTCIDLLQQHGLVRRRGVQVCAAAEASPQR
FT                   LQQLAERWHRLSGELMVTPQRQAQVALVGTCLQQLPAILSGQVQATDVMFPKSSMEKVE
FT                   GVYRNNALSDYFNQVVAGVVQQHIEALLAKAPRHRIRILEIGAGTGGTTSIVLPALQPW
FT                   REHIAEYCYTDVSKAFLMYARKTYGVANPFLTYQLWNVEHPPESQGLARGGYDVVIAAN
FT                   VLHATGNMRRTVRHAKAVLRRGGILVMNEISDRSLFSHLTFGLLKGWWLYEDLELRIPG
FT                   TPALYPESWAGLLREAGFRNVVFPAECAHCLGQQIIVAESDGLSHLAPVERPGQTNGIP
FT                   GPRGQAGDAVGVAGSDHSRDALTAVARSGLADALQLAPERIAVDQPFADYGIDSILGVS
FT                   FVGHLGEALGTELNTALLFDYPTLESLVDYLLAQYPAQSARLAGGQGDRPARVEGAGQA
FT                   ERLDPAVNARAGGAHQKAVAALVVAGLARALQLDPEQIDREQPFSDYGLDSILGASLVD
FT                   DLGGTLGVELSAAILFDFPTVTALSAYLVENCSAEITGALNRLDNAGLVGNNARGQSMK
FT                   IELRHPFSDRLEDLFLSGELSIDSLLNMVGNGVMENGAAGSPLPNSLYLQ"
FT   gene            500413..501279
FT                   /gene="rhiI"
FT                   /locus_tag="RPSI07_mp0404"
FT   CDS_pept        500413..501279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiI"
FT                   /locus_tag="RPSI07_mp0404"
FT                   /product="RhiI O-methyl transferase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34752"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34752.1"
FT                   /translation="MTTQVEDNVSPISQWYDMMTRMFPEERLTFLNYGYLAEDSRFDWI
FT                   HEADLEQKCSANLIRTLLGDADLRGKKVLEIGSGRGGNCSYLARYAGAASVTGLDFCPA
FT                   HIEFCDRVHRLEGVSFVGGDAMDLPFDDETFDVVVNIESSHAYPDLNRFGEEVRRVLKK
FT                   GGLFLYADTMKGDNNSPMSEQDRIGVEFFTNVLEQHQAMIRHAGFGVEDHVDISEGVVR
FT                   AFKSKQGHLKHVLKALVTEKKQRNSTLPPEVYHAFDTMLHFFDDSGIKAYQNGRLVYKL
FT                   WRLKKSA"
FT   gene            501403..513870
FT                   /gene="rhiD"
FT                   /locus_tag="RPSI07_mp0405"
FT   CDS_pept        501403..513870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiD"
FT                   /locus_tag="RPSI07_mp0405"
FT                   /product="RhiD polyketide synthase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34753"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34753.1"
FT                   /translation="MQPGAEVAEVESGRGLDNCRETTVMSSQEFQSILAGLQNRQITEA
FT                   EARQRLQRLKAATAEAATGTAQAGAGSQVLSGAGRARESVEIAVIGMAGQFPAADSVDR
FT                   FWHNLSTGADGVVELGERYLDARRSYSPERQPGKTYCKWGGVLAQRDDFDPLFFNISPR
FT                   DAESMNPHQRLILQESWKALEDAGYNPKRFRDRSVGIFVGAEPTGYFHETFIGASDAII
FT                   ASRLSYFLDFKGPALVVNTGCSSSAAAIHLACESLRNREADLALAGGVFATLGEPSLIS
FT                   LSQMDMLSPTGRCHTFDRCSDGIVLSEAVGMVTLKRLPEALADGDPIHGVIRASGMNQD
FT                   GASNGITAPSGQAQERLISDLYRRFDIDPRQISYVEAHGTGTPLGDPVEVNALVRAFRQ
FT                   FTRETGYCALGSAKAHIGHTSAAAGVVSLIKILLSMKHRRLPGLLNFEQLNPRIELADS
FT                   AFHIHRELTDWPAGGSGPRMAALNSFGHSGTNVHMVIREAVEVAATAPPEASRPRLLPL
FT                   SARTDNSLRQYARLVRDALADPALRLTDLAYTLQTGRLVQDHRLMFLCDDKDQLAQQLD
FT                   DWLDGRSPGLVWHGRIGAGEQPAVELPSTADHAALQRLAEAWVAGGQVDWAAFNRCHGA
FT                   NARRVHAPVYPFARQNFWIPPARRGTAAGDAGAAPGLTAGRLHPFLARNTSDLLSQRFT
FT                   TVFDGEEFFLKQHVVGGRRIFPGVGHLEMARAAVAMAASGLAAGRQPVLRNVVWLRPLI
FT                   IEGQPRQIDVALTLEEDDQIRFEISSRDYDPHAGRATGEAVLHSQGQAGFAEQPAQHSV
FT                   DLAALKTRMDGGRLSAEQCYQAYREMTFEHGPAYQGLQSVALGRREVLAELALPSCRHD
FT                   SLDDYLLHPSLMDSALQAAIALSIGADVVLPEGSREHLPPATRPTLPFALEGLQVWDRC
FT                   SERMWARVSYGERRDDQQADNGLQRLNIELFDPQGKLCIRMEGFTSRVLGDHVDPAATD
FT                   NPLMETLLFQPEWADEAASHRETAGSSQRWVLLSGFDGQTVADVRRQLAEQGAGCHCDV
FT                   LPTPQPDPADDYEQAALALLQRIRSLLGQGSGGRHLIQLAVYNPDGERMTGGLAAMLRS
FT                   LRLEAPHVAGQLIELDEQRSLAQRLEDNAATGDVEIRYQAGHRQVQRWRPCPAVDLAIG
FT                   APWKDCGVYLITGGLGGLGRVFARAIAESVSGATLILTGRSPAAPQLPAGIDAGRARIE
FT                   YRQLDVSDRDAVQRLIGSILAEHGGLDGVLHSAGVIRDGLLIHKQDEALKQVMAAKVAG
FT                   ARNLDLATAELPLDFLIFFSSGAGVVGNTGQADYAAANAFVDRYAAYRSWLAAQGRRSG
FT                   HSLAINWPLWQAGGMQVAEATARRMADSTGMAAMPTNAGMHALRQCIALARPQLLVMNG
FT                   RREQITALVTGRGDVDIQADLAATGDDAPQAPAVAPPPSHGTGAPLREVLCRTLIDLVS
FT                   RQMKIPAADIRLDAEFSQYGFDSISLTALATSLKQQWRLNLAPTIFFEHATIGRFAAYL
FT                   EREHGSVLMARLLPQQVAPQPRQVKQAPQPPRPQGAQASRPEARRRRLKATTLSAEPTP
FT                   ASAPGSAAEDEDIAVIGVAGRFPMADDVEQFFRNLQDGRDCIGEIPASRWDWREYYGDP
FT                   HRQADKTNVKWGGFINGVDHFDPLFFAISPREAQLMDPQQRLLMTYVWLAIEDAGYATA
FT                   DLAGSDTGIFVGTGVTGYSSLIAKAGVPVEGYSATAMVPSVGPNRMSFLLDLHGPSEPV
FT                   ETACSSSLVAIHRAVQAMRNGDCRMAVVGGVNTLIAPEAQISFNKAGMLALDGRSKTFS
FT                   AQANGYARGEGVGMIVLKKRSQAEADGDHIYALIRSTVENHGGKASSLTAPNPRAQAEL
FT                   LKSAYRQAGVDPRTIGYIEAHGTGTELGDPIEINGLKMAFLELGEALGIAELGQGYCGV
FT                   GSVKSNIGHLELAAGIAGVIKVLLQLKHKVLFKSLHCEALNPYIELDNSPFYVVQQSRP
FT                   WPAARDSAGNVLPRRAGVSSFGFGGANAHIVLEEYLPPPCRRDEAVPGARPILLSARTP
FT                   ERLREYARRLAAFIAAESPEARLDPTQYLDDLAYTLQVGRDAMEERLALLTDSLADLQR
FT                   QLADFAGGGEAVYRGRVQGDNQALALFRQDEDMAAALAAWIDKRKYHQLLELWCRGLAI
FT                   NWRQCYRDGRRMQRLSLPGYPFVEERYWVTDLAAGRAAGPAPGGAWLHPMLERNTSDFY
FT                   RQRFSSRWQGDERWFADHQVNGRPTMPGVGYLEMARAAINRSLDAQQPAAGPLQFRNVV
FT                   WLAPYAPALQHDALHIELTLEPRKIDFRIYSQADGEAVEHCKGSAEVIPVAVVAPLDLD
FT                   ALGAGPWRRSLDTAELYPLFDEIGIHYGPSHRGVERLWVGEGRLLARLALEPGWFDDNW
FT                   VLHPGMLDAAVQASVGLLLQQADGLNEMRVPFALEQLCVHGPCRPVMWASICVDRDSQR
FT                   STVQRIDIDLCDEQGHIAVSVRGFSSRPLNGGGRGQTARIAADKPLPAGLSLLAPQWRI
FT                   ADGASTASQALPTLAIGATGERRDWLAGLHPQIGFLPSLAPTIDAIAAQLAACAPFQRL
FT                   IWLAPQSLAGVADPRWLDSREQGVLALFRLVKALLQLGYQQRALEVQLIFTASVAVRAG
FT                   EPLAPEQAACHGLAGALAKECEHWRVELIDLPADAQPLPVAMPAQTLPGECLAWRDGEW
FT                   FAQRLLPLAERATAHGGVAAYREGGVYVVIGGAGGIGEVWTRHMIRHCRARVIWLGRRA
FT                   ADDEINGKLAALARIGRESNAPAPLYIQADATDAEQLTRARRQVIERFGPIHGLVHSAL
FT                   VLDDGRLAQMDEAQFSACLDAKTATSVRMAQVFAPADNPALDFVLFFSSMNAFSRAAGQ
FT                   GNYAAGCTFADAFAAQLDQHWPCAVKVINWGYWGSVGVVADPGHRARMAEQGLGSIEPD
FT                   EGMAALDRLLAGPWPQLGLVKLLEPMAIAGIDSGWQLDCYPADTPTTSAAPAEAAQRLG
FT                   PPPQHHSAAGEMDRLLLALVFACLGELAGGGPLTEQRIAADPAVSANLDAHPFYRRWLR
FT                   ESLRLLVRQGHIDGEGRLLTDVPAAVTLWSQWGQASDAWRRDGDLRAQLQLVETCCRAL
FT                   PAILRGEQQATGVIFPGGSMVLVEDIYKNNRISDYFNAVLGEVVADVARRHAEVDRPLR
FT                   ILEIGAGTGGTTAGLIDRLQPWRERIAEYCYTDVSQAFLRHAEARFAPEAPYLRTAIFD
FT                   VSRACSGQGIRTNHYDLVIATNVLHATPDLRRTLRNAKTALRRGGLLLLNEISERSMFT
FT                   HLTFGLLEGWWLYDDAALRIEGCPGLYPERWRQLLQSQGFDGMAFPAADSHHLGQQIIV
FT                   AASDGVVCLPAEQGGVAAAEVAGTVPIEIAVPVARPLVAEVDVDEDALSGQCRLLITDV
FT                   LSKLVNIAPERLQRDVAFDRYGIDSILQISLIQALEKATGELSRTILFEYNTINQLTDY
FT                   LLTEHRTALARHFAVAREGGRRVAAQPAAPSPQPKPRHAASRALPVRDHGNHGDHAGPV
FT                   PTAMPASLVEPPAGSRDIAIIGVGGRYPMAADLDRFWDNLRNGRNCVSEAPGSRWAASL
FT                   TGTQPWATGRYYGGFLEQVERFDHQLFGISGAEADNLSPELRQMLEVTWRTFEDAGYNR
FT                   DAIARIQQRDAAGVGVFVGSMYHQSPWAERSLERAAIKSNVTDWQIPNRISHYFDLKGP
FT                   SLAVNSACSSSTTAIHLACQSLLQNDCAMAIAGGVNLILDPSKYQTLKLANYLGSSDLS
FT                   RGFGQGDGMIPGEGAGAVLLKPLAAALADGDRILGVVKGSSVNHGGGKLMYSAPDTHQQ
FT                   ARLIAEAIRRAGLEPAQIDYVEAAANGSELGDPIEVAALKKVFGDKRPASCALSTVKSN
FT                   IGHLEAASGISQLTKVLLQLQHGQLVPSIHAEPLNPHIRLDGSAFHLQRQASSWPVPVG
FT                   PDGRQRPRRCLINSFGAGGSYASLVVEGHLERRPQSRRHGGTQLLVFAAASRGSLLAYL
FT                   ERFRACIVANPGLELEDLAYSLAQREHRLAHRAAVVADSLEQAQARLQRLLTDAPQADG
FT                   GCWISPLDGIEAGEAGIASAGTHAQVAEAYCRGAGLDTSALYPEGGNRVSLPGYAFEHP
FT                   SASPQAAATPQPLFDRALYRRIASGELDAEQFEQLITAP"
FT   gene            513892..515349
FT                   /gene="rhiH"
FT                   /locus_tag="RPSI07_mp0406"
FT   CDS_pept        513892..515349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiH"
FT                   /locus_tag="RPSI07_mp0406"
FT                   /product="RhiH cytochrome P450 monooxygenase, rhizoxin
FT                   biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34754"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34754.1"
FT                   /translation="MGDMQDTAAVAERDTVAGQQRDRATVDLLEVARDGKPASVARPVA
FT                   GNLAMKDGFPVMPGKVPLLGHVHRISQDALGELRKAEAACGPMFWTYFGARLPVLQILD
FT                   EEGLAILQNKYTDNSFLREQMPVITGAAMNAFDGPRHRNARHASSAAFSPTGLTRAQVG
FT                   QFVVESIEQRLKRWTRESKLAIFPETKDIALEVVFRILGIKTHELAQWRRQYEEFFLGM
FT                   IPLKINLPGFPAWRCRKARGWLEARVAQIVATARADDDHDSLVGAMIFGRDDNGNGMSE
FT                   VELVHNILGLGFAGSETTASVMAWSALMLAQHPDVWRQLCRQVAGMDSVPSTQEELVRQ
FT                   APLAEAIFRETMRLYPPAPFEMRKVHTEFEMMGHKIPAGVMVGVSLLHVSRNPERYPDP
FT                   DSWKPERWLGVDRALTPVETCGFGGGPHACLGRHVAALEITLFITMLARELGPKGIVPR
FT                   LAGKLPAPAYLPFLRPSNKAFLDMTGR"
FT   gene            515418..528074
FT                   /gene="rhiE"
FT                   /locus_tag="RPSI07_mp0407"
FT   CDS_pept        515418..528074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiE"
FT                   /locus_tag="RPSI07_mp0407"
FT                   /product="RhiE polyketide synthase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34755"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34755.1"
FT                   /translation="MDRQIKVLYRKIQSEAISVEDAAREFEAIRASCRRHGMERAERAI
FT                   QAPPATEHPIVAAVYRYDEPYLRDHQFNQQRILLGLTYASLALESGLGQLADGEALQLK
FT                   KLAFAVPIALAEGERLEVAIRAAQHEGPVFEAVCRSAPSAPWQPVAGGELSAVAARRRQ
FT                   VDPAGLMAGMTAVEPLASIYRISEQIHIGDSYRTLAALYQRQDGGEAMSRVALPEPATA
FT                   DARRYSLHPLLINSAFLTVIPLLAGERLDSVFIPFGIKSLILHRRQVPATGWVHARLVK
FT                   HSGELVLFDAALYGDDGELVAEFAGCSLKRLRGGRLVDDDARRDNAIPGGSEGVEDYLL
FT                   AQLHTLGASRIGKKQRQRNLMDLGLTSVQLVQLAARIERAAAIELEPTVLFEYPSIAEL
FT                   AAFLWQQHSAALTPLLAGRSASADAQPVVEPSAAVEPAAGRPGGAGLGGDRQQDIAIIG
FT                   MQGRFGEAGDLDQFWRNIWQARELIKEVPADHWDVAPWFDADPDAHDRTYAKWGSFIDD
FT                   VDKFDADFFHMSRREAQWMDPQVRLLLQSAYATAEHAGVIRQLRGSDTGVFIGSCFNEY
FT                   LDKLTELGLPMDPYIATGSGAIAANRISFWFDFKGPSLMFNTACSSSLVALHAACVALR
FT                   NGECGMALVGGSNLLLSSWHYRYFSAIRALSPTGRCHTFDARADGYVPGECVATLLLKP
FT                   LSRALADGDPIHGVIKGSAALHGGYTPSLTAPSVAGEENVIVRAWQNAGIDPRSLSYIE
FT                   AHGTGTRLGDPIEINALKRAFARYTDDRGFCHIGSVKANIGHAEGAAGIAGVLKVLLQM
FT                   KYRKLPALGHFQQQNPHIKLEDSPLVIDREGGDWPDQDAPRRAGVSSFGFSGTNAHVVL
FT                   EAYHEQRAFATHQGGMVLVPLSARNAQRLREQAARLLEQLAQQTPDLAALAYTLQTGRE
FT                   AMAARAMFLVGSLAQLQQQLQAWIAGEPGTDFGAASMTAEAALAAGDLRQLAALWLAGT
FT                   EEDEAFDWARLYGEGPRPARVSLPGYAFARERYWLEAPAATAGQSETAVAGTTVATYTE
FT                   QWLEAEEPAPGARIERLICLLGEPRLRQQLAREIGALSPQTELIFIAADRSNGRDEDGH
FT                   YRVATDDPQQLQDGLQQVLSAHGGSRVLYLWSLEDRRWITDSSAIVALLKAMAVTGAPI
FT                   DRLLLAGRAGDALERCHLESWIGIERSLGAVMPHCPVEVAIDVDVPDGPADDSRWLRRL
FT                   WQQLSGEAAGGSRLYQGGRPFRPMLTPARADAAVEPLALEQMHTLLITGGLGELGWLLA
FT                   SELSSRARQRSGGVLNLILNGRSPLSAAKQARLERLRHDKCRIFHVLADCADRQAMADA
FT                   LAEVLPQSGPIDGLIHAAGLKAQRSLFDSSQAEIDAVLNAKVKATLVLDALLAEQPLAL
FT                   ICHFSSSAAMLGDMGACSYAMANRFQQAYGRYVQAGRARRVVSIHWPLWRDGGMAVGER
FT                   ESTAFYLKSSGQRMLERAEGLILLRQIVASDADQMLVLAGEPAKLQRLVAGINHPAEKA
FT                   TAKAPAAKPVTSRPRSRPELKGLSLEQSLLWDLRDLASRPLNAERHALGEHTNLADFGF
FT                   DSISLAEYARLLSRHFGLKLTPELFFSHSTLANIAAHLLAQHRQAVEACYCGEAGHTTE
FT                   PSAKPAAVVASTPDATGAIAIIGISGRFPGARTPDALWRALAEGRGMVGEIPADRYDWR
FT                   AYYGDHREDAGKTRCIWMGSVPGVGEFDPMFFEISPREAKTMDPRQRLLLQESWNALED
FT                   AGVGPRHLEAQRVGMFVGVEEGDFQRLAGEESLTSGHNGILASRLAYFLNLTGPTMAIN
FT                   TACSSALVALHQAASSLRNGECEMAIAAGVNLIFSPDAFIGMTQAGMLSPDGKCFAFDR
FT                   RANGMVPGEAVCCVVLKPLARAEADGDRIHGVLRGSGVNYDGKTNGITAPSGASQQRLL
FT                   EAVYRRAGIDTEAVEYIVTHGTGTRLGDPVEINALNDAFRGNKPGHCALTSTKSNVGHT
FT                   FAASGLVSVIGLLQAFRHETIPASLHCEQENDYIEWRQSPFYVNKTNKAWPSAGRDSER
FT                   LGAVSAFGMSGTNAHVVLESYSRAGDASPFLRPCYLLVLSAKTAEALRERIEQLSVALE
FT                   QGGYRDDQLPSISHTLLEGRHHFRHRLALVAADLEEALYSLRQYLAGEQRPNLFAGEVD
FT                   RAFSAQKTIVRYIDQLLDDSRNAGEDELRELLSGLADCYRQGYDIDGRRLFAAAQHGVQ
FT                   AVPPRLSLPGYPFAREHHWPDIRRHRQQPAPLAGLDMGRLHPLVHRNVSTLAKQRFVSR
FT                   FSGRETFLADHRIGDQRIFPATAYLELAREAIVLASELPPQQVMLRNMVWLRPLAFAAS
FT                   GGDREVELYCDVAVNGSDSDSLSFRIYSLDGGTEQLHAQGDADLAAVASPPPQPVDLPA
FT                   LATRCNLSERSHDALYHGFEAMGVHYGATFRAAGHLRIGQDLVVGKLSGEALDPGLDGV
FT                   LLPPGVLDSALHIAAALGSGRRDTAGPALPFALESLRLYGAVAPALRAGPLTVIAARSE
FT                   TQAGSAVEKIDLRICNDAGECLVQLDGFSSRRSGGELQSVRAEATATREEALGSLIRAP
FT                   FWKPLDGPGEPLPADARPQLLLLGLPAAVVDGVRRQSGHPVDILPGVPGEHGAAAYRAA
FT                   ALSLFERLQRRVGGDAGGYLQLFIGLGQDDLRPTALDAMLKTAMIENSGLKARLVAVDP
FT                   AMGDEAMIRVIGEQSRHHSHELVRIFASGSLYGRQWRALDPDTAPRDEATPFRDGGTYA
FT                   ITGGAGGLGLIFAEQIAGSCRSPVLYLAGRSAITQALQQKIDRLQGLGAKVLYQALDVS
FT                   DAAAVRAWIDRIHAAQGALHGVIHSAGVIRDSMILNKSAGEFGQVLAAKVAGIEALDEA
FT                   IGERPLDFLVCCSSQAAMGNLGQVDYAAANAYMDAFMQYRQNLAADGRRKGRSLSINWP
FT                   LWRDGGMKLAPVIEQQMRQQLGIVPMPVEVGIASLRRLLTGSVSAQGWVVYGESSRLAG
FT                   IGQPADAALQPPAKPAPRTAVTLSLSDADLKKRIEAFVTGIVATVTQIDAAKIHPAEKF
FT                   EVYGFDSIMAVGVTHALEKHLGSLPKTLLFEHVNIAGVVDHFAAKYRDHFAAMFGGDGE
FT                   AQPAAAPAVPSSSTGQATSALASAQALPLHRFAPVNRTAGGPAAPQTARSATGELVEDS
FT                   ELENYVAVIGLGGYYPGADNMDALWRNLADGIDCMSDFPADRWDHRKLYYKNRKVLGKT
FT                   TCINGAFIEDVDKFDYSYFKMPKVYADHMSPEVRLFLQVAVHTFEDAGYSKETMLSRYG
FT                   GDVGVLVGTMVNDYHYYGFENNLSRGAMASGSGMATIPMTVSYFYGLTGPSLFIDTMCS
FT                   SSSTCIHTACQMLKHDETRMVLTGGLNLMYHPYTTVNTSQGNFTSITSSSVNSYGVGAD
FT                   GTVIGEGVGAVLLKRLDRAIADRDRIYGVIKGSAITNAGERNGFNVPNPELQTLAIRQA
FT                   MEQANVHPSSISYIEGHGSGTRLGDPIEVLGLNNAFRWATGDRQFCYLGSIKSNIGHLL
FT                   AASGIAGLTKTLLQLKHRQIVPSIHSDRLNEDIDFAETPFVVPQQLTQWRQPERIIDGR
FT                   KQVFPRRAGITSIAAGGMNAHMIIEEYPEPADGAGRIPDDQLVFVFSVHKLAVLAENLT
FT                   SFRDWLAGSEAPLAQIAYTLQVGKNNLRNRLAIRCRGRQALLDALDACIAGRYQAGADS
FT                   AICYRFQENDAAQPPERDAGDPLAPLLTRWLDGDHQVDWASLYAQLPVRISLPVYRFEK
FT                   VRCWYTEAGYESSILNPLMFTGKLHPLVSRSCATLQPEAMFRTDFIEAELLDYVYKGGD
FT                   GRCLSAFNFADVALAMPTLASQFDGCTLSVSCAFEHYIADWATVTALEYRLFEIDRGQL
FT                   ELEFDFRRGDGRPVNLGFAVINPLTGDEPPLPQPLLDNASALFNRQTLQPGQRLSAAEV
FT                   SRRLAQAGHDFTPYLDNAGELVIGHSGLLLEGGSPVNRHNHHADNVRLSPYLATTIDQA
FT                   LCLLLDALGLPQGRVIVRNIERLCCYDRPAGRFSVILSGIGLRDNALSLSLLVLDEQAQ
FT                   ICVKADRVSLHLDEPALASIDRGHDWLAGAVEAADRPIAAIARPQLEPTGRPAAASTAA
FT                   QGTGPKADDRAPGRGERILAFIQQELRGKLGFAAQEIGASAQVHDLGLDSIMVVQLTDS
FT                   VNKRFGTKLMPDLFYEKQQLGELAARLETLEAGSLESEAPHLA"
FT   gene            528046..528162
FT                   /locus_tag="RPSI07_mp0408"
FT   CDS_pept        528046..528162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0408"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34756"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34756.1"
FT                   /translation="MNLKRHTLPDGKVLCGADVSARQAWLPGKPGLQGHAES"
FT   gene            528159..535982
FT                   /gene="rhiF"
FT                   /locus_tag="RPSI07_mp0409"
FT   CDS_pept        528159..535982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiF"
FT                   /locus_tag="RPSI07_mp0409"
FT                   /product="RhiF polyketide synthase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34757"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34757.1"
FT                   /translation="MKTATASNTSDISLPNQRRGGQRQAVPQRARRQIGDDAERAAGSQ
FT                   PQAGKVAIVGFSGRFPGADTPQAFWRLLVEGRSAVGAFPYWDLPGIAERRHLRDAFACP
FT                   GGFILDPAAFDADFFKISAREAEAMDPQHRLVLEQTWAAFEDAGICPRSLRGSNTGVYI
FT                   GVSSADYNGLLARSAAGAHDATGNAHSIIANRISYLFDFHGPSAPIDTACSSSLVAVHR
FT                   AAQSILSGDCTVAVAGGVNLCFEPMVFIGAAKAGMLSPGGHCRTFAADADGYVRGEGVG
FT                   VLILKDYRQALADGDNIVATVIGSAENHGGHANSLTAPNPRAQADLIKQACRGIDIDSI
FT                   GYIEAHGTGTRLGDPIEISGLKQAFAELGGSGARRCYLGSVKTNIGHLESAAGIAGVIK
FT                   VLLALKHGYLPKSLHSEPLNPYIDLAGSPFEVLGEGRAWPQQPDSRGGMLPRRAGVSSF
FT                   GFGGANAHVVLEAAEPAAGAAVQGWAATIFPLSARTPEALRARVEQLIDCIERQPGLAL
FT                   PDLAASLQLGREAMECRLAIAAESRDGLLARLRHDPVGVDGDGQGSEPADDIAASEVFR
FT                   ALQQQDRDALLALWRRGANVDWRQLYPAGRARRIPLPTYPFSRDVYWISDTPAAGRTRE
FT                   PVLHPLVQRNTSDLAGQRFSSRFDGNESFFDEHRIRGRKILPGVAYLEMARAAIALSLA
FT                   GDEAPVRLKHIAWQQPMRHDGGELAIDIELAEQGNGEIRFEVLGAAAQGPSYCRGVALV
FT                   GAAEPLPQLDLPAIAAATAVQRLESRQCYRIFGEMGLDYGDRFRGIRALQAGNGQVLAT
FT                   LALPGGPADTGDCTEPLRMPPGLLDSALQSALGLALLDPAQPDDGRQPLVPFALDGVIF
FT                   GDLSLLGDGCHAWVRYAANHQPGRITRLDVDLCDTQGRVALRLLGFSSRRLDGGRAEPL
FT                   VMMPLWRDRAPRLNGAQRCSRHRILLLDHPHIAPDALAERCRDLAADGRQIHIERLPVV
FT                   ADDPAPALQALAAFLLRYLKACRAEDLVQLILPDCEAGLQPMAPVFASLQALLRTARNE
FT                   RLIGVAQSIEVAGVQSPEQLAQWLIESSRQADERVRYQDGPGGRPRRQVASWHETALAA
FT                   AARAPWRAGGVYLLTGGAGGLGLLLAEAIAREARGAKLILAGRSAGQPPETSARRIAEI
FT                   EALGAEVRLEALDVADQAAVDALIARCERAFGGIHGVVHCAGLTRDSLLAQKTEADLAA
FT                   VLAPKVAGTLNLDRATAHLALDCFVLFSSASAVMGNPGQGDYALANAFMDAFAGWRNRQ
FT                   AAAGRRHGRTLAVNWPLWRNGGMRIDPRHEQRMAEQTGIRPLSDHGGLELLRRALADAS
FT                   APGQLMVLEGDTARIQAFVAEQWHEPVAMMFDAPEAADPPAASTAQAPAEALPPAASAS
FT                   APADGDPTNPAIRYFKQLLSQALKRPAEKIDSDGTFERYGVDSIILTELTAKLEQHFGS
FT                   LPSTLLYEYQTVRELSGYFADHHREALQRLVCGEPANRRTAADNADVGKRAAAAPSPQR
FT                   HRRNRTSQRGIPSVASQSRDLAIIGLSGRYPGAEDLETFWRRLAGGEDLVSEVPAQRWD
FT                   HQAYFDEQRGRFDKTYCKWGGFLDGVEDFDPLFFNLSPREAAIVNPNDRLFLETCWNLL
FT                   EGAGLTRQRLRQQYRQQVGVFVGVMYQQYQAFQADLVRESLVSVASYSAIANRVSYFFD
FT                   FQGPSLAIDTMCSSSISAIHAAGEALRNGDCRLAIAGGVNLTLHPKKYIGLSVGQVLGS
FT                   RAGSRSFADGDGYLPAEGVGAVLLKTLADAERDGDPILAVIKSTAVNHGGHTHGFSVPS
FT                   AKAQAELIGSHFKRAGIDPRTISYVESAANGSAMGDAIELSALSRVFSEAGVAGRSCAI
FT                   GSVKSNIGHAEAASGMSQLSKLVLQLQHRQLAPSLLLGPLNPKLDFDNSPFVLQRELGD
FT                   WAQPVVEMDGVSQPCPRRASLSAFGAGGSNAHLILEEYPRHEERPARPAADAAQVEDGV
FT                   LYIVPMSAKSAGSLHGGVARLARHLDTHPDLRLNDLAYTLQTGREAMEWRLALLAKGMG
FT                   ELRTALAAILRVLDQGEGMAALETLDLPLFFGNVDEVPAAMASLLSGPGADALSRSLIA
FT                   AGEREQLALFWTQGGEVPWDTLAENTSTGHGVGIVPLPTYAFDKQRYWLEPPNTLKALR
FT                   GDVTAASTTSTTQPLPERMPANVTDAQANSEETAAEQGLRLLAGLLGMAPKALSPAKPL
FT                   SVYGADSIVMAQLAMRLQAEVDPGFTLAEIQQCVTIRDLRECLAERGRHAGSKGQGQGQ
FT                   ALPAEISKLFTRPAARFLELQRLNTMDHGRPVFWIHGALGGCEIYQGLAQRIKRPFFGL
FT                   QARGWMTSRHPLQGIQAMAAYYVQAIQSVQSHGPYDLGGYSLGGMLAYEVTRQLQELGE
FT                   TVTTLVMLDSPDVTGERTARLADKTRLLQTVNMALQMTIGETPERFAEVLIHRDAIDLS
FT                   LSQREYLQQLTALARQRGLKMSDDRLQQLMEQVAQIQQAYHVEHHRILPLPRAGEVACH
FT                   YFRNAGGLWMGALEPYFSTDGREFAAFNHANYWQEWQRQLPNFEMIDVASSSHMTLLTE
FT                   PEVFEVIATFCASLYAEAVAEDTVG"
FT   gene            536024..543181
FT                   /gene="rhiA"
FT                   /locus_tag="RPSI07_mp0410"
FT   CDS_pept        536024..543181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiA"
FT                   /locus_tag="RPSI07_mp0410"
FT                   /product="RhiA polyketide synthase, non-ribosomal peptide
FT                   synthetase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34758"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34758.1"
FT                   /translation="MKWCGLSVMEPMSTSTFTDHLLFLAIVCSLERRQLISRCGIGQPF
FT                   EFAQFAPAESVNVGPLRVAFDGLKAFGWLSQSQADTYFFGGRASAVDNLPDRIGDLFAL
FT                   LAPERQPVEEDLPRLSRWLVLSALDWNLHCPALARSLDALLALALLRRMALSGAIDTDT
FT                   GRVDPRRIDNGRIRPELAHQLTDFLAARQWLRSDERQPALDPARHVLLSALLREPFLAY
FT                   CASLPSTLDEALFGKAEQWAAVSRWLQDAGQAQVWPGDRQALEQLLGKIFDAQPLIMQP
FT                   DWIVAFGRHPSGLLDDMRQWIHRRTVRGKALDSRPLQLLVLDDPVPGDPAALRRRLDDA
FT                   GVGAGARVLWLGADWRHLEQPGHTPVQQPQPAPQRYYLRPDGSAADGTSVLAGLQARFN
FT                   DLAALIGDQPVVLSQGHWHPGGALADRFACHDSVEAAHYLMALAGAGLFADPEMLHKWP
FT                   REGADSEATTGCYRAREYRIRHVTAADLPALLMLERACWPEGGRVDEVILRRRLSHWPA
FT                   GQLALERDGEVVGVIYSQRITEIDGLFGVDFATVDQLFHTDGGIVQIQSLNILPAHQYS
FT                   GYGDQLLEFMLQYCTLLNGVDTVVGVTRCKDYPKHRQIALVDYIHRRDERGILLDPVLR
FT                   FHELHGARIERLVAGYRPADHDNAGHGVLVHYDLASRRRQELQLSAAPAALPEVSIDDA
FT                   VRREINRCLGQPEDSRLSSRHSLMDLGLDSADLLALGEQLGLTFGLALEHTFFFRYNSI
FT                   DKIVAALKAHLDGSSPASDSNQPPAPKPAEPAPKTPPSTAIEVAGDVAIVGISGRFPGG
FT                   ELEDFWAAVRSGVSQLREAPAGRAGAGPLGGYLDDIDCFDHAFFGIPAAEAALMDPQQR
FT                   LLLQHAWLALEDAGIPAAQFAGSHTGVFIAAAPNEYRDIVEVPKDSPFRLTSSSPCMYA
FT                   NRISYCLDLRGPSEYCNTACSSVLVALHRAMQAMRAGECRQSLIGAVNLLLSPDETAGY
FT                   RLMDFLSGQGRTRSFQAGADGYVRSEGVGVLLLKPLADAERDGDRIYLKIKGSGVCHGG
FT                   RGASLTAPNHDSMRATMIAAYRSAGVDPDSVSYLEAHGVGSSFGDAIEIAAIQAARTEL
FT                   SGDDRQGVPWTLSTLKPVIGHCELASGMAALFKVIDAVAQRRLPGIPGYEQPSLAITLD
FT                   PRQLRLEAESRPWPALQDANGLALPRRASLNSYGFGGVNAHLVVEEHIAPQRAVQDPVG
FT                   PQLILLSARDAARLREQAARLSRYIGQRPDLCLADIAYTLQVGRTAMACRWACVADSIA
FT                   SLQRQLAELERAPTDAIAMLDEDAIAIDPSRAGLGDEITRALRRGDLPALARHWRQGVE
FT                   PDWRQLPSLGAPRRIGLPGYAFAKARHWLPPRQAEAEAARRDGACVAQPQGFRQILAGL
FT                   LGGAPAALDGCESHSLASLGLSSLAAVGLKARLEQQWQVSVPLAQLNPYLRLGEVEAHL
FT                   ASLAGRGGDPVAPRLQVAPEDRGQPFPLNDIQQAFLSGRKLLAEAERVGCHIYLEFDWR
FT                   DLDVYRLNQAWNRLVSRHDVLRITLLDDGCQQIGKPAPCRFRTRDLRRTDVAGRERALA
FT                   DIRASMSHNVYLPGQEPFFEIRVSLLEPRRSRVHLSIDELIVDATSLDVLLQEWLMLYR
FT                   DPAAELPDPGLSFRDYQLSLEAFKPSPRYQRDLQYWVDKLAQMPPGLSLPKVQRPAGRQ
FT                   RRRLDSTLAPGRWHRLKQQGDALQVSGTALLLTLFGLILRQANAGKAFSLISTFHGRFP
FT                   VHPATDRLVGPLISTHVFAFDNARDETLAGLAQWVQRQLLEDMDHMSVSGIAALREIRR
FT                   RGGKPLHSSGSEVVFTSMLNNPVIGGAESFGDAQHHGVTQTPQINLDHQLREHGGALRF
FT                   SWDVAVDCYPDGMIDQLFSDYCDLLDKLADGVDDWQALETAGLVKMRGAGELPSAGPAA
FT                   GHAAPFVLAPGKPPDTPFALTDQQQAYAFSRSLHREQASSHLYLAVAMADIEIARLEQA
FT                   WRQLVAHHPMLRTRVLPDGTQQLMEAAPPLSLALNEPGVSVAQIADEMLGRVSALGAWP
FT                   HAELRVSPLDGQRSLVHLVVDLLVADLPSRDLLIRQLLNLYHGRPPAPLSIGFGGYIAA
FT                   QEPHKRSPAAQHAARYWQETFRLLPQGPLVSGDKAATGRHLEYEHCLDCWPALLASAGR
FT                   AGISADALLISAYAWSIAEHGSRQPFTLVAPGWRRPAVHPEIDALVGDFTTLSWIPFND
FT                   EPMTLIERARRCERIFAEDQRHGAVGGLQALRKAATDKQHPRKLGFPVVFTRLNPQGPL
FT                   DLPEGATLVKHASRTHGVALDNLSVEQRGTLWIHWDLAADRLAPAQADAMFADYCRLLE
FT                   ALAAGDSLWAVREDRLAATLAAGEYREMKTGEEGLSFCG"
FT   gene            complement(543282..545264)
FT                   /gene="rhiG"
FT                   /locus_tag="RPSI07_mp0411"
FT   CDS_pept        complement(543282..545264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rhiG"
FT                   /locus_tag="RPSI07_mp0411"
FT                   /product="RhiG acyl transferase, rhizoxin biosynthesis"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17154220; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34759"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34759.1"
FT                   /translation="MPYIAQGQKSSVVFMLPGQGCQFYQMGRELYQNNPVFHRWMNELD
FT                   TLVRPELGHSVIAEIYHDNNARSKTFDDIRLSHPAIFMIEYALGKTLIEQRITPDYLLG
FT                   TSLGELAAAALADVLPLPEAIRFVTRQGQLFHRRRSPATEGAMLAILSEASLYQQTPLL
FT                   RDHCDIAAYNASSLIVVSGQSARIADAERHLSSRDIVFQRLPVNQAFHSHHIDFLQPEV
FT                   EALASQLSLRQARIPVISCHSTETLDRLTADHFWHTIRQPIRFSQTLARIEREAAERGE
FT                   SLIYLDLGPSGTLANLIKQNLRDRKLPQIFPVLSPFGRDLEKFDEVLALGRALQPLPAT
FT                   VTAPVQETPRQVQQPEPTPVRQVQQPVLAPRPMMQPTAGPKRVYVFPGQGSQRVGMGAA
FT                   LFEQFPDHLAKADEILGYSLQTLCLEDPDQRLSNTRYTQPALYTVSALAFLSKQRQDPR
FT                   KPDFLAGHSLGEYCALFAAGAFPFETGLKLVKKRGELMARATGGSMAAVIGRAPDEVNA
FT                   LLSRHGLDALDIANYNSQSQVVLAGPVDALGRAREILQEQGVTMIPLTVSAPFHSRYMQ
FT                   SAMEEFGEYLRQFSYSPLHTPVISNIHAAPYRDEDLIDNLTRQICGSVRWLDTVQYLIR
FT                   QGEFECEELGPGNVLSKLVNSIRNA"
FT   gene            complement(546097..546846)
FT                   /locus_tag="RPSI07_mp0412"
FT   CDS_pept        complement(546097..546846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0412"
FT                   /product="amino-acid transporter subunit ; ATP-binding
FT                   component of ABC superfamily"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /EC_number="3.6.3.28"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34760"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34760.1"
FT                   /translation="MNPPLIQIERVNKSFGAHHVLKNVSTAFHAGQVAVIVGASGSGKS
FT                   TLLRTLNRLERHDSGRITVDGIEVDDHPRHLEALRREVGMVFQQFNLFSHLSVLDNVTL
FT                   APRRTRRIGRKEANDQAMELLRRVGLEAHAHKHPFALSGGQQQRVAIARALAMQPRVML
FT                   FDEPTSALDPEMVKEVLDVMRGLAGSGMTMIVVTHEMGFAREVADRVLFFDQGEIAVDA
FT                   SPEVFFRKGHDNPRVNAFLGRALLAAA"
FT   gene            complement(546843..547631)
FT                   /locus_tag="RPSI07_mp0413"
FT   CDS_pept        complement(546843..547631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0413"
FT                   /product="putative amino acid transmembrane ABC transporter
FT                   protein"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34761"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34761.1"
FT                   /translation="MTFIFASWPVGWSRQQRSTLAMAAAAALLLALLWLIAIPLAAAPE
FT                   PIAANAQIFADGTRTTVKLTLASALAGVLLGVVAALGKLSPVWLLRQASSFYIWVIRGT
FT                   PLLVQILFVFLALPAWLPWLQMDDFTSACVALAFNAGAYNAESIRAGLLAVPKGQLEAA
FT                   HSLGLSRWHTFADVIFPQAFKVALPPLVNNFISLLKDSSLAYAIGVVELTNVGNRLQAA
FT                   TFQPLPALVTTAVIYLVLTTVLTQFSNAVEQRMDVEGRRR"
FT   gene            complement(547656..548420)
FT                   /locus_tag="RPSI07_mp0414"
FT   CDS_pept        complement(547656..548420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0414"
FT                   /product="putative substrate-binding periplasmic (Pbp) abc
FT                   transporter protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34762"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34762.1"
FT                   /translation="MKLVKLFAALVLLASAALPAQARSYEEIKQSGKLIVATGGEFPPF
FT                   NYFAGSQLTGFEIEVAQAVVKKMGLAIEWKTLSFDSLLAGLQQNRWDLVISSHGVTEER
FT                   AKAVDFASPHYCSGSSIVARDPAIRTAADLTGKVVAVQTGSTYLENVRKLAKPREIKNF
FT                   PQDRDARTALSSGRADAWVTDRFVALAAIQSNPETNLKLGSPLFVERIAAAVAKGNTAL
FT                   AASYNKALAETLADGTYAAISNKYFHEDIRCQ"
FT   gene            548592..548690
FT                   /locus_tag="RPSI07_mp0415"
FT   CDS_pept        548592..548690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0415"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34763"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34763.1"
FT                   /translation="MSLKMANRQLKLAICQKGSSLHTGGAAVDYSL"
FT   gene            complement(548678..549115)
FT                   /locus_tag="RPSI07_mp0416"
FT   CDS_pept        complement(548678..549115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0416"
FT                   /product="putative transcription regulator protein,
FT                   AsnC/Lrp protein"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34764"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34764.1"
FT                   /translation="MSISSLDDTDRELIGLLRDNARLSIVTLAKKLRVARATVQNRIAR
FT                   LERDGVIVGYTVRLRPNVDTQRIRAITCIAVEGNRATEIRRRLTGHPNVVALHTTNGRW
FT                   DLVAELRTDTLEAFDTVLNELRLIDGIANTETSILLSTYKL"
FT   gene            549255..550304
FT                   /gene="arcB"
FT                   /locus_tag="RPSI07_mp0417"
FT   CDS_pept        549255..550304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcB"
FT                   /locus_tag="RPSI07_mp0417"
FT                   /product="Ornithine cyclodeaminase (OCD)"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="4.3.1.12"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3281832, 9375792; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34765"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34765.1"
FT                   /translation="MTRFVDVSTMSRLVQEIGLTRLIGELADFIQSDFIRWPEFDKCAR
FT                   VANHSEIGVIELMPVSNAKNYAFKYVNGHPNNTRQGLYTVMAFGVLAEVETGYPVLLSE
FT                   LTLATALRTCATSLMAARALARPDSRRMALIGNGAQSEFQALAFHHHLGIEEIAVYDID
FT                   PLATEKLVRNLSAWPSLKIVRARSTAEAVRGADIVTTVTADKAYATIITPDMIEPGMHI
FT                   NGVGGDCPGKTELHADVLRGARVFVEYEPQTRIEGDIQQLPADFPVVDLWRVLAGEVEG
FT                   RQSAGQVTVFDSVGFALEDYSMLRYVLEQAERHNLGETVQLVPWADDPKDLFCHTRSNT
FT                   HRATMRRAA"
FT   gene            550301..551260
FT                   /locus_tag="RPSI07_mp0418"
FT   CDS_pept        550301..551260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0418"
FT                   /product="conserved hypothethical protein, predicted
FT                   amidinotransferase, FN0238 type"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34766"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34766.1"
FT                   /translation="MTTMPKFATRVSGVRSIQAPAAVVMVRPHRFTPNPETAADNAFQQ
FT                   AATAASARIAQAAYDEVTAAAERLEAEGVRVHLFDDTGERDTPDSVFPNNWFSTHPGGH
FT                   VALYPMYSPSRRRERRADVIEMLKAHYRVQDVIDYTGLEPDGLFLEGTGAMVFDHMARI
FT                   AYVARSNRADPVLLERFCTHFNFEPMVFGTADEAGRPVYHTNVLMTVATEFAMVGFGLF
FT                   DDPRRADAIRARLEESGREIVALENGQIAAFAGNAIELSGRDGRLLAMSARAEASLTDA
FT                   QRAVIERSARIVALPVPTIELAGGSVRCMIAGIHLAAR"
FT   gene            complement(551313..551930)
FT                   /locus_tag="RPSI07_mp0419"
FT   CDS_pept        complement(551313..551930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0419"
FT                   /product="putative phosphoglycolate phosphatase (PGP)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="3.1.3.18"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34767"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34767.1"
FT                   /translation="MHSKLIAFDFDGTLADSFACFRASLNAAAARHGFRPLDDALLTQA
FT                   RGLPAQGVLRLLGVPLWKAPRLIAEVRRQMYEHASQIRLFPGIEDTLRQLTARGVRIAV
FT                   ATSNTEDLVRTVLGPASGLVTDFCCGISVFGKTRKLRALIASAGLQPAQSLYVGDEIRD
FT                   ALAAQAAGMPFRGVSWGYTAAAALRLHCDTPLLDRPEDLLAA"
FT   gene            complement(552265..552708)
FT                   /locus_tag="RPSI07_mp0420"
FT   CDS_pept        complement(552265..552708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0420"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34768"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34768.1"
FT                   /translation="MRDAPASPTPPPQPEPDAAGAGRADDPVRLAARRIRSVDAAGTEA
FT                   SDDTVDTDGKGLEAARDPSPWQDNVIFSNATAANHIPETDPDLAGVDSRPGHGGLLIST
FT                   APGHAVTYRGTVDVATRTGTRTALRFSIGEAAAVRPQPGKPTR"
FT   gene            complement(552931..553089)
FT                   /locus_tag="RPSI07_mp0421"
FT   CDS_pept        complement(552931..553089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0421"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10538"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10538.1"
FT                   /translation="MTLAPDNDFQPGMAVSPWVRIQTACTSEPRAIGFPREAGRRTARK
FT                   RASITPG"
FT   gene            553548..555080
FT                   /locus_tag="RPSI07_mp0423"
FT   CDS_pept        553548..555080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0423"
FT                   /product="type III effector AWR4"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34769"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34769.1"
FT                   /translation="MDAPFKGRGAATRRTVGRVLLVLLAGLAVLAACLALNTWRHGSRQ
FT                   LDVSPAAPLAVDGAAAAARLGEAIRARTISSLTDAQQNADQFRQLHALLEARYPRAHAA
FT                   MQREQVGDFSLLYTWKGSDPSLKPVLLMAHQDVVPIAPGTEGDWTEPPFAGVVKDGMVW
FT                   GRGAWDDKGNLIAQMEAAELLAASGFRPRRTIHFAFGADEEIGGERGAGQIAALLKSRG
FT                   EQLAFVIDEGLLITEGVVPGLTRPAALIGVTEKGFLSVALKLSATPGHSSMPPAPGESA
FT                   IAMMSAALKHLDDQQLPAGIRGVTREMFETLAPEMNGLNRVALSNLWLFEPLVRGQLQA
FT                   SPSTNAVLQTTTALTIVQAGNKDNVLPGRAEATVNFRLLPGDSASSVIAHVEHAVRSAA
FT                   PKGHFELAMLPGVSEAAPVSPTQSASYQLINRTVRELFPGTVVAPGLMVGATDSRHMVG
FT                   ISDHVFRFSPVRAKPADLARFHGTDERISETNLVELIRFYHRLIHQAAGMDA"
FT   gene            complement(555174..556571)
FT                   /gene="czcS"
FT                   /locus_tag="RPSI07_mp0424"
FT   CDS_pept        complement(555174..556571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcS"
FT                   /locus_tag="RPSI07_mp0424"
FT                   /product="Sensor histine kinase of the two component
FT                   regulatory system, heavy metal resistance operon czcCBA
FT                   activation"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000, 9044283; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34770"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34770.1"
FT                   /translation="MMRWPASLAARLVLAFVLVAGVMLTGAGTYLYYALNAQLRATDDA
FT                   MLLGKIVQLRHCARDSQSIDDIVRDAHRYTEVVSGHDGLILRVIAPDGRTLVEANPEGE
FT                   PVAAPPAVPPDVVASESALHTWWSRTGIASRAIAAQARLGNRHDTVTVLVAQDGDSRAA
FT                   LLASYRRHIFLAVIAGVAAVALLSLWLVRSTLKGLARIGRQAASVVPSQLDTRLTLEGA
FT                   PRELSDLLAALNAMLTRLQDGFARLSQFSADLAHDFRTPLANLVGQTEVTLAHPRPAEE
FT                   YRAVLESSLEEYARLSRMIEDMLFLARADHARVALSVAPLDARHEIQVLVDYFEAVAAD
FT                   RDILIQVSGDGRVRADLTLLRRAINNLLDNALRHTPGGARIDVAVQVLPHGTVIAVRNP
FT                   GPGIPAANLPLLFDRFYRGDPARANSERSAGLGLAIVHTIMDLHGGTAQASSPPGGPTE
FT                   FRLSFPA"
FT   gene            complement(556568..557242)
FT                   /gene="czcR"
FT                   /locus_tag="RPSI07_mp0425"
FT   CDS_pept        complement(556568..557242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcR"
FT                   /locus_tag="RPSI07_mp0425"
FT                   /product="response regulator in two-component regulatory
FT                   system, regulation of heavy metal resistance operon czcCBA"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10198000, 9044283; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34771"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34771.1"
FT                   /translation="MRLLIVEDEPKAGDYLLKGLTESGFVADLARSGPDGLYQAMEHDY
FT                   DLIVLDVMLPGMDGWQVIRELRRHKTTPVLFLTARDELSDRLKGLELGADDYLVKPFAF
FT                   AELVARVHTILRRGPMRESEVLEIADLTIDTIKRRVTRAGRRIDLTAKEYALLHLLARR
FT                   TGEVLSRSLISSQVWDVNFDSNTNVVDVAIRRLRAKVDDPFEHKLIHTLRGMGYVLDTA
FT                   AR"
FT   gene            557589..557891
FT                   /locus_tag="RPSI07_mp0426"
FT   CDS_pept        557589..557891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0426"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34772"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34772.1"
FT                   /translation="MSVRRNCLLPLAAAAAFLACGAATAASVSAPALSSMQPQAHGTRD
FT                   PYTDGARDPYTDGAAHVEATLQARVGPRDPYSDGGMSRTNGPRDRDPYTDGAQSA"
FT   gene            557903..559222
FT                   /gene="czcC"
FT                   /locus_tag="RPSI07_mp0428"
FT   CDS_pept        557903..559222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcC"
FT                   /locus_tag="RPSI07_mp0428"
FT                   /product="cobalt-zinc-cadmium outer membrane resistance
FT                   protein (Cation efflux system protein czcC)"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2678100, 9044283; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34773"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34773.2"
FT                   /translation="MHPCIRAVAALSCVLLARAGLAAAPVGEAAAASDTAAPAAQSAPA
FT                   SVPGAAPERVTLQQAVDRAMATHPVLAAAGYAVSASEGAIDQARRLRNPEAAFLTEDVR
FT                   RDRATMTAQLNIPLELGGKRAARTRAAELARDAASQDAAVLAAELRADVTRAFFDLSIA
FT                   QERLRLAQASDALAAQAEAAAVRRVQAGKVSPVEQTKAAVARAGAAIELRDARAELLVA
FT                   QRALSAFWGGNVTVPEADGSAETLPTVPPEAHSVLAAATAAEPVTMASTPRALRARLEI
FT                   EHRQALVNVERSKRVPDVTLSVGAKRDSSANANMAVLGIAVPLPLFDRNQGNLLEAQRL
FT                   ADKAAEDYRALRLEQTAALSQDIARLEAARQAVQALRQDVLPGAGRAYDAARIGFEAGK
FT                   FNFLDVLDAQRTLFQARAQYLAALSRAHQAAAGIDRILGR"
FT   gene            559248..560450
FT                   /gene="czcB"
FT                   /locus_tag="RPSI07_mp0429"
FT   CDS_pept        559248..560450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcB"
FT                   /locus_tag="RPSI07_mp0429"
FT                   /product="Cation efflux system protein, heavy metal
FT                   resistance"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2678100, 9044283; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34774"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34774.1"
FT                   /translation="MTLPRQQRRAIVLIVAVGALAGAALWWGMGARQAAHAESEAAPPA
FT                   EQAEHTGHAEEASHAETIAMTAEAVANAAIGVETAGAAELRTEVVLPGEIRLNEDRTAH
FT                   VVPRVAGVAEQVAVELGQPVTRGQLLAVLSSPALSDQRSELQAAQQRLALAQQTHAREK
FT                   RLWEQGIAAEQDYQQARTALQEARIAADNARQKLTAIGAAPAGPALNRFELRAPFDGVV
FT                   VARHLSQGEAVQAETAVFTIVDLRTVWADFSVTAKDLEAVTTQATATVRATATGTAVQG
FT                   KVSYVGALLGEQTRSAPARVTLDNPKRAWRPGMFVNVAVEAGRVPVPVAVRADAVQTVD
FT                   EKPSVFVPVPAGFEVRPVKTGRSDGTWTEILDGLSAGTRYAAANSYVLKAEAGKSADHG
FT                   H"
FT   gene            560461..563646
FT                   /gene="czcA"
FT                   /locus_tag="RPSI07_mp0430"
FT   CDS_pept        560461..563646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcA"
FT                   /locus_tag="RPSI07_mp0430"
FT                   /product="Cation efflux system protein, heavy metal
FT                   resistance"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2678100, 9044283; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34775"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34775.1"
FT                   /translation="MFERLLRAVIAQRWLVLLAVLGAAAYGAYSYTRLSIDAVPDITNV
FT                   QVQINTPAPGYSPLETEQRITYPLETAMAGLPKLEQTRSLSRYGLSQVTVIFKEGTDIY
FT                   FARQLVSERLQAAKEQLPDGVSPGMGPVSTGLGEIYLWTVEADANARKPDGTAYTPADL
FT                   RELQDWVIRPQIRNVPGVTEVNTIGGFAKEFLVATSPERLAAYRLTLADVVTALERNNA
FT                   NVGAGYIERKGEQYLVRAPGQLRDAADIGNVVIASPNGTPVRLRDVAAIESGSELRTGA
FT                   ATSNGREVVLGTAVLLMGENSRTVAQAVDKRMQDIRRTLPAGVRVETVYDRTVLVDKAI
FT                   ATVKKNLLEGAILVMAVLFLFLGNLRAAVLTALVIPLSMLMTFSGMVSAKVSANLMSLG
FT                   ALDFGIIVDGAVVIVENCVRRLAHAQHALGRPLTRAERFEEVFQAAREARRPLLYGQLI
FT                   IMVVYLPIFALSGVEGKMFHPMAITVVLALAAAMVLSITFVPAAVALGMGERVAEKENR
FT                   LMGWARRMYAPLLERALAAPAVVLTFAVVAVSVSLVAALRLGAEFVPNLNEGDFSIQAM
FT                   RVPGTGLAQSLEMQMQIERTLKAKFPEIARVFARTGTAEIATDVMPPSISDGYIMLRPE
FT                   RDWPAGPDGRRRDRDQLLADIRATAETLPGNAYEFSQPIQLRFNELISGVRSDVAVKLF
FT                   GDDMAVLEKQAQAIAAQLNRLAGAAEVKIEQTGGLPFLNIDIDREKAARYGLAIGAIQD
FT                   TVSAAIGGKGAGTVFQGDRRFGIVVRLPEAARSDPAALGRLPLALPNGQGYVPLSEVAT
FT                   LHEVTGPNQVSREDGKRRIVVSANVRGRDIASFVQEAQRALDAQIRLPAGYWMAWGGQF
FT                   EQLQSATERLQVVVPLALALVLTLLFMMFGNLKDGLLVFSGIPFALSGGIVALALRGIP
FT                   LSISAAVGFIALSGVAVLNGLVMLSFIRSLREGGKPVDAAVREGALTRLRPVLMTALVA
FT                   SLGFVPMALATGTGAEVQRPLATVVIGGILSSTALTLLVLPVLYRLAYRRDSRDSRDGV
FT                   TAPADAAVAPAVR"
FT   gene            complement(563653..564087)
FT                   /gene="hit"
FT                   /locus_tag="RPSI07_mp0431"
FT   CDS_pept        complement(563653..564087)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hit"
FT                   /locus_tag="RPSI07_mp0431"
FT                   /product="ribonucleoside phosphate hydrolase, Histidine
FT                   triad (HIT) protein"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1472710; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34776"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34776.1"
FT                   /translation="MPDPTYDNQNIFAKILRGEMPCIKVYEDEHTLAFMDIMPQADGHV
FT                   LVLPKEGAAQLFDLSDDAAAAAIRTTRKLARAVRRAFTPPGIAVFQLNGSAAGQTVPHV
FT                   HFHVLPRYTDLPLQPHARVQADTDKLKTQAEQIIAALRAE"
FT   gene            complement(564161..564424)
FT                   /locus_tag="RPSI07_mp0432"
FT   CDS_pept        complement(564161..564424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0432"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34777"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34777.1"
FT                   /translation="MPDTPDTPTPIRTSDLPGRLDRLPWARFHTRVVIALGITWLLDGL
FT                   EVTLAGAVAGALAAIQARWGTAAERRPLEHVAAPLSADDGPG"
FT   gene            complement(564467..565159)
FT                   /locus_tag="RPSI07_mp0433"
FT   CDS_pept        complement(564467..565159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0433"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34778"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34778.1"
FT                   /translation="MGQAWIESAFIATLPEMRMPSPLIDDPGTPPADAATTAPTARAQL
FT                   TPDDWIRAATGVLVTKSIDAVRVDVLAKELGVTRGSFYWHFKNRDDLLRQVLQDWNERT
FT                   RIGPKLERQNVSVQGLVRDLLALPFRGRSARRTAMIEFAIRAWARRDPMAQEAVDAVDE
FT                   HRIGYYVQHFQAIGFARKDAKTRAFMLYAYQLAEALLWNQGSKPDKDARRRFFEDTLLA
FT                   GAPDVARE"
FT   gene            complement(565279..566232)
FT                   /locus_tag="RPSI07_mp0434"
FT   CDS_pept        complement(565279..566232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0434"
FT                   /product="putative glyoxylate reductase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number="1.1.1.26"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34779"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34779.1"
FT                   /translation="MFLPLLTMQPTLLILIAMAADNLARIDQHFHVIYAPTRAERDAAI
FT                   ARDGHAVRVVLTNGSTGLSGLEIAAMPALELACALGAGYENIDVQAARAHGVVVANGAG
FT                   TNDACVADHAMGLLLAAVRGIPKLDRATRNGVWRDDIPLQPGVWGKRLGIVGLGTIGLQ
FT                   IARRAAGFDMQIGYHNRKPRADVPYRYFDALGTMAEWADFLIVATPGGAQTRHLVNRDV
FT                   LEALGPNGCVVNIARGSVVDTAALEAAIRAGKLGGAGLDVYESEPAPPAGLLDLEQVVL
FT                   TPHIAGWSPESIEATVDRFLENARLHLAGEAVVSPV"
FT   gene            566461..567192
FT                   /locus_tag="RPSI07_mp0435"
FT   CDS_pept        566461..567192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0435"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34780"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34780.1"
FT                   /translation="MQATDKPARNSRAGWVGRWTAVAVMAVAAAGLAGCVTAPYPGYGG
FT                   GYGPGYAAGSSTAYSSGYGGTTVSGQPYNSGYGSGYDSGYNNGYGSGYGNPGTPGTPQP
FT                   YPAYSSPSYAPYPTDSGAYNGAPAYQAPADNRYGVVDRIEMVPVQGSPTGVGAVLGGVV
FT                   GGLVGHQIGGGRGNTVATIGGAVAGALAGNAIEGNTVAGQAYRVVLRLNDNSVTTLTQS
FT                   NPNGLRAGDRARIENGVAVPY"
FT   gene            567305..569110
FT                   /gene="cheD"
FT                   /locus_tag="RPSI07_mp0436"
FT   CDS_pept        567305..569110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="RPSI07_mp0436"
FT                   /product="MCP: methyl-accepting chemotaxis protein"
FT                   /function="12.3 : Protein interactions"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34781"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34781.1"
FT                   /translation="MLNRLSIRFRLNAALVLLGALLAIIGTIGVVGMRASDANIREIYS
FT                   NQLASTSLVSKAHLSTAVIRTTLDRAVLHPEAADVPSLIEKAGVYRARSEEAWKKYKAL
FT                   PMSAEEARLAADVEAKRTAFFRDGVEPLIAALRARDAAAIDKVVMTAIPPMFVSLSAAV
FT                   EALDSNQAEQAKAAYEGAVARSQRFLWLIIGAIGVGILAAAGCAFGLDRAISVPLSRML
FT                   GHFGEISRGNLTEQIVVTSQDEMGALTRGLQDMQRGLIRTIETMRGGSDSIASATKQIA
FT                   AGNMDLSQRTEEQASSLEETASSMEELTSIVKQNADNARQASTLAVNASDIAVKGGEVV
FT                   GRVVETMAGINDSSKKIADIIGVIEGSAFQTNILALNAPKGAARAGEQGRGFAVVAGEV
FT                   RSLAQRSAGAAKEIKELISDSVGRVENGTTLVAEAGTVIDEVVVAVKRVTDIMGEISAA
FT                   SDEQSSGIEQVNQAVNQMDEVTQQNAALVEEAAAAAQSLEEQAGLLREAVASFRLPHGG
FT                   EARVVAPAARAVVAKPAAAASAAKPAVRKPVAAVRARAPRKPAAQAPVAKAPVAKAAPA
FT                   VTAEPAGGKLALSAAAVDQDDWAQF"
FT   gene            569820..571919
FT                   /locus_tag="RPSI07_mp0437"
FT   CDS_pept        569820..571919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0437"
FT                   /product="putative putative bacteriophage receptor protein
FT                   NfrB"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34782"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34782.1"
FT                   /translation="MSHAVWEAYLALLNTMTVATALVILISTADDFFLDAFYWVRELWL
FT                   WHSEDRRLPATISAQTLREREERHLAIMVPAWKEYDVIAKMVENTLATMEYTRYIIFAG
FT                   AYRNDAETTTEVDRMVRRYPGRVVRAAVTHDGPTCKADCLNTIIQTIVRYEAGHGIRFA
FT                   GVIMHDCEDVIHPLELKYFNYFIGDQDLVQLPVLSLERKWYEWVAGTYMDDFSETHQKD
FT                   LVAREALTGTVPGAGVALCYSRRAIEAVMKVRGDAPFNTGTLTEDYDFSFRLRELGMRE
FT                   AFVRFPICETTEPATDASGKLRTRWRLGRRRGARPQLLATREYFPSTFRTAYRQRARWI
FT                   LGIAFQGWLQMGWDGDLVARYFFFRDRKGVVTALFSIFAYVLSLNYLMLAWAWRAGWLH
FT                   LDGAQFVVASSWMQSMLAVNAVLLFNRLAQRVYFVGRLNGPLQGMLCLPRLVINNFINF
FT                   FSVCRAWKIFLIYCMTGKPIAWDKTQHTYLSNDALGRTRCRLGETLIRWEALTQPQLDQ
FT                   ALAIQQQTGKRLGQILLQEGMVTPDTLADALAEQADLPRVSLTNVVLGALVDCLPRDLA
FT                   VRHHVVPFSIGEDGSLNIAVSELPDGEVLEELARAAGRKVACFMACDHEMSAELAWMAD
FT                   PNRRATVVFGPSAYSATLAVESLASVAQGAGGPAPTAADAASAPAGHPSAESPHPNPNV
FT                   AGGVA"
FT   gene            571916..573667
FT                   /locus_tag="RPSI07_mp0438"
FT   CDS_pept        571916..573667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0438"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34783"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34783.1"
FT                   /translation="MNSARHTRRPLSARLRWPIAVAVWALCHGALAESAAMQPLSPDAY
FT                   RYADRAYQSIAANQLDAAEQAARAALGVQPDSLQLNLLLLDVLTRKGQLEAARAQADAL
FT                   LERFPDQPRVYAQHGFLAQRAQQPEVAEHDFARALEGNDWTPQEQRNLRLAWSDSAYAA
FT                   KHPDAALQALAPLQDQPDPDIQIRLAQARLLAGDREGAAHAAALAGAQADDPVRQRYAR
FT                   ALFAQATNAGAAQDTAALPASDPRVIGQRALNEAYDHLRAHDDRAALDAFQRGFATGEG
FT                   NWSHYADAAYAAKRLGDNPTAISLFRASLDHADRTDDGTGSGDPNGSQPLPADRRFGYR
FT                   REVEQMQRTWGAVLSSAYQASAFGLPTNSSILQGGAEVYWQPPGIGYQDGRILQFFVRG
FT                   YDNLHDGSGAPSGMPTAQGSVGARYKPIKDANLVFTAERLIKIGNQSVNDTLLRIGYSS
FT                   DEGIDLQVTRPRWQTWQVYAEGAYFVNAGRLIVSGEARYGHTWRLGSISDRLTVYPHIV
FT                   LAGDHDNRADRQMAAGVGPGVNFRYWFRESKYAAPASWLDLTVQFRVPLTHADRAKGVV
FT                   ARAILWF"
FT   gene            573903..575162
FT                   /gene="wecB"
FT                   /locus_tag="RPSI07_mp0439"
FT   CDS_pept        573903..575162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="wecB"
FT                   /locus_tag="RPSI07_mp0439"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase
FT                   (UDP-GlcNAc-2-epimerase)"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="5.1.3.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11106477, 7476194; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34784"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34784.1"
FT                   /translation="MRKILTVFGTRPEAIKMAPLVQALQAEQGIVSSVCVSAQHREMLD
FT                   QVLQLFDIVPEFDLNVMRSRQTLSDVTSAVLDGINGVLDAYAPDAVLVHGDTTTTLAAS
FT                   LAAFYRCIPVGHVEAGLRTGNVWSPWPEELNRRVTDAISTWHFAPTAESRQNLLDEGVE
FT                   PQRVTLTGNTVIDALLAVKYRLDSDPALAAEIASAYPFLDPARRLILVTGHRRENFGEP
FT                   FERFCVALRLLAARHPDVQIVYPVHLNPNVQQPVRAILSGHDNVHLMDPQDYLPFVYLM
FT                   DRAYLIVTDSGGIQEEAPALGKPVLVTRDTTERPEAVASGTALLVGTDTARIVREAETL
FT                   LDDSAAYLRMAHAHNPYGDGQACRRIVEALKTALSAPVPDVQRGPRLVHLDGAGADAQV
FT                   IDLEAARATAPGPSIQRLKG"
FT   gene            575172..575489
FT                   /locus_tag="RPSI07_mp0440"
FT   CDS_pept        575172..575489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0440"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34785"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34785.1"
FT                   /translation="MKTNRFVGGWLVAAALTAAWTLPLPVHAADVGGKGHAQQNGKGPK
FT                   KPGPGVMGADGRVMPPPLPGVVTRVHPGMPNEDLKEADHERGTHFNIGQFRKADGSVHR
FT                   D"
FT   gene            575504..577234
FT                   /locus_tag="RPSI07_mp0441"
FT   CDS_pept        575504..577234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0441"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34786"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34786.1"
FT                   /translation="MKTFLRKFAVALTLGAGLFCTSLSLTTPARAQTCTVQLGAVCVSV
FT                   GVGTPAQAQTTTAKILVMYDAPPNDQYTNLGFSYAIMLYNLLGHFNTQVTLLPVQNYTA
FT                   GMTESYTATFYMGSYYNNPIPAAFLRDVTTTQKTVVWFKYNLWELAWNTAYPFTSRYGI
FT                   NFVSLAGMNATPSSSNPNPGFYDTVTYKNQSMAKYYAFNATTGVVSADPDIGVTSVADA
FT                   TKATSLVTITNTVSKATAPYVIRSGNFWYFADMPFSYIGPRDRYLVICDMLHDILGTNA
FT                   PTLHRALIRLEDVDALVSVSTMTTLTDYMSGKKIPFSVAAIPLYMDPNGVYNGGVAQTI
FT                   HLVNATGLKQSLNYAKARGGKVLMHGYTHQYSNIPNLINAVSANDFEFWLATQNRPVNE
FT                   DSTQWAAQRLSSGLLEFELNGYQPFAFEAPHYQSSPLSMRAVPQYFNSVYQRVVYYTSD
FT                   NPQTLNSTAPGHDFSVGQFFPYIINKDYYGQRVIPENLGNIEYNICSIDPSSCLTYTAQ
FT                   DILTNAQYAVVVRDGFASWFFHPFWLEPDLNEPGFTDFQAVMNGISALGFTWVDAATVQ
FT                   "
FT   gene            577237..578136
FT                   /locus_tag="RPSI07_mp0442"
FT   CDS_pept        577237..578136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0442"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34787"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34787.1"
FT                   /translation="MKRARTMLAMAALVLGASGQAAEPVGVLPAGIVPLFGVTVDAVDD
FT                   VNGVVDALAHLSHTPTARIVFDEGMDAAHYAAPVAAIRRVAYVMGELIDSSTLRLYSVS
FT                   QVGARATDYLDVLGDSVDLWEIGNEINGEWTGRTRDVVDKTLAAYDAVKQRGARTALTL
FT                   YYNEGCAGQPSRAMFDWAARNLPARLRNGVDYVFISYYEDDCKIAPPEWDAVFARLGEL
FT                   FPHAALGFGEVGTRHADRKRELIARYYGLTVHHPRYVGGYFWWYFRQDMVPRSRPLWRH
FT                   IDAAFQTMQARPPAPLTR"
FT   gene            complement(578126..579259)
FT                   /locus_tag="RPSI07_mp0443"
FT   CDS_pept        complement(578126..579259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0443"
FT                   /product="putative MscS mechanosensitive ion channel"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34788"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34788.1"
FT                   /translation="MEWLDTHTFLRVPAHDWAAAAATVVVAYLVLWNLLRLIVNRLEAR
FT                   ARRTGMRFDAMAAAVLRDTHPMFVGLAALLAGSYFIDLPTRVAGKLDHIWFVIIGFQIA
FT                   LWLNRGVKLWTREKLSAQDQATRNPVITSMMAWVLRFALWSMLVLAILANVGINVTAFV
FT                   ASLGVGGVAVALAVQSILSDLFASLAIGLDKPFEIGDFIVFESIAGTVQHVGLKTTRIR
FT                   SLSGEEIVTSNTALLKSTIHNYKRMSERRIVFTFGVTYDAQAAQLRQIPDIIRRAVETA
FT                   GNTRFDRAHFKEFGENALTFETVYFVTDPDFNLYMDIQQRINLAILEGLEKLGTAFALP
FT                   TRTIRVEHAGDDADPPDAPAPRRGHGRGNSMPPRANA"
FT   gene            complement(579359..579625)
FT                   /locus_tag="RPSI07_mp0444"
FT   CDS_pept        complement(579359..579625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0444"
FT                   /product="conserved hypothethical protein, PAAR motif"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34789"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34789.1"
FT                   /translation="MPRVIRLGDPTDHGGKVIQTSAPHFKVNGVAIARKGDRCSCPRDG
FT                   HHDCVIIEGDEHFKVEGVPVAFEGHKTSCGATLMATDSGFETA"
FT   gene            complement(579672..581174)
FT                   /locus_tag="RPSI07_mp0445"
FT   CDS_pept        complement(579672..581174)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0445"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34790"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34790.1"
FT                   /translation="MTQSLLQRLRRHARWIALTLPALIGISAYAVGWFDRTPASFRKPN
FT                   MTALSPRLQPLFEKTKTVCFGRFLIDVPATAAVVFGPVRASTRIERLPGEGDKLGEYVA
FT                   KREAELRKQGRYDEKRDDLNLYKETLAGAVSDQKIVVGYQDSEAFFYKVESYIRLGQDL
FT                   YIQKTQAPVEPYKLTGQEPKKSVIASLGDAIDDLNATARNLHTRAEDGIPTAPGVCLDG
FT                   AFLDDSSGWLTHERIPVGIRLKEFPDVHFSIETNRNQGHLRESSALEPRLKQAEDWANR
FT                   MGGGDWYRHIKMLRRADRQIEGWTGYEALDRVPEQEDVSAHHDFKFMGLGHPTDPLKPE
FT                   LDVQMQTGVADNMIGKHRPSITDEEAVALWDKLTSTIRVRPVGGSGTGKAASNGPLPPH
FT                   APSVPLGQLAATGRQCPQTGWWQCPDVGAIDGGHRFIREVQVMPKVVIVGKPSLWQRLT
FT                   GERPVWQAATVWALVSVEPAPDTADALALPSSVPSEADGEQA"
FT   gene            complement(581171..582877)
FT                   /locus_tag="RPSI07_mp0446"
FT   CDS_pept        complement(581171..582877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0446"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34791"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34791.1"
FT                   /translation="MPYVSQLPTYPELGGRKTQGFLSPTEDKSIQRASILPRRVLPIIF
FT                   LPGIMGTNLRLKPERQRELRRDNNIAWRPERYSTTYDTANATAPERQRLLDPETTEVDT
FT                   YDPATNPTGDPKETADKRHDNVSLPKFKLDVGIDTPLICDDPPTAKPRKTKEQKARARG
FT                   WGEIYFGSYRHLLERCEQRLNSAFWGGKLDPWWKCVVGVAPTAWQATEKPALAPLTEEE
FT                   LKQAIKGCWFPVHAVGYNWLQSNWKAAEYAAQRIEKIMADYRQWGFQCEKVIVVTHSMG
FT                   GLVGRALVHPKIGEMQDKVLGVVHGVQPAIGAAAAYKRIRCGFEDAGMLHGPVASITAK
FT                   ICGNMGAEVTAVLANSPGGLQLLPSEAYGNGWLRVTHKGRTLKSLPQTGDPYEEIYKLQ
FT                   DKWYGLLRPEWINPGGDKEGGIERTHGYLSQAKAFHRAIEQTYHDQSYAHYGADNGRPA
FT                   WRNVTWEINDRATVGNIDALRIVTDTQQGALEVADATTQRIRVRLLPADGPGDQTVPLY
FT                   SADHQLRSGKFKGLFRQTGYEHQASYKDEHALCSTLYSLVRIVQTMQWSTP"
FT   gene            complement(582886..585627)
FT                   /locus_tag="RPSI07_mp0447"
FT   CDS_pept        complement(582886..585627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0447"
FT                   /product="conserved hypothethical protein, Rhs element Vgr
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34792"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34792.1"
FT                   /translation="MDADVNSTRLPCELPSVLAQNRSAMHLNFGPNANAAAATLVPQYA
FT                   DIRQGVCAGLEAQVVCLSEHADLPHDELLGLPVSIQLATDDGALHAINGIVSNVHGGAF
FT                   DGTLASYRLTVIDAMSLMRGRRNMRIFVGKSVPDILGILLAEWQQRSAIMGQAFRFQML
FT                   LDRSRYPVRAQTLQLDESDSGFLDRLTRRAGIFCFVVAGTPDGSDGDTPAHTLVFCDDP
FT                   MKLPQAQAGTVPFHYGAAVKARDSVTHWGEAHSLVSGAIRGASPDHETGRVDRVEVDTL
FT                   LDQGKAGNDLARLMTNSAIDRAHAGDSREDYERLGRLRMQAHERRAACVHAASDVHNLA
FT                   PGFWFVLSGHPLVDKREPKQREFVVTRLHQRIANNFPKELDEQARALAEASGWHLEVRP
FT                   GDGGTQMRYENTFTCVPRGVPLTPDYDPRIDLPRTDPMTAIVVGPNGQEVHCDELGRYK
FT                   LQFVGLHSEDHEHAQGAGTSGTERDSAWVRAGNLWAGQRYGINLPLRAGMEVLVAFANG
FT                   DPDRPYIATVLPGHNNMPAAFNDTGALPDNKHLSGIKTKEVDGSGFNQVAFDDTPGEIS
FT                   SQLASTHAASQLSLGYLTHPRDRGKAEPRGEGAAITTQAMASMHGNQGMLLSTEPRSQA
FT                   GNQMDRDGLLGLAQTFASLAGELGKMAATHHAGTYDPARLKHLIRQLQDWEHGTNTAPQ
FT                   GAGQGGTPLIALSSPASIVAGSADNIALAAQTTVDVMSGDNTQVSAGKDALIYATNEVS
FT                   IFAVEGGVRVVAAKGNVIVESHAEGIELNSAKRIALNAGEEIVLNAPKVRTVTQGAQTT
FT                   WGGGEIVEEASGGYTIKSANFQQIGGGGGVPVALSLPANDGHFDRRLQLTDQLTGEPLA
FT                   NRRYRATLEDGQVVEGVSDAQGFAEHIKSGITFAHYTLEILD"
FT   gene            585761..585946
FT                   /locus_tag="RPSI07_mp0448"
FT   CDS_pept        585761..585946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0448"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0448"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34793"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34793.1"
FT                   /translation="MNGGAAAMPFLIGTRMEHRVGPVFRLSSIVVDVTGNKGTFVPVSK
FT                   VDAMIGRRTRFLFLYF"
FT   gene            complement(586064..587182)
FT                   /locus_tag="RPSI07_mp0449"
FT   CDS_pept        complement(586064..587182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0449"
FT                   /product="putative signal transduction ggdef domain
FT                   protein"
FT                   /function="12 : Regulatory functions"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34794"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34794.2"
FT                   /translation="MSANPPPLSALPDARARSRDYQARHFVPLILALSKCGVLAYGFAV
FT                   LLGWATGLLHTLTLPLALLALLATIAATAHRRRHSGAWEWLALVHLLAQEAAVIVFGHQ
FT                   AGLHWVLPAFYLMPLATSPAWLTRRDFVIAMSLCAAGPLAALLTANEPASVVRHAWLGL
FT                   ALYLPICIAAAAVIHRYLLRAMARHFAAETKLADRANTDHLTGRLARQRFFELGAFAVE
FT                   RARHHGEPLCALYLDVDHFKSINDAWGHAAGDDALVALSDALAGVLRPHDLFGRLGGDE
FT                   FAVLLPDCDLLAALSVVDRLKTAVAVHRHPMGPLTVSVGAAPLRPEQELAHLLADADLA
FT                   LIEAKRQGRNRVCVPSGSTHDAGAVGAIASVG"
FT   gene            complement(587378..588649)
FT                   /gene="mntH"
FT                   /locus_tag="RPSI07_mp0450"
FT   CDS_pept        complement(587378..588649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntH"
FT                   /locus_tag="RPSI07_mp0450"
FT                   /product="manganese transport protein"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34795"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34795.1"
FT                   /translation="MRGSVAIPPDLPLWKKLLRFAGPGLLVSVGYMDPGNWATDIEAGS
FT                   RYGYSLLFVVLLSSLAAMVLQCLSARLGIVTGKDLARLSRERYRPGAVRVQWLLAELSI
FT                   VACDLAEVLGCALAFHLLLGVPILGGMALTALDTLIVLGLKGKNFRQLEAIVLGLILTI
FT                   GLCYFVELALIQPHWPSVAGGLMPSWQAVSEREPLYLAIGILGATVMPHNLYLHSSVVQ
FT                   TRVVSETEAARREAVGLSRLDTIVSLSLALLVNGAILVLAAAAFHANGHQDVADIQDAH
FT                   RLLEPIVGTAVAGVLFGIALLAAGQSSTFTGTIAGQILMEGFLELRIPCWQRRLITRAL
FT                   ALIPAFIGVAMLGDHAIGKLLVISQVVLGFQLPFAMFPLIRMTGDRALMGTFANGLLTS
FT                   ALAWCLFAVISVANLWLVWQVLAG"
FT   gene            588867..590648
FT                   /gene="hscC"
FT                   /locus_tag="RPSI07_mp0451"
FT   CDS_pept        588867..590648
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hscC"
FT                   /locus_tag="RPSI07_mp0451"
FT                   /product="Hsp70 family chaperone Hsc62"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0451"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34796"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34796.1"
FT                   /translation="MPEDSGPRAAAFLLFPFLHLTIVIVGIDLGTTNSLAAVWRDGAAR
FT                   IVPNALGHALTPSCVGFLDDGTLVVGEAARERLQTHPHLSAALFKRYMGTDRKIRLGAQ
FT                   TFRPEELSSFMLRALKADAEALLGEPVTEAIVTVPAYFSDAQRKATRVAGELAGLKVER
FT                   LLNEPTAAALAYGLQTREESKFLVFDLGGGTFDVSILELFEGVMEVRASAGDNFLGGED
FT                   FATLLMQAFLQKTPLGERVGTSIERLPSAVAERLRACAERAKRTLTDAAAATLRIDHEN
FT                   ETYTWEVTADAFVSLAEPLLERLRAPVERALRDARIRPAELDSIVLAGGATRMPMVRRL
FT                   VSRMFGRFPVVDLNPDEVVALGAAVQAGLKMRDAALDEVVMTDVSPYSMGVEIVQQVSA
FT                   QRFSEGHFMPVIERNSVVPVSRVERLHTVSDNQATINLRVFQGESPRVADNVFLGELRI
FT                   PVQPRPAGQVQLDVRFTYDVNGILEAEGTVLETGEKHVLVIEENPGVMTPDEVRERLSA
FT                   LAAIKIHPRDQAENRAVMARAERVFEQLLGPQRGAVGNAIAVFQGALDGQEPERIREVR
FT                   TAIKRLLDQVESGAMFD"
FT   gene            590671..592503
FT                   /locus_tag="RPSI07_mp0452"
FT   CDS_pept        590671..592503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0452"
FT                   /product="conserved membrane protein of unknown function,
FT                   putative DnaJ-class chaperone"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34797"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34797.2"
FT                   /translation="MHGPWAVLAIAPTQDARQIKRAYAARLKGVRPDEDAAGFQALREA
FT                   YEWALAQCDAAPTRPVVSLQVGLVAPSPEAGPPAEPAGEEAAAEPSPDYTPRRSHEQRI
FT                   VYRHTPPAAQEVPASVRGAELWRAFRVALPPQDDDDVSADSAARVEAQLRKALQHPDLV
FT                   SFDARDAFELAAQQVCASECAVGALRLACDSVFRWTHTPMPLRPHERQRWLAATGQAAG
FT                   DRQYQDVQRLARHSAAVRHMLESGPPRISLLRFFVPGYLADVRRFLDQLQTKWPQVLQY
FT                   RLDGASLQAWSEAAHRAWPTFSGLAGMAALGALGALLFWSTGKRLDVPEWYRDLGATLA
FT                   WFVTAAIAVLPLVLRVVYPLWPQAAVQRWQAGLGGRPFDALIWYGVRMIMPVLAFFAAA
FT                   LPPWYAQAVTVALVLTGLLQAILLLLFERGRILVVFPLAGLFYGALMWEAFKPFYADGF
FT                   LVLLLTDTVFFGLRDILHRVYRRDWQHTRARVILLACGAALVPAQLLLARDLPVLAAVF
FT                   GWGWFIGGCAVVDMFGSALARSKTFGMSYVWLIAMGLLLVYSRLAAHGLAGPDNPVAGI
FT                   LTLQAVVAVLAVLALAGTGWQAWMTRLRTARQRA"
FT   gene            592639..593304
FT                   /locus_tag="RPSI07_mp0453"
FT   CDS_pept        592639..593304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0453"
FT                   /product="Putative DNA-binding response regulator in
FT                   two-component regulatory system with BasS (basR)"
FT                   /function="9 : Transcription"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34798"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34798.1"
FT                   /translation="MNAILLIEDDLPLGTALARALRQAGYNTTWVRRLMDAQKWMGSNT
FT                   FDAIVLDLGLPDGEGHVFLEELRAAQSDVPVIIASARDALSERLKGLDEGADDFLVKPF
FT                   PVDELIARLRAVLRRHAGQSTNRWSVGSLVVEPSQKRVTQDGNVVELTPREYQLLFELV
FT                   RRAHRWVTRETLMDALYREGNRVSANALEVVIHHLRGKLGEGVIQTIRGVGYMIGGNR"
FT   gene            593301..594779
FT                   /locus_tag="RPSI07_mp0454"
FT   CDS_pept        593301..594779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0454"
FT                   /product="Sensor protein, Histidine kinase"
FT                   /function="13 : Signal transduction"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34799"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34799.1"
FT                   /translation="MKCSVPAILRVRSLSFRLYVLILMALVLMLLVQLAIAYLEISRSN
FT                   SRQVVSDLRMSAQAYADLTALNMDDVPRREEFLRRLTDIRLGLSQPDLLPGEFRYVLCD
FT                   RDGQVITALPGAPTMPCGKAHGKVVEIMLEGVPWRAYTVDSIDGKLTATVAQPMSAYER
FT                   AIRDLYREVALTIAFLAAILMVMVGWAAHQGLKPLRALTGQVEARDTADLEPVQSVEHA
FT                   ELKPLVQALNGLFERVRRSIEADRRFFADAAHELRTPLAAIQAQAYVVSHSDSEDDRST
FT                   ALREFDRGISRATQSLSKLLALARLDARRVEAQLAQGTLSDLAGCARSGVIQQASRAER
FT                   RNVTLSYDGASQAWVSVSHEDAATLVENLLDNAVRETPDGGEVHVDVQRFEIGGRPMIE
FT                   LRIEDTGPGIPPEEREHVFERFYRPRGSQSQGSGLGLAIVRRIVELGKGSVAIEDGHGG
FT                   KGCAVVIRLPALTSAPEPLDPQDEPPGTADVPPG"
FT   gene            complement(594920..595531)
FT                   /locus_tag="RPSI07_mp0455"
FT   CDS_pept        complement(594920..595531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0455"
FT                   /product="conserved hypothethical protein, NAD(P)-binding"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34800"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34800.1"
FT                   /translation="MKIAIIGATGRVGTRLIDEALRRGHQVTAIARTASKLPARTGLTA
FT                   KDADVADQAALVAALAGHDVVFSTVRFLQTSADQIVGAVKKAGVPRLLVVGGAGSLEVA
FT                   PGVALIDTPQFPKEYFDEASAGRDFLNALRKESALDWTFVSPAALFEPGQRTGHFRLGK
FT                   DTLLVDAAGKSWVSMEDYAIAFLDETERPAHSRQRFTVAY"
FT   gene            complement(595635..596066)
FT                   /locus_tag="RPSI07_mp0456"
FT   CDS_pept        complement(595635..596066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0456"
FT                   /product="putative transcriptional regulator, Rrf2"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34801"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34801.1"
FT                   /translation="MSTSSRFAVAVHILTLLASAEEPVPSSLIAGSVGTNPALIRRLVA
FT                   LLADAGFVTSQMGASGGSTLARPADRITLLDVFRAVESPVLIALPHSQPNPACEVGREI
FT                   TGVLERVTARAQSAMEAELAAQTIAGMLAEVERAQRRRA"
FT   gene            596214..596723
FT                   /locus_tag="RPSI07_mp0457"
FT   CDS_pept        596214..596723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0457"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34802"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34802.1"
FT                   /translation="MSAPIPSPSLLPARAFARGKRLRGVRWIMMVWCLLFTVSVFSATH
FT                   FPDGQAAGDAFDAIEAVVDAALGDASQPAVSNTVFERAFAGAAGKLPGQCADSHPWFAK
FT                   ASAAPDAPSSNAVTSDPASDAPELWLPPPALPLAPALRVARARPAFPPFRPGPAPAPML
FT                   RPPAHA"
FT   gene            596833..598194
FT                   /gene="cusC"
FT                   /locus_tag="RPSI07_mp0459"
FT   CDS_pept        596833..598194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusC"
FT                   /locus_tag="RPSI07_mp0459"
FT                   /product="Outer membrane protein of the copper-transporting
FT                   efflux system CusCFBA"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12813074; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34803"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34803.1"
FT                   /translation="MLSFQEAASPCPVARVRVSQRFLLAAMLAWTAMPATAAPRVAADS
FT                   VSPAAARTVAPRDEAVPLPRYSLPQLLELARASHPALAASRAQVQAAQAGMTTARAWPN
FT                   PEVEAMAGRQRARMPGAAEGRTNSVSITQKLDLPWQRAARMQAADAAFEGSQAQARSSA
FT                   RDLEAQLKLRFYDVLRREAEQRTAREDVTLVEQIRRRVAVRVETGEAPRYELIRGDAEL
FT                   LNAQRTDQAAALRVQQALAELRRAVGAELPAAFDVDAGPDAESVAVHNLPPLADLVGNV
FT                   LATHPDLEADRAAVREAEARLAHERSQRWPSLALRGSVDRQPDLQDSRVGLVVSIPLFD
FT                   RREGPVGEAVAALERARAVLRDRELQMRQAVESAYRQYEIAQSQVSALESGVVKQAESA
FT                   LRVAEAAYRHGERGILDYLDAQRVFRQARNDLITARADLRTAAVELDRLRAEAP"
FT   gene            complement(596844..596912)
FT                   /locus_tag="RPSI07_mp0458"
FT   CDS_pept        complement(596844..596912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0458"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10539"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10539.1"
FT                   /translation="MAASKKRCDTRTRATGHGEAAS"
FT   gene            598236..599408
FT                   /gene="cusB"
FT                   /locus_tag="RPSI07_mp0460"
FT   CDS_pept        598236..599408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusB"
FT                   /locus_tag="RPSI07_mp0460"
FT                   /product="Secretion protein of the copper-transporting
FT                   efflux system CusCFBA"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11399769, 12813074; Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34804"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34804.2"
FT                   /translation="MTHRPSSFSSSWRLVAVAAAAVLLLGACGKDSTDTAKAAQQASDP
FT                   NMVVAQPTLTARLKVAPVGQQAVSERLRVPGQIDFDDQRVARIGASVTGRVTELLAVPG
FT                   QQVKTGDILAQLHSTELGTAQLAYQKAVAQRDLQARALERAKLLLAADVIGSAELQKRQ
FT                   SELAMAEAEVRAAVDQLRVMGVSPATLAKMRAGGMSSISPVVASLSGTVVERKVTRGQV
FT                   VQPADALFTVADLSRVWVVGQVPENAAPLVRAGQAVEIETGAPGARIVGKLIWVSDIVD
FT                   PQTRTVTVRTEVDNAERMLKPSMLATLLIESRPEQKLVVPTSAVVREDNRDYVFVQASQ
FT                   THYRLVPVKLGDEANGVRPVASGLQAGQPIVVEGGFHLNNERKRAEMEGA"
FT   gene            599405..602554
FT                   /gene="cusA"
FT                   /locus_tag="RPSI07_mp0461"
FT   CDS_pept        599405..602554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cusA"
FT                   /locus_tag="RPSI07_mp0461"
FT                   /product="outer membrane copper (silver) and drug transport
FT                   protein (RND family)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11399769, 12813074; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34805"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34805.1"
FT                   /translation="MIDALVRGALKQRLVVAVVAAVLLFFGVDAARKLSLDAFPDVTNV
FT                   QVQIATEAPGRSPEEVERFVTVPVEMAMTGLPALTEMRSRNKPGLSLITLVFTDETDVY
FT                   FARQLVMERLIEVQSRMPVGVTPVLGPVSTGLGEVYQYTLDRPDDGNKELSVEELTRRR
FT                   IAQDWVVRPLLRSIPGVAEINSQGGYEKQYQVLVNPERLRHHNVTVQQVFEALAVNNAN
FT                   SGGGVLPHFAEQYLIRGVGLVRDINDIGAIVLKEVGGTPLTIRDVAEVKIGTAVRAGAL
FT                   VKNGVTESVGGVVMMMRGGNAKEVVARIQARVKAVNDNGMLPGGLKIVPYYERSELVDS
FT                   ALNTVVKVLLEGVVLVVLVLLLFLGDIRSSLIVVGTLVLTPLLTFMAMNKLGISANLMS
FT                   LGGLAIAIGLMVDGSVVVVENAFAHLAKPRDPNESRARIILHAVMEVATPVIFGVGIII
FT                   LVFLPLMTLQGMEGKMFAPLAFTIAIALFISLVLSLTLTPVLSSYLLKPKAAKHAGGDH
FT                   GDDAHAQHDEHDTWLIRKLKKPYLRLLELSLNNGRKTVVVAVAVFFATGALMPFLGTAF
FT                   IPEMKEGSIVPGINRAPNISLEESIRMEMEAMRLVMQVPGVKSAVSSVGRGESPADPQG
FT                   QNESTPIVSLKPRDQWPKGWNQDDIAEAMRKALQTLPGVQIVMAQPISDLVDEMVTGVR
FT                   SDVAIKVFGDDLAVLREKAEAIARVAQGIQGAQDMRVERITGQQYLQIAIDRQAIARHG
FT                   LNASDVHNVIETAIGGKQATEIFEGERRFGAVVRLPEAYRGSVEAIRNLIVAAPNGAQV
FT                   PLESIARIEVTDGPAQISRELGKRRVVVGVNVRDRDLGGFVAELQAAVEQKIKLPEGYY
FT                   LEWGGQFQNMERAMGHLKVIVPITVAAIFFLLFLLFNSVRYATLIILVLPFASVGGIIG
FT                   LFVTGEYLSVPASVGFVALWGIAVLNGVVLVSTIRNLREQGMSVEESVRLGARLRFRPV
FT                   MMTATVAMLGLIPFLFATGPGSEVQRPLAIVVIGGLLTCTLLTLVMLPTLYKWFDEEAR
FT                   S"
FT   gene            602551..602874
FT                   /locus_tag="RPSI07_mp0462"
FT   CDS_pept        602551..602874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0462"
FT                   /product="putative nitrogen regulatory protein P-II (glnB)"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34806"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34806.1"
FT                   /translation="MKEIRIVVRPQLLERMHEALRGCAGFPGMTVGEVSGYPPTASLAG
FT                   PHSIKEDLTEFVPRVRIEIVASDVLASQLFDTAVKVLEHGQTGDSAIWMTEVVQATFLH
FT                   RTG"
FT   gene            complement(602980..605190)
FT                   /locus_tag="RPSI07_mp0463"
FT   CDS_pept        complement(602980..605190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0463"
FT                   /product="putative aminopeptidase"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.11.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34807"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34807.2"
FT                   /translation="MRYSTPIRCTAIARRADAGGRRPWRLALLAQTAAVMLLAACGGGE
FT                   DGTPTSSSNTLSADSSQQQANAGTSTGTSTPTPAVDASVPPLELPAHIKPVNYKLWFRP
FT                   NADLTGFSGRADVEIKVTKQTGEVTVAAHNLRFDPARVTLTATGSNTTQMLVPVPQSQG
FT                   DFYDLRLPTGDIKPGTYMLHMEWTGTVNFTKAAGLFKLGLQAATGEKSDALVTQGAANL
FT                   SRQWFPGWDEPAFRHTFELTAEVPGDWKAISNGKQASAMTLPDGYQRVAFSKTPSMPSY
FT                   LMFFGGGKFDMLEDRFTSPLDSSTLPLRWWVPSGEVHSAVDGMQYTKEALNYYYNYFQI
FT                   PLPLDKIDTVVANDSYNNKNAGFGGMENWGAIFEFADQVLVPPEGAPTSLHPKGKARSF
FT                   SVVTHEIAHQWFGDLVTLDWWDNIWLNESFANWFENVTKIQLHPEFTGNSWEGYAAAKQ
FT                   RIYTLDLAVTAVPVQHNLSDTGSNDFLDRFAYHKGGHVLQMIENYIGHDAMRRGLQAYL
FT                   NKYRFGNGTPARLWAELEAASDKPVSKVGDSFVRQTGVPLVTIDARCNPVTNQNVVTIS
FT                   QRAFPSKNMYPGYRWNIPLVLKYGENLAQTRALMFDQAGTQITLPTCSAVLANPTGLDY
FT                   YVTNYSPSLWSELLAQAGAITDKAAATNLAGDATQLYNAGLMSQAVYSQIVGIQNFQPA
FT                   LQTLRAQSVGVGIDALQVPPLETPVHRFKYQGVMKHLSDLKQ"
FT   gene            complement(605765..606205)
FT                   /locus_tag="RPSI07_mp0464"
FT   CDS_pept        complement(605765..606205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0464"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34808"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34808.1"
FT                   /translation="MANPLSSVTTIHNGKGDPAIEPIRKISDLQRGRIAAKVHELMDVT
FT                   GLEERELYRVILADFGLADLGDLRRDQFKSAMEKLGRWISEAREEPTDAPAPARHDIPC
FT                   ARCAELDSALARARRWQTIVTCLVLVAGTAAAYASLVIGCRR"
FT   gene            606733..607038
FT                   /locus_tag="RPSI07_mp0465"
FT   CDS_pept        606733..607038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0465"
FT                   /product="exported protein of unknown function, periplasmic
FT                   binding protein-like domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34809"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34809.1"
FT                   /translation="MMRKRFNILTALVTSVAVRAVHADVITVAQVLPLEGSVDMSTRAA
FT                   VEAAERYLRKVNDAGGMTKLAEDVLRVNAGAVLMFSDSINIGGFLRAYRERGGMRW"
FT   gene            607035..607430
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0466"
FT   CDS_pept        607035..607430
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0466"
FT                   /product="putative abc-type branched-chain amino acid
FT                   transport systems (fragment)"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="PSEUDO:CBJ34810.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            607513..607647
FT                   /locus_tag="RPSI07_mp0467"
FT   CDS_pept        607513..607647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0467"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34811"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34811.1"
FT                   /translation="MLAFRDRISQAETNGEPWAKHCIQRGLELMHERGSGFGWRGLAL"
FT   gene            607896..617864
FT                   /locus_tag="RPSI07_mp0468"
FT   CDS_pept        607896..617864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0468"
FT                   /product="Hemagglutinin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34812"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34812.1"
FT                   /translation="MNAKCYRTVFNAARGMLVAVEESARSTGKGRSAGGRASRRRASAL
FT                   MLTAAGALASPGLQAQSLTVDRGAPGPHPVVGVAANGTPVVNINAPSAAGVSSNAFTHY
FT                   NVGQAGVVLNNSGQNSQTQIAGWVQGNPFLGNNSARVILNQVTSGNPSTLAGPTEIAGN
FT                   RANLIIANPAGITCSGCSFIQAPRVTLTTGTPNFDALGNLSSLSVQQGQITVNGAGLDA
FT                   RGAQLDLLSRAMAINGAVWAERLNAVAGANRIDYGSVTPTVIAGTGPAPQVAIDVGQLG
FT                   SMYGGGATRLIGTEQGLGVNIGGNLAALTGRLDLSANGDVTITPTGRVQSAADAVIAAP
FT                   NVTNQGVVSTPGTVSISGGTTNTGSVIAGGNVAIAGPQIVNAGTIGAGVDANGGVTQAG
FT                   SVVLNATGTVRNGGSLLAGRDVGMNAGSIDTGNGNVNARGAVTLTAAGDVSSRGAAVSA
FT                   HSVAVQAGGTLDNAAGSLWSATGMQVGAQRVANQGGLLGAVGDVAVAAGSVDNSAGTIG
FT                   SQTGSLNVNSAGAIANAGGKLIAAQDASLTGTGLGNQGGTVSARNLSINTGTGAIDNTG
FT                   GTVSAAGTAAIGAGALVNRGGTLAAVGDVTLKVGRLDNTSGALGSQTAGLNLDSTGDVV
FT                   NAGGKLVAAQDASIAAASLNSQGGMVSARNLLLDARGGTLDNTKGTVSAAGTATVNAGS
FT                   LINQGGTLAAVAAVRANVGRLDNTGGALGSQTAGLSVTSTGAIDNAGGKLVAAQDATLN
FT                   AASLGNQGGTISARNLSLNTGSGTVDNTGGTVSAAGTATLAAGTLINRGGTLAAVGDVT
FT                   LKVSSLDNTSGVLGSQTAGLHLDSAGDVVNAGGKLVAAQDATISATSLANQGGTLSARN
FT                   LQVNTGAGTLDNSNGLVSASGQADLTTGSLFNHGGTLAAGGDVTARVASLDNTSGVLGS
FT                   SAGNLSVNSASGIANAKGKLIAAQDATFNAASLDNQGGAVSARGLSIHTGSGKLDNTNG
FT                   SVAAAGVATIQAGNLVNQGGTVAAAGNLNATVASLDNTAGGVLGSSGGNLTVTSAGAVA
FT                   NAGGKLLAAQDIALLAASLGNQAGTVAGRNVTVNTGTGALDNTGGAIAAAAALDATAGA
FT                   VTNASGVMQAGTTLAVRSQSLTNTNGALIGNAVSVNSGTLANRQGTISSATTLDVQGQS
FT                   LNNAQGKLVSNGTLTIHDDTVTNAGGQIASNADVTVGGTTLDNSAGLMHAGGTLSVNGA
FT                   SVVNKNTSTAGTGMEGANVALTATTSFDNTAGAVRSDQSTQIIAPAIDNTQGAIQSAGT
FT                   VGAKAAGALTNTRGNLAGTKSVAVVAGRMSGDGTVQSQGSVSLDLQSDYVNTSTVAAGQ
FT                   DVSVTTTGNVTNSGTLSAGRNLAVSANNIANTQSGQLIGAVSNTLTARGTLSNDGLIDG
FT                   GATVVRANTVVNTGRLYGDTVAIQANTLTNTVGANGVAGVIASRGDMDLGVQTLNNQEH
FT                   ALIYAAGNLRIGGALDAGNHATGSAQSVTNGSATINADANLTIAAAQINNQNNHFATAD
FT                   QTSAGVHVTAYRLSGSLQDIDPSTVWFFHQHTGEWHSGADWQWLGDDDYKVMVMPSAQY
FT                   PFERYGPPFDYSKDTSAVSMIGAPLSFPIGAAYSPGGACGGDNCTVDSYPEVFAYTTTD
FT                   RIWSVFGITPPQEVGEEPIREEYFGSRRWQYDADHAAWQQRHDAAVARYQQLNKAIEAF
FT                   NWDFRRRQVDQFTIYDGTQQVTRTVVTQSDPGTITSGGSMTLNAGVVNNVASQFVAGGD
FT                   LTGNNVIGTRPNNVGMQGTQTVTTTGQALYTYVDDRDRAYNASPWQGQTVQTNFQLDVS
FT                   ATSGTGPNSQHAVKSVAVAATAGQGNGGATAVADHMTIAGGTASVAVPTGGTVHAVTST
FT                   VAAPAGSAVSAATSAVTVPNSGAVIRTVVPNLTLPNNALYRVVRDPGSSVLVETDPRFT
FT                   SFRQWTSSDVMLSQFRNDPGATLKRIGDGFYEQQLIQQQIIRATGQRFIGDYTNNEDEY
FT                   KALLAAGVAAGKAFGLNVGTALTDEQMARLTTDIVWMVKQTVTLADGSQQEVLVPQVYL
FT                   RARDTDITGGGTLMAGNNVSFQAKGDVTNSGTITSRRVTVVTGDNIVNTGTLAGKTLLA
FT                   QAAQDINNLGGHIQGDQVLLAAGRDVNLTSTTASTKNATTIGTNISQVASVAAGALSIQ
FT                   AGRDANLTAAAINTSGDATITANRDVNLNALRQSSEEHVNWGNQNRSDRSSYADTGTQI
FT                   QAGGKLAIGAGQDVNATAAYANATGSIQVVAGRDVKLNAGQSHQDVRDEHFQKETGFLS
FT                   SKTTHTIDAASRTDAAGTTLSGDTVAVQAGRNLTVAGSTVASTNGTSLAAGNDLTVTTT
FT                   QTSSSESHFREEKKSGFGATGNGLSYGNKQQTDIANDNANTYAGSLIGSTNGNVTLKAG
FT                   GDLHMTGSQAVAGGDLTAIGRNVTIDAAAGTTHHDETHITKSSGFTLGLSGGAAGLMQA
FT                   ASSQVQDAADAKDARAAVLNGMASGRSLYDAAKALGGEKPMDDISVSLSWGTSQSKSTS
FT                   TEDATRNQGSTLMAGGKATLIATGTKDANGNPVAGTGNLTIAGSDVSAKNVVLGAANAV
FT                   NLVSSQDTDKTRSENSSSSASVGVQVGNHGFGVSGSMSRAHGNANSDAVIHNNTHVTGS
FT                   DSVTIVSGGDTNLLGAQVNGGKVMADVGGNLNLASQQDTTKASAHQQSMSGSASIGTAG
FT                   GSASGSFTTQNGHSDYKGVQEQTGIYAGTGGFDINVKGNTDLKGAVIASAATPDKNTLT
FT                   TGTLSFSDIHNHSEYSASSFGISGGVGYQSDKKSGETSKAESEEPRKKATPGGFSPMLP
FT                   LMSSGSADSTTRSAVAEGTIHITNQAQQKQDIATLSRDTSNTNTVLDKNPDLGEILSRQ
FT                   AELQKAASAAGEAVARTIGDIADSKRADALAEAEKAHKAGNEELANKYRAEADQWKEGG
FT                   EYRAGLHMAGGALVAGLGGGSAIGGAVGAGAASLAAPQLTELADKVASSMGGGVAGQMA
FT                   GNVVANVAAGAVGSVGGGSGAFMGSNVDRYNRQLHVEEKTMAQKIAARAAAQGLTNPDG
FT                   SPITVDQIENAMRSANNSKYGENATTGMVVPLNSKTKASDIYDNTGMLLQNDGGGHGYL
FT                   VQNQAMLATPSQTLQTLIQQSTGGVNSPYGWDSAASSTPATKSVNPFTPASNGCITAEC
FT                   AAGVGANRAFDGNKSWSVSAGAYAGVGGEFELGLQGLTVTDVKGALGVGLGLHGKLTGP
FT                   AAGGKSDLVVVGRDPDPGEYRVGGSAAGSVALGAGSVEASYAGGLYSRAQPGVVNTGTY
FT                   SQTKISVGVTPIFGFGVEGKFNFMEFAYKRNQ"
FT   gene            618707..621655
FT                   /locus_tag="RPSI07_mp0469"
FT   CDS_pept        618707..621655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0469"
FT                   /product="Hemagglutinin-related protein (fragment)"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBM10540"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBM10540.1"
FT                   /translation="MVALIGNVALKAGGDLSAIGRNVTIDAAAGTTHHDETHITKSSGF
FT                   TLGLSGGAAGLMQAASSQVQDAADAKDARAAVLNGMASGRSLYDAAKALGGEKPMDDIS
FT                   VSLSWGTSQSKSTSTEDATRNQGSTLMAGGKATLIATGTKDANGNPVAGTGNLTIAGSD
FT                   VSAKDVVLGAANAVNLVSSQDTDKTRSENSSSSASVGVQVGNHGFGVSGSMSRAHGNAN
FT                   SDAVIHNNTHVTGSDSVTIVSGGDTNLLGAQVNGGKVMADVGGNLNLASQQDTTKASAH
FT                   QQSMSGSASIGTAGGSASGSFTTQNGHSDYKGVQEQTGIYAGTGGFDINVKGNTDLKGA
FT                   VIASAATPDKNTLTTGTLSFSDIHNHAEYSASSFGISGGVGYQSDKKSGETSKAESEEP
FT                   RKKATPGGFSPMLPLMSSGSADSTTRSAVAEGTIHITNQAQQKQDIATLSRDTSNTNTV
FT                   LDKNPDLGEILSRQAELQKAASAAGEAVARTIGDIADSKRADALAEADKAHQAGNEELA
FT                   NKYKAEADQWKEGGEYRAGLHMAGGALVAGLGGGSAIGGAVGAGAASLAAPQLTELADK
FT                   VASSMGGGVAGQMAGNVVANVAAGAVGSVGGGSGAFMGSNVDRYNRQLHPDEQKWIKDN
FT                   AKRFARQQGISEQAAEQRLAQQGFRQVQSGVGGAWDQVASDFLSQAHGLLAPDPSCPSC
FT                   GPGYMFRATATQKANADMYSNFLPQDRINNFYARNGLSQPTSKEVRQAANDDAKVRDTL
FT                   GNMTVGAAGAALALTVPPALSWCLSNPVACNRIAITGGEIAGGDALPVGLGVAGLAGVR
FT                   AVKTAEEANAAMAAKGWSPAWSPATPVVEGTLQPGTKMQMIVDEATAKQIKDVLDAGKS
FT                   DFSKVRLGGWATFDDVGSVAVDMRQRAAITGEFKPNSSGPFFVVEIQVQKALNSNVGFA
FT                   GAQVSKEKLADGSVTTLNSILRGGASQAEFLIPPAERTQYLRPVTPPKRMGN"
FT   gene            621662..622111
FT                   /locus_tag="RPSI07_mp0470"
FT   CDS_pept        621662..622111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0470"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34814"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34814.1"
FT                   /translation="MIENVVEVFDNGVDLEYGLSYEAREALKLNTGAKFPVATRWTYYG
FT                   HVYEDANCPKPIPDMSGLVYATQGWKTWVVLNPNGTQRFVIQVPRISEKSVPDQGDLGE
FT                   PLPLKGGAMHVMYGEGGDGERHDCRFYFNMHTGELMKVDFVGRHW"
FT   gene            622151..622327
FT                   /locus_tag="RPSI07_mp0471"
FT   CDS_pept        622151..622327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0471"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34815"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34815.1"
FT                   /translation="MILGEKWLNPAVGKLFQVAQRHIIPRLVEFRFVYTLTLNLEILIT
FT                   TIREKVAINGGLF"
FT   gene            complement(622528..622947)
FT                   /locus_tag="RPSI07_mp0472"
FT   CDS_pept        complement(622528..622947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0472"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34816"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34816.1"
FT                   /translation="MRQLKEHVAQRGTGIVVANSFPTYPVTKAAKQPCPPMVMVELKLN
FT                   SESFFFPEQHTHFPGSFRTTFGTFEFRNYPPPSRPWFSLFSPFPPLLAPRPYLRKQTRT
FT                   KSIFLSISHPHYSNHQDIDAHTAHTPYLHTQNTPR"
FT   gene            622783..623289
FT                   /locus_tag="RPSI07_mp0473"
FT   CDS_pept        622783..623289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0473"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34817"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34817.1"
FT                   /translation="MLFGKKERFAVEFELDHDHGGAWLFGRFCYWIGGERVGDYDAGAS
FT                   LRDVLFQLTHIVGDGGKRFCPRLAALPAAQSFKLIFDALRETNSEIFNYVSRDFMSVRL
FT                   DVCIPVDIFNTWNIFLVEDIEEAKLIYQEDGALDAKLAILSVGEFDEVIKTTYAELEGL
FT                   LAKEL"
FT   gene            623586..624149
FT                   /locus_tag="RPSI07_mp0474"
FT   CDS_pept        623586..624149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0474"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34818"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34818.1"
FT                   /translation="MTLIEHLEQYLGPLAEGWTDSHPQEKNKNIRIVRFRDVPYEGTST
FT                   FATLGLSDHIVDLGDGRTVRQELLFAVHDCYPAEQIASFFLTFAGFFQSRQGALLRGDV
FT                   IGPSAPLIPGVAANALYASIPAIFPEEIGTYSMSSPPTVLIWLIPLVGEDSVLVKSRGW
FT                   SEFEDMLEAENPDLLDLNRSSLQN"
FT   gene            624693..625094
FT                   /locus_tag="RPSI07_mp0475"
FT   CDS_pept        624693..625094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0475"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34819"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34819.1"
FT                   /translation="MTSICVEIAASSGEREPCEIEFTQGMSVTLCVRSARFGELSFTDD
FT                   NLFAAMSAYRRRLEQDGYLLLCNGARRDAYPSQMILEMGGGRKIYLLHAGKQTSRQDLV
FT                   DIFGAATIEQVCTVEEQRASYDAWIRSLR"
FT   gene            625091..625315
FT                   /locus_tag="RPSI07_mp0476"
FT   CDS_pept        625091..625315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0476"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34820"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34820.1"
FT                   /translation="MSGNAEHEITPDVVQAGRENPNGWVYKIEGTYGPTEYVPPEAIVG
FT                   AWKVDAHGNLTGEFMPNPKCQPGFSKANK"
FT   gene            625452..627119
FT                   /gene="hlyB"
FT                   /locus_tag="RPSI07_mp0477"
FT   CDS_pept        625452..627119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hlyB"
FT                   /locus_tag="RPSI07_mp0477"
FT                   /product="hemolysin activator translocator"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15889153, 3290200; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34821"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34821.1"
FT                   /translation="MALGASAASSFAIAQVTPPQVTPGPEVQRLQEQQLDQARDRANAR
FT                   PDVFTAPAPAQPISLSALPKETPCFPIQGIVLEDNVFNWLPNLLQPVNGQCMGKQGLEA
FT                   IELQVNNALIEHGYVTSRVLIPQQNLAAGALRLKVLPGRIGAVRNASDDNIGWARMALL
FT                   AGPGDLLNQRDLDQALETVRRLPGQSEVSFDIVPGAHVGESDIVLKPGTEKRWHATLSA
FT                   DNTGMKSTGKYQMSGSLVIDSPLHLYDQLAISASSNTDRGAATQGTRSYSLNWSVPVGY
FT                   ATVFVGANRSRYRQTVAGFEDPIVYSGQSSEVNLGISGVLHRDATSRTGAQFKVFRKIN
FT                   RNYLDDTEIEVQRRDAVGYEASMSHRHYLGPVALDGGIAWRETLPDHSNVPGVVVGDPT
FT                   YGGRSQIETANASLYWPFKVASQVFEFSSNWAIQHARTRVLPSDYFTIGNRYTVRGFDG
FT                   QLTLAAEDGWYWRNELAWRVAGQAIYGGIDMGKVHGPSAESLLGDRLVGAVIGVRGRVA
FT                   SGRYAAVNYDLSFGWPLSKPAGFRTERPAVMAQVGVEF"
FT   gene            627457..628401
FT                   /locus_tag="RPSI07_mp0478"
FT   CDS_pept        627457..628401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0478"
FT                   /product="putative response regulator receiver, CheW-like
FT                   domain"
FT                   /function="13.1 : Two-component systems"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34822"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34822.1"
FT                   /translation="MSQQEVDERTNLTNNNRFELLLFRLGESQRSSQRELFGINVFKVR
FT                   EIMVMPPVTHVADSGAHILGAVNVRGQIIPVIDLASVIGCKNGNANILLITEYARTTQG
FT                   FAVEEVDEIVRLEWSQIFPAEASVGSANITSLARLDGDADNSRLAQVIDVEQILVDVFP
FT                   TRRADLAPDSGDRSIKLPPGAKLLVADDSGLARSLIANGLEAMGAPFVMTKSGQEAWDT
FT                   LQNIARDAAREGKTVRDKIALVLTDLEMPEMDGFTLTRKIKSEPAFQSIPVVIHSSLSG
FT                   SANEDHVRRVGANGYVAKFEANELAQAIVSALG"
FT   gene            complement(628707..629351)
FT                   /locus_tag="RPSI07_mp0479"
FT   CDS_pept        complement(628707..629351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0479"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34823"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34823.1"
FT                   /translation="MTLENPRPPVRTTYRHGDLRRALLDAGVALARAGGPDAIVLREAT
FT                   RRAGVVPNAAYRHFAGRPDLLQAVRAAALAALARAMETELAQIDPALPEADQARAALRA
FT                   IGVGYLRFAQRETGLFRTAFAVPDEVEHDVDPDKAGDSGLNPFQLLGAALDRMTAAGVL
FT                   PAERRPGAEYLAWSAVHGLALLIIDGPLRGRPQEQTGAIALRVVEMVENGL"
FT   gene            629466..629897
FT                   /locus_tag="RPSI07_mp0480"
FT   CDS_pept        629466..629897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0480"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34824"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34824.1"
FT                   /translation="MADVKTMADDEAQLRALIQEWAEAVRAKDVNAVMRHYAPDVVVFD
FT                   VMPPLFVKGAEPYRCNWQDWFDALEGPADFQFVDLHLAVSGDLAYCFSVNRLRARYRDG
FT                   TKHDAQTRATVCFRKIDGRWLVVHEHASVPMPVPESVSA"
FT   gene            629981..630412
FT                   /locus_tag="RPSI07_mp0481"
FT   CDS_pept        629981..630412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0481"
FT                   /product="Putative glyoxalase/bleomycin resistance
FT                   protein/dioxygenase (phnB)"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34825"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34825.1"
FT                   /translation="MLVQPYLFFEGRCEEAVEFYKKTLGAKVDMLMRYKDAPPGAEPKA
FT                   EQCGGVVPPGDKVMHAAFRIGDTLVMASDGMASGKAEFKGFSLSINVADEVEAERTFKA
FT                   LGDGGQVSMPLAETFFAKKFGMLVDRFGVMWMVIAPKPM"
FT   gene            complement(630772..631161)
FT                   /locus_tag="RPSI07_mp0482"
FT   CDS_pept        complement(630772..631161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0482"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34826"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34826.1"
FT                   /translation="MKSYAFHRAGRIALITGGLLAIWQSASSYAATQTPAVPEGYVYRD
FT                   QLVANASAHCVSIDFKLLSGKTETRHFVDDSYVVLEAKNLGVHYKTANVTFYKSDTQCS
FT                   GEVLKTKPDVDVSGRFIVFSTSDAS"
FT   gene            complement(631743..633809)
FT                   /locus_tag="RPSI07_mp0483"
FT   CDS_pept        complement(631743..633809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0483"
FT                   /product="putative serine protease protein"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34827"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34827.2"
FT                   /translation="MLISRISRAALLISLSGGFSADLMAQVDASPSKPNGSPLANIDGM
FT                   PSGLPPKAQAEGNTAKLDGALIRLRQNTAASQVRSASGIESSAAVDRTGNCVNVDIVVQ
FT                   GDAQQTVAQLERLGLQSSAVYRNYISGCLPVEKIDEAAAIPQIRRISKVARSTHSGVVQ
FT                   GQGDYAQLSRSLRQAVKNLGLELTGKGMTVGVLSDSFNCNSQLNQDARFVAKNGRQDTM
FT                   EDDIARGDLPGNGRIRILKELSNCSDGSDEGRAMAEIIHDVAPGADIAFYTAANGQADF
FT                   ALGIETLALPKDQSTAKGVPGGGAQIIVDDVEYFAEPAFQSGIVGVAIDNVVKNHGVAY
FT                   FAAAGNDSADASPVSYVNNTARFADQPVDPTGTGTPGRPLNFDPSGASQVDSIPVRALR
FT                   QIEDTPFWRFRVQLYWDQPFDNSASSLQVCLADKNGKPFNVVLDGKPYPSCTDASVIGQ
FT                   QAITWATLLGTAPEATLRIQLLDGVAPRRLRLRASRVVIGQFGTADAAINGHRLSPNSF
FT                   TTGAANYLATPMCDPTLKTAQLERFSSHGGGLMLFDNDGRALTRPVLDGKPDIVGPDGA
FT                   SSVFFGSPPKDGDRGFGVYNLNCRYYPEYPYQFFGTSAAAPHLAAVAALMRQAVPKATP
FT                   EQLYNALRKTAVDMGSPGRDNATGAGFVQPERALRELVRQAFGQSRVFDPSGQ"
FT   gene            633987..634220
FT                   /locus_tag="RPSI07_mp0484"
FT   CDS_pept        633987..634220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0484"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34828"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34828.1"
FT                   /translation="MNARGEARSRSVYLVWPRKPLNKASAEDGIGEMERGHMEVEPMLE
FT                   ADARLANAAGGSCPCRCLIEQVSCTCPAGFLH"
FT   gene            634313..635344
FT                   /gene="paaA"
FT                   /locus_tag="RPSI07_mp0485"
FT   CDS_pept        634313..635344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaA"
FT                   /locus_tag="RPSI07_mp0485"
FT                   /product="subunit of multicomponent oxygenase, phenylacetic
FT                   acid degradation"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10766858, 11260461, 9748275; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34829"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34829.1"
FT                   /translation="MYTQSLDLPGGVPTEQELAAASRDEAALQTRFDARIAADQKIEPQ
FT                   DWMPAPYRKTLLRQISQHAHSEVVGMLPEGNWISRAPSLKRKAILVAKVQDEAGHGLYL
FT                   YSAAETLGSSRDEMIDALHAGRAKYSSIFNYPTLSWADVGVIGWLVDGAAIMNQVPLCR
FT                   CSYGPYARAMIRICKEESFHQRQGFESLLTMMRGTRAQRDMVQDAVNRWWFPVLMMFGP
FT                   PDNASPNSAQTMAWGIKRISNDDLRQRFIDATVEQARVLGVTLPDPGLRWNAARGHYDF
FT                   SPLDWTEFKRVLDGHGPCNRERLATRQRAHDEGEWVREAALAHARKRAAHNATSAAPTE
FT                   QAA"
FT   gene            635356..635643
FT                   /gene="paaB"
FT                   /locus_tag="RPSI07_mp0486"
FT   CDS_pept        635356..635643
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaB"
FT                   /locus_tag="RPSI07_mp0486"
FT                   /product="subunit of multicomponent oxygenase, phenylacetic
FT                   acid degradation"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10766858, 11260461, 9748275; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34830"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34830.1"
FT                   /translation="MDQHEWPLWEVFIRSKQGLEHKHCGSLHAVDARQALQMARDVYTR
FT                   RQEGISIWVVPSAAITASEPDDKPMLFDPMADKIYRHPTFYRLPDEVNHM"
FT   gene            635647..636459
FT                   /gene="paaC"
FT                   /locus_tag="RPSI07_mp0487"
FT   CDS_pept        635647..636459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaC"
FT                   /locus_tag="RPSI07_mp0487"
FT                   /product="Phenylacetic acid degradation protein paaC"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10766858, 9748275; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34831"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34831.1"
FT                   /translation="MAMQSTNDAHLRYVLRLADSALILGQRNAEWTGHGPVLEEDIALS
FT                   NLSLDLIGQARLLYTHAGRLEGALTGMPRNEDDYAYWRDEPAFRNYTLLELPHAGPLCG
FT                   TAASRRDYAVTIVRHFLYAALMVPLWEALAASADAELAAIAAKSVKEMRYHLAHTRDWL
FT                   VRFGDGTAESHARAQAALDWLMPYTNEFFVTDEVEDAVADAGIGVRPAQVRGTWAATVR
FT                   DTLDEATLTWPEAGPYVSTGKHGIHSEHMGYLLAEMQGLARQFPGATW"
FT   gene            636453..637007
FT                   /gene="paaD"
FT                   /locus_tag="RPSI07_mp0488"
FT   CDS_pept        636453..637007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaD"
FT                   /locus_tag="RPSI07_mp0488"
FT                   /product="Phenylacetic acid degradation protein paaD"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10766858, 11260461, 9748275; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34832"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34832.1"
FT                   /translation="MVAGYAFPTQADAQADTARLARARAALDTVTDPEIPVVSIAELGI
FT                   LRDVRIDEVGTLAVTITPTYSGCPAMDQIADDVTRALQAAGVGAFRVQTALSPAWTTDW
FT                   ITAQGRRKLHHFGIAPPAHVVAAGAAQPIRLVRPADADRVACPQCGSLDTVLVSAFGST
FT                   ACKALYRCRACREPFDYFKPY"
FT   gene            637022..638113
FT                   /gene="paaE"
FT                   /locus_tag="RPSI07_mp0489"
FT   CDS_pept        637022..638113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="paaE"
FT                   /locus_tag="RPSI07_mp0489"
FT                   /product="phenylacetic acid degradation protein with
FT                   NADP-linked, 2Fe-2S ferredoxin-like and riboflavin
FT                   synthase-like domains"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10766858, 11260461, 9748275; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34833"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34833.1"
FT                   /translation="MTPQFHPLRVAEVRGETADTISLRFDVPADLREAYRFTQGQFLTL
FT                   RVPAGEAGRGELRRSYSICCAVQDYDAHGELRVAIKRVDAGVFSNHLHDRIRVGQTLDV
FT                   LPPDGRFYVPLAAESARHYVAFAAGSGITPVLSLIKTTLAAEPHSRFTLVYGNRTVDSI
FT                   IFAEALEDLKDRYLDRFALYHVLSRQPQEIALFNGRLDGDKARAFLDTLIPPDDIDAAF
FT                   VCGPSTMIDAVEAALLARGVPRERVHAERFGVPVGDASARPRKPSAVAGDVALTVVLDG
FT                   KSHHVPMAGDAKVLDSALAAGLDLPYACKGGVCCSCRAKVLEGRVEMEKNFTLEDWEIR
FT                   RGFVLTCQARPLTARVVVSYDER"
FT   gene            complement(638133..638636)
FT                   /locus_tag="RPSI07_mp0490"
FT   CDS_pept        complement(638133..638636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0490"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34834"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34834.1"
FT                   /translation="MKRLIPIATLFLATSNPAKAAALTPSVTLSHIASVGAKQAILEYY
FT                   DTPRWDAIVQGIASGKDDWLRVYEALRRSADAAAGEDLGEAIYDALPLRPFEVLSLLSA
FT                   ESGGTPQQLCTLTFESKRPADGVGAYLDRLDQALNQASSKAQREAASACRLGIEATRKA
FT                   FTKR"
FT   gene            638693..639025
FT                   /locus_tag="RPSI07_mp0491"
FT   CDS_pept        638693..639025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0491"
FT                   /product="conserved hypothethical protein, UCP019302"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34835"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34835.1"
FT                   /translation="MIQPSSVFKDNLAQLPAIDGIDRIDLIDGNGAVVANIENKPGKQG
FT                   SLAVYHYLQQAFGTLDAKAAEHGLAVFAEHTADARNRPGAHPNVDRLLAIAAGVEALQI
FT                   SLVAKD"
FT   gene            639204..639314
FT                   /locus_tag="RPSI07_mp0492"
FT   CDS_pept        639204..639314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0492"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34836"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34836.1"
FT                   /translation="MFNRAGYRPGPRYIDVQWTHTDASEPARLVSELGEN"
FT   gene            complement(639340..639741)
FT                   /locus_tag="RPSI07_mp0493"
FT   CDS_pept        complement(639340..639741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0493"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34837"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34837.1"
FT                   /translation="MAFPVHLGKLIMIWLADTVLVLHALVVLFIVGGLIAILAGAAFKH
FT                   DWVRNRTFRLTHLAAIGVVATLALFDVPCPLTLLEDWLRTGAAGPQGFVQRWVSAWLYY
FT                   DLPAWMFAVAYVAFLLVVVVTWWRIPPRA"
FT   gene            complement(639814..640425)
FT                   /locus_tag="RPSI07_mp0494"
FT   CDS_pept        complement(639814..640425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0494"
FT                   /product="putative transcription regulator protein, TetR
FT                   family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34838"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34838.1"
FT                   /translation="MSRVKNEDEFELRRESVLDTAAEAFAADSYASVSMNQIAAACGGS
FT                   KSRLYHYYEGKEAILFDLLDRYTRRLADLVERAERDALHARLSARATLHLLIRTFLAEY
FT                   ATSRTRHVALLNDVKYLSPEQRDIVLAHERDVVAAVGRQLVAAYPGKVGEANRTPVTMM
FT                   VFGMMNWTFTWLKPDGPLSYEGYAEMVIDMLENGLGGGDA"
FT   gene            complement(640496..641101)
FT                   /locus_tag="RPSI07_mp0495"
FT   CDS_pept        complement(640496..641101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0495"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34839"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34839.1"
FT                   /translation="MSLAQQRDTAVRQTLAAIRAIAAQDGITHASLARIAERLQELAAR
FT                   ETLFPLDAFPPPPRDDADAASRYLLHADADQTFALYLNAINPGKTTPPHNHTTWAVIVA
FT                   LEGEELNRVYTRTDDGSDPDRATLALSREVVVRPGTPITFLDDDIHSIHVVGDRPTRHF
FT                   HLYGRALETLTGRVGFDLATGRVLNYNRNYMRPTQRVA"
FT   gene            641260..642909
FT                   /locus_tag="RPSI07_mp0496"
FT   CDS_pept        641260..642909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0496"
FT                   /product="Rhodanese-related sulfurtransferase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34840"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34840.1"
FT                   /translation="MSIPSIEPVTLKPWLHDGAEIALFDVREAGEFGEGHLLLATPVPY
FT                   SRLEIDAVRLAPRRSVRLVVVDADGGTLAALAARRLRDLGYGDVSVLRGGVAAWQAAGL
FT                   TVFKGVNVPSKTFGELAELAYRTPHITAAELVAWQRARKPHVLLDGRTVTEYRRMTIPG
FT                   AVACPNGELALRAHVLIPDDETPVVIHCAGRTRSIIGAQTLRNLGLPNPVYALENGTQG
FT                   WQLHGLTLEHGADRRYPETVDAPTCRRARRAAAELSRRFAVPSASAAAVRAEQEAGRRS
FT                   VFLLDVRTAEAFARGSLPGAVHAPGGQLLQATDQYVGVRGARLVVFDDDGIRAPVIASW
FT                   LRQMGHDAVVLDGGLSPANAAALAPVLPASASLSEPALAPAPVREIDAAALRSAIAHGQ
FT                   VLLIDLRSSAAYRAAHLPGALWVTRRRLAGDLRGVFGKDIVLIDDDPAISALAAIDLRE
FT                   LGIAGVHRLAGGVSAWRAAGHSLVATPDVPPDAERIDYLFFVHDRHEGNLEAARGYLSW
FT                   EIGLVAQLDAQERAGFAPGVPAVAQPAAVEVE"
FT   gene            642906..644129
FT                   /gene="metC"
FT                   /locus_tag="RPSI07_mp0497"
FT   CDS_pept        642906..644129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metC"
FT                   /locus_tag="RPSI07_mp0497"
FT                   /product="cystathionine beta-lyase, PLP-dependent
FT                   (beta-cystathionase)"
FT                   /function="1.2 : Aspartate family"
FT                   /function="1.5 : Serine family"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /EC_number="4.4.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8463265; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34841"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34841.1"
FT                   /translation="MSRDIASAGQALATRIVHAGRPVFRDGTAPVNVPVERTSTVRHAS
FT                   IASQHGVQARRQAGENVAGYGRHGSQTHRALEDALLALEGGARAFLVPSGLSAISLTFL
FT                   ALLSPGDHVVVTDSVYAPVRRLDAGLLQRLGIELSYVDPADGGLEAAIRPHTRLIYAES
FT                   PGSLLYEVYDLPAIARVARRHGVALAVDNTWASGILFRPLDAGADVSVLAATKYIAGHS
FT                   DVMLGAVIARTDAMAERIAAAHDVLGLTIGADDAYLALRGVRTLPVRMAQHGRNALRVA
FT                   QWLQAQPGVGQVFHPALPDDPGHALWKRDFRGANGLVSCVLDGADPHAAERVADALRLF
FT                   AIGASWGGYESLVTVVPPQRLADHARWAGGGAVIRLHVGLEDPDDLIADLAQALQHAHA
FT                   DALHAIGG"
FT   gene            complement(644159..644809)
FT                   /locus_tag="RPSI07_mp0498"
FT   CDS_pept        complement(644159..644809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0498"
FT                   /product="putative Cob(II)yrinic acid a,c-diamide reductase
FT                   (BluB)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="1.16.8.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34842"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34842.1"
FT                   /translation="MNATHRYAEADLAAVYRVIRERRDMRHFRPDPIEPALLERLLRAA
FT                   HLAPSVGYMQPWRFIRITDAALRTRIHALVDEERHRTAQALGQREDDFLRLKVEGILDC
FT                   GEVLVAALMDKREPHIFGRRTLPEMDLASVACAIQNLWLAARAEGIGMGWVSMFDPQQL
FT                   GQLLHLPAGARPVAVLCLGHVDAFYDRPMLEQENWAHRQPLESMLFENSWEAD"
FT   gene            complement(644806..646122)
FT                   /gene="cobB"
FT                   /locus_tag="RPSI07_mp0499"
FT   CDS_pept        complement(644806..646122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobB"
FT                   /locus_tag="RPSI07_mp0499"
FT                   /product="Cobyrinic acid A,C-diamide synthase"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12195810; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34843"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34843.1"
FT                   /translation="MAAPSDAVRHCPALFLSAPASHQGKTTLTAGLARHHRNQGRTVRV
FT                   FKTGPDYLDPDILERASGQPVYSLDLWMTGEADCRQRLYAAAADADLILIEGAMGLFDG
FT                   TPSSADLAEAFGVPVLALIDASAMAQTFAAIAHGLATFRPALPFYGVLANRVASPRHAE
FT                   LLTAALPTGLRCFGTLARDDAMTLPERHLGLVVAQEIDDLEQRLEHAAAHIAATGLADL
FT                   PPPIAFAPACAEPVPPLLSGTRIAIARDAAFSFLYPANLELLARLGAELRFFSPLADAA
FT                   LPEADAVYLPGGYPELHLDALSANHAMRAALHAHAKAGKPLYAECGGMLYLADTLTDAA
FT                   GHRGTMAGLLPGTATLHTRLAGLGLQSVDLGNGELRGHTFHYSSLQTPLAPVVRARRAN
FT                   GAGSAAPGEAVYRHGSIVASYLHAYFPSNPTAAARLFRP"
FT   gene            complement(646125..646727)
FT                   /gene="cobO"
FT                   /locus_tag="RPSI07_mp0500"
FT   CDS_pept        complement(646125..646727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobO"
FT                   /locus_tag="RPSI07_mp0500"
FT                   /product="Cob(I)yrinic acid a,c-diamide adenosyltransferase
FT                   (Cob(I)alamin adenosyltransferase) (Corrinoid
FT                   adenosyltransferase)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.5.1.17"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34844"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34844.1"
FT                   /translation="MKTDPAAHQRMTERRKAGFEKKKAAATEEKGLLIVHTGTGKGKSS
FT                   AAFGMGLRVVGHGMRLGVVQFIKGALHTAERDLLGRFDNCDFLTMGEGYTWNTQDRDAD
FT                   IATARKGWDEARRMIESGDYDMVILDELNIVLKYDYLPLDEVLAVFAARPAGLHVVVTG
FT                   RHAPEALLDAADLVTEMRLVKHPYREQGIKAQRGVEY"
FT   gene            complement(646787..647890)
FT                   /locus_tag="RPSI07_mp0501"
FT   CDS_pept        complement(646787..647890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0501"
FT                   /product="putative cobalamin biosynthesis protein (cobW)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34845"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34845.1"
FT                   /translation="MTPRIPVTVFTGFLGAGKTTLLSNLIRDNKQRRLAILVNEFGEVS
FT                   IDGALLRGDGAPGGAEVHDLSNGLIAYDDDADFLPTMQALWQRRGTIDHVLIETSGLAL
FT                   PSAVMESLQSEALAPYFVLDATLAVVDTPLLLSGGFDHAADGTAAQTPVASLFEQQLAN
FT                   ADIVVLNKIDALDEDAQLDAEARVRALAPSVRFIELAFDARLDTRLTLGLRLHEPASTA
FT                   HRHYGPMATLPGLNLRPLANQRLLDGHSHSGLSAHSHGLATHKHFHERDPGWQSFMIRS
FT                   QDAQDADTLRHAVAAITRSEPILRAKGFARAGAGRVLIQAVRNRVEARLEPDAAPPKQA
FT                   QLVFIGYHPSRPRVAEQLRELTGTDWR"
FT   gene            complement(647895..649454)
FT                   /locus_tag="RPSI07_mp0502"
FT   CDS_pept        complement(647895..649454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0502"
FT                   /product="putative bifunctional: precorrin-3
FT                   methyltransferase and precorrin-6x reductase oxidoreductase
FT                   protein (cbiJH)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.1.1.131"
FT                   /EC_number="1.3.1.54"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34846"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34846.2"
FT                   /translation="MSGKLYLVSVGPGTRELIPPMVKAALDASEVIVAYDLYLTWIAPW
FT                   ITAKDIRTLPLTQERGRAELAIDEARAGRTVALISSGDIGIYAMAALAFEAMAEDDTFE
FT                   VQVIPGITSANACASLLGSPLSHDFATLSLSDLLCPWAWIETRARHIAQADLAVVLYNV
FT                   QSRQRQEGVYRILDILLEHKRAETLCGIVHNAYREGQTTEIVTLAELRTRRFDMLTSLV
FT                   IGNRFTRRKRGWIYTPRGYGNWDDAPDTVTAARLPAHAVWVFSGTSDGNALARDIAATG
FT                   QAVVVSSASDYGAALAEQRCPGVAVVAGRLGIERRRELLRGSAAHAIVDATHPYAADMS
FT                   RQLIQLAQELALPYLRYERPGDAQVAPAQRAASMEDAARLAMQRGRRIFLATGSKDLAA
FT                   FVNADATGQHAWFVRVAPDPAHLQRAIDAGIPRARLVAMQGPFSQAANEALWRDWGIDC
FT                   VVTKDSGDAGGYHAKAAAAAALGIPLIVVDRPAIDYPAVAQDFAGVLAQLANLAGPKNV
FT                   EA"
FT   gene            complement(649451..650215)
FT                   /gene="cbiG"
FT                   /locus_tag="RPSI07_mp0503"
FT   CDS_pept        complement(649451..650215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiG"
FT                   /locus_tag="RPSI07_mp0503"
FT                   /product="Cobalamin (Vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34847"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34847.1"
FT                   /translation="MKPTAIWLVRADGLPLAQRLARALDAEVYEPWEIPHASPRELFRH
FT                   AFAHHRRWIMVAATGIAVRYLDGLPRNKLTDPAVVVLDEAARFAIPLLGGHEGGANALA
FT                   YEVARLTGSTPAITTATEARKPLTLGIGCRRGKSMEAIGRAVMAALSQRALADVREIAT
FT                   IDLKADEPGLLAFCARHGLPLRVIARSDVAARGWTEAPSGWVRKHVGVDGVCEPCALIA
FT                   SPRGQLIVPKTVLDGVTVAVVEDNPAWKETAQ"
FT   gene            complement(650212..651021)
FT                   /gene="cobM"
FT                   /locus_tag="RPSI07_mp0504"
FT   CDS_pept        complement(650212..651021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cobM"
FT                   /locus_tag="RPSI07_mp0504"
FT                   /product="Precorrin-4 C(11)-methyltransferase (Precorrin-3
FT                   methylase)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.1.1.133"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2211521, 8501034; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34848"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34848.1"
FT                   /translation="MKVYFIGAGPGAADLITLRGARILGSVPVVLYAGSLVPPEMLQHC
FT                   RPDAERHDTAALSLDEQEACYRRAQAEGKDVARLHSGDPAIYGATAEQMRRLEALGIDY
FT                   EIVPGVSSFTAAAAVLGSELTRPAVSQSIVLTRVSGRASAVPELESVARFAEHQATMCI
FT                   FLSGQRLKQTVADLLLHYPADTPVALVRRATWPDQAIHRSTLGTLLSEVSQKDWLLTTL
FT                   LLVGRALSREGGVESSLYAAGFTHIFRDGTDRKTPRRSRRKAGKETA"
FT   gene            complement(651018..651749)
FT                   /locus_tag="RPSI07_mp0505"
FT   CDS_pept        complement(651018..651749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0505"
FT                   /product="putative precorrin-2 c20-methyltransferase
FT                   protein (cobI)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.1.1.130"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34849"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34849.1"
FT                   /translation="MTALGRFIGIGVGPGPAGLIPVAALEALNAADLIYLPRARGSEVS
FT                   VARQCLAGLAVPETKLREIAFEMDPDRSVLSQHYAELAGAVAAELCAGHNVAYLTIGDS
FT                   LTYSTYGYLLAALRDALPALEHVTFPGVTSFAAVASALSWPLGEGKERILILPCPDDME
FT                   ALRTDIASHDIVVLMKIGARLPAVLELLGEMGIAQHCAFARRIGLPGEVLCDDVRGLSA
FT                   DASGYLATMLIRRTAREKRHA"
FT   gene            complement(651746..652897)
FT                   /locus_tag="RPSI07_mp0506"
FT   CDS_pept        complement(651746..652897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0506"
FT                   /product="putative cobalt-precorrin-6A synthase
FT                   [deacetylating](cbiD)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 9742225; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34850"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34850.1"
FT                   /translation="MQPPARRPFDLAALAPNGLRRGRTTGACATAAVKAALLRLVRGET
FT                   VDAVEVSLPDPDYYLEVPIARVMPLAGGAVRADVLKFAGDDPDNTDGATIFAEVSVNHA
FT                   GEVRFVAAQGVGTVTQPGLRVPPGEPAINPVPRQMMCMAVDEVLAGGANPGFDLAIGCV
FT                   DGERIARRTFNPMLGIVGGISILGTSGIVEPMSLAAWMASIEVYVRVALGDAPEAIAFT
FT                   PGKIGRAYAAHTLALSKKQVVQIANFVGASLDYAQTALEEDRHRLGTLWVLGHPGKLAK
FT                   VLDGVWDTHSSKSGMAMGSVAAVAAELGFAAVLVEQIKTANTVENVIQILQHQPGAQAF
FT                   WREIEQRIAALMQPKVPRADRVAVRLFAMDGTPLGAAHQETGA"
FT   gene            complement(652900..654495)
FT                   /locus_tag="RPSI07_mp0507"
FT   CDS_pept        complement(652900..654495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0507"
FT                   /product="Putative precorrin-8X methylmutase (CobH/CbiC)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34851"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34851.1"
FT                   /translation="MKTADDSTHCADYAIVLAGHGSRDPDGVDEFMALVALLRERAGER
FT                   TVAHGFLEFATPTIDEAVDAVVAAGAKTVVMVPGVLLAATHAKNDMPSELLALKQAHPE
FT                   VDFRFGAAMDLHPKLLALCRERIVEAEGRSAQTVSRADTCLVVVGRGTSDPDANSEIAK
FT                   LARMLEEGMGFGTSFVCYAGTARPLVADGLKAAALLGYRRIVVLPYFLFDGVLVKRIYS
FT                   AADDLAARHPEIEMLRAPYLGVHPHVADVFLERAREGIEGRAAMNCALCKYRVQIVGFE
FT                   EQVGTPQQGHHGLVRGLLGRNGTPPAPATDWPPYVPHPIEAESMRIIDAGRDWSGVPAD
FT                   HQIVLKRLVHTSGDFDIVDDLYFSPGAVETGIRALLRCRRIVADVTMVQTGLKRAVLDQ
FT                   LSVETWCGVHDEETRLLAEAHGITRSAAGIRRAWQKFGNDVVVAIGDAPTAILELVRLV
FT                   REHGWRPQLVVGLPVGFVGTRESKEALRRLMQVPRITNRGTRGGSPWAASAVNALMIAA
FT                   IDQVYRQNQTQQQA"
FT   gene            complement(654492..655199)
FT                   /locus_tag="RPSI07_mp0508"
FT   CDS_pept        complement(654492..655199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0508"
FT                   /product="putative precorrin-6b methylase methyltransferase
FT                   protein (cobL)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="2.1.1.132"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34852"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34852.1"
FT                   /translation="MIICIGAGPGDIGYLPQRSVDLIRHADVVAGFNAVVDVVRPLIPS
FT                   TAQVVQMGYRDQVAQLDEVARLHHAGKRCVVVFMGDIHFSGFQYLERVERACGHPVETV
FT                   PGISSAQILASRAKVCFDETSFITFHRRGDLTPFKRHLVHVLQDQRNAIVIPCPWDAAR
FT                   SFMPWHIAAYLLENGIPPEHRVEVWERLTRSEAEWHGSLAACADQRFSDMSIMLIRTLH
FT                   PMASQIEPPPEAA"
FT   gene            complement(655636..657540)
FT                   /locus_tag="RPSI07_mp0509"
FT   CDS_pept        complement(655636..657540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0509"
FT                   /product="putative magnesium chelatase subunit"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /EC_number="6.6.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34853"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34853.1"
FT                   /translation="MKHPYPFSAIVGQEQLKRALLLCAIDPTLGGVLIRGDKGTAKSTA
FT                   ARGLTDVLPPITRVAGCAFNCAPDAPLAECEACQSGNAAHASAPVPFVNLPLGATEDRV
FT                   LGHLDIERALKDGRKAFQPGLLAAAHRGLLYIDEVNLLPDHLVDVLLDVSAMGHNTVER
FT                   EGLAMRHPARITLLGTMNLEEGDLRPQLLDRFGLMVEVTAPRDAAVRTEVVRRRLAFEA
FT                   DPASFAAAWQADTDALRARLAAAQAMLAQVTLPDTLFAFVSTLCCEFEVASLRADIVMH
FT                   KAARALAALDGRPEVTAEDVRDAAELVLPHRRRRKPFEQSGLDRERLDELMRQAAPPPP
FT                   QSTGTEMDAAPSEDHSGDTAPADGAAEQVFAAGPAATVGRIEVTARQAHDAGGRRSLAT
FT                   GTRRGHAIGAVPNEAPSRLAVDATLRHALLRNPADFSVTRADLHEKVHAGRQGNLILLV
FT                   ADASGSMAARRRMEMVKASVLGLLQDAYQRRDQVALICFRGEQAELVLPPTRQVELAER
FT                   ALAALPTGGRTPLAHALQLAAQTLAQPSDLTPLLVVISDGRANIALDAEQDPWREALAL
FT                   AGHLAARGTPALVLDTEQDYVRLGRARELAQALQADCLPLDHLSGEQLTLTIRERVRG"
FT   gene            complement(657537..661634)
FT                   /locus_tag="RPSI07_mp0510"
FT   CDS_pept        complement(657537..661634)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0510"
FT                   /product="putative cobalamin biosynthesis protein (cobN)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="6.6.1.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34854"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34854.1"
FT                   /translation="MSALSHGGIVLLTHAGTDLSTLQRATAQLPDGFASVSGIHLQTID
FT                   RDARMADLLAGPVADARIVIVRVLGRLQAIPGIDALIHDARAQGRALVIVSGTGEPDPE
FT                   LAARSTVPPSLQQEVAAYLQAGGTGNLAQLLRCLSDRLLMTGFGYQPPMALPEHGIYHP
FT                   ELASPATLEDWAAIRNPAWPTVGITFYRAHWLCGNTRFIDLLVDALAERQLNALPVYTA
FT                   SLRTLDASGMPAALGVFADDGIGRIDALVNTTSFAMGDVNADGPTAAGWSVAAFERLDV
FT                   PVIQAIASSMTQAQWAASERGLNPLDTAMNVALPEFDGRIVSVPMSFKDEHDETAYAPL
FT                   PDRVRRVAGIAARQVALRRTPVADKRIAFLFTNSSSKASQIGNAVGLDSPASLLALLGA
FT                   MQAQGYRIDGLPESGDALIHALIDRGAYDEDYLSADQLAQAVATVPAARYAAWFSELPA
FT                   PLQDTMRQRWGDAPGNAYVHDGKLVFAGMEYGNAFVALQPPRGYGMDPDAIYHTPDLPP
FT                   THHYYALYRWLRDEWRADAIVHVGKHGTLEWLPGKGVGVSETCFPDALLGDLPLFYPFI
FT                   LNDPGEGSQAKRRAHAVIIDHLTPPMTTADTYGPLAQLTQLVDEYYQVEMLDPAKLPLL
FT                   QQQIWDLIKEARLDADLAAMLKHDHDHHHEHEHGHEHGHGHAPAEPARVSGGTYRPATP
FT                   KAAGANRYRPVSAKAHHPHHHGHHHGHHGHGHGHEHEHEHEHHHHHDHDHEWDATLNAD
FT                   GVPLSLAKMDGVDVAHLIEDIDGYLCELGAAQIRDGLHVLGRVPAEDALVDMVCAMVRL
FT                   PNLGVPSLPASVAEALGLAWDTLQHDKGKRLEAVSPPLRRLADRPLVTRADALDAVSAL
FT                   TRALVAALAERGFDATQPDAVLDSVLPGIADTGALRQTLAFVCRELVPNLARTSEEIGN
FT                   LLHGLAGGYVPAGPSGAPTRGMAHVLPTGRNFYSVDPRSLPSQAAWRIGTALAGEVLAR
FT                   HRKETGHDPESVSISVWGTSAMRTHGDDIAQILALLGVRPRWQAESRRVAGIEVIPLDE
FT                   LGRPRIDVTVRISGFFRDAFPHLIHLVDEAVHTVARLDEPVERNFVRKHYLADLAHQLF
FT                   AGLPREAAEQRTLYRVFGSKPGTYGAGILPLIQEQHWQDDADFAQAYVNWGGYAYGRCD
FT                   NGTDARADFRHRLSGVEIALHNQDNREHDIFDSDDYLQYHGGMIATIRSLTGRQPRQYF
FT                   GDSHNPDHPAVRSLKEETLRVFRSRVANPKWIAGIQKHGYKGGLELTATVDYLFGYDAT
FT                   AHVVDDWVYEQLAQTYAFDPAMQQFLAESNPWALNAITERLLEAIQRQMWAEPKPDTVA
FT                   ALQALHLRSEAMLEARGETTER"
FT   gene            complement(661631..661960)
FT                   /locus_tag="RPSI07_mp0511"
FT   CDS_pept        complement(661631..661960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0511"
FT                   /product="putative ferredoxin protein"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34855"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34855.1"
FT                   /translation="MRTHHKHVLMCTGPRCTQDGAEAEALFKVLGQTIDACEGLRVKRT
FT                   RTHCFAVCKQGPLMVVYPDGVWYRNLDTASVRRIVDEHLAGGQPVEDRIFHRTGLGDVE
FT                   PEPQP"
FT   gene            complement(661957..663030)
FT                   /gene="hoxN"
FT                   /locus_tag="RPSI07_mp0512"
FT   CDS_pept        complement(661957..663030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hoxN"
FT                   /locus_tag="RPSI07_mp0512"
FT                   /product="High-affinity nickel transport protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34856"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34856.1"
FT                   /translation="MASPLSRPRLRHLIAQHRAPISQLLLLIIANLAAWAWALAAFAGH
FT                   PELLGTALLAYLFGLRHAVDADHIAAIDNVVRKLMQQGKRPFSVGFFFSIGHSALVVLG
FT                   VAIIVRATSALNDRIGTFKEIGGMISTGISAFFLLTIAVTNLVILVGTWKRFLLVRNGG
FT                   TLAEADLDMLSAGNGLLARLFRPMFRLVTKSWHMAPLGFLFGLGFDTATEIGLFSVSAG
FT                   HASDGIPPSAVMVFPVLFAAGMALIDTLDSVLMVGAYGWAFVNPVRKLWYNLTITSVSV
FT                   LIAFGIGGIEALGLLARQLELSGGFWDRVASLNEGLAHFGYLMIGVFVLAWAVSACIYK
FT                   WKGYDSLPHPAQGAPLP"
FT   gene            complement(663126..663305)
FT                   /locus_tag="RPSI07_mpmisc_RNA_2"
FT   misc_RNA        complement(663126..663305)
FT                   /locus_tag="RPSI07_mpmisc_RNA_2"
FT                   /product="Cobalamin"
FT                   /inference="profile:Rfam:8.1"
FT   gene            complement(663368..664222)
FT                   /locus_tag="RPSI07_mp0513"
FT   CDS_pept        complement(663368..664222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0513"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34857"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34857.1"
FT                   /translation="MSSPDLLPLDTPAAATPLVALRDLHLTFGQTAVLRGIDLDVHRGQ
FT                   AVSIIGPSGSGKSTLLRCISGLLRPQRGSVTVDGIRVDQLATEAETIALRKRIGFVFQQ
FT                   YNLFPHLCVLDNLTAAPVRVLGRARQDAEADARALLEKVGLADKARAYPGQLSGGQQQR
FT                   VAIARALAMRPELILFDEVTSALDPETVGEVLNVIGGLVGEGLTCVLVTHEMAFARAIS
FT                   DTVYFTERGVIVEHGPADRLFTSPASERTRAFLSRALSGHHAARPATHAPWHAAFSSTA
FT                   FAV"
FT   gene            complement(664209..664892)
FT                   /locus_tag="RPSI07_mp0514"
FT   CDS_pept        complement(664209..664892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0514"
FT                   /product="Amino acid ABC transporter, permease protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34858"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34858.1"
FT                   /translation="MPDSLLATLLHWAPALLRGLSINIGISLLAVGLGTVAGLAVGTLH
FT                   LSPLRPVRRLARWYVIALRNVPWLVLVYGMSYAVPFEIVLRGHVLPFPDWLKVTLALAL
FT                   PASAHVAEIFRGAVLSIPSTQWEAAASLAFGRREILWRIVLPQCVRRMLPSWMNLYAVI
FT                   TMGTALASLVGVHDLLDTAQIASNTVNRTPFTVVTYFTVLGLFFLYCYPIARLTRRLEH
FT                   RHVVA"
FT   gene            complement(664885..665670)
FT                   /locus_tag="RPSI07_mp0515"
FT   CDS_pept        complement(664885..665670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0515"
FT                   /product="amino acid ABC transporter, permease protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34859"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34859.1"
FT                   /translation="MADDLLLRAIALVRHTGLDYGFLAEAYERAALLNAAKLSLLVMLC
FT                   TVVLSLVCGVGLAVLLISPCRWVARLAQGFVELTRNTPTLVQLCCAFLVVNTLITQGLA
FT                   HWGLANPLTPLFWAVAILSLHKAAFHAEALRAGIEAVPPAMLEAAASLGFSARERLWRV
FT                   QLPLAFRAALPSLMNNTVELVKASSLASAIAVGELTYSTLMIWTQRDNLLECMVLLLLF
FT                   YGTVTYAVHAGGVWLEHRLRMPGYGAAAGTHTGSALGHA"
FT   gene            complement(665683..666516)
FT                   /locus_tag="RPSI07_mp0516"
FT   CDS_pept        complement(665683..666516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0516"
FT                   /product="high affinity periplasmic solute-binding protein;
FT                   high affinity transport system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34860"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34860.1"
FT                   /translation="MPIHAPWFRRAAIAMAAGTFAAAAHADVTLDKIHQRHKLVVGVVL
FT                   SGGPFGSIDPATQRAVGFNVDLAQALGRGLGVEVETVQVQPSNRIPFLQQGRVDILVAS
FT                   MELNPERAGLLAHVPTPYYRVGGVALVPKDSPVRRWSDLKGKEVCLSQGSSYAKPLAAE
FT                   IGATPKGFKSPAESLLALRGSNCAAAVHDATLLQPLPRANPEWKDYRVVGPDLIPAPTV
FT                   IWARKGERDTVAALDRIVQGWHRDGWLIETEKKNGILPPSPALVEWHDKLKAGRG"
FT   gene            666960..667934
FT                   /gene="rfaC"
FT                   /locus_tag="RPSI07_mp0517"
FT   CDS_pept        666960..667934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfaC"
FT                   /locus_tag="RPSI07_mp0517"
FT                   /product="Lipopolysaccharide heptosyltransferase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8478319; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34861"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34861.1"
FT                   /translation="MTSLGDVIQTLPVVTDIRRAFPGVEVDWAVDESCADVVRMSPGIS
FT                   RVLSAPLRRFKKTRSPADLKAILALAVALRRYRYDAVLDLHGVYKSAIVSFLARARWRF
FT                   GYRNPDLGERGAMFAYNRRFGPRPACNAWHGMRISAGEALGYMPQGFADYGIVARRGGE
FT                   PTQLRHSTGTPYALFFHATSKDDKKWPPGHWAGLAREMLAGGLRVLLPWHSAAELREAL
FT                   RIAALAPGAAVMPRMSIAELTHKIDGAAAVVGVDTGLVHMAHAMKKPTVMIFLATSRDH
FT                   CGIAAPRSLSIGEQGWVPGVDDVLGGLARVFPEFGSSKASIAA"
FT   gene            complement(667995..669122)
FT                   /locus_tag="RPSI07_mp0518"
FT   CDS_pept        complement(667995..669122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0518"
FT                   /product="putative acyltransferase transmembrane protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.3.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34862"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34862.1"
FT                   /translation="MNRSSASLQSIQALRGFAALYVVVFHSGLALTHPDVPALAWLTTH
FT                   VIKRGHVGVDVFFVISGFIIAWVAILGPKGPEPPGAFLVKRAFRLGPPYWLMSVLHSAW
FT                   LNPVSTSVLLTSLAFLPQANADAPYFGYPALYVGWSLNYEAFFYLLCALGLALFGRRAL
FT                   WLVALALFTTTVIVPFWHSGVVLGDPEALYPWATPLQAMAANPLVLEFLLGAGLAWLYA
FT                   AHRHRLTPARARLLLLAGVIAFVASVIGPVPKFDLVLRGLPAGALLAGLVAMEHCGALR
FT                   VPRVAVWLGELSYALYLVHPSVIEGTHRLVGVLAPEWLGAQLMHFSVNLALTLLAAALL
FT                   HRYVEQPSIALGHKSVAWLRGWGHAWRARLGPLKP"
FT   gene            complement(669276..669707)
FT                   /locus_tag="RPSI07_mp0519"
FT   CDS_pept        complement(669276..669707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0519"
FT                   /product="conserved hypothethical protein, DGPFAETKE
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34863"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34863.1"
FT                   /translation="MRFMVLRLADPDTEAGVMPSEDLFAAMGQYMEALANAGVLLGGEG
FT                   LHPSAAGARVEFRGGKPSVIDGPFAEARELIAGYAILQVKSLEDALECCKRWPALDGGG
FT                   NVQLEIRRIYEAEDFGAAFTPEEREREERLRAELAARQP"
FT   gene            670146..670451
FT                   /locus_tag="RPSI07_mp0520"
FT   CDS_pept        670146..670451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0520"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34864"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34864.1"
FT                   /translation="MKTSVSPSPAVASLARDAAGDAQVAFEQLHEYKSHTITVRPRRMS
FT                   GGLWMAAFAVSLDGWPLVAVGTEAGKAFRTPIGAARDAVDAARSFIDARLQTRRSA"
FT   gene            670486..670641
FT                   /locus_tag="RPSI07_mp0521"
FT   CDS_pept        670486..670641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0521"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34865"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34865.1"
FT                   /translation="MERQQLFAIAIVIAAVSAAYSLARDLNDDEGDFPPGRAVLVSGHA
FT                   APVAKR"
FT   gene            complement(670676..671200)
FT                   /locus_tag="RPSI07_mp0522"
FT   CDS_pept        complement(670676..671200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0522"
FT                   /product="putative transcriptional regulator, AsnC/Lrp
FT                   family"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34866"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34866.1"
FT                   /translation="MKKIATKFRAAPTTQPQASALSTLDRTDRAILKWLQRDASISNVA
FT                   LAEKVNLSPPACLRRVERLKTLGCIQGVVALLDPKALDLGTLVMIGVVLDRSTPESFAD
FT                   FEKAVQKVPGCLECHVVTGEFDYFMLVRTRDNDSYNRLHAEQLLYLPGVRQIRTFMTLK
FT                   QVLSTTQLPIA"
FT   gene            671345..672361
FT                   /gene="acdS"
FT                   /locus_tag="RPSI07_mp0523"
FT   CDS_pept        671345..672361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdS"
FT                   /locus_tag="RPSI07_mp0523"
FT                   /product="1-aminocyclopropane-1-carboxylate deaminase (ACC
FT                   deaminase) (ACCD)"
FT                   /function="5.6 : Nitrogen fixation"
FT                   /EC_number="3.5.99.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12902221; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34867"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34867.1"
FT                   /translation="MNLNKHPRHPLTFGPTPIQPLKRLSAHLGGKVELYAKREDCNSGL
FT                   AFGGNKTRKLEYLMPEVLAGGYDTLVSIGGIQSNQTRQVAAVAAHLGLKCVLVQENWVN
FT                   YSDAVYDRVGNIELSRILGADVRLDTAGFDIGIRPSWEQAMEDVRRAGGKPFPIPAGCS
FT                   EHPLGGLGFVGFAEEVRQQEAELGFRFDYIVVCSVTGSTQAGMVVGFAADGRADRVIGI
FT                   DASAKPEKTREQILRIARNTAKLVELGRDITEDDVVLDTRYGGPEYGLPNEGTLEAIRL
FT                   CARQEGMLTDPVYEGKSMHGMIDMVRNGEFPEGSRVLYAHLGGVPALNAYSFLFRNG"
FT   gene            complement(672420..673592)
FT                   /locus_tag="RPSI07_mp0524"
FT   CDS_pept        complement(672420..673592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0524"
FT                   /product="putative enoyl-coA hydratase"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34868"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34868.1"
FT                   /translation="MHALLKPAEPATAVEPEVLFRVVNRVAIITLNRPAALNALSHGMV
FT                   RQLSVLLAQCRDDAGIAAVVLRGAGEKGFCAGGDVRALHQLARQGKAHGHDGWLQFFVD
FT                   EYRLDYALHQFPKPVVALLDGISMGGGMGLGQGARLRVVTERSRIAMPETRIGFLPDVG
FT                   ATHFLGVMPPEMALYVGLTGATLSGADALHCRLADLCVPAEWLASFEDRLQRLSHTGDQ
FT                   GDLMQALRRVFEPPCNIVPHAALARVAPWILRYFDRRSTIDRIVATLRESLERDPAREA
FT                   RQWLQATLDAMTTHSPTMLHVTREALLRGRQLTLAECFRMELGIVARAIEEGDFCEGVR
FT                   AHLVDKDHRPGWAPATLAQVRPERVRHFLSSPWRGTAHPLARLGAQRQAA"
FT   gene            complement(673577..674392)
FT                   /locus_tag="RPSI07_mp0525"
FT   CDS_pept        complement(673577..674392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0525"
FT                   /product="putative enoyl-CoA hydratase/isomerase (paaF)"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="4.2.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34869"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34869.1"
FT                   /translation="MMIELETLHDHTVALLTLKRPPANAFTPEGLLQLQSTVATLNADP
FT                   RVRALVITGDGPKFFSAGADLNTFADGDRDVAREAAARFGAAFEALQNARPVVIAAING
FT                   YAMGGGLECALACDIRIAERHAQLAVPETAVGLLCCGCGTQTLPWLVGEGWAKRMILTG
FT                   ERVDAQTALRIGLVEEVVDTGAAREAALAMARRVTTLSPQAVTFSKTLIHQARNGVPRT
FT                   AALAVERERFVDLFAHPDQREGVNAFLEKRTPRWHATATQEEVLQCTPY"
FT   gene            complement(674389..675282)
FT                   /gene="mmsB"
FT                   /locus_tag="RPSI07_mp0526"
FT   CDS_pept        complement(674389..675282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsB"
FT                   /locus_tag="RPSI07_mp0526"
FT                   /product="3-hydroxyisobutyrate dehydrogenase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="1.1.1.31"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1339433; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34870"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34870.1"
FT                   /translation="MKIAFIGLGNMGAPMARNLLKAGHALNVFDLNAQAVQSLVDAGAN
FT                   AAGSPKAAATGVDCVITMLPAAAHVRSVLTADDGILAGIPKGVPIVDSSTIDPDSAKSL
FT                   AALAAGHGNPLVDAPVSGGTGGAAAGTLTFMVGGSAAAFEQVRPVLSAMGKNLVHCGGT
FT                   GAGQGAKICNNLVLGITMAGVAEAMSLGEALGIDPKVLGGIINTSTGRCWSSDTYNPFP
FT                   GVIETAPSSRGYTGGFGTDLMLKDLGLAGDAAKSARQPVYLGALAQQLYQAMSSKGAGK
FT                   LDFSAVIQLYRQEGAA"
FT   gene            complement(675304..676851)
FT                   /gene="mmsA"
FT                   /locus_tag="RPSI07_mp0527"
FT   CDS_pept        complement(675304..676851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mmsA"
FT                   /locus_tag="RPSI07_mp0527"
FT                   /product="methylmalonate semialdehyde dehydrogenase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="1.2.1.27"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1339433; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34871"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34871.1"
FT                   /translation="MSAVASLSPVSPAGHPRTLPTVKLLIGGEWVESRSTEWREVVNPA
FT                   TQAVLARVPFATRDEVDAAIRSAHAAFATWKHTPVGARMRIMLKYQALIREHLPRIART
FT                   LTAEQGKTLPDAEGDIFRGLEVVEHACSVGSLQQGEFLENVAGAVDTYTLRQPLGVCAG
FT                   ITPFNFPAMIPLWMFPMAIVCGNTFVLKPSEQDPLSTMLLVELALEAGVPPGVLNVVHG
FT                   GKDVVDALCTHEHVKAVSFVGSTAVGTHVYRLAGEHGKRVQSMMGAKNHAVVLPDANRE
FT                   QTLNALAGAAFGAAGQRCMATSVVVLVGAAQQWVPELVEKARTLKVNAGVEPGTDVGPV
FT                   VSRAARQRILGLIESGVRQGATLALDGRNVRVAGYEDGNFIGPTVFTGVQTDMDIYRNE
FT                   IFGPVLLVLTAPTLDEAIALVNRNPFGNGVGLFTQSGAAARKFQSEIDVGQVGINIPIP
FT                   VPVPYFSFTGSRGSKLGDLGPYGKQVVQFYTQTKTVTARWFDDAVEAGGVNTTISLR"
FT   gene            complement(676924..678627)
FT                   /locus_tag="RPSI07_mp0528"
FT   CDS_pept        complement(676924..678627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0528"
FT                   /product="putative acetate--CoA ligase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="6.2.1.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34872"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34872.1"
FT                   /translation="MNDVAPAAQGFLEARDLLLRYRTDYERAYREFRWPVLDTFNWALD
FT                   YFDVIARGNDQPALWIVDDPHGEGLRLSYAQMSERSSRVANFLRGLGIVRGDRLLLMLP
FT                   NRVELWDVMLAAMKLGAVVLPATTQLSPDDVRDRVQLGGATCVVADAAERAKFDTVDAG
FT                   VKRIAVGARHDGWIDLAEAYSAPAGFVPDGPTRATDPLLLYFTSGTTSKPKLVEHTHQS
FT                   YPVGHLSTLYWIGLQPGDVHWNISSPGWAKHAWSCVFAPWNAQACVFVYNYARFVPRET
FT                   LEVLVRCNVTTLCAPPTVWRMLVQEPLASYPVKLREIVGAGEPLNPEIIERVRQAWGVT
FT                   IRDGFGQTETTCQIGNTPGQPVVPGSVGRPLPGYRVELVDADDRPATEGEIVLPLSHRP
FT                   LGLMQGYANNAKATAEAMRNGYYHTSDVAMRRDDGYFVYVGRTDDVFKSSDYRLSPFEL
FT                   ESVLIEHEAIAEAAVVPSADPLRLSVPKAFVTLRQGYEAGPELARAVFRFSREKLAPYK
FT                   RIRRLQFSELPKTISGKIRRVELRRRELERLPDPARLPGEYWEEDFSDPR"
FT   gene            complement(678688..679821)
FT                   /locus_tag="RPSI07_mp0529"
FT   CDS_pept        complement(678688..679821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0529"
FT                   /product="putative Butyryl-CoA dehydrogenase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number="1.3.99.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34873"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34873.1"
FT                   /translation="MDDFYTDEQRMILDAARDFATERLAPHAAQWDRDGNLPDDVVAQM
FT                   GELGLLGMIVPPEWGGAYTDYVAYALALEEIAAGCAACATMMSVHNSVGCGPILKFGTD
FT                   AQKARYLPDLATGRAIGAFCLTEPQAGSEANNLRTRAVPRDGHWVLNGSKQFVTNGARA
FT                   RLAIVFAVTDPGAGKRGISAFIVPTDTPGFQVGRPEHKLGIRASDTCPITLDDCAVPQA
FT                   NLLGEPGEGLKIALSNLEGGRIGIAAQAVGIARAAFDAARHYANERIQFGKALREHQTI
FT                   ANMLADMATRLNAARLLVHHAARLRSADKPCLSEASQAKLYASELAEEICSKAIQIHGG
FT                   YGYLADYAVERHYRDARITQIYEGTSEVQRMVIARHV"
FT   gene            680062..681090
FT                   /locus_tag="RPSI07_mp0530"
FT   CDS_pept        680062..681090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0530"
FT                   /product="putative transcriptional regulator, AraC family"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34874"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34874.1"
FT                   /translation="MKNDEKGTISMSLVAEALARARARGLDAQPLIAAAGITPQMLASP
FT                   RSRVSSAQYGALWSGIAQALDDEFFGQDSHPMRSGSFVAMTQAALTARTGRQALQRATG
FT                   FMRLVLDDLAVQVEADAQRVRLTFMHRPGTPEPAMFTYATWFIMVYGLVCWLVGRRIPL
FT                   IAARLRCPAPPAEQEYRLMFCDDMAFGQPVSCVDLSPVFLDLPVIQTAASIKSFLRGAP
FT                   GSFIVKYRNPDAFAARVRKMLRVLPVAAWPASDAMALRLNVAEATMRRRLKLEGHTYQS
FT                   IKDDLRRDIAINALQDTRQTIADIAAAVGFAEPSAFHRAFRKWTGMRPTDYRDARKAGG
FT                   KA"
FT   gene            complement(681143..682543)
FT                   /gene="copS"
FT                   /locus_tag="RPSI07_mp0531"
FT   CDS_pept        complement(681143..682543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copS"
FT                   /locus_tag="RPSI07_mp0531"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CopR, regulation of copper
FT                   resistance, senses copper ions"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="12.3 : Protein interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8449873; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34875"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34875.1"
FT                   /translation="MTRRLSLTTRLTAFFSLCSAAVLLGLGVVIALAMEQHFAVEDFTA
FT                   LGENISVIEKIVESSPAPRVAERIRDALQHRTDFVARILDPDRRTLYASDGFDFRVAGE
FT                   AQARARPGNGRLVWEQSGQQYRAMHTTVALRDGTAGRLDILVAMNTDIHAHFLHTFRGT
FT                   LAFYIALAAVASGIFGWWAARRGLAPLRTLASRARTVTSDKLDERMPVDTVPAEVADLA
FT                   ITLNAMLERLQHDFRRLSDFSTDIAHEIRTPITNLLTQTEVVLSQPREGAKYRDVLTSN
FT                   AEELQRLARMVADMLYLAKMEHSLTLPSAEDIHLADELRALFEFYDALAEDQTVQLQLR
FT                   GDGRVTGDRLMLRRALSNLLSNAIRHTPPRGTVLVSIADTGHGVTVSVDNDGDAIPPQV
FT                   LPLIFERFYRADKSRARPESESAGLGLAITKAIVVAHGGSIAVSRAEGRTRFAIHFARR
FT                   PEADAALH"
FT   gene            complement(682540..683226)
FT                   /gene="copR"
FT                   /locus_tag="RPSI07_mp0532"
FT   CDS_pept        complement(682540..683226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copR"
FT                   /locus_tag="RPSI07_mp0532"
FT                   /product="response regulator in two-component regulatory
FT                   system with CopS, regulation of copper resistance"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8449873; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34876"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34876.1"
FT                   /translation="MKLLVVEDEAKTGEYLQQGLTEAGFVVDLARNGVDGLHLAMTGDY
FT                   DLLVLDVMLPDLDGWQIVQSLRAAERAVPVLFLTARDSVGDRVKGLELGADDYLVKPFA
FT                   FAELLARVRTLLRRGSTPVALDRIQIADLVLDLARRRASRSGQRIALTSKEFALLELLA
FT                   RRRGEVLPRSLIASQVWDMNFDSDTNVIDVAIRRLRAKIDDDFAPKLIQTVRGMGYVLE
FT                   DPEDAA"
FT   gene            683433..685259
FT                   /gene="copA"
FT                   /locus_tag="RPSI07_mp0533"
FT   CDS_pept        683433..685259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="RPSI07_mp0533"
FT                   /product="CopA Copper-resistance transmembrane precursor,
FT                   Cupredoxin domains"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1924351, 8449873; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34877"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34877.1"
FT                   /translation="MRMNHASGLLLPSLPRRRFVQGLAAGGVIAGLGLGGIAPSSAAAG
FT                   ATALGTAPVLRGTEFDLVIDETPVNFTGKPAMATTINGMLPGPTLRWREGDTVTLRVTN
FT                   RLREPTSIHWHGILLPFQMDGVPGISFHGIAPGETFTYRFKVRQSGSYWYHSHSGFQEM
FT                   TGVYGGLIIDPAGGDPIRADRDYTVLLADWTDEDPMRILSRLKTQSDYYNYHQPTVVDF
FT                   FRDVANDGWQAALDKRRMWNQMRMSPTDLADLSAATLTHLTNGVTPAGNWTGLFSPGET
FT                   VRLRFINGAGNTFYDVRMPGLKLKVVQVDGQDIEPVTVDEFRFGPGETCDVLVAPKDDA
FT                   YTIFCQSMDRTGYARGTLAVRPGMQAAVPAPDKPQWLTMTDMMGDMGGMAGMSGMDHGG
FT                   MTMMDAGDITPMAPMDTGGMTMMDGTGGTDDLRVPGKKVRHARTEYGPGTDMRVDTPRT
FT                   NLDDPGIGLRGNGRRVLVLADQHTIGGPLDRRGPRREVEMHLTGNMERYTWSIDGVEYG
FT                   RSTPIHFRYGERLRVILHNDTMMTHPMHLHGMWSELEAPDGRFLARRHTLPVQPAQRIS
FT                   FLVTADALGRWAWHCHLMLHMDAGMFREAVVS"
FT   gene            685286..686257
FT                   /gene="copB"
FT                   /locus_tag="RPSI07_mp0534"
FT   CDS_pept        685286..686257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copB"
FT                   /locus_tag="RPSI07_mp0534"
FT                   /product="CopB ATPase, Copper resistance protein B
FT                   precursor"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number="3.6.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11696373, 8449873; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34878"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34878.1"
FT                   /translation="MTPLTSRHARALLAAALAAAGIGMASAQEIPLMAAGEGGGATGAA
FT                   PAPASPPGEHSAMPGMDHGAMQMDHGSMSMQGGSAPPDARDPHADSDGYRLGVGQYALG
FT                   ETRHLMMADEHTFTSVLVDRLEWAHGNGANATSYDAQAWFGTSYDKLVLKAEGDIHKGR
FT                   VEEARTELLWGHAIAPFWDTQLGLRNDAGTGRPGRNWVALGVQGLAPYWFHLEATAYVG
FT                   DSGRTALRLSSEYELLLTQRLILQPRLEASFYGKRDPALEIGSGLASGTLGLRLRYEFS
FT                   RQFAPYIGVERSQAFGGTAGMIEAAGGRRGETRFVAGVRFWF"
FT   gene            686300..686686
FT                   /gene="copC"
FT                   /locus_tag="RPSI07_mp0535"
FT   CDS_pept        686300..686686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copC"
FT                   /locus_tag="RPSI07_mp0535"
FT                   /product="CopC Copper resistance protein precursor, ''E set
FT                   domains'' superfamily"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1924351, 3372485, 8449873; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34879"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34879.1"
FT                   /translation="MFTMSRAAKATVAACAALAASSVFAHAKLVSSTPADKSVGAAPAK
FT                   IELHFSEALVPQFSGANLVMTAMPGMADHGAMKVTAKVSGGDDGKTMVITPAQPLVPGA
FT                   YRVDWRAVASDTHAVSGNVSFEVK"
FT   gene            686691..687620
FT                   /gene="copD"
FT                   /locus_tag="RPSI07_mp0536"
FT   CDS_pept        686691..687620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copD"
FT                   /locus_tag="RPSI07_mp0536"
FT                   /product="Copper resistance protein D"
FT                   /function="15.5 : Detoxification"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3372485, 8449873; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34880"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34880.1"
FT                   /translation="MADDGLSVALRFALYLDLMLVFGVALFGLRALRPEDRTAAIARRY
FT                   VRVIVVSVAAGIVLSLWSILVMAKAMTGAAEYAELTRHVFGMILTATAFGLAWTARMAA
FT                   LAACLSAVAVLRRRPTARFAVLATLGATALATLTWSGHGAMDDGARGVLHAASDIAHLL
FT                   AAGAWVGALVAFVLLSSARQMSAPGAVAMLSRASNGFAGLGTVIVATLAVTGVANYLFI
FT                   VGPTVDGLITTAYGGLLLAKLALVALMLGLAAANRFRLSPRLAAAVRSADEAGAVRALR
FT                   ASLVTEACLGVLILGLVAWLGGLSPAGA"
FT   gene            687701..688093
FT                   /locus_tag="RPSI07_mp0537"
FT   CDS_pept        687701..688093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0537"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34881"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34881.1"
FT                   /translation="MKKIQSVSAESASERIDARIEELGDWRGQMLCRIRALIKEADPEV
FT                   VEAWKWRGIPVWSHNGLICTGETYKNVVKMTFAKGASLADPSGLFNASLEGNTRRAIDL
FT                   HDGDALDEAALKALIRAAVALNCQCR"
FT   gene            complement(688330..691440)
FT                   /locus_tag="RPSI07_mp0538"
FT   CDS_pept        complement(688330..691440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0538"
FT                   /product="putative Acriflavin resistance/Multidrug efflux
FT                   transporter AcrB"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34882"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34882.1"
FT                   /translation="MSMNISSWSIRNPVPAVLCFVLLTVFGLLGFHKLQIQDFPDMDLP
FT                   TINISASLEGAAPSQLENEVARKIEDKLTSLSKLDHVTTKITDGAVSISVSFKLEKDPQ
FT                   AALSEVRNAVDGARASLPAEMAAPTVSKSDAAASALLTYAASSTAMDEQDLSWFVDNEL
FT                   SKALLSVKGVSKVERIGGIDREVRIDLDPALMAGMGLTAETVSTQLKAMQRDRSGGQGD
FT                   IGGQRQSSRTLVGVGSVQDVAALTITTGDGRRVRLDQIARVTDGAADRSAYAYLDGKPV
FT                   IGVQITRAKGNSDVTVLHEVRRTVAAFAAAHPQVKLTEASNTVAPIEDNYEGSMSMLIE
FT                   GALLAIVVVWWFLRDGRATLVSAAALPLSIIPTFGVIWLLGYSLNVVTLLALSLVVGIL
FT                   VDDAIVEIENIERHLRMGKTPFQAAMQAADEIGLAVIATTFALVAVFLPTAFMSGIPGL
FT                   IFRQFGVTASVAVLMSLLVARLLTPMMAAYLMKAASHIDHDSARMTRYLRWVRACLTGR
FT                   RRTMLAVGVFLVLSVAMVAVLKTGFMPLQDKSQTQVKLELAPGATLEQSRTTVLRAEAL
FT                   IRQVSEVKGVFASVGSATDTTGMGGTSSTADVRSSTLIVDLVPRGERGRKQPAVEDAIR
FT                   AKLRDLPGVRVSVNNGGNGEKLQITLAGSDAGALESAASALETQLRMLHGIGNVTSSAA
FT                   LQRPEVQFRPDPARAASLGVTAEAAADAIRIGTYGDYSTSLPKLNLPERQITLRARIDP
FT                   ALRQDLDAIGQLRVAGTHGSVTVASVGTLSIGSGPSQIDRIDRERNVTLSVELNGRTLG
FT                   EVNREAQQLSALAHLPAGVHQVEQGELQNMGELFQSFGLAMAIGVFCVYAVLVLLFHDF
FT                   LQPATILCALPLSLGGALFSLLVTRMSFSMPALIGLLMLMGIVTKNSILLVEYAIMARR
FT                   EHGMRRLEALMDACHKRARPILMTTIAMGAGMLPNALGLGAEPSFRQPMAIVVIGGLLA
FT                   STLLSLLVIPVVFTYVDDFEQWLRRRFRRTAAAEATDLPRALGSDAR"
FT   gene            complement(691437..692558)
FT                   /locus_tag="RPSI07_mp0539"
FT   CDS_pept        complement(691437..692558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0539"
FT                   /product="putative Secretion protein HlyD"
FT                   /function="16.4 : Excrete"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34883"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34883.1"
FT                   /translation="MKLNRLNRRAAALAAVLIVAGVAAWKFVPGAPAQTAPQAKPAALT
FT                   VSLVAPQTFDWPDTIEANGSTAAWQEAIISAETGSLRITELLVDVGSEVKRGQLLARLA
FT                   DATATADLRKQEAAVAQARANLQQAQADLKRSQQVADSGAVSAQKLDEYRITEAVDRAA
FT                   LASAEAELQNKRTTLSQTRIVAVDDGIVSSRSALLGNVVGAGTELFRLIRQGRVEWQAE
FT                   VDAQQLARVRAGQAARVTLPGGKTIDGKVRLVSPTLSTNTGRAIAYVALNGRDAQPGMF
FT                   ASGTMELGARPALTLPESALVPRDGRTDVYVLNGDGATVSRRTVVAGRRRDGRCEIVSG
FT                   LEAGVRVVSTGGGFLSDGVTVKVLQANANGVRA"
FT   gene            complement(692555..694003)
FT                   /locus_tag="RPSI07_mp0540"
FT   CDS_pept        complement(692555..694003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0540"
FT                   /product="RND efflux transporter, outer membrane
FT                   lipoprotein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34884"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34884.2"
FT                   /translation="MEQNRTRRPWLAAMASSLALCACALQPSYQAPQAVAATGWQAELP
FT                   HGGKVDNLVGWWEHFDDPAVAELVRMAEAGSPTLAKAVARINGARATLASSNAGAWPSL
FT                   TGSGSVTRAKSAVALGGATVSGLTTTRSASADASWEIDLFGKQRSARESSQAQLDARID
FT                   DWHDARVSLAAEVADDYVQYRACRQLARAYAQSAASYAQTENATRAAVGAGMSSASDGY
FT                   LAQASTASARATATQQNVACEELVKSLVALTGADEPTLRGVIDRTGAPELPEPAAFRVT
FT                   SLPADLVRQRPDLASSERALASTYADIGQARADRFPSLSLSGSLTISATNLAAPTSSWS
FT                   FGPSLSVPLFDAGKRRAAVDSAQASYDAQLAAYRSAVLTAVKEVEVALVDLDGAARRSD
FT                   DARRAAEQYRLYERAAQANWRAGFDTLLTLEQARRSLTSAEITHIELQRDRVRSWIALY
FT                   KALGGGWQADGAPSAHASSQGTTS"
FT   gene            694178..694873
FT                   /gene="cpxR"
FT                   /locus_tag="RPSI07_mp0541"
FT   CDS_pept        694178..694873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxR"
FT                   /locus_tag="RPSI07_mp0541"
FT                   /product="two-component response regulator transcription
FT                   regulator protein"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11830644, 20011345, 3058985, 8294007, 9159398, 9401031,
FT                   99395032; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34885"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34885.1"
FT                   /translation="MIPVLLVDDDAELTAMLVQYLAHEGFAAEVAHDGEAGVAGALSGR
FT                   FAIVVLDVMMPRLSGIDALRRIRAASRVPVLMLTARGDDIDRISGLNLGADDYVPKPCT
FT                   PGELVARLRAILRRVPAAGTGDASVANGPIHAGPLALWPSSRRATWQDAPLDLTGTEFS
FT                   LIEILARHAGRLVSKEDISQQAFDRPLARFDRRIDVHISSIRQKLGQRPDGQPWIISVR
FT                   GMGYQLLTD"
FT   gene            694884..695975
FT                   /gene="cpxA"
FT                   /locus_tag="RPSI07_mp0542"
FT   CDS_pept        694884..695975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpxA"
FT                   /locus_tag="RPSI07_mp0542"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with CpxR"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2185221, 3058985; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34886"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34886.1"
FT                   /translation="MSLRLGRLFWRGFVMLWLAMVAAFACAGLYMHASGHKPPSPGAMP
FT                   WILLVPVLSGATVALPVAFGLAWHLSKPLRHLTQALRDAARARFDVRVLPALGSRRDEF
FT                   TDLAREFDNMAARLQQASMQQRQLFHDVSHELRSPLARIQAAIGLMQQDPQSSPAMAER
FT                   VAREAQRLDQLIEELLTLHKLEAGAMSPARERVDVIELLADIVQDAAFEAQARGCAVTL
FT                   DAPGSFVAEVAGEPLYRALENVVRNAVKYTAAHTAVEVHARTLEPLQAGSDRAEWLEIR
FT                   VSDRGPGVPAESCEDIFEPFRRLEPPQRDAAAQSVPGVGLGLAIARRAMALHGGDIRAA
FT                   PREGGGLVVSVCLPRLALRSTQL"
FT   gene            complement(696111..697010)
FT                   /locus_tag="RPSI07_mp0543"
FT   CDS_pept        complement(696111..697010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0543"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34887"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34887.1"
FT                   /translation="MLDGVSLDQLRAFIATVDAGSFSAAARKLRRAQSMVSGLVANLED
FT                   QLGVALFDRSRRYPQLTTEGTVLLADARSVVGGIDGMKSRAKGMTKGLEPELCVVVDVF
FT                   FPIQMISEVAKAFRERFPMVPLRLYVEALGGAYQPVLDGRASVGIVGSLPTVPASLTAE
FT                   KLTTVGFVMVAAQDHPLAALRGPIAKEQLARHTQLVLTDRSDLSAGREFGVFSGLTWHL
FT                   ADLFAKHAFLLSGLGWGGMPLHAVQADLDAGRLVELQIDEVPPGGLSMQMSAAYPTASP
FT                   PGPAGRWLIERLRDCPSS"
FT   gene            697192..697596
FT                   /locus_tag="RPSI07_mp0544"
FT   CDS_pept        697192..697596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0544"
FT                   /product="Conserved membrane protein of unknown function,
FT                   similar to DoxX protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34888"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34888.1"
FT                   /translation="MNKHSSTIAAIGRIVIALIFIMSGFSKLGTADATQGYIASVGLPF
FT                   PAVGYLIAVLTEIGGGLLLLIGFRTRLVAAWLAAFSVATAIFFHHNFADQNAMIHFLKN
FT                   FMMAGGLLQIVAFGATKLSLDARRVMALAN"
FT   gene            697640..697810
FT                   /locus_tag="RPSI07_mp0545"
FT   CDS_pept        697640..697810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0545"
FT                   /product="putative 2,5-didehydrogluconate reductase
FT                   (fragment)"
FT                   /function="15 : Cellular processes"
FT                   /EC_number="1.1.1.274"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34889"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34889.1"
FT                   /translation="MTIVCATGARIPSRGLGTDGMRGKALAGIVAAAVRAGFRHIDTEG
FT                   LSEPSHFGPST"
FT   gene            complement(697961..698593)
FT                   /locus_tag="RPSI07_mp0546"
FT   CDS_pept        complement(697961..698593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0546"
FT                   /product="putative NADH dehydrogenase/NAD(P)H
FT                   nitroreductase"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34890"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34890.1"
FT                   /translation="MDKRLSDEGMDLLFRQARTHNRWQAKPVSDDTLRELYELMKWCPT
FT                   SANCSPARILLLRTQEAKQRLLPALAPGNIDKTMSAPVTAIIAYDGKFYDKLPKLFPHA
FT                   DARAWFADTPELAEVTARRNSSLQGAYFMLAARSLGLDCGPMSGFDHAKVDHEFFPAAG
FT                   QTRGFEQEYFPDSHIKTNFLCNLGYGDPAGLFPRSPRLDFDEACKLL"
FT   gene            699028..699633
FT                   /gene="azoR"
FT                   /locus_tag="RPSI07_mp0548"
FT   CDS_pept        699028..699633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="azoR"
FT                   /locus_tag="RPSI07_mp0548"
FT                   /product="FMN-dependent NADH-azoreductase"
FT                   /function="19 : Unclassified"
FT                   /EC_number="1.7.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34891"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34891.1"
FT                   /translation="MKLLHVDSSILGQGSVSRDLSADVVATFRDRHPDLAVTRLDLAAT
FT                   PIGHLTAAHLAAAQGAPIDDALKSDVAIGQLALEAFLAADIVVIGAPMYNLGIPSQLKA
FT                   WIDRISVAGKTFRYGEHGPVGLCGGKKLVIASSRGGIYSEGSPAAAFDHQETYLKVAFG
FT                   FLGITDITFIRAEGVAMGPDARSGAIASAKKETAALAA"
FT   gene            complement(699088..699933)
FT                   /locus_tag="RPSI07_mp0547"
FT   CDS_pept        complement(699088..699933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0547"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34892"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34892.1"
FT                   /translation="MPGFVRTGFPGMGHQEHAVCSGKRGFKRFRTIEIHQDDFVTQLRM
FT                   LGRIARQRAYVELTARLQRAHHGAALLTGCADDGDALPGVRHGCVPVRIGWSRATSRSE
FT                   RGSLFLRRGDGPTACVRTHRHTFRANEGDIRDAEKAEGHLQIGFLMIEGGGGRAFAVDA
FT                   AARGGDDQLLAAAQSDRAVLPVAERLPGDGDAVDPGLQLRGNAKVVHRCADDHDVGCQE
FT                   CLERELADGNVGLQCIIDRSALCGRKVCCRQMANRCGGKVETRDRKVGVSVTEGRDDIR
FT                   "
FT   gene            699673..700038
FT                   /locus_tag="RPSI07_mp0549"
FT   CDS_pept        699673..700038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0549"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34893"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34893.1"
FT                   /translation="MSNTRKRIAVVGATGQQGGAVVRALQASGQFNVRALTRNPAKHPE
FT                   LGDEVVLVDFNRPETLEAAFAGAHGVFLVTHSWEAGADEPRHSRDAIALANTVAGQQPT
FT                   QFAAWAKASFASLESIP"
FT   gene            700035..700904
FT                   /locus_tag="RPSI07_mp0550"
FT   CDS_pept        700035..700904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0550"
FT                   /product="Pirin like protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 2b : Function of strongly homologous gene"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34894"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34894.1"
FT                   /translation="MNAVIQIPPAPLVGVGRHVIFRTRGHAHGPVVRMVSPADVGKMIK
FT                   PFVFLDLIDTQEAIGQQGFGWHPHSGIATLTLAMEGQGRYIESIGHEGTMVAGDIEWMS
FT                   AGRGVWHSGFAVPPVKAFQLWVALPPERELAPAFSQHLSVNDIPSDGPARVLLGRSGEA
FT                   VSPIDAPPGINYFVVQLKAGQRWTYQPPGGYRVGWIAVMDGRLCTPDPVDKGELAVFDP
FT                   SDAAIAFEAVTDARFVLGMAIPHPHDLHLGHYSVHTSPAALIEGEREIERIGRELRAKG
FT                   VNRSPSWL"
FT   gene            700964..701473
FT                   /locus_tag="RPSI07_mp0551"
FT   CDS_pept        700964..701473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0551"
FT                   /product="putative NADPH-dependent FMN reductase"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.5.1.29"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34895"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34895.1"
FT                   /translation="MLDHLKKREGVDARLLDLKDYPMPFFDAPVPPAMPGRPAYEHEVV
FT                   KRWTQAIAASDGFVIVSPEYNHGTPAVLKNAIDWVYPEWRRKAVTFVGYGSVGGARAIE
FT                   QLREIAVEIQLAPIRSAVHVPAAAIYAHFQGQDVTPHLAALDAVAEQTIDDLLWWTQAL
FT                   KTARAS"
FT   gene            701484..701798
FT                   /locus_tag="RPSI07_mp0552"
FT   CDS_pept        701484..701798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0552"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34896"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34896.1"
FT                   /translation="MMHASRPSNSGSICVDRWSSMIDLPISPATLRASASATLALNSGY
FT                   HMAFLSGAIFAAAAGVLGGLLLRRGQSDGAGAQPAADSDDVTTAHPVPATGNAAATAHH
FT                   "
FT   gene            701862..702227
FT                   /locus_tag="RPSI07_mp0553"
FT   CDS_pept        701862..702227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0553"
FT                   /product="conserved hypothethical protein, NTF2-like
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34897"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34897.1"
FT                   /translation="MNNRIHELLDRNLQEVFGEGDATRRRAAIEALYTEDCVLYVPSGT
FT                   VVGHDALDKFAGDLRATHPHFVYTPHGEPQALHNAGRLAWGSGPQGGAPEYAGLDVIIV
FT                   RDGKIAALYVFLDSMPS"
FT   gene            complement(702368..704020)
FT                   /locus_tag="RPSI07_mp0554"
FT   CDS_pept        complement(702368..704020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0554"
FT                   /product="Thioredoxin-disulfide reductase"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /EC_number="1.8.1.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34898"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34898.1"
FT                   /translation="MIQQQTDGAEDRRHQIFPVLTPAQVDAARRFASGPPRHFTASEIV
FT                   FGTGERNVPVWLVLEGSIEVQRRDGLDEATPVTTHRVGQFTGEVSQIDGRASIASARAG
FT                   LDGATLLPFDPPHLRALMVGSAEVGEIVMRALILRRVRLIEHGGSGTILIGAPDDPHLL
FT                   RLQGFLTRSGYPNHVLDPRVDDEGRSFVERMALLPADLPLVVCPSGNLLKRPNERELAA
FT                   CLGIIPKIDQQKTYDVAIVGAGPAGLAAAVYGASEGLSVIVLDERAMGGQAGASARIEN
FT                   YLGFPTGISGQALAGRAFTQALKFGAEVAIPVCVERLERNQDRLTLKLSDDSTVTAHTV
FT                   VIASGAAYRRPDIAGLDRFEGFGVSYWASPIEARLCAGKEIALVGGGNSAGQAIVFLAP
FT                   HVKRLHVFVRRDLSETMSRYLIDRISALSNVEIHVGTDLTELTPNSDTLANATVRDRAS
FT                   GTFTHYAICHLFLFIGATPHTRWLNGSIATDDKGFILTGGSASSLETSMPGVFAIGDVR
FT                   AGSTKRVAAAVGDGAAAIAQIHSYLSKLKKEVA"
FT   gene            704264..704470
FT                   /locus_tag="RPSI07_mp0555"
FT   CDS_pept        704264..704470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0555"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0555"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34899"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34899.1"
FT                   /translation="MPGAGKPSCATVTHASDSRTLTMRAHERSGLLQHWRQYRVRPDTL
FT                   AELTARLLRRRAPTDFISRLGPG"
FT   gene            complement(704445..704621)
FT                   /locus_tag="RPSI07_mp0556"
FT   CDS_pept        complement(704445..704621)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0556"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34900"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34900.1"
FT                   /translation="MRNPFQNGAACNCSRPGSQSSAADSRFLQLTGPVLMKKQLDHGEE
FT                   PVEQVVNLVRVGK"
FT   gene            704657..704941
FT                   /locus_tag="RPSI07_mp0557"
FT   CDS_pept        704657..704941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0557"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34901"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34901.1"
FT                   /translation="MIRKTLNASRLQDEVNRRIHGIHEIIEDGVKIRVPRPQLQEPDET
FT                   GCNWTMKHFGNTAGYERVIAAVLKAVRAEYNLSSEAKTPGNPFEDVSGN"
FT   gene            complement(705157..705849)
FT                   /locus_tag="RPSI07_mp0558"
FT   CDS_pept        complement(705157..705849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0558"
FT                   /product="putative tyrosine phosphatase protein"
FT                   /function="13 : Signal transduction"
FT                   /function="11 : Protein fate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34902"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34902.1"
FT                   /translation="MFHWDDPAKGVDMQKSTTAQGKFFHATLKTLPLAALLTACSAIHN
FT                   PSTAPGIEGCLNFHEVEGTSGKLFRGGQPLDESEWNLLANNGIKTIIKLNRYSGSTDTD
FT                   ETEKMNAAKHGMMIIPIYMPPEDNSLAFWRAPDDSQTDKALTAISESTSHGATYVHCSH
FT                   GKDRTGLVIALYQMRVQHKCKAAAMKDLWDYGHSPWLWGITNRVKHEPEQPACIEGNPT
FT                   PPSVSSTR"
FT   gene            complement(706221..706859)
FT                   /locus_tag="RPSI07_mp0559"
FT   CDS_pept        complement(706221..706859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0559"
FT                   /product="putative isochorismatase hydrolase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34903"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34903.1"
FT                   /translation="MASEPIRDPANDHLLTPQNAAFVIIDYQPVQVNSIASMDRQLLVN
FT                   NIVGTSRAAVAYKLPIVHSTVNVKTGLNKPPIPQLRKVLGDFPTYDRTSINSWEDVEFR
FT                   EAVKATGRKKLIMTALWTEACLTFPALDALKEGYEVYVVVDAVGGTSVAAHEAALRRIE
FT                   QAGGKMISVAQLFCELQRDWSRSETVPAFIDLFIQTGGTAGIQFSYDRS"
FT   gene            707069..707353
FT                   /locus_tag="RPSI07_mp0560"
FT   CDS_pept        707069..707353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0560"
FT                   /product="hypothethical protein, bacterial regulatory
FT                   protein domain (LysR family)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34904"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34904.1"
FT                   /translation="MVEHGGLTRAGLALGMPKSKLSRRIAALEAQYGVRLLQRSTRHFS
FT                   VTEIGREWSSKRICATERSSTSCPARPRKGASFMRSFRLAEAWCRRCVC"
FT   gene            707818..709431
FT                   /locus_tag="RPSI07_mp0561"
FT   CDS_pept        707818..709431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0561"
FT                   /product="putative drug resistance transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34906"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34906.1"
FT                   /translation="MGLQSTAMALHTALPHSHAQVLPFKESLLAMLGICFVVVLVALDQ
FT                   TVVGTALPTVVAELKGFDLYAWVATSYLLTSVVTVPIFGRLGDFYGRKPFVVASIVVFT
FT                   LASVMCGMAGSMAFLVWSRALQGVGGGMLVGTAYACIADLFPDARVRLRWQVLLSAAFG
FT                   IANAIGPTLGGWMTQALGWRSVFYVNVPFGVLGLWFAWRFLPHLRQNLHAGRIRPDWQG
FT                   ALLITVALGALQLCVEWLPRYGLSLPVLGWLVLSVAAFAGLWWWEQRAEQPLLPFDMVR
FT                   NPALATLFVLAALSGFSMFALLFYAPLLFQGGFGMSPQQAGLVITPLVVCITLGSIING
FT                   RIVTRIPRPTVMLYAGFALLALALAGMAASSRATPQMALILLMLLAGLGLGFVLPNLTV
FT                   FAQQSAGRAHLGIATALLQSLRMVGGMIGTALVGTLVSERYAAGVGDALRADSATQWLH
FT                   RLADPEILIDHDAQTALLAQMQSAGHDGVALLGAARHVLVSAIHLGLIVATVVAVVGLW
FT                   RVRRVPPVALHHVEPVQAAE"
FT   gene            709611..710087
FT                   /locus_tag="RPSI07_mp0562"
FT   CDS_pept        709611..710087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0562"
FT                   /product="putative transcriptional regulatory protein,
FT                   MarR"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34907"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34907.1"
FT                   /translation="MTSERERFAVMHQFGRTYRAFMAAFEAYVGQPMPRWRIMLALHDH
FT                   TGGGLAQKQLAERLQMDPGALTRQLKVLEQLGWIERVTDARDNRLTNVSLSDAGLAVVL
FT                   ECMPRRVAFLNATLDGLPEDLVHALSEALALIETRIADVPVQLDTPVAESTETR"
FT   gene            710107..711078
FT                   /locus_tag="RPSI07_mp0563"
FT   CDS_pept        710107..711078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0563"
FT                   /product="putative Mg2+ transporter protein, CorA-like"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34908"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34908.1"
FT                   /translation="MPMVINSALYRNGRRERDLSVEAISDVLHSPGAFVWLGLHEPDDA
FT                   MLARVQEEFQLHDLAIEDASKAHQRPKLETYGDTLFIVLNTAQMEQGEVVFGETHLFVG
FT                   RDFLVSVRHGPSASYSPVRERCEHVPHLLAKGVPFALYAVMDFVVDNYQPVLESMQEAF
FT                   DAIEGQLFGDAFDRAAIEQLYRLKRQLLRLRNAALPVEDIASQLIRLHEDVVPKELRAY
FT                   FRDVADHAHRLVGALDVIREMLTTAISVNVALVSVTQNDIVKRLAGWGAILAIPTVVFS
FT                   NYGMNFKGMPELQHPAGYPIVLACTAVACVWLYRKLRRSGWI"
FT   gene            711088..711660
FT                   /gene="tag"
FT                   /locus_tag="RPSI07_mp0564"
FT   CDS_pept        711088..711660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tag"
FT                   /locus_tag="RPSI07_mp0564"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number="3.2.2.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3520491, 3536912; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34909"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34909.1"
FT                   /translation="MSRCCWVGEDPLMIDYHDTEWGTPSHDDRHLYEMLVLEGAQAGLS
FT                   WQTILRKRARYQEVFDGFDPARVARFTPARIETLLADPGIVRNRAKVEAAVINARKVLE
FT                   LQDEVGSLDGFLWAFVGGRPVVNRWNSYRDAPASTEASKAMSKALAARGFKFVGPTICY
FT                   AFMQATGMVDDHEAGCFRAGKAKVKSK"
FT   gene            complement(711670..712893)
FT                   /locus_tag="RPSI07_mp0565"
FT   CDS_pept        complement(711670..712893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0565"
FT                   /product="Putative CynX-related transport transmembrane
FT                   protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34910"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34910.1"
FT                   /translation="MPRQPQPTPSTLHDTAGRRSTGALVMLVAGLVLVGMNLRPALSSL
FT                   SPVLKQVAAGTGLSGATAGLLTTLPVVCLGVFAPAAAVLARRFGAERAVGGLLIALAAG
FT                   IALRSAGGIVPLFAGTLAAGACIGVTGILLPGIVKRDFGRQADLMTGVYTMALCLGAAV
FT                   AAGASAPLSALLGGWQPALAFWALPALLAFAGWWPHMRHPHAGGAAARIERVALWNRPI
FT                   AWQVMLYMGLQSSLAYCVFGWMPVILQDRGLSAVQSGMVVAVSVLLQLITALGGPFIAR
FT                   LGRDQRPAVLLMMLMSWAGLMGCLYAPVSTLWWWAVLLGLGQGGNFSVALSLIVLRSAD
FT                   ARVAGSLSAMTQGGGYTLAAAGPYLMGVLHDLTGGWAAMGWLFSAIALGALGSGVLAGR
FT                   NRTLHADS"
FT   gene            complement(712983..713867)
FT                   /locus_tag="RPSI07_mp0566"
FT   CDS_pept        complement(712983..713867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0566"
FT                   /product="putative NADP oxidoreductase"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34911"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34911.1"
FT                   /translation="MVSVSAEVSSVSVGWIGAGRLARALAVRASHAGVRCAGVASRTQA
FT                   HAASLAQVLAARPLDAQGVADQADWVFVTVPDDAIAAIATTVRWRPGQLVIHCSGAGER
FT                   DLLDPARQSGAATASFHPLFLFAGLPDDAERLGGASIAIDADAPHDAALADLARRLGCK
FT                   PLKVRPGQRALYHAGANYAASFLLCALHEAATLWQAAGIEREAAVAAMWPLVDGTLAAA
FT                   KSKGLAGALAGPVSRGDGGVIDRHLRALGTLGADHVALYAALTRRALALAAERGHPPAD
FT                   ILETLAARLPELQ"
FT   gene            714108..714305
FT                   /locus_tag="RPSI07_mp0568"
FT   CDS_pept        714108..714305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0568"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34912"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34912.1"
FT                   /translation="MQPSLPCLRSWGYGPTGGVERIVVIVVSSCCPAVCDAADDRLRLA
FT                   SGRATLGHAGPGRPMHHRGR"
FT   gene            714401..715969
FT                   /locus_tag="RPSI07_mp0569"
FT   CDS_pept        714401..715969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0569"
FT                   /product="putative outer membrane chanel lipoprotein"
FT                   /function="7.7 : Unknown substrate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34913"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34913.1"
FT                   /translation="MNPSRPAGTSWPAGLARRAVPALLVLALAACAVGPDYRAPQLAGV
FT                   EAPAGWHATLPHHGSRMMLARWWEQFHDTALTQLIEQADAGSPTLAQAVGRVREARASV
FT                   SSSQAALFPQLKGSGSAVRQGGFGGSQALGGTGGTGVSSTSLSPTLGLGTFTTLAASAD
FT                   ASWELDLFGGKRRSLEGADARLEASLADWHDARVTLSAEVANTYLQQRECEALVAIGET
FT                   TLASRQETLQLTERKFGAGFVAPADLAQAQATVADATNALESQRAQCAQGLDRLVALTG
FT                   LDHAALAAWLAPGKGRIPAPPDAGAPDVPAQVLSQRPDVSSAERAVAGASADIGVAVAS
FT                   RLPSLTLAGSIGINAFRISGQSLTSRSWSFGPSVSLPIFDGGSGAARVETARARYDQAL
FT                   AGYRAKVRQAVQEVEDALVRLDAAGRRLDAAAVADAQYAKVLQAASARYRLGAGSLLQL
FT                   EDVRRTTLSASQSLAAVQLERAQAWVALYKAVGGGWREDAAPAHATSPVPAPAAERRAP
FT                   IGNAS"
FT   gene            715987..717105
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0570"
FT   CDS_pept        715987..717105
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0570"
FT                   /product="putative transporter lipoprotein transmembrane
FT                   (fragment 1)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="PSEUDO:CBJ34914.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            717102..720191
FT                   /pseudo
FT                   /locus_tag="RPSI07_mp0571"
FT   CDS_pept        717102..720191
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0571"
FT                   /product="putative transporter lipoprotein transmembrane
FT                   (fragment 2)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="PSEUDO:CBJ34915.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            720226..721005
FT                   /locus_tag="RPSI07_mp0572"
FT   CDS_pept        720226..721005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0572"
FT                   /product="putative Enoyl-CoA hydratase/isomerase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="4.2.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34916"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34916.1"
FT                   /translation="MPDASVLFQTDGPVCTILLNRPACRNAVDGPTAAALLEAFERFVA
FT                   DDALRVAVLGGTGGHFCAGADLAALGDPARRNPLMPDGSAPGPMGPTRMALPKPLIAAV
FT                   SGYAVAGGLELALLADLRVVERDTVFGVFCRRWGVPLIDGGTVRLPRIVGMGRALDMIL
FT                   TGRAVHADEALAMGLASRVVEPGEALAAAQQLAREIAALPQQCMLADRASVYRQWDLPL
FT                   EAALRQEGAHGTPMVFAEGIAGAARFADGAGRHGAPG"
FT   gene            complement(721089..723359)
FT                   /locus_tag="RPSI07_mp0573"
FT   CDS_pept        complement(721089..723359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0573"
FT                   /product="hypothethical protein, Ankyrin repeat"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34917"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34917.1"
FT                   /translation="MTNPVSLVRSWLGSTATPGRAAKHAPAQKNDAGRLPRQAGSELSS
FT                   LTPRSPGRALPTITASPAPDRRAPARAPSDPELREAIKAVRSAADWSLNASGPGSPRAG
FT                   SARDEGQAPIRADGPPGDGWGMAFLRKAEAEVRQELLDMAWQHDFSSARMNEILAHAPD
FT                   LVNAVDHHGETLLIGALACSNFELAKALIARGADVNARDGHGNTPLHLAAGHDAALMRQ
FT                   LLEAGADPRATNKRGATPLFSARSAEVVNLLAHAGTPVDLCDKNGNSAVMWLAQAAKRD
FT                   TVLAMLAHNPDLGIRNKQGRTFARLLTARFGGMAHAIPKTAFAAKAFLELAKRETPLIG
FT                   DLRDRKPLSSSAGTAGMRRPQAPPRSASDLRVGPELRLSPRNARAAGKPAINDLKSGHK
FT                   INFVRDPLRTFDELNDRDVEAISEALGFGKLSTDHADTREQQRTAIRRTFAQFVKELNH
FT                   DLEDYDNAALEHPALNDPLSPEERDELMEAMKVAHIWIAATRVPGGDFEKPLRLRLFFG
FT                   GTQNFRDVRQDISSAFGRIADVDRAAKRAGELFAKILSHPDHVQLDFLGGASMGGAMAQ
FT                   AFRATVESRVLLPKQPSMILMDPQLLNNNQARRATKGGAIDVDYSRPRGVALTLDYSKA
FT                   PHRGLMGIMKGPGGYRYPGLVHIKLGLTDTDTDGEQGTRPKTSGPPGLGYHADPRQFVN
FT                   ALSRFSVDRHEAVLDDPAFDALRAPRWAPQQGPVRTSATLPAIARHGRRPMESIDEEDN
FT                   PGT"
FT   gene            724036..724719
FT                   /locus_tag="RPSI07_mp0574"
FT   CDS_pept        724036..724719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0574"
FT                   /product="putative lipoprotein, similar to Curli production
FT                   assembly/transport component CsgG"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34918"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34918.1"
FT                   /translation="MKQVSKVVSAGAAVVALGMLGGCATETSQALPVQKVESASRPYAG
FT                   VRAPIAVGKFDNRSAYMRGVFSDGVDRLGGQAKTILITHLQQTNRFNVLDRDNMDEIKR
FT                   EATIKNTAQKLKGADYVITGDVTEFGRKEVGDQQLFGILGRGKEQIAYAKVNLNVVNIA
FT                   TSEVVYSAGGAGEYKLSNREVIGFGGTASYDSTLNGKVLDLAMREAVTNLVNAIESGAW
FT                   TPGAQ"
FT   gene            724761..725129
FT                   /locus_tag="RPSI07_mp0575"
FT   CDS_pept        724761..725129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0575"
FT                   /product="putative lipoprotein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34919"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34919.1"
FT                   /translation="MMSKLFAMSRVAAGVAVGSALLAGCAGPKSLYQWEGYQPQVYEYF
FT                   KGESKEAQVAELERGLEKIKSANGAVPPGYHAHLGMLYSSLGKDDQMVQEFQTEKALFP
FT                   ESGAYIDFLMKNVKKGTN"
FT   gene            725129..725800
FT                   /locus_tag="RPSI07_mp0576"
FT   CDS_pept        725129..725800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0576"
FT                   /product="putative lipoprotein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0576"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34920"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34920.1"
FT                   /translation="MAKRFLKLFAAAGAAALMAGCAVPTKNVDYAAFKASKPHSIVVLP
FT                   PLNESPEVKATYGMLSQVTTPLAEAGYYVLPVALVDETFRQNGLTTAGDIHGVPVAKLK
FT                   DIFGADAALYVTITQYGTKYVLIDSVTVVAADAKLVDLKSGQTLWTGHASASSKDSGNS
FT                   VDVNAGGIIGVLVSAAVKQIVNSAIDSGYSVAGATSARLLSAGQPGGLLYGPRSPKYGT
FT                   D"
FT   gene            complement(725877..728207)
FT                   /gene="metE"
FT                   /locus_tag="RPSI07_mp0577"
FT   CDS_pept        complement(725877..728207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metE"
FT                   /locus_tag="RPSI07_mp0577"
FT                   /product="Cobalamin-independent methionine synthase,
FT                   5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   S-methyltransferase"
FT                   /function="1.2 : Aspartate family"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="2.1.1.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15502870, 15630480; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34921"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34921.1"
FT                   /translation="MTTIHTLGYPRIGAQRELKFALESFWKGAASEADLLATGRTLRER
FT                   HWNAQHDAGLDFVTVGDFAWYDQVLQTAALLGALPTRYGFDAARLTLAQSFVLARGNAD
FT                   HAAMEMTKWFDTNYHYLVPELTPDLRFGPGTGWLFDEVREAQAAGHRVKVALLGPLTFL
FT                   HLAKARGGLADKLSLLPQLLQAYAAVLQRLAAQGVEWVQIDEPALVLDLPKAWSDAYGP
FT                   AYGTLAAAGGPKLLLATYFEAASHHAALIRSLPVAGVHLDLVRAPQQLEAFAPWPADKI
FT                   LSAGVVDGRNIWRTDLEQALARVTPLAQSLGDRLWLAPSCSLLHVPVDLAAETRLDDEL
FT                   KGWLAFARQKLDELAILKRALVEGHDARHAAQAALADNAAAIASRAASRRVHNEGVKKR
FT                   VAAIRAQDAERAAPYPVRAEAQQARLSLPLLPTTTIGSFPQTPEIRQARAQYKRGELQA
FT                   LAYLERMRAEIADVVRRQEALGLDMLVHGEAERNDMVEYFGELLWGYAFTANGWVQSYG
FT                   SRCVKPPVIYGDVYRPEPMTVEWSKYAQSLTAKPMKGMLTGPVTMLQWSFVRDDQPREQ
FT                   TALQIALALRDEVRDLETAGIAAIQIDEPAFREGLPLRAADVAAYLEWAARAFRVSASG
FT                   VRNDTQIHTHMCYSEFNDILPAIASMDADVITIETSRSNMELLDAFGEFAYPNEIGPGV
FT                   YDIHSPRVPRVEEMEALLDKAAQVVPVQRLWVNPDCGLKTRGWPEVEAALRGMVEATRR
FT                   LRARHAGAVHAGTRAPQTESAVA"
FT   gene            728322..729236
FT                   /gene="metR"
FT                   /locus_tag="RPSI07_mp0578"
FT   CDS_pept        728322..729236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metR"
FT                   /locus_tag="RPSI07_mp0578"
FT                   /product="transcriptional regulator of methionine
FT                   biosynthesis (LysR family)"
FT                   /function="1.2 : Aspartate family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2205852, 2643109; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34922"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34922.1"
FT                   /translation="MLEIRHLRTLIALAESGSVSRAAERLHLTQSALSHQLRALESHYG
FT                   LAVVRRKGQTVELSEAGERLLELAHKVVADIQAAERDLERIKGRAAGTLRIALECHTCF
FT                   DWLMPVMDAFRQRWPEVELDLVSGFHADPLALLKEGRADVVIGSEPKPRRGVVFAPLFR
FT                   FEILAVLPVDHPLRSRKWLEAKDFADQTLITYPVPEERIDLIRQVLAPAGVPFTRRTTE
FT                   LTIAVLQLVASRRGLAALPSWGIRNYVDYEYVIAKRVGREGVWSNLYAAMARDYAEAPF
FT                   AQDFIETAKSICFAQLPGVMALE"
FT   gene            complement(729369..730010)
FT                   /gene="pdxH"
FT                   /locus_tag="RPSI07_mp0579"
FT   CDS_pept        complement(729369..730010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxH"
FT                   /locus_tag="RPSI07_mp0579"
FT                   /product="Pyridoxamine 5'-phosphate oxidase 2 (PNP/PMP
FT                   oxidase 2) (PNPOx 2)"
FT                   /function="4.8 : Pyridoxine"
FT                   /EC_number="1.4.3.5"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9693059; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34923"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34923.1"
FT                   /translation="MNLTDMDTEEAFRNDHETISGEDPFAMFGEWLELAHRKEINDANA
FT                   MALATTGPDGLPNVRMVLLKGFDSEGFVFYTNTESQKGVELAENMQAAAVLHWKSLRRQ
FT                   VRFRGSVSRVSAEEADAYFVSRARASRIGAWASRQSRPLDHRTALAKSVAAEVVRFGVG
FT                   EIPRPAFWTGFRIVPNCIEFWMDKPFRLHDRLVFRRSHSGDPWSALKLYP"
FT   gene            complement(730032..731318)
FT                   /locus_tag="RPSI07_mp0580"
FT   CDS_pept        complement(730032..731318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0580"
FT                   /product="putative diaminopimelate decarboxylase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34924"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34924.1"
FT                   /translation="MQSRTTITVPTKLQYKPRLTEHWIAQADLPSICSQTGTPVFIYSE
FT                   AQLIRNIRRVKAAISAAGLDGRVSIFVPFFPNANPHVLKPLRDEGAGILLQMPNEYTLI
FT                   TQYGFSDFIVSPGHVSNEEIAFWSKKNYPVFLASLDEISYAIHENAPTISVRVDSLGSD
FT                   KPGIKVDQLGSLAEMLSAKGRTLECFEVYCGSGNSLQGMIDIARQIFQMYLDHFPTARS
FT                   INFAGGHGFNYEKWSEAEKHFDWKTYFQAIRDLAAEMKIPETVKFMFEPGRDVLADAGV
FT                   LLTGIKRDIVQHSLGNIVVTDGSRMLMPSAQLRNRSHNTVFLDSAFNEIVNDSKRCNAK
FT                   VRGRSILRNDYILPGEVVAPETVKAGEYMLILDVGAYCATQHMEFLNVPPAGEVLVEAN
FT                   GAIYMVTKPGNELDKWRNLLPERQLLAGA"
FT   gene            complement(731478..732284)
FT                   /gene="trpC"
FT                   /locus_tag="RPSI07_mp0581"
FT   CDS_pept        complement(731478..732284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="RPSI07_mp0581"
FT                   /product="Indole-3-glycerol phosphate synthase 2 (IGPS 2)"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="4.1.1.48"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2184433, 9061023; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34925"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34925.1"
FT                   /translation="MSILDAIKPSKEEEVANAKASRSLSELEQAIKQLPPPRDFVGAIA
FT                   ESVRNKEVALIAEIKKASPSKGLIRSDFDVAEIAKAYRDGGAACLSVLTDQAFFQGKPA
FT                   DLALAKEVSGLPVLRKDFMIDPYQIYEARAMRADCILLILAMLDHAQATELEATAQAMG
FT                   MGVLIEIHDESELERAMGMKSRLIGINNRDLTTFAADLKTSERLAPKVNGDRIVVSESG
FT                   IGGREDVIRLTAAGINSFLIGEQLMRARHIESATREITQARLHASP"
FT   gene            complement(732331..733419)
FT                   /gene="trpD"
FT                   /locus_tag="RPSI07_mp0582"
FT   CDS_pept        complement(732331..733419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="RPSI07_mp0582"
FT                   /product="Anthranilate phosphoribosyltransferase 2"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="2.4.2.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12093726, 12923085, 9061023; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34926"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34926.2"
FT                   /translation="MPAECLTSSHNVRLWSRTMFDLKAAIGRLAEGQTLGRQDAWMLFE
FT                   HMAFGQASHAQLGALLMALRIRGETIDEIVGAALAMRARMVPVKAPAGAVDIVGTGGDN
FT                   AGTYNISTCAAFIVAGAGVPVAKHGNRALSSKSGAADVLSALGVNLNQTPADIERCIAE
FT                   AGIGFMFAPTHHPALKQLMPVRVDLATRTIFNILGPLLNPAGVKHHLIGVYSRDWVEPL
FT                   AHALGDLGSERAIVVHGSDGLDEITTVGPTFVSMLAHGRVRSFEITPEMVGLARAHPAE
FT                   LKGADGKWNAAALRRVLEGQPGAYRDIALFNAAGGLIAAGLVEDWPDAMALARVSVDDG
FT                   KALETLNRLVESSQPEDQVHPF"
FT   gene            complement(733358..735559)
FT                   /locus_tag="RPSI07_mp0583"
FT   CDS_pept        complement(733358..735559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0583"
FT                   /product="histamine dehydrogenase oxidoreductase protein"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0583"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34927"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34927.1"
FT                   /translation="MMALGSVSSKPTRFGPLFEPVQLGPVVAKNRFYQVPHCNGMNRVH
FT                   PSSMARMRGIKAEGGWGSICTEQCDIHYSGCHPRELRLWDAQDIPILAKACEEIHRHGA
FT                   LAGIELAHNGFHVSNLETRAIPIAPSLAPTRGVAPVTAREMDRRDIQDVRRWHRAAALN
FT                   AKRAGFDIVYVYASHDMTLPAHFLSRRHNRRSDEYGGSLENRVRLLRELVMDTKDAVGD
FT                   RCAVALRFGVDELMGSGGLSSEGEGRDVVEMLADLPDLWDVNLSPFGNDGQTSRFSDEG
FT                   FQDRYIRFVKRVTGKPVVGVGRFTSPDHMLSLITSGALDLIGAARPSIADPFLPEKIRN
FT                   GAFDDIRECIGCNICVASDKLSVPLRCTQNPTMGEEWRRGWHPEVIPPKNTDDQVLVVG
FT                   AGPAGLEAAVWLGRRGYETILADRARNFGGRAVAESQLPGLHAWRRVADWRLGQLRKDR
FT                   HVLMLPENDMTADIALEADCSLIVVATGAKWRRDGVGRTHAAPIPGLDALPVYSPDDIM
FT                   AGRIPEGRVLIFDDDHYYMGGVISEKLAAHGCAVEFVTPESLVSAFTVNTAEQPRIQKR
FT                   LIECAKGVHVSQKLDHVTRDGAVVSCIFSGREKLIRADAIVLVTSQVPRDRLYHDILER
FT                   LRYQDERDAVPRVLRIGDCHAPGTIAAAVFAGHLFARTLDNALYDAPPFRRESVAMDWN
FT                   QELDTPPLPQAMRYHASSNHARRVFDVIAQCSSVVKDDV"
FT   gene            complement(735556..736236)
FT                   /locus_tag="RPSI07_mp0584"
FT   CDS_pept        complement(735556..736236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0584"
FT                   /product="Putative predicted enzyme with a tim-barrel fold
FT                   protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0584"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34928"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34928.1"
FT                   /translation="MGCNLKENIGRIRKAIQHAAIDSGRRTDAVTLVAASKTVEPQHIQ
FT                   KAIDLGLTVFGENRVQEAVKKWPELRNRNPGIELHLIGPLQSNKVRQAVGLFDAIESVD
FT                   RARLAQAIAEEAEKQGRDPAIYIQVNVGKEPQKGGVLPAEAPALIRACRDVYQLNVQGL
FT                   MCIPPAGFDPSDHFACLRSIAEDHGLGILSMGMSADYRQAIAQGATHVRVGTSIFGARA
FT                   PIPQ"
FT   gene            736183..736338
FT                   /locus_tag="RPSI07_mp0585"
FT   CDS_pept        736183..736338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0585"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0585"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34929"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34929.1"
FT                   /translation="MLYGFPDPSDVFFQIASHTFAYFCNDLPVGHCIEKVGHRRMAVMR
FT                   DCAQRS"
FT   gene            complement(736326..737030)
FT                   /locus_tag="RPSI07_mp0586"
FT   CDS_pept        complement(736326..737030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0586"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0586"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34930"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34930.1"
FT                   /translation="MYFYHSDAVWARFPTLTALTLVLRGVRAANGVAPDIDATLSQVAA
FT                   QLDETAEGEMPSIQAWRQAYSTMGLKPTQYRCAAEALLRRFRKDRDLPRFHPLIDALNV
FT                   ESMHAAIPIAAFDCAHIVEGITVRPATGTERYSTFQGEIEHPAEDEIVFADAAGEAHSR
FT                   RWVFRQGATSVVSKMSDTVLIVAEALHDKAAEDLLSLRESIGLRMKALGIAIADEAMLT
FT                   RSHRRFTFAHDL"
FT   gene            complement(737089..737985)
FT                   /locus_tag="RPSI07_mp0587"
FT   CDS_pept        complement(737089..737985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0587"
FT                   /product="putative tonb box harboring transmembrane
FT                   protein, multidrug resistance efflux transporter domain"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0587"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34931"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34931.1"
FT                   /translation="MSNRTIGYLLLSLAMMTVGSTVIASKLIAGNLAPFPATALRFAVA
FT                   LPFLFALVFLRGERWPRLSGRAWGLLMLQAGAGSVGYTTLLISGLAYLPAADAGVVIGT
FT                   LPAVSALFSVIVLGERPQLRLVVSVLLATVGVMAVAWTGSGSAPLMGVLFILGAVICES
FT                   AFILLNKRMPVPLPPLLQATAMTGLGLLVSLPFAVLDFPVTAPSTAAVAAVVWYALVPT
FT                   VGGFLLWYAGAARVTGSEAATFTAVAPLTAVALAALFLNERIGATQAFGVVAVILAILT
FT                   LTLSVRPVSRSFDGDLQ"
FT   gene            738259..739083
FT                   /locus_tag="RPSI07_mp0589"
FT   CDS_pept        738259..739083
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0589"
FT                   /product="AraC family transcriptional regulator protein,
FT                   AraC family"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0589"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34933"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34933.1"
FT                   /translation="MPKRVSADRFTAGVCRLPGVLAVEAASTRSFSRHTHDQFGIGVVL
FT                   RGAQDSASGRGQVRAVPGDLITVNPNEVHDGRPVAGEPRAWRMLYFDPALIARLSVEMG
FT                   RSPGGEFAHPVLDHGPATQVFMRLYAALTGPAQEPWQEIAEQELFQILAPLWGDTPPPQ
FT                   EGSSSKGIARAKVRIDASPEIPVTLAELAADAGLSRYHFLRAFKAATDLPPHAYRLQRQ
FT                   LQMARRLIFSGHSLAQATTMAGFADQSHLTRHFVQTYGLTPGSLATAIRVGA"
FT   gene            739262..740419
FT                   /locus_tag="RPSI07_mp0590"
FT   CDS_pept        739262..740419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0590"
FT                   /product="putative butyryl-CoA dehydrogenase"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.3.99.2"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0590"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34934"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34934.1"
FT                   /translation="MALDDESFGLLQPSVQRFIRERLVPAENILEEEDEVPADIVADMK
FT                   EMGLFGLSIPEAYGGIGLSMAQECEVVYDLGHTSFAFRSVFGTNVGIGSQGILMDGTEA
FT                   QKAAYLPRIASGELIISFALTEPNAGSDAASLQTRATLDGDHYVINGTKRFITNAPRAG
FT                   AFTLMARTGGEGAGGISAFIVPADTPGIALGKPDRKMGQRGTKTCDVMLDNVRVPAANI
FT                   IGGVAGQGFKTAMKVLDRGRLHISALACGMAHRLITDAVAYAKERRQFGQPIADFQLIQ
FT                   AMLADSQAELYAGLSMVRDCARRYDAKPAGKQDHEVSMLASCTKLFCTEMVGRVADRAV
FT                   QIHGGAGYVAEYKVERFYRDVRLLRLYEGTTQIQQLIIAKHLLRD"
FT   gene            740493..740996
FT                   /locus_tag="RPSI07_mp0591"
FT   CDS_pept        740493..740996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0591"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0591"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34935"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34935.1"
FT                   /translation="MIDARIAKVGMVLALAAFAMTVAYNNVVDFNTNYVYVQHVFSMDT
FT                   VFPDSTLKGRAIVSEPVWLAGYWLIIVCEAVIGVLLLLGAIAMWRARRLPAAAFRRAKT
FT                   LVYAGATLGFLLWFFGFVVVGGEWFLMWQSRTWNGIQPAFRIYLSILVVLIFVNQPDPD
FT                   LDTP"
FT   gene            741131..741769
FT                   /locus_tag="RPSI07_mp0592"
FT   CDS_pept        741131..741769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0592"
FT                   /product="putative transcriptional regulator; repressor,
FT                   FMN-binding protein"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0592"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34936"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34936.1"
FT                   /translation="MYVPTDFDESRTEVLHALIAQHPLGTLVTHGKSGLDANHIPFLLN
FT                   ADEGRLGVLHAHVARANPVWQDVADGDEVLVIFHAGDAYISPNWYPSKPEHHQHVPTWN
FT                   YRVVHAHGRIAIRDDERFVRSVLARLTRTHEASQPVPWKMADAPAEYVSALLKEIVGIE
FT                   IEITRLVGKAKLGQNRDARDARGAAMALKASGKDAIGDAMLACLAEKRE"
FT   gene            complement(741804..743075)
FT                   /gene="fahA"
FT                   /locus_tag="RPSI07_mp0593"
FT   CDS_pept        complement(741804..743075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fahA"
FT                   /locus_tag="RPSI07_mp0593"
FT                   /product="Fumarylacetoacetase (Fumarylacetoacetate
FT                   hydrolase)"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="3.7.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11154690; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0593"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34937"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34937.1"
FT                   /translation="MTARQLSWLASANAPDTHFPLENLPYGIFSTQQNPSPRAGVALGD
FT                   QVIDLGALDDTGLLPASARGAFRTGTLNTFIALGKPVWHETRTRLQALFGAADTHVQNN
FT                   TALRSRALVPMAQAVMHLPVDIPGYTDFYSSREHATNVGRMFRDPDNALLPNWLEIPIG
FT                   YNGRASSVVVSGTPLHRPLGQIKLPDQPRPVFGACRKLDYELEMAFIVGKPSALGEAIS
FT                   VDAAPDHMFGMVLLNDWSARDIQQWEYVPLGPFNAKTFGTSISPWIVTMEALEPFRVAN
FT                   PEQSPEPLAYLRQSRPNAYDIALETALRPHGGERATIARTNFRAMYWTMAQQLAHHTVS
FT                   GCNVRVGDLMGSGTISGTTPDSYGSLLELTYNGKQPLSLGNGAARAFLEDGDEVVMTGW
FT                   CQGDGYRVGFGEVRGEILPARGAR"
FT   gene            complement(743121..744467)
FT                   /gene="hmgA"
FT                   /locus_tag="RPSI07_mp0594"
FT   CDS_pept        complement(743121..744467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmgA"
FT                   /locus_tag="RPSI07_mp0594"
FT                   /product="Homogentisate 1,2-dioxygenase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="1.13.11.5"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0594"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34938"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34938.1"
FT                   /translation="MNMLATTARNAFTPASLDRPAYQSGFGNEFATEALPGALPHGQNS
FT                   PQKTPYGLYAEQLSGTAFTAPRAHNRRAWLYRIRPAAVHLPFEAIAQDRFHSDFHAVPP
FT                   SPNQLRWDPLPALAAGTDFVDGIVTFAGNGGPDAQTGCGIHLYAANASMTDRFFYNADG
FT                   ELLIVPQQGRLRLLTELGVIDVEPLEIAVIPRGVRFRVELPDGEARGYLCENFGAIFRL
FT                   PDLGPIGSNGLANPRDFLTPHAWYEDREGDFELVAKFQGNLWRARIGHSPLDVVAWHGN
FT                   YAPYKYDLRLFNAVGSISYDHPDPSIFLVLQSVSDTPGVDTIDFVIFPPRWLAMEHSFR
FT                   PPWFHRNIASEFMGLIQGVYDAKAEGFVPGGASLHNCMTGHGPDAETFEKASNADTTRP
FT                   HKVDATMAFMFETRAVIRPTRLAAESAQLQAQYFECWQGLKKHFDPAQR"
FT   gene            744705..745634
FT                   /gene="nahR"
FT                   /locus_tag="RPSI07_mp0595"
FT   CDS_pept        744705..745634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nahR"
FT                   /locus_tag="RPSI07_mp0595"
FT                   /product="HTH-type (HTHLYSR) transcriptional activator"
FT                   /function="9.4 : RNA processing"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2703465, 2848005; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0595"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34939"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34939.1"
FT                   /translation="MLNLRDVDLNLLVVFQEILREKRISVVAERLGLSQPAVSNALARL
FT                   RQTFDDELFVRTPRGMMPTALAEQLADPVSSALDTLQRALGQRTHFDAASSARAFTVAM
FT                   SDVGEVYFMPVLAQLCAEQAPGVRIDTVRAGAFDMKAGMASGAIDLAIGAFDDLSGESV
FT                   FQRRLFRQDYVTMFRHGHPLEQAAQEGRLTLERFRAASHLVVASSASPYNAIGPLLDKA
FT                   GISQSARFSVPHFVAVPYIVSTTDLVVTVPRKLAERAAPPFGLGFVPPPLKLPALQTNV
FT                   FWHRRFHQDAGNQWLRNLVARRFAEVEG"
FT   gene            745573..745758
FT                   /locus_tag="RPSI07_mp0596"
FT   CDS_pept        745573..745758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0596"
FT                   /product="hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0596"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34940"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34940.1"
FT                   /translation="MRATSGCAIWWRGALRRWKGSGALGGRGRSHSTADVHAMNPPSLD
FT                   PGPKLRNQSVPPKTIG"
FT   gene            complement(745755..746378)
FT                   /locus_tag="RPSI07_mp0597"
FT   CDS_pept        complement(745755..746378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0597"
FT                   /product="putative peptide chain release factor homolog
FT                   protein"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0597"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34941"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34941.1"
FT                   /translation="MILLQFSSAQGPVECELAVVKALAYLQRESAQAGVRVEVIEQEDG
FT                   ERPGTLRSALVSLEGDAEAAAAQRWEGTIQWTSPSPYRPRHARKNWFFGVARCATPAVT
FT                   LPSEIRFETTRSSGPGGQHVNKTESAVRAIHMATGISVKVQTERSQHANKRLAVLLLAH
FT                   KLASHDEAMNAAQRAQRRTLHRQVERGNPRRVFKGERFELAGSD"
FT   gene            complement(746378..747514)
FT                   /locus_tag="RPSI07_mp0598"
FT   CDS_pept        complement(746378..747514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0598"
FT                   /product="conserved hypothethical protein, RtcB homologue"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0598"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34942"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34942.1"
FT                   /translation="MGNCILHLADGVTLIASDDTWIEGNAIQQLQTTATLPGMRHVAGM
FT                   PDLHPGLGYPVGAAFFSAGRLYPALIGNDIGCGMALWATDLDAKKVSLDKLEKRLGNLD
FT                   GPLDDAWHELATALAPAGTGFYAALGTIGGGNHFAELQRIDTVYDDAAADALGLDARQL
FT                   LLLVHSGSRGLGQAILDEQLGAHGHDGLPQDSPACAAYLARHDAALQFAKANRELIARR
FT                   MLDRLHAQGRPLLDVHHNLVTPAVVKGERGWLHRKGATPSDGGPVVIPGSRGDFSYLVA
FT                   PQPSEHSLFSLAHGAGRKWMRSECKDRLARRFSPAQLNRTRLGSHVICEDRQLIYEEAP
FT                   EAYKPIDSVIAPLEQAGLVKVLARLRPVLTYKTRGECC"
FT   gene            complement(747797..748003)
FT                   /locus_tag="RPSI07_mp0599"
FT   CDS_pept        complement(747797..748003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0599"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0599"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34943"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34943.1"
FT                   /translation="MPLNTQPNLPRPDDFYEALIDTHRGLSDEQSAMLNAQLILLLANH
FT                   IGEMEVLREALAAARMALPAATA"
FT   gene            complement(748015..749694)
FT                   /locus_tag="RPSI07_mp0600"
FT   CDS_pept        complement(748015..749694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0600"
FT                   /product="Putative 2-polyprenyl-6-methoxyphenol hydroxylase
FT                   and related fad-dependent oxidoreductases"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="1.14.13.50"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0600"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34944"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34944.1"
FT                   /translation="MNPDYQTRIFPYTPCAEQQPGAAAAVRPVVVVGAGPVGLAAAIDL
FT                   TQQGMPVVLVDDDCTLSTGSRAICFSKRSLEIFDRLGCGDRMVDKGVSWNVGKVFLKDE
FT                   LLYSFDLLPETGHRRPAFINLQQYYVEGFLVERAQALPNLELRWKNQVTGLTQDAEGVT
FT                   LAIDTPDGPYALRARYVIAADGSHSPVRRMMGLEAHGQTFKDRFLIADVRMKADFPSER
FT                   WFWFDPPFHPNQSVLLHHQPDNIWRIDFQLGWDADPVAEKQPERVLPRVRALLGEDVDF
FT                   ELEWVSVYTFSCERMDHFRHGRVLFAGDAAHRVSPFGARGANSGLQDAENLAWKLRMVL
FT                   DGEAPDTLLDTYASERELAADENIRHATHSTDFITPKSPASRRFRDAVLRLAKHHPFAR
FT                   TLVNSGRLSTPTVLQGSPLLTPDDAPFSGPLVPGAVALDAPLRDSEGRAGWLLSNLGDR
FT                   FSVVRFCAAGERVDALPLPALAVFPFGGIGPVAPGVTALEDVDGLAAQRYDARPGTTYL
FT                   IRPDQHVCARWRNADPAKLATALQRASGRTAATPPTRATATA"
FT   gene            complement(749764..750723)
FT                   /locus_tag="RPSI07_mp0601"
FT   CDS_pept        complement(749764..750723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0601"
FT                   /product="putative metallo-hydrolase/oxidoreductase,
FT                   Beta-lactamase"
FT                   /function="15 : Cellular processes"
FT                   /EC_number="3.5.2.6"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0601"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34945"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34945.1"
FT                   /translation="MTKAFASQADLEAKQVTFTQLSPNAYAYTAEGDPNSGVIIGDDSV
FT                   LIVDTTATPAMAQDLIARIRAITDKPIKHVVLSHYHAVRVLGASAYFAEGAQNIIASRG
FT                   TYEMIVERGEADMKSEIERFPRLFAGVETVPGLTWPTLVFERELTLFLGKLEVKILHLG
FT                   PGHTKGDTVVWIPSQKVLFSGDLVEYDAACYCGDAQLEEWPATLDALRALGPEQLVPGR
FT                   GPALRNPREVDQGLAYTRDFVSTLLARGKEAVAQKMDLKAAMAHTRAAMDPKFGHVFIY
FT                   EHCLPFDVTRAYDEASGIKHPRIWTAQRDQDMWAALQG"
FT   gene            751006..751881
FT                   /locus_tag="RPSI07_mp0602"
FT   CDS_pept        751006..751881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0602"
FT                   /product="putative transcription regulator protein, IclR
FT                   family (iclR)"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9.3 : Transcription factors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0602"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34946"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34946.1"
FT                   /translation="METSEVEHDAPPSGDAEDARASRDRAGIQSIEVGSQLLAALTRAS
FT                   RAMALGDLARAAGMHPSKAHRYLVSLQRVGAVSQDPLTSRYELGPFALRLGLASLNRVE
FT                   AVTRTRPLLASLRDRTGHTIGIAVWSERGPTVVHWEKAGGAPGVNLRIGDVMPMLNSAT
FT                   GRLFSAYLPIEQTLPLVERELHARANDDLPGLPRSLTDYYRLCEDIRAEGAAWVSGGLL
FT                   PGVSALSLPVFGARGELALVLIALNLQPLFQAGPGGELEKTLRTFVDQLSAMLHSPVPP
FT                   TARAGGRRSR"
FT   gene            752042..753094
FT                   /locus_tag="RPSI07_mp0603"
FT   CDS_pept        752042..753094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0603"
FT                   /product="ABC transporter, permease protein; branched-chain
FT                   amino acid transport protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0603"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34947"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34947.1"
FT                   /translation="MDLSIAAILAQDGVTSGAIYALLALALVLVFSVTRVIFIPQGEFV
FT                   AYGALTLAAIQTNKAPLSASLLLALGVLTFVAELGRTLLQPELRRHALRTGAMYAGKYL
FT                   LFPLAVFAAANALAPMTLPQPVQVALALLIVIPMGPMIYRLAYEPLAEASTLVLLIVSV
FT                   GVHFAMVGLGLVMFGAEGSRTEAFSDARFDVGALTVSGQSLWVVMVSALMIVALYFYFG
FT                   RTVSGKALRATAVNRLGARLVGIGTTQAGRLAFTLAAALGALCGILIAPLTTIYYESGF
FT                   LIGLKGFVGAIVGGLVSYPVAAAGALLVGLLESYASFWASAFKEVIVFTLILPVLLWRS
FT                   LTTRHVEEEE"
FT   gene            753099..754925
FT                   /locus_tag="RPSI07_mp0604"
FT   CDS_pept        753099..754925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0604"
FT                   /product="ABC transporter, permease protein (N-ter) and
FT                   ATP-binding protein (C-ter)"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0604"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34948"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34948.1"
FT                   /translation="MTTLTKSSGNAAPRGWLSRNRLLTAAFVIVLALLPVLPTPEFWIT
FT                   LLNYIGLYSLVALGLVLLTGVGGLTSFGQAAFVGLGAYSTAYLTTQYGLSPWLGLLAGL
FT                   AITMVSAYVIGLITMRMSGHYLPLATIAWGLSLFFLFGNLEFLGKYDGLNGIPVLNLLG
FT                   KPLQTGREMFYLIWAVVVVAVLAVQNLLNSRPGRAIRALKGGGTMAEAMGVNTAWMKVV
FT                   IFVAAAILACISGFLYAHLQRAVNPTPFGLNYGIEYLFMAVVGGVGHVWGAVLGAGLLT
FT                   ILKDSLQSLLPKLLGSTGNFEIIVFGVLLVLLLQYARDGVWPFIRKLFPSAPTARAPDD
FT                   APALRQREKPQAGELILDVRAVRKEFGGLVAVNDVSFQVRAGEIIGLIGPNGAGKSTTF
FT                   NLVTGVLPITRGDVLYRGERISGKPSREIVRRGIGRTFQHVQLLPGMTVLENVALGAHL
FT                   RGDFAAQGGVLASVARMNQHEEQKLLFEARRQLERVGLADCLYQEAGSLALGQQRILEI
FT                   ARALCCDPALLLLDEPAAGLRYKEKQALAALLVKLKAEGMSVLLVEHDMDFVMNLTDRL
FT                   VVMEFGTKIAEGVPQDVQQDPAVLEAYLGGVE"
FT   gene            754937..755680
FT                   /gene="livF"
FT                   /locus_tag="RPSI07_mp0605"
FT   CDS_pept        754937..755680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="RPSI07_mp0605"
FT                   /product="leucine/isoleucine/valine transporter subunit ;
FT                   ATP-binding component of ABC superfamily"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14702302, 2195019, 90307651; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0605"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34949"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34949.1"
FT                   /translation="MSIILEVKDLHVRYGKVEALHGASLKVGAGQIVTVIGPNGAGKST
FT                   MLGAIMGALPTAGSASGMVAYLGHNLTGLPVEKRVARGMCLVPEKRELFATMSVEDNLV
FT                   LGAYRRKRAGERNYLDQMDVVYQLFPRLKERRRQEAGTLSGGERQMLAVGRALMAKPQL
FT                   LMLDEPSLGLAPLIVKEIFHIISNLRSTGVATLLIEQNARAALQVADYGYVLETGDMTL
FT                   EGPARELAVNPRVIETYLGLAKKAA"
FT   gene            complement(755788..756108)
FT                   /gene="vrg"
FT                   /locus_tag="RPSI07_mp0606"
FT   CDS_pept        complement(755788..756108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vrg"
FT                   /locus_tag="RPSI07_mp0606"
FT                   /product="Vrg-6 (signal peptide virulence protein)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1730491, 2174866; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0606"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34950"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34950.1"
FT                   /translation="MQKLFALCAPAAAAALSSQPALAGVDVGIGIGIPGPVYVAPAPVY
FT                   APPPVVIEPQPIIVAPAPGYYYDDWQARAWREQQWREQRWREREWRKHHRHGHHDDDDD
FT                   DE"
FT   gene            756553..757764
FT                   /locus_tag="RPSI07_mp0607"
FT   CDS_pept        756553..757764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0607"
FT                   /product="putative cytochrome P450 monooxygenase
FT                   oxidoreductase protein (cyp133B)"
FT                   /function="16.7 : Manage energy"
FT                   /EC_number="1.14.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0607"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34951"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34951.1"
FT                   /translation="MKLADLKLADLSTPSFLENPYPLYETLREQGPFVRIGPNGLMTGR
FT                   YSIVDALLHNRQMGKNYMDSIRLRYGDKGPDMPLFQGFSRMFLLINPPAHTRLRSLMMQ
FT                   AFNARQIESMRELATATAHQLIDGFEQKQSADLVAEFAFPLPVRIICRMLDVDIDDAPA
FT                   LGVAASKLAKVFDPAPMSADELVKTSAAYEELAQYFTKVIEARRAQPGTDLISMLLRVE
FT                   EDGQKLTHDEIVSNVILLFIAGHETTSNMIGNALIALHRNPRQLDLLKRDPSRMPNAVL
FT                   ECLRYDGSVQVTIRAAMEDVEVEGEVVPRGTTVFLMLGAANRDPAQFTDPDQLDIGRQQ
FT                   GRPQTFGAGIHHCLGYRLALIELESALNALFERLPHLRLTNLDQLSWNQRGNLRGVNAL
FT                   MAAW"
FT   gene            complement(757802..758713)
FT                   /locus_tag="RPSI07_mp0608"
FT   CDS_pept        complement(757802..758713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0608"
FT                   /product="putative membrane protein; DMT domain"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0608"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34952"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34952.1"
FT                   /translation="MDPATDGRLALRTLLLTSITMVAFASNSLLCRLALQHASIDAASF
FT                   SSIRLVSGAVTLAILARAGSGGAPRARADWPAATMLFAYVAFFSFAYLTLSAGTGALIL
FT                   FGAVQLTMLGAGLRAGERFEPLGWLGFALALGGLVYLMSPGVTAPTPLGAALMTAAGIA
FT                   WGVYSLRGRGLVNPLVATAGNFLRAAPMALAVSVLLYSRAHASPAGIGLALASGAVTSG
FT                   IGYVIWYAALKGLSAIRAAAVQLSVPPIAAFGAVLFLAEPLTPRLATASAAILGGIAMV
FT                   LASRTQSRRAAAPLDPGQTTKP"
FT   gene            complement(758721..759542)
FT                   /locus_tag="RPSI07_mp0609"
FT   CDS_pept        complement(758721..759542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0609"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0609"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34953"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34953.1"
FT                   /translation="MPIMPAASRHQRVFLPVLGGVVTLAWATLWLWARSPYGRYLDHGD
FT                   WTASGPAAWLCRAIPGGSLILPAALYALAWTLMILAMMLPTTLPLFQAFERVVAGRPDR
FT                   VRLLSLLGAGYLAAWSTFGLLAHGLHALLLAGVARVPLLTWHGWLIGAATLAGAGAFQF
FT                   STLKYRCLEQCRTPLSFVISHWRGRAPERHAFVLGLRHGLFCVGCCWALMLLMFVVGAG
FT                   SLGWMLALAALMSIEKNVSWGRRLSAPLGVALLVGAALLAAAHVWGVIPLA"
FT   gene            complement(759589..760191)
FT                   /locus_tag="RPSI07_mp0610"
FT   CDS_pept        complement(759589..760191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0610"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0610"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34954"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34954.1"
FT                   /translation="MSYHLEGRLLEVCNCRVLCPCWIGEDPDFGTCDTIIAWHMDQGTI
FT                   DGVDVAGNTIAAVCHVPGNILEGNWTAAIFVNDTASDEQEKALLKVYTGQAGGPIAELA
FT                   KLIGKVVSVERAPITFDIVGAKGTLKIGTDYYAELEPYVGPSGAQTTLSDTVFSTVPGA
FT                   PVFVGKAPVYRSKNAAIGIDVNLKNHNALQSTFRFEA"
FT   gene            complement(760495..761055)
FT                   /locus_tag="RPSI07_mp0611"
FT   CDS_pept        complement(760495..761055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0611"
FT                   /product="putative gcn5-related n-acetyltransferase;
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0611"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34955"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34955.1"
FT                   /translation="MSDVTLRPVADADLPGVLAVQQACYGDALLEPPEALASRWARSPA
FT                   LCLVATRGARVVGYLLSHAWHAWAPPKLHVPLPPDTPTDANRLWFVHDMAIAPDGRGQR
FT                   LGERLYAMACATARAQGLRRSRLVAVQGADAFWHRLGYRPASANTAQQQALRAVYGNDA
FT                   QLMERTNLVQSCYKLERDTQRRP"
FT   gene            761219..762091
FT                   /locus_tag="RPSI07_mp0612"
FT   CDS_pept        761219..762091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0612"
FT                   /product="d-alanine aminotransferase (D-aspartate
FT                   aminotransferase) protein"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="2.6.1.21"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9696787; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0612"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34956"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34956.1"
FT                   /translation="MSRIVFLNGQYVPAAEATVSIMDRGFTFADGIYEVTAVARGKLVD
FT                   NDAHLARLTRSLSEIGIDNPYTEAEWTRVCEELVARNGLEEGVVYMQVTRGVAERDFGI
FT                   PAQITPTAVAFTQVKSIVDSPLARKGAAVVTVPDLRWKRCDIKSVGLLPQVMAKQMAAR
FT                   AGANEAWMTDGDHVTEGASSTAFIITTDKRLITRPLSNAVLPGITRVSVMALAREHGLV
FT                   LEERTFTVQEAQQAAEAFFTSASTFVMPVISIDGVPVGDGQPGPLTQALRTLYLRFAGV
FT                   ETAEPAEQA"
FT   gene            762156..762677
FT                   /locus_tag="RPSI07_mp0613"
FT   CDS_pept        762156..762677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0613"
FT                   /product="putative signal peptide (transmembrane) protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0613"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34957"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34957.1"
FT                   /translation="MKTGGWRRQGAIAATVLVAAQWVSMPVFAQDASTQEGIQAAAGAP
FT                   VPDGVDARWRRFVGMSGVESYLDRQSVRPQTGADAGPPTVSFRLLRNVLPDFIIKTSDG
FT                   QPIRSSVKQVVLDCAHRSYTVIAQTLYRARNATGKPLYQIRYGSDAQSRALREGSVFDW
FT                   IAGRFCAPSH"
FT   gene            complement(762693..762893)
FT                   /locus_tag="RPSI07_mp0614"
FT   CDS_pept        complement(762693..762893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0614"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0614"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34958"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34958.1"
FT                   /translation="MKSKVVVYGPLYGKWYAILVNNGAAAESRQFGSYEAAADFASRQY
FT                   PDLEQERQPYARGREEEEAPA"
FT   gene            763454..764815
FT                   /locus_tag="RPSI07_mp0615"
FT   CDS_pept        763454..764815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0615"
FT                   /product="putative cytochrome c peroxidase"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0615"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34959"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34959.1"
FT                   /translation="MQAAWRMVGGLACAAIVTACGGGGESGSGSTAATATLSPMAQVGK
FT                   AIFFDPALSASGKQSCASCHDPARAFTDPNNLAVSIGGPNSDLPGLRNAPSLNYASFTP
FT                   NFQVDGTGTASGGFFRDGRSPSLMDQAQQPFTNAFEMANASADDVLKSLLTRPYIDQFT
FT                   AVFTKAGIQDSATAMQSIGRALAAYQSEDPGFHTFDSKYDAYLAGKTTLTDSEMRGLLL
FT                   FNNPNKGNCNACHVSSRTGGTPALFTDFTYDNVGIPRNWSIAANQEGTTLPYVPKNGVA
FT                   LGAPDYSYYDLGICGPLRTDFRVGGATCGQFKVPTLRNIALTPPYFHNGVFQTLDQVAA
FT                   WYVTRDTDPGRWYVKADGTPDVPYNDLPVGFDANVNTSEVPYNPASAPSMTNQEISDLV
FT                   HFLCTLTDGFDPANPSAYNVPAQCQSSTADSVAAARIQSVSATGATAAKASTSQ"
FT   gene            764841..766217
FT                   /locus_tag="RPSI07_mp0616"
FT   CDS_pept        764841..766217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0616"
FT                   /product="Phosphate-selective porin O and P"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0616"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34960"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34960.1"
FT                   /translation="MKRTALSAAAVIALMGAGAADAATTQQLEQKLDAMAAQIDALRAE
FT                   LKDVRAQNAALASQQQTQAKAQAQQGAELQTVQQTVQTAQLAQAKPSPLDNLTLWGYGE
FT                   ANYSRPTRRSEDSKADLARAVFGIGYRFNDKTRFNSEFEIEHGVTSSSDVGEFEVEQFY
FT                   IDHKLTDKVGLNAGLFLIPTGFINRNHEPTNYYGVHRNFVETLIIPSTWREGGLSLYGD
FT                   TDIGLNWNVGLTTGLDLAKWNFNPENPLFSSALEMQNNAIAPMQTSHQELALANARNLS
FT                   QYVALNYTGIPGVTLGGSVFTGKSSRASTEAPLPDQRATLYEAHARWTPGKWDLSALYA
FT                   YGTFSNTAAVNLQNPGAANPMPAAFYGWYVQAAYNVWQKGDYRVAPFVRYERYNMGSKY
FT                   EGLAPGFTPVAGWPALYDTVYTIGANFYLNPNVVFKIDYQRFTQNRDFSRVDLGLGVSF
FT                   "
FT   gene            766243..766803
FT                   /locus_tag="RPSI07_mp0617"
FT   CDS_pept        766243..766803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0617"
FT                   /product="FMN-binding domain protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type m : membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0617"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34961"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34961.1"
FT                   /translation="MRYQPVPIVLVCAAAIGAPGVVVTRAYAADYMTVAEAQKTIFPDA
FT                   TAFEPVALALSADQLKQLAERAGGQARAGAWRVWQAVQGGKPLGYVVTDAVIGKFELIN
FT                   YAVGLSPAGEIVDVEILTYRESHGYEVRNKPWRAQFTGKSARSALRIGDDINNISGATL
FT                   SCTHLTDGIRRIAVLAQLALVKG"
FT   gene            767237..768370
FT                   /locus_tag="RPSI07_mp0618"
FT   CDS_pept        767237..768370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0618"
FT                   /product="putative Type III effector, lipase domain"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0618"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34962"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34962.1"
FT                   /translation="MAADRVRTIDPVRVDLASALRQVDLTPGLARPRPGTGNLDARRRE
FT                   VLECMRACAGEAYTADLGKVSDVGQLRFAAEMSSPTLKCWESASRHDVQAVVMAFSGTR
FT                   MEEADDLLCDLKSQMAHPHINPLDRRLPQLGHVGAGWQERWQAEALARRGDGQHMAEIL
FT                   AGYAAAARERRQPLSVSVVGHSLGAVVATLASFDIANFLGTSGANGKVSTYAFNPPRLG
FT                   LKGVEDTYRRALASLAGPQEGALRFTLRQFTRNMDPIQSVPLFMQHPDWADGTHRGRGG
FT                   TYAAEARGGVRIVTYNDEAASRVNLSLNHELSLWKAAIASGMSDAALHSLFDGRPKPGP
FT                   GAEALRMSRRRFFLSLVDGAPGQYASGAGGPPRRSGA"
FT   gene            768483..768962
FT                   /locus_tag="RPSI07_mp0619"
FT   CDS_pept        768483..768962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0619"
FT                   /product="putative transmembrane protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0619"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34963"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34963.1"
FT                   /translation="MSAPSRFAHHLRDSAFRLTRRRRWTVYGVFGVLLLTGLAWLAQHF
FT                   FTDDGGEGGAVLAWSMKLHGAAAMASLYLFGMLWGPHIRNAWVRRRNRAAGAVFGGLTV
FT                   LLVVTGYALYYVNGELPRQCAEVLHWVAGLAVCIALWVHIAIGRRRRKAASAFQM"
FT   gene            768832..769446
FT                   /locus_tag="RPSI07_mp0620"
FT   CDS_pept        768832..769446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0620"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0620"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34964"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34964.1"
FT                   /translation="MASCRASARRCCTGWRGWRCASPCGCISPSAADGARLRRRSRCSG
FT                   GAVVLNPQSASRSSSGARRMQRRSASCWRWGGAGALQPAAGDRLTARPGGGPRKKPARR
FT                   RAGRVDSRKDRSIELLGRQNVVRIPQSDHHRPPATITAGRLAWHPTIPVCVDDCRAHAE
FT                   NNNAKQWMHCMACMLSSNFRAAMACIGNYPPPGHTWGAPPM"
FT   gene            769875..770681
FT                   /gene="nadX"
FT                   /locus_tag="RPSI07_mp0621"
FT   CDS_pept        769875..770681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadX"
FT                   /locus_tag="RPSI07_mp0621"
FT                   /product="L-aspartate dehydrogenase"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.4.1.21"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0621"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34965"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34965.1"
FT                   /translation="MLHVSMVGCGAIGQGVLELLKSDPDLCFDTVIVPEHGMDRARAAI
FT                   APFAPRARVATRLSTLEDRPDLLVECAGHDALREHVVPALELGIDCLVVSVGALSEPGL
FT                   AERLEAAARRGHAQMQLLSGAIGAIDALAAARVGGLDAVVYTGRKPPRAWKDTPAERQF
FT                   DLEALDRPTVIFEGNASDAARLFPKNANVAATLALAGLGLERTHVRLMADPTVDENIHH
FT                   VEARGAFGGFELIMRGKPLAANPKTSALTVFSVVRALGNRAHAVSI"
FT   gene            770926..771045
FT                   /locus_tag="RPSI07_mp0622"
FT   CDS_pept        770926..771045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0622"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0622"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34966"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34966.1"
FT                   /translation="MSTTATWIVILTCAYMEYSTWHGRQIYRRTVGYENVVWC"
FT   gene            complement(771056..771574)
FT                   /locus_tag="RPSI07_mp0623"
FT   CDS_pept        complement(771056..771574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0623"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0623"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34967"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34967.1"
FT                   /translation="MPIAPAAQRLIDRLGLQPHPEGGFYRETYRSEERVRRGVPAVERA
FT                   ACTAIYYLLAEDAYSAWHRIQSDELWHFHAGDGLNVYVLEADGAVTTHRLGPALEDEQA
FT                   AYQAMVPAGRWFAAERVAGAHGYTLVGCTVAPGFEFSEFALAESRALLESHPAHGDLIL
FT                   RLAAGPSKR"
FT   gene            complement(771582..772802)
FT                   /locus_tag="RPSI07_mp0624"
FT   CDS_pept        complement(771582..772802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0624"
FT                   /product="sterol desaturase transmembrane protein"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.3.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0624"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34968"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34968.1"
FT                   /translation="MTQPQHSATPPEQEPPPALIRVADATVRDANQLLNSSGGLVFGNG
FT                   LIATILALVLGFLCLLGVMAFHFPQYLTTPELRHAYSVDVMRQILFFSLLVSGGLALAN
FT                   IVLDNRRRLNGLAFAFVLAAVALGGSRVQVGDFPDHTPYIGLDWFILDLLGSTVIFVLL
FT                   EKLFPLYKKQPVFRPEWQTDMVHFAVNHFIVGLVLLVVNFLIHRVFGWMVHAGFQQMVQ
FT                   HIWFVPQLLLCMLVADLMEYVTHRAYHEVPFLWRFHAVHHSVKTMDWLAGSRQHILELI
FT                   VTRVAVLGPLFVLGFDKSVVDTYIIIVGFQAVFNHANVHLPWGPLKYIFVTPDFHHWHH
FT                   SSEDEAIDKNYAAHFSFIDYLFGTAVKSKKAFPEQYGVVGDYMPDGFINQQRFPFRRNP
FT                   ATPATPT"
FT   gene            773399..775075
FT                   /locus_tag="RPSI07_mp0625"
FT   CDS_pept        773399..775075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0625"
FT                   /product="Putative Type III effector, with T6P synthase
FT                   domain"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="2.4.1.15"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 19144559; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0625"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34969"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34969.1"
FT                   /translation="MRPIKPTPTTTPSAPAVSDTPGFADVPRAESSQQAAGRPRSRHPQ
FT                   FERLPSPPARTRSQELRAAMFRRCASDVSARFDARQRLVVVSNRLIDPQRPAAGGLAVA
FT                   LGDMMHDTEGLWFGWSGRTADGTADADVRTEPFGRTTLAQVDLSRPHRDGYYVGFSNSV
FT                   LWPVFHEKVKWADLNPDYFKAYEEVNRMLAARLQPMLRDNDILWVHDYHLIPFAQALRT
FT                   LGCTQRMGFFNHIPLPPPETLRRIPQHRQLMRALSSYDLIGMQSRRDVENLHRYWAEEG
FT                   VDPQPGRRSDCVDAFPIGIDVESLRALVPSAASQAIIDAVRGTSAKRMLMIGVDRLDYS
FT                   KGVPTRLKAFRELLETHCHLRGTVTLVQISAPTRQGIPAYVSLRDKTLKRVQEINARFG
FT                   TDDWTPVLYFNESVDRTALPQLYRMSRVGLVTPVADGMNLVAKEYVAAQAPEDPGVLVL
FT                   STGAGAASQLRDALLVPAKNRTAIAAACARALSMPLAQRQAMHARLLRNIEAEDLRWWR
FT                   ENYLSALTSPRERGTASPAATHAAAEVEAGSGPARQRFPEA"
FT   gene            complement(775264..776370)
FT                   /locus_tag="RPSI07_mp0626"
FT   CDS_pept        complement(775264..776370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0626"
FT                   /product="putative porin signal peptide protein"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0626"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34970"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34970.1"
FT                   /translation="MKRSLTTVAVLGTISAAAHAQSSVTLYGIIDVGIRYNTHQNAAGN
FT                   SKIGMGNGGPLSGSRWGLMGTEDLGGGNKAFFQLESGFTPGTGATQQSTPAGNSRLFGR
FT                   TSVVGLSSPTYGEIALGRQYTLVHEMAYTHDIYALSNYVGTLGFQGAGLTGGGRLDNTV
FT                   RYTTPSFGGFSFKGAYTFGEVAGNTKQYASPAVAASYDNGPLSVGAAFQIINNIGGLTP
FT                   ATTAYGSTYFGILIPDSTQKVFTIGATYKLGATKLYASYIYSNVYPAGYRNDSFSVAVS
FT                   YPLTPALELKLPIYVDLLKHGGQSGTRVTGGPLLDYSLSKRTDVYAGVDYTKLNGAWRT
FT                   LAGTSGFTLPVSGRDSVFEATVGIRHKF"
FT   gene            complement(776788..778227)
FT                   /gene="pntB"
FT                   /locus_tag="RPSI07_mp0627"
FT   CDS_pept        complement(776788..778227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntB"
FT                   /locus_tag="RPSI07_mp0627"
FT                   /product="pyridine nucleotide transhydrogenase (proton
FT                   pump), beta subunit"
FT                   /function="5 : Central intermediary metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number="1.6.1.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1633824, 1932078, 3525165; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0627"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34971"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34971.1"
FT                   /translation="MNLHFISLDVVTLLYLVASVFFIQALKGLSHPTTSIRGNRFGMVG
FT                   MTLAVITTAALILKLAAGNALGLGYVLLGLVIGGGVGAFMARRVEMTKMPELVAFMHSM
FT                   IGLAAVFIAMAAVGEPYAFGIAAKGEAIPTGNRLELFLGAAIGAITFSGSVIAFGKLSG
FT                   RYKFRLFQGAPVQFAGQHLLNLVLGLATIGLGIAFMATQSWPAFGAMLALAFLMGVLII
FT                   IPIGGADMPVVVSMLNSYSGWAAAGIGFSLNNSMLIIAGSLVGSSGAILSYIMCRAMNR
FT                   SFFNVILGGFGGAASEAQTGAVQQRSVKSGSADDAAFILGNAETVVIVPGYGLAVARAQ
FT                   HAVKELAEKLTHKGITVKYAIHPVAGRMPGHMNVLLAEAEVPYDQVFEMEDINSEFGQA
FT                   DVAIVLGANDVVNPAAQQKGSPIYGMPILEAYKAKTVIVNKRSMAAGYAGLDNELFYLD
FT                   KTMMVFGDAKKIVEDMGKAME"
FT   gene            complement(778224..778547)
FT                   /gene="pntAb"
FT                   /locus_tag="RPSI07_mp0628"
FT   CDS_pept        complement(778224..778547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAb"
FT                   /locus_tag="RPSI07_mp0628"
FT                   /product="NAD(P) transhydrogenase (Alpha subunit part 2)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.6.1.2"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8075801; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0628"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34972"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34972.1"
FT                   /translation="MEVVSHTIVSLTTFVLAVYVGYHVVWNVTPALHTPLMAVTNAISA
FT                   IVIVGAMLAAALTETVPGKVIGVLAVALAAVNVFGGFLVTRRMLEMFKKKDKKPATVSG
FT                   VAK"
FT   gene            complement(778559..779689)
FT                   /gene="pntAa"
FT                   /locus_tag="RPSI07_mp0629"
FT   CDS_pept        complement(778559..779689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pntAa"
FT                   /locus_tag="RPSI07_mp0629"
FT                   /product="NAD(P) transhydrogenase (subunit alpha part 1)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.6.1.2"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8075801; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0629"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34973"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34973.1"
FT                   /translation="MLIGIPLQTAEGETRVALTPETAKKLKAHGHVLRVQAGAGWRASI
FT                   PDLAYASVGCEMTDAAGALGADLVLTVRPPVQQDLALMKPDAVLVGMLDPHDKDSLSRL
FT                   AAARLTGFALEAAPRTTRAQSMDVLSSQANIAGYKAVMMAADRYQRFFPMLMTAAGTVK
FT                   AARVVILGVGVAGLQSIATAKRLGAVVEASDVRPSVKEQVESLGAKFIDVPYETAEEKE
FT                   AAEGVGGYARPMPASWLERQKAEVAKRVAQADVVISTALIPGRPAPVLITDDMVQAMKP
FT                   GSLIVDIAAGKGADGVSGNCALTEAGKTVVKHGVSIVGETNLPGLVAADASALYARNVL
FT                   EFLKLILNKDGALAIDESDDIVAACLVTRGGAVLRT"
FT   gene            complement(779749..780783)
FT                   /locus_tag="RPSI07_mp0630"
FT   CDS_pept        complement(779749..780783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0630"
FT                   /product="putative sorbitol dehydrogenase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.14"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0630"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34974"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34974.1"
FT                   /translation="MDALVIHAANDLRIEDIATPEVQPHQMRVQVRFGGICGSDLHYYN
FT                   HGGFGTVRVKEPMVLGHEVAGRVEEVGQGVHQHAKGDRVAISPSRPCGQCHYCQQGLQN
FT                   HCLDMRYYGSAMRTPHVQGAFRREIVIDESQAHRLADSLSDQEGAMAEPLSVALHAVRR
FT                   AGPLLGKRVLVTGCGPIGALIVVAARRAGAAEIIVTDMGAYPLRAALAVGADVALNIAE
FT                   QPDGLKPYSADKGQIDVLFEASGNERALRGAIDVLRPRGIIVQVGLGGEMTLPVNAIVA
FT                   KELELRGAFRFHEEFAMAVELLNKGLVDVKPLISATVPYRNAAHAFALAGDRTQAMKVL
FT                   LDFQ"
FT   gene            complement(780801..781577)
FT                   /gene="gno"
FT                   /locus_tag="RPSI07_mp0631"
FT   CDS_pept        complement(780801..781577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gno"
FT                   /locus_tag="RPSI07_mp0631"
FT                   /product="Gluconate 5-dehydrogenase (5-keto-D-gluconate
FT                   5-reductase)"
FT                   /function="6.11 : Sugars"
FT                   /EC_number="1.1.1.69"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0631"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34975"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34975.1"
FT                   /translation="MTPPNLNLFDLSGRTALITGASSGIGLALAGGLARAGARVVLNAR
FT                   GQEKLAQAADSLRAQGADVHTAAFDVTQSAAVTDGIARVEAELGPIDILVNNAGMQRRA
FT                   PLEQFETAQWHELMKTNVDSVFLVGQAVARYMIPRGRGKIINICSVQSELGRPGIAPYT
FT                   ASKGAVKMLTKGMAIDWGPHGIQVNGLGPGYFKTELTQALVANAEFTAWLVGRTPSRRW
FT                   GDVEDLVGAAIFLASKASDFVNGHILYVDGGVTATL"
FT   gene            complement(781549..782070)
FT                   /locus_tag="RPSI07_mp0632"
FT   CDS_pept        complement(781549..782070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0632"
FT                   /product="putative gluconate kinase"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /EC_number="2.7.1.12"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0632"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34976"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34976.2"
FT                   /translation="MVMGVAGCGKSTLAARLATALDAEWIEGDDHPIEAGKATMRQGTA
FT                   VQAADRGPSLTRLTTLLVAAPGNAVLACAALTRSDRAQLRAAVPQLRIVYVDIALADAI
FT                   ARVSARGRHRFPPSLVLSQFAILEAPAGEPGVLQIPADQPVDTQVQQVLRWITEDTLRQ
FT                   DDDATQSEPV"
FT   gene            complement(782097..783092)
FT                   /locus_tag="RPSI07_mp0633"
FT   CDS_pept        complement(782097..783092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0633"
FT                   /product="Glyoxylate reductase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.26"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0633"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34977"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34977.1"
FT                   /translation="MRPSVLVTRATFPDIASRLRAHFDVTDNPSDTILSPSDLIERLQG
FT                   KQGVMSTGSERIDSALLDACPGLKAVCNVGVGYNNIDVAACTARGVVVTNTPDVLTQTT
FT                   ADFGFALMLATARRITESERFVRRGEWQKTGIHDQMLGSDIYGATLGILGMGRIGQAIA
FT                   RRAALGFEMQVIYHNRSPLTAETEARAHARYVDKDTLLRESDHLVLVLPYSPEAHHTIG
FT                   AAELARMKPTATLINIARGGIVDDEALAQALRRGTIAAAGLDVFEGEPRIHPGLLALNN
FT                   VVLTPHIGSASVNTRRAMAALTVDNLIAALGYGPQAGQPPTPVNPQVLQQ"
FT   gene            complement(783145..783819)
FT                   /locus_tag="RPSI07_mp0634"
FT   CDS_pept        complement(783145..783819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0634"
FT                   /product="putative dimethylmenaquinone methyltransferase"
FT                   /function="4.5 : Menaquinone and ubiquinone"
FT                   /EC_number="2.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0634"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34978"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34978.1"
FT                   /translation="MSTYKAVRKIASAPQVDTALIAALRELPVAALSDNMHRNTGTGCL
FT                   QPFHKPVAKTMAGTAVTARSRGGDNLTYLRALEFCRPGDVLVIDAGGDLQNAVVGGILT
FT                   YYAARMGVAGVVIDGAVRDVAELREREFPVYARGVTHRGPYKDGPGEINVPVSIGGMVV
FT                   RPGDVVVGDQDGLLAIPPEDVPQLIDKARAVLATEAETIRAMKEGRWDRSFIDALEARC
FT                   NN"
FT   gene            complement(783836..785044)
FT                   /gene="aatA"
FT                   /locus_tag="RPSI07_mp0635"
FT   CDS_pept        complement(783836..785044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aatA"
FT                   /locus_tag="RPSI07_mp0635"
FT                   /product="aspartate aminotransferase A protein"
FT                   /function="1.2 : Aspartate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="2.6.1.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0635"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34979"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34979.2"
FT                   /translation="MTTSRIAARVRRIKPSPSTSAADRANELRRQGKSIVNLVVGEPDF
FT                   DTPQHIRQAAVQAIEKGATRYTLMAGTVELRQAIVDKMARENDLQYAMNEIIATNGAKS
FT                   AIYSALAITLEAGDEVLIPAPYWVSYPDMVLACDGTPITLACPESEGFKLTPTRLEAAI
FT                   TARTRWLILNSPSNPTGASYTLDEYRALAEVLARHPHVLVMTDDIYEHIRFDTVRTPHL
FT                   LNAAPELRDRTLAINGVSKTYAMTGWRLGWVAGPRDLIQALDTFLSQSAGNCCSISQAA
FT                   AAAALNGDQRFVTESVAVYKQRRDETLARINAIPGLTCRAPDGAFYLYVNCAGLIGKKT
FT                   PEGKTLDTDTDVVMYLLEREGVAIVAGTAYGLSPYFRLSIATSLETLEEGCRRIERAVL
FT                   ALS"
FT   gene            785220..786161
FT                   /gene="nac"
FT                   /locus_tag="RPSI07_mp0636"
FT   CDS_pept        785220..786161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nac"
FT                   /locus_tag="RPSI07_mp0636"
FT                   /product="nitrogen assimilation transcriptional regulator"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0636"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34980"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34980.1"
FT                   /translation="MNFRRLRYFVKIVDVGSVTQAADLLHVAQPSLSQQMATLEGEVRQ
FT                   QLLLRTKQGVVPTEAGKVLYRHAQAILHQVDQAKVEMKAAGQGLSGAVSVGLAPGTAAS
FT                   ALALPLLRAVRARHPGIVLYLNETYGSTLSELIMNGRMDMAVLYGGKTVVHGLSFLPLL
FT                   REQLYVVGPACMPAPPDEVPLSMLGEIDLYLARPYNVVRRLVDEAFSAIGMAPKVSAEI
FT                   ESAGTLKAIVADGLGATILPASMAREVATSCDAWQCRIVDPVIEAPLALCQSGHQPLSE
FT                   PAQAIKEILLELVAGLAGNLLPCEASENHEAS"
FT   gene            786251..786709
FT                   /gene="accB"
FT                   /locus_tag="RPSI07_mp0637"
FT   CDS_pept        786251..786709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accB"
FT                   /locus_tag="RPSI07_mp0637"
FT                   /product="biotin carboxyl carrier protein of acetyl-coa
FT                   carboxylase (Bccp)"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="6.3.4.14"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1370469, 7678242; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0637"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34981"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34981.2"
FT                   /translation="MDLSQIKQLIDAMASSDLAEMSFSHQGWVLRLVRHKSAAHRGDDV
FT                   LPLADRAPLAPMPAHHPPSPPAQSVPAAPKRRELLAPLFGVVHLQPAPGEPAFVQPGQT
FT                   VQAGQTLCVIEAMKVFNAVLAESDGTVDAVLVESGAEVEAGQPLIRFA"
FT   gene            786706..788094
FT                   /gene="accC"
FT                   /locus_tag="RPSI07_mp0638"
FT   CDS_pept        786706..788094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="accC"
FT                   /locus_tag="RPSI07_mp0638"
FT                   /product="Biotin carboxylase (Acetyl-CoA carboxylase
FT                   subunit A) (ACC)"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="6.3.4.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1682920, 7693652; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0638"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34982"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34982.2"
FT                   /translation="MSHRGFVMFDTVLIANRGEIALRIQRACRGLGLRTVAVYSEADRD
FT                   AVYVRQADQALCIGPASPTASYLNQAALLAAARVSGAQAIHPGYGFLSENAGFVERVTD
FT                   AGLTFIGPSAACIRTMGDKVSAKRAMREAGVPCVPGPDTSLPEDPAAVLAIARDIGFPV
FT                   IVKAAGGGGGRGMRVVQEASALLDALALTREEARRAFGNPEVYIEKFLTHPRHVEIQVL
FT                   ADRYGHALWLGSRDCSLQRRHQKILEEAPAPGIEPSLIAAVGERCAAACRRIGYCGVGT
FT                   FEFLYENGAFYFIEMNTRLQVEHPVTEMTSGIDIVQQQIRVARGEPLTLRQDDIICQGH
FT                   ALECRINAEHPDTFAPSPGVITGWQLPGGYGVRVDTHAGAGYRVPSHYDSMIAKLIVHG
FT                   ASREDALRRMCLALDELQVDGIATNLPLHREVVRDKDFEAGGVDIHHLERWLRARTERR
FT                   NETR"
FT   gene            788098..788766
FT                   /locus_tag="RPSI07_mp0639"
FT   CDS_pept        788098..788766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0639"
FT                   /product="putative allophanate hydrolase subunit 1"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="3.5.1.54"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0639"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34983"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34983.1"
FT                   /translation="MASMTTDMERISLLGTTALLFDVPGELSLITQQRLWSLALDVEAW
FT                   PEVREAVPGMNNLMLTFTRPPSGLAQIETRLREAWRAATPLPREGRLVELPVVYGGELG
FT                   PHMADVVNHTGLSVDEIVERHSAPDYHVFALGSHPGYCYLGGMDPRIATPRRKVPVLSI
FT                   PGGAVSIGGSQTGVSASDGPSGWNTIGSSEMCFFDPNRDPPALLQPGDVLRFRVERVIR
FT                   "
FT   gene            788763..789755
FT                   /locus_tag="RPSI07_mp0640"
FT   CDS_pept        788763..789755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0640"
FT                   /product="conserved hypothethical protein, allophanate
FT                   hydrolase subunit 2 domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0640"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34984"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34984.1"
FT                   /translation="MIEVLSASALATVQDLGRLGGLRWGVGTSGAMDSLALAAGNLLLG
FT                   NDEGAAGIEVQVFPFQARFTQDCRFALTGADCGAQLDDRPLLPWWVHEARAGQTLRLAV
FT                   PQRGPVPACRAYLCLAGGVDVPLALGSRSTQLRGAFGGLDGRALRRGDVLLAGAPGLGN
FT                   GSGGAGIGLVPPALGLPLVADGLPAMRVLPAAEYGCYSEASQQSFWSQPWKVTPQSDRY
FT                   GFRLAGPTLTPREPFEMRSHGIVPGVIQVPPSGQPIVQMREAQPSGGYPKIGTVIEADL
FT                   WRLGQAPIGSQVRFIETTWDEAVAALAEVEAWLADVRRLIGLHAAAGGR"
FT   gene            789757..790164
FT                   /locus_tag="RPSI07_mp0641"
FT   CDS_pept        789757..790164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0641"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0641"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34985"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34985.1"
FT                   /translation="METEHIRQICTWLAATDITEFDLQGPGVHLLLRNEGAAAPRVSAQ
FT                   PAPAASAAAVSPEVVRAGSVGVFWHQHPQQTAPLAAVGATVRASQPLGLLQIGPLLLPV
FT                   TAPCEAVVLDILVPDGTVVGWGTSLVVLGTR"
FT   gene            790177..790947
FT                   /locus_tag="RPSI07_mp0642"
FT   CDS_pept        790177..790947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0642"
FT                   /product="conserved hypothethical protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0642"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34986"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34986.1"
FT                   /translation="MEIDLNADLGEGYGPWRMGDDEAMMSLISSANVACGFHAGDPLIM
FT                   DRTVRLAIRGGVDVGAHVGFPDRQGFGRRLMHVEMPDLTAMVTYQLGALAGIAGALGCR
FT                   MTHMSFHGALGNRAAADAAWAYPLLQAIAAFDPSVIISTSSSQAIEGAAAELGLPVAVS
FT                   FLADRAYDDQGLLVSRGQPGAVIHDEAQVLARVRRLLTEGTIVTHTGNVLAMQPRSILV
FT                   HGDTPGAVALTRRLRTEIESLGGRIVPISRQLGL"
FT   gene            791058..791810
FT                   /locus_tag="RPSI07_mp0643"
FT   CDS_pept        791058..791810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0643"
FT                   /product="oxidoreductase protein"
FT                   /function="18 : Unknown function"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0643"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34987"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34987.2"
FT                   /translation="MSFTDYKTALVTGASSGIGAAVVERLCREGVQVHALARSADALAK
FT                   LAERTGCIPHAIDVTDLAGITALTNEHAFDILVNNAGVDRPGSLLNADAEGVDLLVDVN
FT                   LRAVLHLCRLVLPGMVARDRGHVVNISSIAGAYNFGGNSTYHATKAAIHMLSRQLRIDA
FT                   YGKRVRVTEICPGRVATDIFAHVHGDSAETHERFVKGFELPQAADIAEAIAFAIAAPVA
FT                   VNIGHMEITPTLQVPGGLSTMRPEPSQD"
FT   gene            791823..792524
FT                   /locus_tag="RPSI07_mp0644"
FT   CDS_pept        791823..792524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0644"
FT                   /product="amino acid ABC transporter transmembrane protein"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0644"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34988"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34988.1"
FT                   /translation="MQGFDLMAILKNPEFSRMLLEGVWMTLVIAGSSWVLAMVLAFVLL
FT                   AIRMAPSPIAEHFVGSYVSYHCNVPTLVQLMFWYFGISTLFPLPVLDWLGEHHSEALFA
FT                   IVALSLCQAAYFSEDLRSGLRAIPPGQEEAARALGNSFIGAMRHVLMPQAVRNALPALI
FT                   NHSVSLFKNSSLAMAIGVAEMTHAVKEIENASFRAFESYLLATVMYLGFSLVIMAVGAC
FT                   LARRFRVVTGR"
FT   gene            792531..793274
FT                   /locus_tag="RPSI07_mp0645"
FT   CDS_pept        792531..793274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0645"
FT                   /product="amino acid ABC transporter transmembrane protein"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0645"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34989"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34989.1"
FT                   /translation="MDLIDIVHDNWLLLLVGQYPNGPLGGIACTLILSVLGIVLAFPLS
FT                   VALALARLSPWRALRAVVTALVYAVRGVPLLMLILWVYFLVPLLIGHNVSGFTTMLCTL
FT                   AIYEGVYLCEVVRAGIEALPKGQMEAARALGHSYLGAMRLVILPQALYNMLPSMLAQFV
FT                   STIKETTLGYVINVPELTFAANQINNALLSKPFQIFFLLAVIYFVVCWSLTRAARALER
FT                   RIAAKRAGKRRVLTSGTPQPLPVEP"
FT   gene            793298..794032
FT                   /locus_tag="RPSI07_mp0646"
FT   CDS_pept        793298..794032
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0646"
FT                   /product="amino-acid ATP-binding ABC transporter protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0646"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34990"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ34990.1"
FT                   /translation="MIKFSNVCKWYGEYCALNNINAEVRKGEVVVVCGPSGSGKSTLIR
FT                   TVNRLEEIKSGQILFDGNDVHAPMRSDALNEVRSRIGFVFQSFNLFPHLSVLENIVLSP
FT                   MRVRGVRRSEAREKAMQLLDRVGLANKADAYPAQLSGGQQQRVAIARALAMEPPAMLFD
FT                   EPTSALDPEMVGEVLAVMRSLANEGMTMMCVTHEMNFAREVADRVWFMDSGAILEVAEP
FT                   NVFFRDPQHPRAKRFLSDLRSH"
FT   gene            794068..794910
FT                   /locus_tag="RPSI07_mp0647"
FT   CDS_pept        794068..794910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPSI07_mp0647"
FT                   /product="putative amino-acid-binding periplasmic abc
FT                   transporter protein"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RPSI07_mp0647"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ34991"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT