(data stored in ACNUC7421 zone)

EMBL: FP885897

ID   FP885897; SV 1; circular; genomic DNA; STD; PRO; 3417386 BP.
XX
AC   FP885897;
XX
PR   Project:PRJEA50685;
XX
DT   22-JUN-2010 (Rel. 105, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   Ralstonia solanacearum CFBP2957 chromosome complete genome
XX
KW   complete genome.
XX
OS   Ralstonia solanacearum CFBP2957
OC   Bacteria; Proteobacteria; Betaproteobacteria; Burkholderiales;
OC   Burkholderiaceae; Ralstonia.
XX
RN   [1]
RP   1-3417386
RA   Genoscope - CEA;
RT   ;
RL   Submitted (02-FEB-2010) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
XX
RN   [2]
RX   DOI; 10.1186/1471-2164-11-379.
RX   PUBMED; 20550686.
RA   Remenant B., Coupat-Goutaland B., Guidot A., Cellier G., Wicker E.,
RA   Allen C., Fegan M., Pruvost O., Elbaz M., Calteau A., Salvignol G.,
RA   Mornico D., Mangenot S., Barbe V., Medigue C., Prior P.;
RT   "Genomes of three tomato pathogens within the Ralstonia solanacearum
RT   species complex reveal significant evolutionary divergence";
RL   BMC Genomics 11:379-379(2010).
XX
DR   MD5; f016cab966ffc29b8e7642b147c55e5b.
DR   BioSample; SAMEA2272283.
DR   EnsemblGenomes-Gn; EBG00001239560.
DR   EnsemblGenomes-Gn; EBG00001239561.
DR   EnsemblGenomes-Gn; EBG00001239562.
DR   EnsemblGenomes-Gn; EBG00001239563.
DR   EnsemblGenomes-Gn; EBG00001239564.
DR   EnsemblGenomes-Gn; EBG00001239565.
DR   EnsemblGenomes-Gn; EBG00001239566.
DR   EnsemblGenomes-Gn; EBG00001239567.
DR   EnsemblGenomes-Gn; EBG00001239568.
DR   EnsemblGenomes-Gn; EBG00001239569.
DR   EnsemblGenomes-Gn; EBG00001239570.
DR   EnsemblGenomes-Gn; EBG00001239571.
DR   EnsemblGenomes-Gn; EBG00001239572.
DR   EnsemblGenomes-Gn; EBG00001239573.
DR   EnsemblGenomes-Gn; EBG00001239574.
DR   EnsemblGenomes-Gn; EBG00001239575.
DR   EnsemblGenomes-Gn; EBG00001239576.
DR   EnsemblGenomes-Gn; EBG00001239577.
DR   EnsemblGenomes-Gn; EBG00001239578.
DR   EnsemblGenomes-Gn; EBG00001239579.
DR   EnsemblGenomes-Gn; EBG00001239580.
DR   EnsemblGenomes-Gn; EBG00001239581.
DR   EnsemblGenomes-Gn; EBG00001239582.
DR   EnsemblGenomes-Gn; EBG00001239583.
DR   EnsemblGenomes-Gn; EBG00001239584.
DR   EnsemblGenomes-Gn; EBG00001239585.
DR   EnsemblGenomes-Gn; EBG00001239586.
DR   EnsemblGenomes-Gn; EBG00001239587.
DR   EnsemblGenomes-Gn; EBG00001239588.
DR   EnsemblGenomes-Gn; EBG00001239589.
DR   EnsemblGenomes-Gn; EBG00001239590.
DR   EnsemblGenomes-Gn; EBG00001239591.
DR   EnsemblGenomes-Gn; EBG00001239592.
DR   EnsemblGenomes-Gn; EBG00001239593.
DR   EnsemblGenomes-Gn; EBG00001239594.
DR   EnsemblGenomes-Gn; EBG00001239595.
DR   EnsemblGenomes-Gn; EBG00001239596.
DR   EnsemblGenomes-Gn; EBG00001239597.
DR   EnsemblGenomes-Gn; EBG00001239598.
DR   EnsemblGenomes-Gn; EBG00001239599.
DR   EnsemblGenomes-Gn; EBG00001239600.
DR   EnsemblGenomes-Gn; EBG00001239601.
DR   EnsemblGenomes-Gn; EBG00001239602.
DR   EnsemblGenomes-Gn; EBG00001239603.
DR   EnsemblGenomes-Gn; EBG00001239604.
DR   EnsemblGenomes-Gn; EBG00001239605.
DR   EnsemblGenomes-Gn; EBG00001239606.
DR   EnsemblGenomes-Gn; EBG00001239607.
DR   EnsemblGenomes-Gn; EBG00001239608.
DR   EnsemblGenomes-Gn; EBG00001239609.
DR   EnsemblGenomes-Gn; EBG00001239610.
DR   EnsemblGenomes-Gn; EBG00001239611.
DR   EnsemblGenomes-Gn; EBG00001239612.
DR   EnsemblGenomes-Gn; EBG00001239613.
DR   EnsemblGenomes-Gn; EBG00001239614.
DR   EnsemblGenomes-Gn; EBG00001239615.
DR   EnsemblGenomes-Gn; EBG00001239616.
DR   EnsemblGenomes-Gn; EBG00001239617.
DR   EnsemblGenomes-Gn; EBG00001239618.
DR   EnsemblGenomes-Gn; EBG00001239619.
DR   EnsemblGenomes-Gn; EBG00001239620.
DR   EnsemblGenomes-Gn; EBG00001239621.
DR   EnsemblGenomes-Gn; EBG00001239622.
DR   EnsemblGenomes-Gn; EBG00001239623.
DR   EnsemblGenomes-Gn; EBG00001239624.
DR   EnsemblGenomes-Gn; EBG00001239625.
DR   EnsemblGenomes-Gn; EBG00001239626.
DR   EnsemblGenomes-Gn; EBG00001239627.
DR   EnsemblGenomes-Gn; EBG00001239628.
DR   EnsemblGenomes-Gn; EBG00001239629.
DR   EnsemblGenomes-Gn; EBG00001239630.
DR   EnsemblGenomes-Gn; EBG00001239631.
DR   EnsemblGenomes-Gn; EBG00001239632.
DR   EnsemblGenomes-Gn; EBG00001239633.
DR   EnsemblGenomes-Gn; EBG00001239634.
DR   EnsemblGenomes-Gn; EBG00001239635.
DR   EnsemblGenomes-Gn; EBG00001239636.
DR   EnsemblGenomes-Gn; EBG00001239637.
DR   EnsemblGenomes-Gn; EBG00001239638.
DR   EnsemblGenomes-Gn; EBG00001239639.
DR   EnsemblGenomes-Gn; EBG00001239640.
DR   EnsemblGenomes-Gn; RCFBP_10043.
DR   EnsemblGenomes-Gn; RCFBP_10045.
DR   EnsemblGenomes-Gn; RCFBP_10075.
DR   EnsemblGenomes-Gn; RCFBP_10076.
DR   EnsemblGenomes-Gn; RCFBP_10101.
DR   EnsemblGenomes-Gn; RCFBP_10130.
DR   EnsemblGenomes-Gn; RCFBP_10241.
DR   EnsemblGenomes-Gn; RCFBP_10314.
DR   EnsemblGenomes-Gn; RCFBP_10317.
DR   EnsemblGenomes-Gn; RCFBP_10320.
DR   EnsemblGenomes-Gn; RCFBP_10745.
DR   EnsemblGenomes-Gn; RCFBP_10757.
DR   EnsemblGenomes-Gn; RCFBP_10826.
DR   EnsemblGenomes-Gn; RCFBP_10828.
DR   EnsemblGenomes-Gn; RCFBP_10829.
DR   EnsemblGenomes-Gn; RCFBP_10832.
DR   EnsemblGenomes-Gn; RCFBP_10855.
DR   EnsemblGenomes-Gn; RCFBP_10913.
DR   EnsemblGenomes-Gn; RCFBP_10914.
DR   EnsemblGenomes-Gn; RCFBP_10920.
DR   EnsemblGenomes-Gn; RCFBP_10929.
DR   EnsemblGenomes-Gn; RCFBP_10957.
DR   EnsemblGenomes-Gn; RCFBP_10958.
DR   EnsemblGenomes-Gn; RCFBP_10971.
DR   EnsemblGenomes-Gn; RCFBP_11108.
DR   EnsemblGenomes-Gn; RCFBP_11109.
DR   EnsemblGenomes-Gn; RCFBP_11111.
DR   EnsemblGenomes-Gn; RCFBP_11147.
DR   EnsemblGenomes-Gn; RCFBP_11171.
DR   EnsemblGenomes-Gn; RCFBP_11194.
DR   EnsemblGenomes-Gn; RCFBP_11195.
DR   EnsemblGenomes-Gn; RCFBP_11236.
DR   EnsemblGenomes-Gn; RCFBP_11237.
DR   EnsemblGenomes-Gn; RCFBP_11362.
DR   EnsemblGenomes-Gn; RCFBP_11473.
DR   EnsemblGenomes-Gn; RCFBP_11501.
DR   EnsemblGenomes-Gn; RCFBP_11502.
DR   EnsemblGenomes-Gn; RCFBP_11526.
DR   EnsemblGenomes-Gn; RCFBP_11527.
DR   EnsemblGenomes-Gn; RCFBP_11837.
DR   EnsemblGenomes-Gn; RCFBP_11839.
DR   EnsemblGenomes-Gn; RCFBP_11888.
DR   EnsemblGenomes-Gn; RCFBP_11889.
DR   EnsemblGenomes-Gn; RCFBP_11903.
DR   EnsemblGenomes-Gn; RCFBP_16s_rRNA_1.
DR   EnsemblGenomes-Gn; RCFBP_16s_rRNA_2.
DR   EnsemblGenomes-Gn; RCFBP_16s_rRNA_3.
DR   EnsemblGenomes-Gn; RCFBP_20088.
DR   EnsemblGenomes-Gn; RCFBP_20157.
DR   EnsemblGenomes-Gn; RCFBP_20158.
DR   EnsemblGenomes-Gn; RCFBP_20399.
DR   EnsemblGenomes-Gn; RCFBP_20458.
DR   EnsemblGenomes-Gn; RCFBP_20495.
DR   EnsemblGenomes-Gn; RCFBP_20496.
DR   EnsemblGenomes-Gn; RCFBP_20498.
DR   EnsemblGenomes-Gn; RCFBP_20499.
DR   EnsemblGenomes-Gn; RCFBP_20538.
DR   EnsemblGenomes-Gn; RCFBP_20540.
DR   EnsemblGenomes-Gn; RCFBP_20541.
DR   EnsemblGenomes-Gn; RCFBP_20542.
DR   EnsemblGenomes-Gn; RCFBP_20545.
DR   EnsemblGenomes-Gn; RCFBP_20552.
DR   EnsemblGenomes-Gn; RCFBP_20553.
DR   EnsemblGenomes-Gn; RCFBP_20594.
DR   EnsemblGenomes-Gn; RCFBP_20596.
DR   EnsemblGenomes-Gn; RCFBP_20618.
DR   EnsemblGenomes-Gn; RCFBP_20622.
DR   EnsemblGenomes-Gn; RCFBP_20623.
DR   EnsemblGenomes-Gn; RCFBP_20836.
DR   EnsemblGenomes-Gn; RCFBP_20844.
DR   EnsemblGenomes-Gn; RCFBP_20856.
DR   EnsemblGenomes-Gn; RCFBP_20941.
DR   EnsemblGenomes-Gn; RCFBP_20942.
DR   EnsemblGenomes-Gn; RCFBP_20997.
DR   EnsemblGenomes-Gn; RCFBP_21140.
DR   EnsemblGenomes-Gn; RCFBP_21295.
DR   EnsemblGenomes-Gn; RCFBP_21409.
DR   EnsemblGenomes-Gn; RCFBP_23s_rRNA_1.
DR   EnsemblGenomes-Gn; RCFBP_23s_rRNA_2.
DR   EnsemblGenomes-Gn; RCFBP_23s_rRNA_3.
DR   EnsemblGenomes-Gn; RCFBP_5s_rRNA_1.
DR   EnsemblGenomes-Gn; RCFBP_5s_rRNA_2.
DR   EnsemblGenomes-Gn; RCFBP_5s_rRNA_3.
DR   EnsemblGenomes-Gn; RCFBP_tRNA1.
DR   EnsemblGenomes-Gn; RCFBP_tRNA10.
DR   EnsemblGenomes-Gn; RCFBP_tRNA11.
DR   EnsemblGenomes-Gn; RCFBP_tRNA12.
DR   EnsemblGenomes-Gn; RCFBP_tRNA13.
DR   EnsemblGenomes-Gn; RCFBP_tRNA14.
DR   EnsemblGenomes-Gn; RCFBP_tRNA15.
DR   EnsemblGenomes-Gn; RCFBP_tRNA16.
DR   EnsemblGenomes-Gn; RCFBP_tRNA17.
DR   EnsemblGenomes-Gn; RCFBP_tRNA18.
DR   EnsemblGenomes-Gn; RCFBP_tRNA19.
DR   EnsemblGenomes-Gn; RCFBP_tRNA2.
DR   EnsemblGenomes-Gn; RCFBP_tRNA20.
DR   EnsemblGenomes-Gn; RCFBP_tRNA21.
DR   EnsemblGenomes-Gn; RCFBP_tRNA22.
DR   EnsemblGenomes-Gn; RCFBP_tRNA23.
DR   EnsemblGenomes-Gn; RCFBP_tRNA24.
DR   EnsemblGenomes-Gn; RCFBP_tRNA25.
DR   EnsemblGenomes-Gn; RCFBP_tRNA26.
DR   EnsemblGenomes-Gn; RCFBP_tRNA27.
DR   EnsemblGenomes-Gn; RCFBP_tRNA28.
DR   EnsemblGenomes-Gn; RCFBP_tRNA29.
DR   EnsemblGenomes-Gn; RCFBP_tRNA3.
DR   EnsemblGenomes-Gn; RCFBP_tRNA30.
DR   EnsemblGenomes-Gn; RCFBP_tRNA31.
DR   EnsemblGenomes-Gn; RCFBP_tRNA32.
DR   EnsemblGenomes-Gn; RCFBP_tRNA33.
DR   EnsemblGenomes-Gn; RCFBP_tRNA34.
DR   EnsemblGenomes-Gn; RCFBP_tRNA35.
DR   EnsemblGenomes-Gn; RCFBP_tRNA36.
DR   EnsemblGenomes-Gn; RCFBP_tRNA37.
DR   EnsemblGenomes-Gn; RCFBP_tRNA38.
DR   EnsemblGenomes-Gn; RCFBP_tRNA39.
DR   EnsemblGenomes-Gn; RCFBP_tRNA4.
DR   EnsemblGenomes-Gn; RCFBP_tRNA40.
DR   EnsemblGenomes-Gn; RCFBP_tRNA41.
DR   EnsemblGenomes-Gn; RCFBP_tRNA42.
DR   EnsemblGenomes-Gn; RCFBP_tRNA43.
DR   EnsemblGenomes-Gn; RCFBP_tRNA44.
DR   EnsemblGenomes-Gn; RCFBP_tRNA45.
DR   EnsemblGenomes-Gn; RCFBP_tRNA46.
DR   EnsemblGenomes-Gn; RCFBP_tRNA47.
DR   EnsemblGenomes-Gn; RCFBP_tRNA48.
DR   EnsemblGenomes-Gn; RCFBP_tRNA49.
DR   EnsemblGenomes-Gn; RCFBP_tRNA5.
DR   EnsemblGenomes-Gn; RCFBP_tRNA50.
DR   EnsemblGenomes-Gn; RCFBP_tRNA51.
DR   EnsemblGenomes-Gn; RCFBP_tRNA52.
DR   EnsemblGenomes-Gn; RCFBP_tRNA53.
DR   EnsemblGenomes-Gn; RCFBP_tRNA6.
DR   EnsemblGenomes-Gn; RCFBP_tRNA7.
DR   EnsemblGenomes-Gn; RCFBP_tRNA8.
DR   EnsemblGenomes-Gn; RCFBP_tRNA9.
DR   EnsemblGenomes-Tr; EBT00001585061.
DR   EnsemblGenomes-Tr; EBT00001585062.
DR   EnsemblGenomes-Tr; EBT00001585063.
DR   EnsemblGenomes-Tr; EBT00001585064.
DR   EnsemblGenomes-Tr; EBT00001585065.
DR   EnsemblGenomes-Tr; EBT00001585066.
DR   EnsemblGenomes-Tr; EBT00001585067.
DR   EnsemblGenomes-Tr; EBT00001585068.
DR   EnsemblGenomes-Tr; EBT00001585069.
DR   EnsemblGenomes-Tr; EBT00001585070.
DR   EnsemblGenomes-Tr; EBT00001585071.
DR   EnsemblGenomes-Tr; EBT00001585072.
DR   EnsemblGenomes-Tr; EBT00001585073.
DR   EnsemblGenomes-Tr; EBT00001585074.
DR   EnsemblGenomes-Tr; EBT00001585075.
DR   EnsemblGenomes-Tr; EBT00001585076.
DR   EnsemblGenomes-Tr; EBT00001585077.
DR   EnsemblGenomes-Tr; EBT00001585078.
DR   EnsemblGenomes-Tr; EBT00001585079.
DR   EnsemblGenomes-Tr; EBT00001585080.
DR   EnsemblGenomes-Tr; EBT00001585081.
DR   EnsemblGenomes-Tr; EBT00001585082.
DR   EnsemblGenomes-Tr; EBT00001585083.
DR   EnsemblGenomes-Tr; EBT00001585084.
DR   EnsemblGenomes-Tr; EBT00001585085.
DR   EnsemblGenomes-Tr; EBT00001585086.
DR   EnsemblGenomes-Tr; EBT00001585087.
DR   EnsemblGenomes-Tr; EBT00001585088.
DR   EnsemblGenomes-Tr; EBT00001585089.
DR   EnsemblGenomes-Tr; EBT00001585090.
DR   EnsemblGenomes-Tr; EBT00001585091.
DR   EnsemblGenomes-Tr; EBT00001585092.
DR   EnsemblGenomes-Tr; EBT00001585093.
DR   EnsemblGenomes-Tr; EBT00001585094.
DR   EnsemblGenomes-Tr; EBT00001585095.
DR   EnsemblGenomes-Tr; EBT00001585096.
DR   EnsemblGenomes-Tr; EBT00001585097.
DR   EnsemblGenomes-Tr; EBT00001585098.
DR   EnsemblGenomes-Tr; EBT00001585099.
DR   EnsemblGenomes-Tr; EBT00001585100.
DR   EnsemblGenomes-Tr; EBT00001585101.
DR   EnsemblGenomes-Tr; EBT00001585102.
DR   EnsemblGenomes-Tr; EBT00001585103.
DR   EnsemblGenomes-Tr; EBT00001585104.
DR   EnsemblGenomes-Tr; EBT00001585105.
DR   EnsemblGenomes-Tr; EBT00001585106.
DR   EnsemblGenomes-Tr; EBT00001585107.
DR   EnsemblGenomes-Tr; EBT00001585108.
DR   EnsemblGenomes-Tr; EBT00001585109.
DR   EnsemblGenomes-Tr; EBT00001585110.
DR   EnsemblGenomes-Tr; EBT00001585111.
DR   EnsemblGenomes-Tr; EBT00001585112.
DR   EnsemblGenomes-Tr; EBT00001585113.
DR   EnsemblGenomes-Tr; EBT00001585114.
DR   EnsemblGenomes-Tr; EBT00001585115.
DR   EnsemblGenomes-Tr; EBT00001585116.
DR   EnsemblGenomes-Tr; EBT00001585117.
DR   EnsemblGenomes-Tr; EBT00001585118.
DR   EnsemblGenomes-Tr; EBT00001585119.
DR   EnsemblGenomes-Tr; EBT00001585120.
DR   EnsemblGenomes-Tr; EBT00001585121.
DR   EnsemblGenomes-Tr; EBT00001585122.
DR   EnsemblGenomes-Tr; EBT00001585123.
DR   EnsemblGenomes-Tr; EBT00001585124.
DR   EnsemblGenomes-Tr; EBT00001585125.
DR   EnsemblGenomes-Tr; EBT00001585126.
DR   EnsemblGenomes-Tr; EBT00001585127.
DR   EnsemblGenomes-Tr; EBT00001585128.
DR   EnsemblGenomes-Tr; EBT00001585129.
DR   EnsemblGenomes-Tr; EBT00001585130.
DR   EnsemblGenomes-Tr; EBT00001585131.
DR   EnsemblGenomes-Tr; EBT00001585132.
DR   EnsemblGenomes-Tr; EBT00001585133.
DR   EnsemblGenomes-Tr; EBT00001585134.
DR   EnsemblGenomes-Tr; EBT00001585135.
DR   EnsemblGenomes-Tr; EBT00001585136.
DR   EnsemblGenomes-Tr; EBT00001585137.
DR   EnsemblGenomes-Tr; EBT00001585138.
DR   EnsemblGenomes-Tr; EBT00001585139.
DR   EnsemblGenomes-Tr; EBT00001585140.
DR   EnsemblGenomes-Tr; EBT00001585141.
DR   EnsemblGenomes-Tr; RCFBP_10043.
DR   EnsemblGenomes-Tr; RCFBP_10045.
DR   EnsemblGenomes-Tr; RCFBP_10075.
DR   EnsemblGenomes-Tr; RCFBP_10076.
DR   EnsemblGenomes-Tr; RCFBP_10101.
DR   EnsemblGenomes-Tr; RCFBP_10130.
DR   EnsemblGenomes-Tr; RCFBP_10241.
DR   EnsemblGenomes-Tr; RCFBP_10314.
DR   EnsemblGenomes-Tr; RCFBP_10317.
DR   EnsemblGenomes-Tr; RCFBP_10320.
DR   EnsemblGenomes-Tr; RCFBP_10745.
DR   EnsemblGenomes-Tr; RCFBP_10757.
DR   EnsemblGenomes-Tr; RCFBP_10826.
DR   EnsemblGenomes-Tr; RCFBP_10828.
DR   EnsemblGenomes-Tr; RCFBP_10829.
DR   EnsemblGenomes-Tr; RCFBP_10832.
DR   EnsemblGenomes-Tr; RCFBP_10855.
DR   EnsemblGenomes-Tr; RCFBP_10913.
DR   EnsemblGenomes-Tr; RCFBP_10914.
DR   EnsemblGenomes-Tr; RCFBP_10920.
DR   EnsemblGenomes-Tr; RCFBP_10929.
DR   EnsemblGenomes-Tr; RCFBP_10957.
DR   EnsemblGenomes-Tr; RCFBP_10958.
DR   EnsemblGenomes-Tr; RCFBP_10971.
DR   EnsemblGenomes-Tr; RCFBP_11108.
DR   EnsemblGenomes-Tr; RCFBP_11109.
DR   EnsemblGenomes-Tr; RCFBP_11111.
DR   EnsemblGenomes-Tr; RCFBP_11147.
DR   EnsemblGenomes-Tr; RCFBP_11171.
DR   EnsemblGenomes-Tr; RCFBP_11194.
DR   EnsemblGenomes-Tr; RCFBP_11195.
DR   EnsemblGenomes-Tr; RCFBP_11236.
DR   EnsemblGenomes-Tr; RCFBP_11237.
DR   EnsemblGenomes-Tr; RCFBP_11362.
DR   EnsemblGenomes-Tr; RCFBP_11473.
DR   EnsemblGenomes-Tr; RCFBP_11501.
DR   EnsemblGenomes-Tr; RCFBP_11502.
DR   EnsemblGenomes-Tr; RCFBP_11526.
DR   EnsemblGenomes-Tr; RCFBP_11527.
DR   EnsemblGenomes-Tr; RCFBP_11837.
DR   EnsemblGenomes-Tr; RCFBP_11839.
DR   EnsemblGenomes-Tr; RCFBP_11888.
DR   EnsemblGenomes-Tr; RCFBP_11889.
DR   EnsemblGenomes-Tr; RCFBP_11903.
DR   EnsemblGenomes-Tr; RCFBP_16s_rRNA_1-1.
DR   EnsemblGenomes-Tr; RCFBP_16s_rRNA_2-1.
DR   EnsemblGenomes-Tr; RCFBP_16s_rRNA_3-1.
DR   EnsemblGenomes-Tr; RCFBP_20088.
DR   EnsemblGenomes-Tr; RCFBP_20157.
DR   EnsemblGenomes-Tr; RCFBP_20158.
DR   EnsemblGenomes-Tr; RCFBP_20399.
DR   EnsemblGenomes-Tr; RCFBP_20458.
DR   EnsemblGenomes-Tr; RCFBP_20495.
DR   EnsemblGenomes-Tr; RCFBP_20496.
DR   EnsemblGenomes-Tr; RCFBP_20498.
DR   EnsemblGenomes-Tr; RCFBP_20499.
DR   EnsemblGenomes-Tr; RCFBP_20538.
DR   EnsemblGenomes-Tr; RCFBP_20540.
DR   EnsemblGenomes-Tr; RCFBP_20541.
DR   EnsemblGenomes-Tr; RCFBP_20542.
DR   EnsemblGenomes-Tr; RCFBP_20545.
DR   EnsemblGenomes-Tr; RCFBP_20552.
DR   EnsemblGenomes-Tr; RCFBP_20553.
DR   EnsemblGenomes-Tr; RCFBP_20594.
DR   EnsemblGenomes-Tr; RCFBP_20596.
DR   EnsemblGenomes-Tr; RCFBP_20618.
DR   EnsemblGenomes-Tr; RCFBP_20622.
DR   EnsemblGenomes-Tr; RCFBP_20623.
DR   EnsemblGenomes-Tr; RCFBP_20836.
DR   EnsemblGenomes-Tr; RCFBP_20844.
DR   EnsemblGenomes-Tr; RCFBP_20856.
DR   EnsemblGenomes-Tr; RCFBP_20941.
DR   EnsemblGenomes-Tr; RCFBP_20942.
DR   EnsemblGenomes-Tr; RCFBP_20997.
DR   EnsemblGenomes-Tr; RCFBP_21140.
DR   EnsemblGenomes-Tr; RCFBP_21295.
DR   EnsemblGenomes-Tr; RCFBP_21409.
DR   EnsemblGenomes-Tr; RCFBP_23s_rRNA_1-1.
DR   EnsemblGenomes-Tr; RCFBP_23s_rRNA_2-1.
DR   EnsemblGenomes-Tr; RCFBP_23s_rRNA_3-1.
DR   EnsemblGenomes-Tr; RCFBP_5s_rRNA_1-1.
DR   EnsemblGenomes-Tr; RCFBP_5s_rRNA_2-1.
DR   EnsemblGenomes-Tr; RCFBP_5s_rRNA_3-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA1-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA10-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA11-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA12-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA13-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA14-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA15-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA16-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA17-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA18-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA19-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA2-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA20-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA21-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA22-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA23-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA24-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA25-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA26-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA27-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA28-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA29-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA3-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA30-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA31-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA32-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA33-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA34-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA35-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA36-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA37-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA38-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA39-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA4-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA40-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA41-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA42-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA43-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA44-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA45-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA46-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA47-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA48-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA49-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA5-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA50-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA51-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA52-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA53-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA6-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA7-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA8-1.
DR   EnsemblGenomes-Tr; RCFBP_tRNA9-1.
DR   EuropePMC; PMC2900269; 20550686.
DR   EuropePMC; PMC4736150; 26830494.
DR   EuropePMC; PMC5796747; 29422785.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01070; sucA.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02276; Hammerhead_II.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; FP885897.
DR   SILVA-SSU; FP885897.
DR   StrainInfo; 760698; 0.
XX
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software)
CC   are available in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3417386
FT                   /organism="Ralstonia solanacearum CFBP2957"
FT                   /strain="CFBP2957"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:859656"
FT   gene            378..1955
FT                   /gene="dnaA"
FT                   /locus_tag="RCFBP_10001"
FT   CDS_pept        378..1955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="RCFBP_10001"
FT                   /product="chromosomal replication initiator protein DnaA,
FT                   DNA-binding transcriptional dual regulator"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10749858; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10001"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41321"
FT                   /db_xref="GOA:D8NK09"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41321.1"
FT                   /translation="MQDFWHAASAQLESELTPQQFKTWIKPLTPLSFDEQACMLRIAAP
FT                   NRFKLDWVKSQFSGRIQSLACDYWEMQVDVQFVLDPTAGQRQAAMQPALAPMPMQPQAA
FT                   QPMRTQAAPAMPHAAPARPTGAPYRETAAATAAHAAADIDVPVMDAAEASAQSYRVPAS
FT                   APSAAMMSLSAPPAAPVDDTVHERSRLNPILTFDNLVTGKANQLARAAAVQVANNPGKS
FT                   YNPLYLYGGVGLGKTHLIHAIGNFMLMENPRARIRYIHAEQYVSDVVKAYQRKAFDDFK
FT                   RYYHSLDLLLIDDIQFFSGKNRTQEEFFYAFEALIANRAQVIITSDTYPKEITGIDDRL
FT                   ISRFDSGLTVAIEPPELEMRVAILMKKAQAENVTVPEEVAFFVAKHLRSNVRELEGALR
FT                   KILAYSNFHGKEITIEVTREALKDLLTVQNRQISVENIQKTCADFYNIKVADMYSKKRP
FT                   ANIARPRQIAMYLAKELTQKSLPEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELH
FT                   VLEQTLKG"
FT   gene            2233..3348
FT                   /gene="dnaN"
FT                   /locus_tag="RCFBP_10002"
FT   CDS_pept        2233..3348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="RCFBP_10002"
FT                   /product="DNA polymerase III, beta-subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number="2.7.7.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1575709; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10002"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41322"
FT                   /db_xref="GOA:D8NK10"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41322.1"
FT                   /translation="MQLVKTSRDNLLRPLQIVSGIVERRHTLPILANLLIRKNGERVSF
FT                   LSTDIEIQITTHADCGAGNGDIATTVAARKLVDILRAMPDGEVSLTLNDKRMSVQSGKS
FT                   RFALQTLAAEEFPTVAEANDFGARITLPQKTLKHLLAMVHFAMAQQDIRYYLNGMLLVV
FT                   DGKQVMAVATDGHRLAYCGVETGEQPAGAGGRHEVIIPRKTILELQRLLEDVDDPVSVQ
FT                   LASNQVKFTFGNIELISKLVEGKFPDFQRVIPKGYRNSFTIDRTFLQQALQRTAILTTD
FT                   KFKGVRCMLDTNVLKISSTNADQEEAQEELEIDYQGDALDIGFNVTYLLDVLANLKAEK
FT                   VQVSLGDSNSSALITLPDDDTFKYVVMPMRI"
FT   gene            3485..6013
FT                   /gene="gyrB"
FT                   /locus_tag="RCFBP_10003"
FT   CDS_pept        3485..6013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="RCFBP_10003"
FT                   /product="DNA gyrase, subunit B (type II topoisomerase)"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /EC_number="5.99.1.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2174443; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10003"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41323"
FT                   /db_xref="GOA:D8NK11"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41323.1"
FT                   /translation="MTEQQKPQSTPAESSSYGAASIQILEGLEAVRKRPGMYIGDTSDG
FT                   TGLHHLVFEVLDNSIDEALAGHCTEIHVTIHTDNSISVIDNGRGIPTGIKFDDKHEPKR
FT                   SAAEIVMTELHAGGKFDQNSYKVSGGLHGVGVSCVNGLSKWLKLTVRRDGKVHHMDFAR
FT                   GIPQNRLLEQAEAPDGKMVEVSPLRTSGTTDKRGTEVHFLADEEIFTNVEYHYEILSKR
FT                   IRELSFLNNGVHIKLTDQRTGKEEDFAFSGGVKGFVEYINKNKTVLHPTVFNAQGEKDG
FT                   VGVEVSMQWNDGFNEQVLCFTNNIPQRDGGTHLTGLRAAMTRVINKYIADNEIAKKAKV
FT                   ETSGDDMREGLACVLSVKVPEPKFSSQTKDKLVSSEVRLPVEEVVAKALTDFLLETPND
FT                   AKIICGKIVEAARAREAARKAREMTRRKGVLDGMGLPGKLADCQEKDPALSELFIVEGD
FT                   SAGGSAKQGRDRKFQAILPLKGKILNVERARFDKMLSSQEVLTLITAMGTGIGKDDYNL
FT                   DKLRYHRIIIMTDADVDGSHIRTLLLTFFYRQMPEIIERGHVYIAQPPLYKIKHGKEER
FT                   YIKDDNEMAAYLMRQALDTALLVRADGTEIASDALAELARQYQFSRAVIERLSRVIDAD
FT                   ALRAIAEGVALDLSSAASAEASAQALKARLLEMQGNASSANGGATADAFMQYDEKHEKY
FT                   RVMVVRRQHGNQRLSHIDADFVAGADYATLSQTAQTFQGLIGEGAKVRRGTGDKQREQA
FT                   VTDFHAAITWLLAEAERGISRQRYKGLGEMNPGQLWETTMDVTQRRLLKVQIEDAIAAD
FT                   QIFTTLMGDDVEPRRNFIETNALVARNIDV"
FT   gene            6243..6602
FT                   /locus_tag="RCFBP_10004"
FT   CDS_pept        6243..6602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10004"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10004"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41324"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41324.1"
FT                   /translation="MFTKEDEIWNRAALDGGGKNPSEGDVNLASALLLHSLAMNGGVLH
FT                   ALQVLTDQQRVAAIVGFRYFGFYKVADLLSEPFSDTDEDEERLEDTYSQEIPLDEVLFN
FT                   AFCAKLATDSQAFAA"
FT   gene            6671..6979
FT                   /locus_tag="RCFBP_10005"
FT   CDS_pept        6671..6979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10005"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10005"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41325"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41325.1"
FT                   /translation="MRKHFPAAGEATWAWVNVADQDGLREEQLLKLLDEYIPSELLLVE
FT                   AHRKVAAFLPRASVTQFVSEHIGTGNIRICDRAFRGFVVVAANGVAAGWPPSQSGEQ"
FT   gene            7134..7400
FT                   /gene="lcrS"
FT                   /locus_tag="RCFBP_10007"
FT   CDS_pept        7134..7400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lcrS"
FT                   /locus_tag="RCFBP_10007"
FT                   /product="Transposase"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10007"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41326"
FT                   /db_xref="GOA:D8NK14"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41326.1"
FT                   /translation="MKTSKFTEAQIAFALKQAELGTKVEEVCRKLGISEATSYNWKKKY
FT                   GGVGPSELRRMRQLEEENAKLKRLVADLSLDKAMLQDVLSKKL"
FT   gene            7421..7897
FT                   /locus_tag="RCFBP_10006"
FT   CDS_pept        7421..7897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10006"
FT                   /product="transposase"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10006"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41327"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41327.1"
FT                   /translation="MVDELRDRYRVSLTKACALFHMSRSLYGYRSVARDSSAMLARIKE
FT                   IAATRVHYGYHRVHVMLQREGWKDNHKRVYRLYRAEGLSLRHTRPKRNKSARLRQPKSI
FT                   ITMHQRNLEHGLCIRCPVRWPTPAGVDGRGQLHQGKPGHRSGLTPEGGRRCASA"
FT   gene            7884..8276
FT                   /locus_tag="RCFBP_10008"
FT   CDS_pept        7884..8276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10008"
FT                   /product="transposase; integrase, catalytic region
FT                   (tISRso16b)"
FT                   /function="17.2 : Prophage functions"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10008"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41328"
FT                   /db_xref="GOA:D8NK16"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41328.1"
FT                   /translation="MRVLDAVVAERDTPQTIKVDNGSEFISKAMGRWAYEHGVELDFSR
FT                   PGTPTDNAKVESFNGWFRQECLNEHWFLSLADARSKIADWRRYYNENRPHSALQWATPA
FT                   EFARRARKNASTDDSTTPEISPSGRY"
FT   gene            complement(8296..8559)
FT                   /locus_tag="RCFBP_10009"
FT   CDS_pept        complement(8296..8559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10009"
FT                   /product="putative HhH-GPD family protein"
FT                   /function="8 : DNA metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10009"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41329"
FT                   /db_xref="GOA:D8NK17"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41329.1"
FT                   /translation="MRRYFAIAPVMADIRYDKGLHAVAYRVLSGGDAPKMNWAILDVAA
FT                   TYCKPRQPACPSCPLKRSCAHARSGVVSPSVQGKLSLKGRST"
FT   gene            9075..10391
FT                   /locus_tag="RCFBP_10010"
FT   CDS_pept        9075..10391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10010"
FT                   /product="putative cytosine-specific methyltransferase"
FT                   /function="8.2 : Restriction/modification"
FT                   /EC_number="2.1.1.37"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10010"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41330"
FT                   /db_xref="GOA:D8NK18"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41330.1"
FT                   /translation="MDNTKPLRFADVFAGCGGLSLGLLEAGCQGVFAIERSPLAFETLR
FT                   HNLIDGKQHKFDWPNWLPKEAMTCEDLLFRHGAQLDGIKGAIDLIVGGPPCQGFSTAGR
FT                   RDPADPRNQMTEQYLVLVEKLQPRFLVIENVAGFNMRFDDEENLDKLLKDPKHDSYADY
FT                   VAGRLEDLGYSVFRGLVNCSDFGVPQNRLRYLVLCELRGKSEGPMPDLFQELLKGRKAF
FT                   LTSKDLPVKRKTTVKEAIADLLVAGKPRVENEDSEVKGFKEAVYDAPRNPKGYLKLMRA
FT                   YSPGEAPNSRRLPNHKKTTIEYFKKVQKVCRPGYSLTVKQRAKIGTKKHSTTVLHADLP
FT                   APTVTTLPDDILHYSEPRILTVRENARLQSFPDWFEFRGKYTTGGKQRKQECPRYTQVG
FT                   NAVPPLLAEAIGRLVSSRSQAVTVEPDERTCLTTADIIV"
FT   gene            10550..12655
FT                   /locus_tag="RCFBP_10012"
FT   CDS_pept        10550..12655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10012"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10012"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41331"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41331.1"
FT                   /translation="MSEQQRRARFPNDLVDWAGHHSGGVKRLFDDHSGRPGGVLLKTNL
FT                   LSKLQNWAGMFATDAAQCPSVLLLVGGPGNGKTEAIESTIRWLDKSLGCDDRLVQVLAD
FT                   AFHPENGLVPRVVQVDAGRLAQTPRELRLSIVQDASAVVGCEGRSPASLLVEELSNLTP
FT                   GDPSHVYLCCVNRGVLDDALIHALENGLNVSRIVLEAITRAVSLASDAPTCWPLEGFPG
FT                   MAVWPMDAESLLVNPIGEPVAPAATLLQQALAQADWPTPGTCSAGERCPFCNSQLLLSR
FT                   EGPQQALLRILRWYELGSGKRWSFRDLFSLVSYLLAGYRSAEARHQRSPCEWAAELVDL
FT                   DKGLADAKKPTKQALTAIFKLAASSYQHALFHHWDKEIAASLRKDIKELGLEGDRTLMG
FT                   LQHFLHERRAAYLPATIASLLDGLVELLDPALANPDSEVPVSTRNTVVLRDLDIRFSRS
FT                   IAEGIEFVRKYQVLSATELDLLRRLATVDVHLSLPQVRRKRPATATRVQHVLRDFAGRL
FT                   VRRSICTRTATVADAEVLHAFQSVVEDDRSSRLYEVADQVERLLNNGQDFEISLTTTFG
FT                   QPLPPPQRQATLIVPSRHVGMLPPANGGRPRAPICFLEVGSGQSARPIALTYDLFKAVK
FT                   ELERGLSPASLPRAVVALLDTTRARLAGPIVRDREILRRAKIRVGTDGTVIASSWDGFV
FT                   SRNERHR"
FT   gene            12655..14181
FT                   /locus_tag="RCFBP_10014"
FT   CDS_pept        12655..14181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10014"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10014"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41332"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41332.1"
FT                   /translation="MTLVDFKQAPWRTSHKKYSDSALAIIPAPEYASSEVLVSSLYRTI
FT                   GFEAVSEGSVPQAGRDHDKFVQKHRDKRRTEPPGVLVGADTWSTIIHGVLESPKLPNQS
FT                   SKRFLQVSPLVPGLAVLSGSARLSSNSWHAGGLIRRMIWLGSKDEVSASALWAELFSAM
FT                   DVGENDDVFARWLREETSAWTAPSPSWQLVPPARGDSVTLASADFEGLQFPARQFTKDL
FT                   AAIVAAKNSMTRRQWISLLEAILRLAAVSHVTWLCDVQARIWRNVQVALSEEESSNGER
FT                   ITVPVFPQSPLYMAYGSKALSGFKDKASSYLQSRLGINAVLWFLDDVGQPYVGALSSSE
FT                   DVTNLCRHIRRNRAVLASAGITKTIAEVLESEARALLCKKGIGANLTEFARHCLGQRQS
FT                   ASPLLRGYDQGYVLRKNGTSAASPWVVSLGPVSVLALVHCALFGMGGPRSIQRLVQHLA
FT                   AYGVAVDRNDIASSDLGHQLRMLGLVLDSPDAESGMLLLPPFPANEDVVA"
FT   gene            14193..19730
FT                   /locus_tag="RCFBP_10015"
FT   CDS_pept        14193..19730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10015"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10015"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41333"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41333.1"
FT                   /translation="MKNLAETLADYIRAKVVDATAGRSGARLESRFIFHGPSLELLVPV
FT                   YEALAVEGGIRISGAEGFATLPVLLQIPTMDEVIQNPNIGQSGRCDESHLLHLRNDPHC
FT                   PSFVALVPPGLHNNMSVASTTDEFGVSALNNAKHAPFEAWWKDEFVQFLVTKALEGAGL
FT                   EGEPLREARVVAKYAAAAVDDVEPEPGSRNAAWRLLSRLFSVPSVDIHLAPSLAVALAC
FT                   GMPSSTSTDSSMKSLQDVLAQLANALADGFGTGISLMQQNASAEVKGALDEFLKHLRAR
FT                   CDVPTAFERATPAFYLPADGITLEQPPDWWLILSSERWTELMAEEPEEVGDLSIECLNP
FT                   ILPLRRGMPAIVQDAVRLAVFTGTEEIAAPVDVLLQRTAGGARGKQSISLKVDSSSALY
FT                   VDDQVPPHKASMSFKATALGHKAASIKVISLARWSPGVLVSCRLADKLSPPKKPGRRST
FT                   VGPNWEMTLALPGSGRYELLVFVSPDVEITEVVGVPDDATEIDEGPASLNVVPVTDDQY
FT                   QVEVDVDGKYQVDVRFQRTGQASVETCRVYITCVEAVEEGCRSEFERLIKRNRQHLERF
FT                   DAKAVIQLDRHARTSSLQSWMLEEQHVEKSFRPLVIAEDYAAIWAPPNWDSTEGACLSQ
FT                   GRFLHDPRPDTAAFLPPPHFIAARCELAKFIRDTDEQSGLMESAQLGVWLAKRPDFRTL
FT                   IEGYLDAYIAWLASDPDVACWVDVVAVASLEPDGRTLSRIPDAILLSPLHPLRLAWHCV
FT                   AQRVLHEAVDGEDPAPCPASSVIDPDCVPDLLTMSLQAPGGIERVDFVSVECSSDYWSV
FT                   LWNGARLRQLAERCKKPPFDQAFGISVGGISSGFSSAQVARALEDVSGLLAAKPVVNLV
FT                   VSSAGGTTDACNEGLASWCARRFGNGDGAASKHAVGRRTLEVFDTRQNGSRPDEATIAN
FT                   LAEDTEGLVRWFNGQPAGAKPDLGIIAQLESAEPESTGVGMRSPLGFGGLIRHRIRRQL
FT                   PGAFLSESRQGLQMPASGDVLADKVSACMLAMESRRDDKVGLRFAPNVHAVKDMLDVKR
FT                   ADFVAVSSSAIDPACFLAEWIKGAYLWDYDLPAYSSRAGDTSGYYLLSQVKDADRDGLR
FT                   RVLSTLPGCDSLGDEHVEQILLEVARRGIPTVRGLSGDNTGATGDLGLFVAVRLLQDQF
FT                   RTAGHMSSLLPVLGGSHQDITIAIIVPVDPFRGYLADLAKSVGKDGREASLSRPDLLVV
FT                   GIRLTDGLVRIKLTPVEVKCRLNTALSTAETTDALSQARALSTLFRAIDTRAAKSVAWR
FT                   IAYQHLLLSMIGFGLRVYSQHRVVGDQASRWAEYHERIATAILCPESSIEVDETGRLIV
FT                   IDDSPDSVPHDWDSDGFAESVVIALQHASRIVNGDSQSFYDAVRSRVGDWQLLPQPAEV
FT                   KASVSVETSAPLAMRETIDTTIAVASPIASTEHAGGLDSRLASNEAATNKHAGSSADSG
FT                   STSEPDSLGVRLSIGVTVDGFEPKALKLNVSDTRLNQLNLGVVGDLGTGKTQLLKSLIY
FT                   QVAKSTNANRGIKPSFLIFDYKRDYSNPDFVAATGARVVKPTRLPLNLFDTSMMGESVA
FT                   PWLDRFRFFADVLDKVYTGIGPVQRDKLKGAVRAAYEVCDVQGRAPTIYDIHSEYRGLL
FT                   NGKSDSPMAIIDDLVDMEIFTRDPKEALPFDEFLDGVVVVSLDSLGQDDRSKNMLVAIM
FT                   LNMFYENMLKTPKRPFVGSDPQLRVVDSYLLVDEADNIMRYEFEVLRKLLLQGREFGVG
FT                   VILASQYLRHFKAGATDYREPLLTWFIHKVPNVTAAELGALGFTSDLGELSERVKSLPN
FT                   HHCLYKSFDVAGEVIRGLPFYELIRNNSSG"
FT   gene            19841..20107
FT                   /locus_tag="RCFBP_10016"
FT   CDS_pept        19841..20107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10016"
FT                   /product="transposase"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10016"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41334"
FT                   /db_xref="GOA:D8NK22"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41334.1"
FT                   /translation="MKKSRFTNSQIIEALKRVEAGLAVPELCRELGISTATFYKWRSKY
FT                   GGMDVSLMARMKELEAENARLRKMYVEEKLKAEIVAEAFEKTW"
FT   gene            20128..20928
FT                   /locus_tag="RCFBP_10017"
FT   CDS_pept        20128..20928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10017"
FT                   /product="Integrase, catalytic region"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10017"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41335"
FT                   /db_xref="GOA:D8NK23"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41335.1"
FT                   /translation="MAERAVQARGLSIRLACEAFGISQTCYRYAGKRNQENDEIADWLL
FT                   RLTDNHRNWGFGLCFLYLRNVKGFGWNHKRVYRIYRELELNLRIKPRKRLVRQAPEPLS
FT                   VPLAQNQVWSMDFMHDQLADGRSIRLFNVIDDFNREALGIEIDFSLPSERVIRSLEQII
FT                   GWRGKPRSIRCDNGPEYLSGLITTWAQANGIKLEYIQPGKPQQNAYVERFNRTVRYEWL
FT                   SQYHWGDLEHVQRFATDWMWTYNHDRPNMALGGFTPKQRLAMAA"
FT   gene            complement(20996..21151)
FT                   /locus_tag="RCFBP_10018"
FT   CDS_pept        complement(20996..21151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10018"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10018"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41336"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41336.1"
FT                   /translation="MSINRAFEANAQLAKASKPGMCALDYPAMLAEPVVPLNATASNPG
FT                   SNAPLA"
FT   gene            21741..22001
FT                   /locus_tag="RCFBP_10019"
FT   CDS_pept        21741..22001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10019"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10019"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41337"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41337.1"
FT                   /translation="MTSKRRIYLTGALAGREFLRRTQSDLHVHQQYLPESLRWEMVFTT
FT                   ASQPPEFLAGFVDAIGAFVLMTLEGCDINPQTWEVLAAVER"
FT   gene            22424..23560
FT                   /locus_tag="RCFBP_10020"
FT   CDS_pept        22424..23560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10020"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10020"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41338"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41338.1"
FT                   /translation="MTIRILSALEQDLLNPDSTDAAVVPHPDYMARCRELAAGYHALRQ
FT                   RQEPGERPLRAYLLFDIWDGNPLATQLSEAWPEAAAARAAVPDQYYAGREGEAPCVVPL
FT                   PDNVLPDGATDTLAELRAQETLAGWLEDASRRASQRLVRQYFCAVLFSADSAAWVARYL
FT                   ASLGFQYPPGSRTARLFRYQDPRVMQRVWPALSAAQQGMWLGAVEGWWSLTQPWGPWAT
FT                   EDLVVPGNAAVPAPPWFKTERPMVPDGQTETLMLSRLMNAEQWRHAHSAQTGNQAWMRF
FT                   AENGIDPHEQPDADLMLQLLAAGASHHLDGLNLEDFVWCSLRYREGPPSIDWRAPHWSR
FT                   VLEQTLQALNADPDTRFASAFDACLNPGEEDHGAHRPV"
FT   gene            23538..26321
FT                   /locus_tag="RCFBP_10021"
FT   CDS_pept        23538..26321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10021"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10021"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41339"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41339.1"
FT                   /translation="MAHIAPCEQCNRKGLPILFTRYAAGYSSRPKGLAVLDQFKPTGHL
FT                   RAQPGDVPIKTGRYGVRMLRAGYLYLRIERRGLSEWQGYAVHPHGYLRQFPVMVLEQAQ
FT                   TMVPCERDARPANNSLVWVEDAKNVKSLWYAFHPDPIDPRHLKSEIEPNLSQYMQRFDV
FT                   AGWLAGSTGQADTQQPAQLDKQVLEFAALTDEQVQTVGNEQCFGLMGMTPQERGWGNYE
FT                   TEENEQQFIAVPDAPPVVVDDVRTVLITQPTYQKKHGPRLEGMRKFLQDNKGAVVACED
FT                   ALGIAQELSLHHLTAAIPYIAWLKETDKQGISNAWKDSASRSVHAIKSALEKKAVADYD
FT                   GSIDNLKGAREVMGGHYPGSDSQEPIRLRRPDGTDETISVQELNRRRMANLDQQIEQRT
FT                   AKRPKAVEDASDTALTNVQTYCNMDAVDAFDIAHKGKLKLRDENMNHIAEDLLPWLKSD
FT                   SLTDRALGLYNEHASSDTAEDGMRCASQLCTILLQLDNSPKGRAWYGALDLFTPHKKNL
FT                   VWRMLSLNNREISQELESALKQLNRPLPPDDSVPADARDTANNQKAYADALAAIKAMGK
FT                   TIKNADKINKETAKILVAIDEYRTGKDKAAAVTKGKASLAEIHKAALESRSSILLAAVL
FT                   GKFRAAPITKLEAVIARTQALMLVHGLGSKAAAHMVEQQQDKLSSQQRKDVFQYLAHKI
FT                   QKTSRNLFNRGGADSAAQEMRVSYVLCGVNTLAIMPALARAYSRQDPRSLADLTTAASA
FT                   LVGSLKQARADFYEKAVYKKVPDVLAQKAQKAGATVAAERELLALKAGAARYVAAGAIV
FT                   GVVVDVVDAAVALQEGKDELLAAYGARALAGGVSIYGTLQTAKYITAPQWLLRLNLWTA
FT                   VATVALTVLIAKIKGKAWENWLQAQPFRKSGSQRTPYRLEADMMRDLADALAEIDG"
FT   gene            26946..27434
FT                   /locus_tag="RCFBP_10022"
FT   CDS_pept        26946..27434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10022"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10022"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41340"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41340.1"
FT                   /translation="MRGLVLYWPPFDPNDPERKGEDVLWVGPKLAGEGLWQYIRTFMEE
FT                   GMDKVPEPNEYEWLRKGFHTPGQHLEETELSASRVLDDIGGRGKNSAQTQFTFLMTFLW
FT                   APLHCLAERLCTWPTFPEEWNSDCGQKRREDGIGPEEPLRWTPSLESLVAEPRKRAHV"
FT   gene            27431..27925
FT                   /locus_tag="RCFBP_10023"
FT   CDS_pept        27431..27925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10023"
FT                   /product="Putative vgr-related protein (fragment)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10023"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41341"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41341.1"
FT                   /translation="MIAKKLKDDGWRIKYGASSRGSYANRKDKTITLDGNLKGNALATT
FT                   QTLAHEVGHASYPFKEDYSSKAAYVNGTLADEGAATLNNIKVQREITANGGTDIGIAGN
FT                   STNHAVYNKAYDQFLKDSNADAARQAIGAQFGKGEITSNTHQPYAEYYGSWYDKSFPPK
FT                   K"
FT   gene            28029..28478
FT                   /locus_tag="RCFBP_10024"
FT   CDS_pept        28029..28478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10024"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10024"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41342"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41342.1"
FT                   /translation="MTVWQAIDALTQQIPFSKTKIENLLSTQLIETDEGGNDVFQFFKS
FT                   NPIKLSDGVVIEDVDLRIKRTGPHPGFLVLSVGGSCIGIDTVRTHYSDLRITDTPRGHS
FT                   LDEVTSHSASLPWGELSFSFKERNPNCLSSVAFDPKKADAGSGAR"
FT   gene            28552..29361
FT                   /locus_tag="RCFBP_10025"
FT   CDS_pept        28552..29361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10025"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10025"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41343"
FT                   /db_xref="InterPro:IPR014894"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41343.1"
FT                   /translation="MPEYQMHDAVIDLPAHFKDKTMHLFTVGEAGTSAFTFVVSRAPME
FT                   PGDTVDTFATRLVSEMRKTLPRFELKHLGESEVDGEAVREIDYQWVSEGTPLHQRQAVV
FT                   MSPVVGRDRTAISFIGTCPKGFTPEAEKAYAELIGSVVLKRSDVPAFVAVPLDSSAMGN
FT                   VFVLQESSRTLYALPSITDLFRHDVMEMFSGVTFYDAQGTRLALEPAPEGQQAWRRPDG
FT                   RHFTLWTTDPQASEPLQARLGDVEAVKGMASLPTIEAVQAALAANPR"
FT   gene            29376..30527
FT                   /locus_tag="RCFBP_10026"
FT   CDS_pept        29376..30527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10026"
FT                   /product="membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10026"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41344"
FT                   /db_xref="GOA:D8NK32"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41344.1"
FT                   /translation="MSTLLAAARLGDPVAHTASKGWMMAGLIAGALIGAAAVVVTGGAA
FT                   LTLVAAAAAGAAAGGGLGEVLGTMSWAPRHVTGNLISGSFNVFVNGRPAVHAHLSQGIC
FT                   GDHSGSPQLVAQGSSTVFINGQPAARMEDMLTCSAVISAGSPNVFIGGATVTTDDISPE
FT                   IPGWVNWTMLAVGVAAAAVLAGPLVAALGTVGGIAGGEAGSWLGGKFFGDGSDGQKWSM
FT                   LGGSLLGGLAGAKGANAALKVTGKTSGVPSSTMQTGARQVLDPNTVKGWDAAEGAYDAI
FT                   RGDATDVSAIAKNTGMSEARIARIKEHVFIKEHALDSGVRRFDADPDIVNSWNRLKTGD
FT                   WVESDLDLLQHERFESKFEAIFKTDYRTAHDAAIRSGRTWTPE"
FT   gene            30532..30771
FT                   /locus_tag="RCFBP_10027"
FT   CDS_pept        30532..30771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10027"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10027"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41345"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41345.1"
FT                   /translation="MAFYIKIEKYEETEFSAKYKFWSVDGNCGEFEINKQSGEVHLLVQ
FT                   VSGDQQGHLFNRAAVKVIREWRQGRLPEMTEWAS"
FT   gene            30913..31128
FT                   /locus_tag="RCFBP_10028"
FT   CDS_pept        30913..31128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10028"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10028"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41346"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41346.1"
FT                   /translation="MRLLSGSEKNWNWHTLDRALSAQGRGGQCNVAQIATSLSEEGLIT
FT                   ISTKDNPAMPTYAITDNGHRWLESHT"
FT   gene            31256..31891
FT                   /locus_tag="RCFBP_10029"
FT   CDS_pept        31256..31891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10029"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10029"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41347"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41347.1"
FT                   /translation="MIPESTFLTAFNSVESQTVIAWHLDPRLNKQHEIEFSRKLGRVLS
FT                   RSERERGFPAEREIVLSGDGVKVRVGNRLEPDTDVRYETYVAFDPVTSTELAESEQIFY
FT                   ALFVLEPEAVIRPAIQKANFPAVYAGWSPVEKIRHWVGVLYRLRRQVGETGRNEDGAFG
FT                   PALLAKMRATDPNIDGILAAILAELGRMEMVDPDTIRAAFNKRTGASV"
FT   gene            31952..32347
FT                   /locus_tag="RCFBP_10030"
FT   CDS_pept        31952..32347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10030"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10030"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41348"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41348.1"
FT                   /translation="MTDSDFEKLDDRELADAALDEKLGFARAKAIVELANRALKNPDLL
FT                   DSVCTAISSDRSIGFHKQAPLGWFGADHIYLSGQEHAMRALLSELDKWSSTEQEDLVRH
FT                   WAGRRGIAAVTKELKELYGWNPHYGNQ"
FT   gene            32334..32582
FT                   /locus_tag="RCFBP_10031"
FT   CDS_pept        32334..32582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10031"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10031"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41349"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41349.1"
FT                   /translation="MGINKGERFSREDIYIDYPFEEVMFRWDHVEKKAYRKFYGERESG
FT                   PIPHDNNLYNEALRSGDEITSEAYTTGKPGSPERRNS"
FT   gene            complement(32596..33162)
FT                   /locus_tag="RCFBP_10032"
FT   CDS_pept        complement(32596..33162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10032"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10032"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41350"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41350.1"
FT                   /translation="MTQHTNIATGSATHPDAWIQAWKFAADAHREQKVKGSDLPYLFHV
FT                   GAVMMELLAVHNALPIEDIDLAVMCAALHDCMEDQGVPIEVLQREFGPHVAAGVEALTK
FT                   RAALPKQDAMIDSLDRIRQQPKAIWCVKLADRIVNLAPPPAHWSAEKITAYREEARVIL
FT                   AALGPAHEGLAVRLEQKIRLYPAAA"
FT   gene            33407..33748
FT                   /locus_tag="RCFBP_10033"
FT   CDS_pept        33407..33748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10033"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10033"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41351"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41351.1"
FT                   /translation="MLSGGPVFLERHGADVELMSVGPAELAVDEASGLQVNVVDYGACL
FT                   SRRPASDIGLKRPLAGVRGRLFYEVRSSRKCSPKKTKSGIARPWMVVAKIRLKEMSTSL
FT                   QPCCYIVWR"
FT   gene            33631..33990
FT                   /locus_tag="RCFBP_10034"
FT   CDS_pept        33631..33990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10034"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10034"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41352"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41352.1"
FT                   /translation="MFTKEDEIWNRAALDGGGKNPSEGDVNLASALLLHSLAMNGGVLH
FT                   ALQVLTDQQRVAAMVGFRYFGFYKVADLLSEPFSDTDEDEERLEDTYSQEIPLDEVLFN
FT                   AFCAKLATDSQAFAA"
FT   gene            34059..34367
FT                   /locus_tag="RCFBP_10035"
FT   CDS_pept        34059..34367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10035"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10035"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41353"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41353.1"
FT                   /translation="MRKHFPVSGEATWVWVNVADQDGLREEQLLKLLDEYIPSELLLVE
FT                   AHRKVAAFLPRASVTQFVSEHLGTGNIRICDRAFRGFVVVAANGVAAGWSPSQPGEQ"
FT   gene            34603..35007
FT                   /locus_tag="RCFBP_10036"
FT   CDS_pept        34603..35007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10036"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10036"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41354"
FT                   /db_xref="GOA:D8NK42"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41354.1"
FT                   /translation="MTKSTDRSDLVALRDLVREFVRERDWEKFHTPKNLAIALSVEASE
FT                   LLEPFQWLVSGDRLELGEARMTAVRHEMADVLVYLLSLADKLNVDLFQAVQEKMDINRA
FT                   KYPAEKVRGDARKYSEYKEEQDETTVRRPL"
FT   gene            34979..35548
FT                   /locus_tag="RCFBP_10037"
FT   CDS_pept        34979..35548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10037"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10037"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41355"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41355.1"
FT                   /translation="MRRLYADHCKTFIEDCERNQIAEKLRQSFKDMRGREPGQSELQSW
FT                   RNSLRTLAMIFSRAGLMNQGVMLEFELPMTSTRVDCLLCGYGADGVPTAVAIELKQWAE
FT                   TEESAGDHEVTTFLAGCQRDVLHPSVQAGQYAMRLRDHHEACYADLNPVRVAACAYLHN
FT                   YIAREHAPPMTTGPQRQSSRVPRHSG"
FT   gene            complement(35515..36378)
FT                   /locus_tag="RCFBP_10038"
FT   CDS_pept        complement(35515..36378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10038"
FT                   /product="putative endonuclease"
FT                   /function="8.2 : Restriction/modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10038"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41356"
FT                   /db_xref="GOA:D8NK44"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41356.1"
FT                   /translation="MARRRKDDNVLEGLFQLARLLPWWLGVALAVIAYVFLHRYATAPL
FT                   PTPTQVASGQLGDMVVGQLFKALAMVGQYLVPLALLGGAIASYLGKRKRDQLAHNVAES
FT                   KHGDALRQMTWREFEMLVGQAFRMRGYTVTETGGGGADGGIDLQLRKGSERFLVQCKQW
FT                   KAYKVSVSVVRELYGVMASQGADGGFVVTSGVFTEDAKAFAKGKNVTLIDGIALTALIK
FT                   QARTTAPTALAIPIPSEQPSPSTTEPNCPRCGSAMVRRKAKRGTNAGSEFWGCIAYPEC
FT                   RGTREL"
FT   gene            36652..37623
FT                   /locus_tag="RCFBP_10039"
FT   CDS_pept        36652..37623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10039"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10039"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41357"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41357.1"
FT                   /translation="MDNTAFRQAVLQHLTVLRTRWPDGGLYLLYVPGEDDPLRLSGNQP
FT                   RTQAIVRQSMLNDIDEAFLPRVITLDCRRVAAYLLETDAALDDPLLEASIALVGSRGGQ
FT                   GGEETSYAVCGWIASADDAGTIARRLSDSVRRSDPRIGRIVRLRWHDPRVLSQMWPQLP
FT                   AEQRVALLGTQLAWVAINAVGQVAVFDAGAEKVAIDQSNPPLLVPDAAQWNRLHNVALV
FT                   NRLLELWRERLRATGGALPQDAVDVLHRHVAQALRHKLDGRDAQTYVLVALGLQEGFEQ
FT                   DTDWCAAIQAAAQAPGTFEDHVAALPEPFWVRYAGESLKHAV"
FT   gene            37694..41245
FT                   /locus_tag="RCFBP_10040"
FT   CDS_pept        37694..41245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10040"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10040"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41358"
FT                   /db_xref="GOA:D8NK46"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41358.1"
FT                   /translation="MQGASCQECGRIYFPLLLVRPTVVDARYAGILRESDYVYATSLDK
FT                   AFGQARREGTVPAVRLLAEGFVLVFYKDRCKWDVWRSYNDGTLKKLLEQVTPEEYARMA
FT                   DGLKDDAKGSVCARGASNLPAGLITLVGPNTQSEIWLACTPHLWAPQVLRDYTTDRHSK
FT                   RATRMTLLKAKAWIEGGTLPEKGTMLLNTDALQHNVIEFNGAIPPAGAKRASILSAFEN
FT                   ALVPLATDRFGQAPAMVRAVRDIEKTAGPKSKDKALIVMLQDPIGVVADHNQIRLMTVE
FT                   AKKAWAAGSPDYNGRDADPERPWKLRSSLHAQTIEGWAIAQAREEARRYVTREMNRGIP
FT                   PMTEEDFRKQKAAGTLPDGATFESIPFMDVDYSRLLKGELPKSTVRLDTEGRPVPQTVG
FT                   LRDHPGQQTTLGYPRLPSADVKAVADHHYNGQTATGRRDRYREKLRFGELTDWRNTYQK
FT                   ASDRWDAEFIAKRDRDYVAWLKSPSLEQAMLHDFDWGINLKNIVPALGTIAQQVSDVAS
FT                   RLVAVEKACGGGALGSDSAKVFVEWLDRPIDDPKNWVDRSLVVPFDATQSIMSDPGKRK
FT                   DTMEKVAGMLEVSQLVREQLKEHQEELTHAAESIAATKEQALNLATAALDEAKAKAAGI
FT                   PKTDPARLETYYRFHIRTRALMEQVTHPDVAQPYVTVRFKIPQGDVLDAVAEAFSKGQI
FT                   EASMTSKAATTRAERRETGRTLRKLAGRPGLDVPESYPVMLTQDTLARIQKQAARAGEE
FT                   LVEVVPDDILGGLKQPFKLPKSLATRLIGEQATAGRATLETLVAKETRVVRVLAVFQVW
FT                   ALLVSLKSLKNAQGYEYVDALMSVFSCVSGLMQGGLAISLTTIEARTVGAGLKLVPRAA
FT                   ANITLLRLASGMAGAAGSAFDAVGSFAKYAARKGTGDTQAATEYFRVGLMFAGSAGALA
FT                   MGASAIYLRSLSQSLAKSTAQRAAAIAVGELGGAAFVGLIGATLTGVGIVVSVIGFGWS
FT                   LYALYMEDDLNDTFLKRSYWGIGDSPVSSFGGPRVSHGDQAPVEAWIKKGLLEEAEAFA
FT                   GLTLGIKITLEWARQEMGTPSIGEMVSPILVGGYKYLTRGHALKAKLESQSHGDNRRIS
FT                   WSITVKDSAGKILTGLTDKDVSLRSDKDSGRDVFEVTLPLDDTAYEQAAQAEFTYKFYE
FT                   QYERVGLSSDTLRVKKN"
FT   gene            41269..41901
FT                   /locus_tag="RCFBP_10041"
FT   CDS_pept        41269..41901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10041"
FT                   /product="membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10041"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41359"
FT                   /db_xref="GOA:D8NK47"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41359.1"
FT                   /translation="MSETYTWSAPDGSGSIHFSLKPDGIEIVAPYGTELEPYTSITAIS
FT                   LIPAISTDAACTVITFNRKAFGLRARQIVWAERPVKNPVQAANYDKWLKALHQALIDRH
FT                   LADGISFRCGTRWSALGWLYSVYPVIRVAALTLIPIGIAAALATQSWAFATTCIGGGSA
FT                   MLLMPKFAKPSIPTELQRIRSYTPDAIPVGCFATAPQGPVRNFVFKA"
FT   gene            41922..42767
FT                   /locus_tag="RCFBP_10042"
FT   CDS_pept        41922..42767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10042"
FT                   /product="transposase"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10042"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41360"
FT                   /db_xref="GOA:D8NK48"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41360.1"
FT                   /translation="MPRKPKAKPVDLPAIPAELLEQFGSGPMTAEAINAATLALKKALI
FT                   ERALGGEMNHHLGYPPGAAKPATVTNQRNGSGAKTVLTEDGPIRIEVPRDRDGSFEPLL
FT                   IPKHERRFKGFDDKIVAMYARGMTVREIQGFLLEQYATEVSPEFISSVTDEVMAEVTAW
FT                   QARPLDPMYPVVFFDALRVKIRETPWYATRPSIWRWECCPTARVTFWACGSKTPKRQVL
FT                   DEGVQRPQDARRGRHPDRRDGRPQGHARSAGGRVSGDHAADLHRSPDPQQPRLCELEGP
FT                   "
FT   gene            42556..43170
FT                   /pseudo
FT                   /locus_tag="RCFBP_10043"
FT   CDS_pept        42556..43170
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10043"
FT                   /product="transposase, IS256 family (fragment)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ41361.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(43411..44256)
FT                   /locus_tag="RCFBP_10044"
FT   CDS_pept        complement(43411..44256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10044"
FT                   /product="putative endonuclease"
FT                   /function="8.2 : Restriction/modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10044"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41362"
FT                   /db_xref="GOA:D8NK50"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41362.1"
FT                   /translation="MAKRKDDNVLQGPFELAHVLPWGLSLALAVTAYGALHSYAVASAS
FT                   TQAAPGQIGDMATGEWFRTLASVGQYLVPLGLLAGAAAAHFVQRKREQQARSAAQRKQG
FT                   DALRQLSWPELERLLGQVFRTHCYTAAETGAGADSGVDLQLHKNGELYLVQCKQWQAYK
FT                   VSVDTVRELHGLMTAQRAAGGFVVTAGVFTADARAFAKGKHIALVDGAALTTLIQQAQA
FT                   AALARKTMPGMRPRPSTERPHCPRCGNVMVRRTVKQGAKTGCHFWGCVTYPECRGTRGL
FT                   "
FT   gene            44456..44626
FT                   /pseudo
FT                   /locus_tag="RCFBP_10045"
FT   CDS_pept        44456..44626
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10045"
FT                   /product="conserved protein of unknown function (fragment)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CBJ41363.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(44855..44926)
FT                   /locus_tag="RCFBP_10046"
FT   CDS_pept        complement(44855..44926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10046"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10046"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41364"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41364.1"
FT                   /translation="MTVQVLKGISPINGSHRLGKQSW"
FT   gene            44907..46475
FT                   /gene="cheD"
FT                   /locus_tag="RCFBP_10047"
FT   CDS_pept        44907..46475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="RCFBP_10047"
FT                   /product="methyl-accepting chemotaxisI(Serine
FT                   chemoreceptor)"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /function="12.3 : Protein interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2033064; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10047"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41365"
FT                   /db_xref="GOA:D8NK53"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41365.1"
FT                   /translation="MSTWTVKRKLATLVTSIIVAFACLTVFLLSRQTAATADIHSLYEK
FT                   DYRAASIIGQIDGLLTRVDINILRMIAIGDPASISNWKAQNTERFNKVDQLLVELSASS
FT                   DPSMTGSIKALGEAYGRMRKGMEHQVEAVEAGDIKRGGEINKNEVKDNADKTFGTLAEL
FT                   KGAQDLIAKNKVQAQEAAASSARIVSITAAVLIALGSLGLGLLIVRDLLRQLGGEPTAA
FT                   AEAVGAMAQGDLSRTIAVQAHDQTSLLAKLKDMQGSLSGIVATVRNNAESVATASAQIA
FT                   QGNQDLSHRTEQQASALQQTSATMDELGSTVGNNAENARQANQLAVGASSVAAEGGDVV
FT                   SQVVGMMKGINDGSKKIADIIGVIDGIAFQTNILALNAAVEAARAGEQGRGFAVVAAEV
FT                   RSLAQRSAAAAKEIKTLITSSVEQVERGTALVDRAGATMEQIVDAIQRVSNIVAEISSA
FT                   STEQSSGVSQVGQAVSQMDEATQQNAALVEESAAAASSLQSQAQQLVQAVAVFKLTHLA
FT                   NAAGH"
FT   gene            complement(46836..47624)
FT                   /locus_tag="RCFBP_10048"
FT   CDS_pept        complement(46836..47624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10048"
FT                   /product="transcription regulator protein, IclR family"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10048"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41366"
FT                   /db_xref="GOA:D8NK54"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41366.1"
FT                   /translation="MTQPDDAPNLLFNQSLEKGLAVLGAFNAQRRTMTIAEVAAVAGIN
FT                   KSSAQRMVYTLEQLGYLRKHPQTRRYQLTPAVMKIGFNYLAANTLIDVANPFLAELTKV
FT                   TTETSCLTEPDRDEMVYVARFVSAHFVPVHMPIGSRIPMYCTASGRAYLAALPEPEARA
FT                   IVEASERIAHTMHTRTEVADIMDMLRETRQRGYATNREELFLGDMTIAAPIVGGNGRPL
FT                   GAIHLVAPTGRWTVDEMEAKLAPPLLQCARAISTSVRALG"
FT   gene            47829..48605
FT                   /locus_tag="RCFBP_10049"
FT   CDS_pept        47829..48605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10049"
FT                   /product="putative amino acid-binding periplasmic (Pbp) abc
FT                   transporter protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10049"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41367"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41367.1"
FT                   /translation="MSFVSFSRRTALVLCMLGCASLAWAQGGTSSAAPTYNVGATATGV
FT                   PFTFLDVKSNSIQGMMVDTVTAVGKAGGFNVNVQQTVFAALIPSLTSNKIDIISAAMLK
FT                   TPTRAQVVDFSDPVYSYGEGLLVKTDDAKAYASLDDLKGEVVGAQMGTVFLDMLNKKGI
FT                   FKEVRSYDSVADMTRDLALGRIKAGLGDQPILAYQIRQNTFQGVKLVSSYKPVNVGDVC
FT                   LVVRKGDAELLGRINKAIAKIKADGTLAAIVQKWGI"
FT   gene            48619..49290
FT                   /locus_tag="RCFBP_10050"
FT   CDS_pept        48619..49290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10050"
FT                   /product="putative amino-acid ABC transporter"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10050"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41368"
FT                   /db_xref="GOA:D8NK56"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR014341"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41368.1"
FT                   /translation="MSAAAFLEHAREFLPILLQGAVVTVEVTVLSFLLSSVIGLALALM
FT                   RLSPVKAVSAAGATVANIIRGLPIIVQLFYIYFVLPDIGIQLTAFQAGVIGLGIAYSAY
FT                   QAENFRAGIEAVDPGQREAAQAMGMRGALIMRRVILPQAFRIALPPYGNTLVMMLKDSS
FT                   LVSTITVAEMTRAGQLIASSTFQNMTVYTLVALLYLLMSLPLVFGLRRLERAMGAGRTQ
FT                   R"
FT   gene            49287..50048
FT                   /gene="glnQ"
FT                   /locus_tag="RCFBP_10051"
FT   CDS_pept        49287..50048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnQ"
FT                   /locus_tag="RCFBP_10051"
FT                   /product="high-affinity glutamine transport protein, ABC
FT                   transporter, ATP binding component"
FT                   /function="1.3 : Glutamate family"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.28"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10051"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41369"
FT                   /db_xref="GOA:D8NK57"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41369.1"
FT                   /translation="MIEIRDLQKHFGEHHVLRGVSLHVDKGEVVCLIGPSGSGKSTVLR
FT                   CINGLESYDGGEIRAFGERVDRDGKAIHTLRSRMGMVFQRFNLFPHRSVLENVMEGPVY
FT                   VKGERPGAARAKAMALLEKVGLAAKAQAYPSQLSGGQQQRVAIARALAMEPEAMLFDEP
FT                   TSALDPELVGDVLEVMRALAREGMTMIVVTHEMGFAREVADRVCFLHSGTIVEEGPAAQ
FT                   VLGAPRQPRTQDFLRRVLHKPVEPATGDLAL"
FT   gene            50045..51352
FT                   /locus_tag="RCFBP_10052"
FT   CDS_pept        50045..51352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10052"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10052"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41370"
FT                   /db_xref="GOA:D8NK58"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41370.1"
FT                   /translation="MTMPSLDLVPGGEPLPPSLWTATAPAAPPTPALQASIATDVLVIG
FT                   GGYTGLSTALHLAERGTGVTVLEANDPGWGASGRNGGQVNPTLKHDPDELVRMLGAARA
FT                   EPLIDVVSRSADLVFDLIDRHGIDCQPVRAGWLQLSYSDKAVPAMHARAHQWARRGVRV
FT                   ELLDRAAVARRVGTEAFAGGWLDGRAGAIQPLAYARGLVHAAQQAGASVHGHTAVTTLE
FT                   RQGSTWVASTGTGAQVRAQRVVIATNGYTGALWPGLAQTVLSANSFIVATRPLKPADAQ
FT                   AILARGETASTSQRLLLYFRKDAAGRLLMGGRGFFTEPRGPQDFAHLERSLELLFPQLG
FT                   RLDYEYRWAGRIAITRDFMPHIHEPAPGMTMALGCNGRGIALCTSLGQHIAARLTDSGH
FT                   AFPYPVSPIVPIPLHGLQRFYIAAGVAWYSLLDKLG"
FT   gene            complement(51436..51906)
FT                   /locus_tag="RCFBP_10053"
FT   CDS_pept        complement(51436..51906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10053"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10053"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41371"
FT                   /db_xref="GOA:D8NK59"
FT                   /db_xref="InterPro:IPR018729"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41371.1"
FT                   /translation="MDYLTIKAIHILSSVLMVGTGFGTAFYLFFANRSGSVEAIAVVSR
FT                   LVVKADWWFTTPTVIIQPLSGAYLIYRAGFPLDSFWLIASLGLYVVAGICWLPVVWYQI
FT                   RMGRLAIAAHEQRVALPDLYWKYARRWELLGYPAFSAMVIVYFLMVLKPINH"
FT   gene            complement(51894..53156)
FT                   /locus_tag="RCFBP_10054"
FT   CDS_pept        complement(51894..53156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10054"
FT                   /product="putative NAD-dependent epimerase/dehydratase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10054"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41372"
FT                   /db_xref="GOA:D8NK60"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR025695"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41372.1"
FT                   /translation="MKVLVCGASGFIGQSISRYLAGVGHEVVRGVRKPVLPGDIPIDFS
FT                   TDTDVPTWLGRLAGIDVVVNAVGILTEHPTARFETIHHRAPAALFAACAEAGVKRVIQI
FT                   SALGAEHGDTPYFKSKHAADQALMRLPIAWQILRPALVYGPDGASASLFRILASLPVIP
FT                   VPEVGQAAFQPIHIDDLVRGIGRAIDPAVPAGQQIDMVGGERVTYRAMLETYRRAMGFE
FT                   HPLYVTIPAALMRAAARLSAWMPGAPLTPDTWRMLQAGSAADAAATTRLLGYPPKRVAQ
FT                   FIAPDCAELLRLRALAAWRTGLLRYVLAMLWMATACVSALVYPMADSLALLKQVGLAGW
FT                   PAIAVLYGASILDLMMGVACIRYPCRALWGMQAALVAGYTVVVCVALPQFLAHPFGPVI
FT                   KNAPILAILAILFAESKSWTT"
FT   gene            complement(53153..53533)
FT                   /locus_tag="RCFBP_10055"
FT   CDS_pept        complement(53153..53533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10055"
FT                   /product="membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10055"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41373"
FT                   /db_xref="GOA:D8NK61"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41373.1"
FT                   /translation="METLSLAVEVAIPIAAGLAVSLYLRGVTHRLLVDLCGTQARSDFW
FT                   VRVTAILITGIPLLLVLAFGRSGHPDAVIGDVARRALSMTTLGIVIAVGAMARAIMGSI
FT                   PKAAAGLQPGPQPGPQPIEASA"
FT   gene            complement(53648..54175)
FT                   /locus_tag="RCFBP_10056"
FT   CDS_pept        complement(53648..54175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10056"
FT                   /product="putative transcriptional regulator arsR family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10056"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41374"
FT                   /db_xref="GOA:D8NK62"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR026282"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41374.1"
FT                   /translation="MELNPIAERFVLHWGEMGTRWGVNRTVAQIHALLYLAGRSMDAEE
FT                   ITQTLGVARSNVSNSLKELQSWSLVRVVHVKGDRRDHFETSTDVWELFKLIVAGRRQRE
FT                   IDPTAVVLRECLDNPDIEEADAGTRQRIEQTLHFIETMSTLADEMLRFKPETLMKMLGV
FT                   SARISQAIRKKT"
FT   gene            complement(54284..55093)
FT                   /locus_tag="RCFBP_10057"
FT   CDS_pept        complement(54284..55093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10057"
FT                   /product="putative hydrolase (alpha/beta hydrolase
FT                   superfamily)"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="3.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10057"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41375"
FT                   /db_xref="GOA:D8NK63"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41375.1"
FT                   /translation="MAMLIQTLQTLQTLLPGPDRSTLRAQRIDGNSARPALVFLHEGLG
FT                   CIEMWGDFPQRLCAATGCPGLVYDRVGYGQSSPMTRPRGLDYLHIAARIELPHVLQTLI
FT                   PDTPYVLIGHSDGGSIALIHAADRPLQLRAAVTEAAHVFVEDVSLAGIREADAAFDAGK
FT                   LAGLVRYHGDKTKQTFKAWSETWQRPDFRDWNIEALLPRIACPLLVMQGDDDQYGTPAQ
FT                   VEAIVRQAGGPATPVLLTDCGHTPHKTHADAVLAQMRAFIDALQLTA"
FT   gene            55320..56105
FT                   /locus_tag="RCFBP_10059"
FT   CDS_pept        55320..56105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10059"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10059"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41376"
FT                   /db_xref="GOA:D8NK64"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41376.1"
FT                   /translation="MNIASQVHKPVDIARSKLPEITLAFWIMKICATTLGETAGDLLSM
FT                   TLKIGYAASSVLLVGIFLVTLGAQLRSRAYHPLLYWTVILSTSTAGTTLSDFMDRTLGL
FT                   GYATGSAILASLLGAVLLYWKLSQKSLSIARVRGGKGELLYWGAILVSNTLGTALGDFL
FT                   ADSSGLGFAGGALLIAGIIALIAAAYYFTGLSRVALFWMAFVLTRPLGATAGDLLTKPV
FT                   SAGGLNLGTVGASLVLLAILLATVGYASWQARRVSLQSA"
FT   gene            56140..56805
FT                   /gene="qseB"
FT                   /locus_tag="RCFBP_10060"
FT   CDS_pept        56140..56805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseB"
FT                   /locus_tag="RCFBP_10060"
FT                   /product="Transcriptional regulatory protein"
FT                   /function="12 : Regulatory functions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10060"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41377"
FT                   /db_xref="GOA:D8NK65"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41377.1"
FT                   /translation="MRVLLIEDDPMIGAVVEAALRDAAYAVDWVRDGQTAIDVSGHQHY
FT                   DVLLLDLGLPGQDGHAVLRTLRARDNPVPVLILTARDAVDERVRGLDGGADDYVLKPFE
FT                   MVELLARMRAVLRRRGGAASPVLSNGMLSLDPATHEVRVGDGEAVRLSGREFALLQTLM
FT                   LRPGAILSRSELEERIYGWGHEVASNAVEFLIHALRKKLGAESIKNVRGVGWMVSKGR"
FT   gene            56781..58121
FT                   /gene="qseC"
FT                   /locus_tag="RCFBP_10061"
FT   CDS_pept        56781..58121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="qseC"
FT                   /locus_tag="RCFBP_10061"
FT                   /product="sensory histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10061"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41378"
FT                   /db_xref="GOA:D8NK66"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41378.1"
FT                   /translation="MDGVQGAVRPSLQRRLSLWLSAIIVAVAVAAGGFAFVSAFGEAHE
FT                   LQDDVLRQVGAMFDPQHLPAAPAEAPVADQESRVIVQLLPAPGSNAGHASTRAAPMFPS
FT                   TLADGMQTARAGKYDYRVWVRTLDDGRRIAVAQETAVRDETARNSALHTVMPFLILVPI
FT                   LLLAMADVLRKMFAPINRLAHEVDQRDERQLHAIAPDAVPDEVRPFVVAINRLLARVAQ
FT                   SVQAQHRFVADAAHELRTPLTALSLQAERLGEAPMSPVAQERLAALRQGIERGRALLEQ
FT                   LLTLARAQADTRAPEGKVSVQRVFRSVLEDLMPLAEDKRLDLGVTTDADARVHASELDL
FT                   FVILRNLVDNAIRYTPDGGSIDLSVRTDGGLAHITVQDTGPGIPAPERARVFDAFYRVL
FT                   GNGATGSGLGLSIVGTLVQRLGGEVALDEAPGAASGLRVTVRLPLAG"
FT   gene            58221..59045
FT                   /locus_tag="RCFBP_10062"
FT   CDS_pept        58221..59045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10062"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10062"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41379"
FT                   /db_xref="GOA:D8NK67"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:D8NK67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41379.1"
FT                   /translation="MPSPQHRYHFPNLLEAFFIVIVLFFTEYLVNALIWKLGRHAGLQP
FT                   MGIYSIGRVLAHGVVFTVLLHHAKGTYRELVHENPSSWQATLAVFAGPVLLLTPGLLLL
FT                   GGLLQRLVVQLFPMSSSMADGWYTFLSGGLGAIVLICLIAPVVEEMLFRGIILRSFLRQ
FT                   YPPGVAIVHSAAVFGMAHLNVYQFVLAFLLGLLLGKLYERTRSLLPGMLVHGCYNTAVT
FT                   ILAWQSERSEWNTAADWSMQSYVFAVVSGGAGAWLLYKLVAPRPASRAEPQA"
FT   gene            complement(59122..66201)
FT                   /locus_tag="RCFBP_10063"
FT   CDS_pept        complement(59122..66201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10063"
FT                   /product="putative type III effector protein (SKWP1)"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10063"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41380"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41380.1"
FT                   /translation="MKFDTNYHHRPPVHFANAGRGDASASSKPQGHRGPRTRSNDLPRP
FT                   ANAPTGVAQRDRTSPSAANKALSNALDYPERGLDRAAAVTLGIQRKEQQHELWSRSGFG
FT                   FPQRCLDMARDNILAERNGHGRALVFLIPCGDAEANAGLLGHYLAKLGDGGHRRIAPAL
FT                   RDGIRACAELCAGYLVHTPWFEGAPVATYSHLANKLSKFPDRTACMEALAWIARQVMLA
FT                   PYLHRLGDRQAAMLVGGLAKNARSDVCRDAILRVTGWLLDDDATRERLNAFQVPMLLNA
FT                   LSKWPAHEDAKFFVLQLADLMAPSSQLLYALDGQGVANSLNALSKWPGEARTEKPVLRM
FT                   AERLVAEPDLLRSMREQEVTSSLNALSKWAHREEATQAMLLLAARLADEPQLRWSVQPQ
FT                   GVATALNALSKLSEAPQAKQAVLLLADRIATEPRLLQALEAQGVANALGALSKWPGEAR
FT                   ALRAAHLLTDRLATDPSLRRALKSQEFTGTLNALSKWPREVAMQHVALQLASRIPAEPE
FT                   LLPALGALNIANALNALCKWPCAEGAKRAALLLAARLEAEPLLCSQLGALELANSLGAL
FT                   AKWPDEAQMGRTAMQLAACLMAQPKLRQSMQAQGVANVLNALSKWPQQDTAKRVAMQLA
FT                   DRVATEPRLLKAMDCQHLANTLSALSRWPDEQQARHTAPVLAAHLMAEPDGRWRALDAR
FT                   YTSNVLFALRKWSDEHWATQLALQLAERIATEPTLLDDVDAQGVSDALSALSKWSGEDS
FT                   ARLATRELACRLIADTALQAAHGTQHLASTLNALAKWQREPEAMRAFWQLSTLLGRASH
FT                   PWRKFNIADMAQIGNAFARLVQDEGEEFERARSVLQRLSIHLELHPECFECSNAGHIGV
FT                   LFKSFASLRMQRELRPLGTPALNRVMALCRETQLRDEPLETVGNLCLGLLPLARSPELA
FT                   RHRVPALKTFESIQPIMARKIDSYLRQGVQATAGSALRAMDGQEACGTRGPALTFYQIL
FT                   KAYTLVARQWKPRYIQGDRQAVLGRQATLKQWVDRTLARTRGVIEADLQEKSWNLIAQI
FT                   EAGDNVLNALDLRIGKELTAITQRHPPTRFNLAGTHARMRTEPGKVRPVKAGVGDTRHV
FT                   TVDLQGRELRVDDGAEPPYSFYARLTGQPLVEVQLPGALSTFMLARTFQYQGEPWRFDL
FT                   FGGSRLTRGHIRQVKSILANSQPVASVLPAMRYADSAPGSAFMALTHKLAPQREDWSRM
FT                   QRALLEMVPRDHVVEGSLRIGWFEDVKVPGTPHPFRLKGPDGTRIALCPDDGCGFMKWE
FT                   VALQIPAVREHIEAWQAVRAKHATPAQQELVAEHEQGANAMPPQALMHYPRDEAVLAEA
FT                   HEAIQHKLDKLRAQVQGPVANGPNGPNAQAPALSPDAVDLLALYQMTIGGGYEGRRIRA
FT                   VPSADDKLYLPTIPMDGFAHPAGDLLVGKPPYDKENLLPIAAERVGTSAKGDATAHFLD
FT                   QCFAIQYSYTGFDDDSGPAADMLHSKGMLIIPPPGYWSSAHNGMDLACSREDLKVLSRW
FT                   KQGRDRAGLPDAMLSTGSLRVKDILMPGRLGALPIPELRKRNMDTDGDDAFVYAGYPKL
FT                   AAHIRQVMEDRSGRRTTEYAFKPPKTASPAFDEQGQYQAGRAREILAVQRGGQLVGSAS
FT                   NAATRFLSQPDELREAMARDMMFGTYDGVDRRLRNGLRARISGSADAPALRDLLVLAHE
FT                   GIARAHLPLAREVALLLHTLTTQLGAAGARPAPPVSAELAQRFGALAEAWAAATDTPAR
FT                   IHAILDHYPVCRLSHEQFPKGQPGYLEGEPELTIRNLFTLAVKVGTDALKSDTGTDLFS
FT                   TLIEQCGLVERRYPDRVRRVPHTKQTAREFRDGRFDPKRAVAALERIPTLAAGVMEDAV
FT                   GALQQAGLLASPLAPAERARAASPGDIKRTAAALNEQAHAASARITSLLQANLRTWAGS
FT                   GPDLGAGAVRLAGLEQAVKSTGSLEEKLGGLLGGKQLDLPEAISQVNDALRYSIVLSPP
FT                   AFTSASRRIVAGLEEHGHVMTERTNHFNRLGSAFRALSVTLQDPSDGLLWEVQFHTEQT
FT                   FTLKARYHNLYKQVQRARYQGASSDALRALLQPAWKDFNAVPTPAGCDEIEDWRQEPAQ
FT                   AAPGLQPGLDGQGAQRTIAAYLLPLARRLGAQARRIEALVSPKVQTALRTCGGNLREDQ
FT                   SGDWRNVIFKKERSIARKIALRQRAAQLAPEAAAAGVRDSLRYEVVLPAEGFGKTVNAI
FT                   LKLLGKQGLKVMRMKNPFAQPDTTYAGVNVNLRLASGNLPGDFEIQFHTAQSLSTKLRG
FT                   HKDYEKLRELPPASTHDGQDEASAEFAAERERLLKKMRDAAALVERPQGIEILIPFDHY
FT                   RDAPPSGTSRRTS"
FT   gene            67260..68537
FT                   /locus_tag="RCFBP_10064"
FT   CDS_pept        67260..68537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10064"
FT                   /product="Putative sugar transport protein (major
FT                   facilitator superfamily)(sotB)"
FT                   /function="7.3 : Carbohydrates, organic alcohols, and
FT                   acids"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10064"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41381"
FT                   /db_xref="GOA:D8NKJ7"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41381.1"
FT                   /translation="MPTLAPQRERHLLWLLALTQFTIIMDFMVMMPLGPQIMHTFGIGP
FT                   AAFATAVSAYSWCSGASGLLAATYIDRFDRRRLLLVVYALFSLSNLACALASTFPLLLA
FT                   ARAFAGLSGGVLGSVILAIVSDVIPPARRGAATGVIMSSFALAAVAGVPIGIALGAHLG
FT                   WAAPFFLLTVLTAVFWLGARRTVPSLTEHLREGGDSLGRILGGLWQLLTHPHHLRAFVL
FT                   TMVMMTAHMTVIPFISPVLVANHGVAPQDLSWLYVAGGAATFFTSRAVGRLADRYGRRR
FT                   AFVVSALLSCIPVLVMTHLPDWPFIGMLLFFPCFMVVLSSRMVPMQALMTTVPAPQVRG
FT                   AFLSANSAVMSLGTGCGAWLGGLLLSTGAGGHIDGYGFNGWVAVAASLFCVLWVRNVKG
FT                   SDAHGDPSMHAPRPAPASAQNEAERA"
FT   gene            complement(68638..69063)
FT                   /locus_tag="RCFBP_10065"
FT   CDS_pept        complement(68638..69063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10065"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10065"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41382"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41382.1"
FT                   /translation="MPHPVRTLTVNIERSCEAVAAFLAEPLNFPAWATGLASGIAPGTQ
FT                   GSGAAPDEWIARAPQGTVFVRFSPANPFGMADHWVRLPDDTVVYVPLRAMHNGSGTTVA
FT                   LTLFQLPGMDDAQFEADAQWVQRDLAKLKTVLESVTA"
FT   gene            complement(69136..70341)
FT                   /gene="hmp"
FT                   /locus_tag="RCFBP_10066"
FT   CDS_pept        complement(69136..70341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmp"
FT                   /locus_tag="RCFBP_10066"
FT                   /product="Flavohemoprotein, Nitric oxide dioxygenase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number="1.14.12.17"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8125952; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10066"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41383"
FT                   /db_xref="GOA:D8NKJ9"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41383.1"
FT                   /translation="MLSEQSKPLIDASVPVLREHGLTITQTFYRNMFASHPELTNLFNM
FT                   GNQANGSQQQSLASAVFAYAANHGNNAALAPVVGRIVHKHAAVGIRPSHYPIVGRHLLG
FT                   AIAEVLGDAATPALLAAWDEAYWLLAAELIAAEARLYAHMQSGPDHRQPVRIIERRQQA
FT                   EDVVSFTLEAVGGTTLADFLPGQYISVQVELAPGVLQQRQYSLSDAPNGRTWRISVKRD
FT                   AGEAGRPAGTVSNWLHENARQGEVLLVSQPYGDFVPQLATDNPIVLMSAGVGITPMIAA
FT                   LNTLAGQNVARKVVFSHASRTASHVAHTDDLEHAARVLPDFEAHVFLESGEAAAFASRP
FT                   AQPGRMTVDAFLDGKVADADFYLCGPLPFMQAQRAALLAGGVPAARIHREVFGPDLLDD
FT                   IL"
FT   gene            70590..71102
FT                   /gene="nsrR"
FT                   /locus_tag="RCFBP_10067"
FT   CDS_pept        70590..71102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nsrR"
FT                   /locus_tag="RCFBP_10067"
FT                   /product="HTH-type transcriptional regulator nsrR"
FT                   /function="12 : Regulatory functions"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 16885456; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10067"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41384"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41384.1"
FT                   /translation="MRLTDYTDYSLRTLIYVAVHPDTLVTIQQIADAFGIPKNHLIKIV
FT                   QGLGQDGFLHTVRGRAGGITLGRPAADINIGDVVRATEPDFSLVECFHGADNHCIITRV
FT                   CGLRGVLAAALQAYFEVLDTYTLQDLIDKPAALNRVLAEGVAVAMPGKGRAPKAAPAAG
FT                   ARARKSS"
FT   gene            71220..72665
FT                   /locus_tag="RCFBP_10068"
FT   CDS_pept        71220..72665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10068"
FT                   /product="putative typeI restriction enzyme (hsdM)"
FT                   /function="8.2 : Restriction/modification"
FT                   /EC_number="2.1.1.72"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10068"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41385"
FT                   /db_xref="GOA:D8NKK1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41385.1"
FT                   /translation="MMTADLQRHVDRLWDTFCAEGIADPIEIIEQLTCLLCLKRQDDRH
FT                   ALAIHLARRTGQPPGSDTRPVFREDQDTLRWSVFRTLNPQDRFDTMSAHGIPFLRALGD
FT                   KDPVCGRHLQDIRFTLPTPALLDKVVQQLDAIPLHRRDVRGAVYDALLGRIPQAGQGGQ
FT                   FHTPRHIVRFMVALTRPAPSDTLCDPAAGTGGFLAAAGEYLRREHPGLLHDTQQAAHFH
FT                   HGMFHGYEIDRTMLRIGSMNLLLHGVEGPNLRDHDALAPTDTNEAGAYSLVLAHPPFTG
FT                   DVDHGSVDPDLLHRVRTRKAELLFLARCLHLLRPGGRAAVIVPDGVLFGSGIAHRTLRR
FT                   MLVENHQLEGVIKLPAGVFRPYAGIGTAILLFTRTDTGGTGHVWFYDLRADGFSLDAPR
FT                   TPLLPDDRLGATPAVPWAPHDHASNNLPDALRRWRQREASERGNPRSAQSFCVPKRDIA
FT                   AQGYDLTLNRYQERARCPSPTAA"
FT   gene            72641..73501
FT                   /locus_tag="RCFBP_10069"
FT   CDS_pept        72641..73501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10069"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10069"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41386"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41386.1"
FT                   /translation="MPEPDRCLTPRGTWLAIWPRMWHELWHVLAAQPCAPPDLFCDLAR
FT                   DLAAALAPSPDPDSTPLAELANDPQASRAWFAALPAEDIASESALVTFLQDAYATLGEL
FT                   GGETLASAYFRLLGGLIDTYNLRYELRRPCTLALSLPGLFGSLMQTLRDQTGQDLHLAT
FT                   LMREFDHAFRDVHDDATDIRIKTCMQKQINLLEALARHCTGVTEHTLGNVCNQVAHWPH
FT                   RKVKEAMQNLYAFTSDYPGIRHSGTPGNARRTINMRDMIAMSILLVGFTPYLVEGFDAK
FT                   RVWRG"
FT   gene            73564..76422
FT                   /locus_tag="RCFBP_10070"
FT   CDS_pept        73564..76422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10070"
FT                   /product="putative restriction endonuclease, type I, R
FT                   subunit (hsdR)"
FT                   /function="8.3 : Degradation of DNA"
FT                   /function="8.2 : Restriction/modification"
FT                   /EC_number="3.1.21.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10070"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41387"
FT                   /db_xref="GOA:D8NKK3"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41387.1"
FT                   /translation="MSSTDCQAARERAARRRDAPAPDSHAAGDDAIDRLLRAAGWPLTG
FT                   PDDTAFPITGLPTPQGKGYVDYVLWGDHRKPLAIVEARHTRRSARAGRQRARQCADCLE
FT                   AMTGQRPLIYCTNGRDHWFWDDRTGPPRAVRGFHRKDELERLIERRTRRQPLTTAAIDT
FT                   AIAERPHQHRAIRRIAEAFEQDRLRGALVSMPTGTGKTRTAIALTDLLMRCHWIKRTLF
FT                   LADRAAQLQRAAAAFATHLPGATLVDPAKDAAPEGNVYLSTCPAALDWLNGTDDAPRFG
FT                   PGHFDLVIVDVAHRGICRQYRAIFSYFDALLVGLTATPKEAIDRNTYDVFGLAVGVPTD
FT                   AYGLDEAIADHHLVPPRTVSVPVRPQREGIRYDDLSDMEKDRQDTLEWDDDNAADASAP
FT                   EAADAWLHHQDAVDEMIALVMEGRGHRVAGGDWIGKTLIFARNHDHARFIAGRFDANYP
FT                   QYKGELACVITYEAGQTQTLVDAFSVADRMPRIAISAGPLDIEIAVPEVVNLVFFRRVR
FT                   SRTRFWRMVGCGTRPCQDLYGPGQDKQDVLVFDFCRNLAFFNVDAEAAAQTLPEPLGRR
FT                   VFRARLELLTRLQTQPAALSVQEARASYGNPPTPATLHDDIAQWLHRQVASMSTDNFAV
FT                   RAKHRYVCPYTRREAWLHLSPAQAEELAEHVSGLPTTLRDDSDEAARRFDLLMLRLQLC
FT                   VLRGEPAPERLKTPVRSVAKALLAQTCHPAVRDQAGWLAALAEEGWWSDTSALQLEQAR
FT                   RRLRPLAHLIDAETRRQLACADCADTAGPTSEITVTACADGTGSERFRAKARGFLRARQ
FT                   HLPTLRKLRHNEPLTATDLAGLEQMLVADGIGSGEDIDRARRASGGLGVFVRGLIGLDR
FT                   AAATAALSGIIGSEAMTTDQREFIDLVITHLTGHGTMDAARLYASPFTDIAPQGPDGLF
FT                   APVTVDALVTALRQIKAHAVAT"
FT   gene            complement(76438..77913)
FT                   /locus_tag="RCFBP_10071"
FT   CDS_pept        complement(76438..77913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10071"
FT                   /product="putative sensor histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10071"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41388"
FT                   /db_xref="GOA:D8NKK4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41388.1"
FT                   /translation="MRRPSSPASPPSRARSLRSRLALWLALPLAVYVGADGWLDLAAAR
FT                   HNADVVHFHALNTAAQMISGQIEWSDEGRLRVTVPPAALAVFAAPEVAVRDQVSYQVIT
FT                   ESGRLLAGRLDFGTRQPFGGAGWPETGIYSDALAEPGVAQAQPVHVAAVMRTMYDAGRS
FT                   ERVLTRVAQTTNGRDAMIRQLWWPSLVRQMVLVGLALAMILIGLTLELRPILRLADNVS
FT                   ARAPTDLAPLDAATLQRELQPIALALNQYLRRIADNAGAQKRFIADAAHQMRTPLAILA
FT                   TQMQVAAQANADDGLREVLHAARTSTRNLADLINDLLLLSQAENAQVASEPVDLVPLAR
FT                   GVLEDLALLADGRRIDLGMEGAERPVWTAGNRTLLAAMLFNLVDNAVRYTHEGGRVTVQ
FT                   VTANYGWAMLSVTDDGPGIPPEAHARVFERFTRLPGTSTEGSGLGLAIVRQIVETMGGQ
FT                   IALASGPGGVGLVVTVWLRRAGEPPSESRAKVG"
FT   gene            complement(77897..78571)
FT                   /locus_tag="RCFBP_10072"
FT   CDS_pept        complement(77897..78571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10072"
FT                   /product="putative response regulator, CheY family"
FT                   /function="13.1 : Two-component systems"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10072"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41389"
FT                   /db_xref="GOA:D8NKK5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41389.1"
FT                   /translation="MKLLLIEDNAPLAQWLSEALRRAQFTVDHASDGESADSLLLTQHY
FT                   DVVLLDLQLPSLSGRAVLQRLRDRRNAVPVMILTASGGIDDKVACLGAGADDYLVKPFE
FT                   IRELIARIQVLVRRNTPANAVELQCGDLSYHTGSRTFALSGRPLVLPAREHTVLEILML
FT                   KLGRTVSKPALVNGVFGLEDDASPEAIEIYIHRLRKKLEHSAATIVTLRGLGYLLRDAS
FT                   TQ"
FT   gene            78719..79765
FT                   /locus_tag="RCFBP_10073"
FT   CDS_pept        78719..79765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10073"
FT                   /product="putative ABC transporter, periplasmic-binding
FT                   component"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10073"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41390"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41390.1"
FT                   /translation="MGVFTCRGTRTRGPRGWITPLLTACIMLAAPPLAADTSTHLTLMV
FT                   SGTAKMIYLPATLAQRLGYFRDEGLDVELLSQPAGVDAESELLTGYAQGVIGFYDHTID
FT                   LQTKGKEVRAIVVFSPVPGEAEVVSTRLPATVQSMHDLRGRTLGVTGLGSSTSFLTRHL
FT                   MALQGLGPGEYTMLPVGAEHSFVAALRSGRIDAGMTTDPTATRLVRNKEARVLLDLRTV
FT                   ESTRAALGGLYPAACLYVQTEWLEAHPELATKLARAFVRTLRYLRSHRAEDVAAHMPPE
FT                   FRRDRPDVYVQALAAALPTFSDDGRMPEDGPATVLRVLSTSNPNARDKHIDLSRTYTNR
FT                   FVDQAKRP"
FT   gene            complement(79766..80896)
FT                   /locus_tag="RCFBP_10074"
FT   CDS_pept        complement(79766..80896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10074"
FT                   /product="Putative outer membrane porin"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10074"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41391"
FT                   /db_xref="GOA:D8NKK7"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41391.1"
FT                   /translation="MSRTTFALAAITAAVAGLAATGAQAQTSSVTLYGLIDTTISTVSN
FT                   TNAAGARTTGFQVPWFSGSRWGLTGKEDLGGGTSAIFKLESEFETPTGNMDTPGVLFNR
FT                   DAWVGLSNPTFGKLTFGRQNALARDVAGIYGDPYTSAEVTLEEGGFTNVNNFKQLIFYA
FT                   GSATGTRLNNGVVWKKLWDGGFFTGLAYQFGEVPGQFSQNTTETAALGYNGGNFHLSAF
FT                   AQQAKVNGFTDRSYSLGGNVILGMFRVNAGYFHYTGDQPAAIGNRKDDAYTVSLKIAPP
FT                   GAFDYEIGYQIMKAGNAAFSADGNTLNAYSDVSTATASGSGRKNTLYGSVFYHVSKRTE
FT                   FYVAADYMKLKDQYIVGSTNGHNSQTEFGVGMRTRF"
FT   gene            81144..81578
FT                   /pseudo
FT                   /locus_tag="RCFBP_10075"
FT   CDS_pept        81144..81578
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10075"
FT                   /product="fragment of putative isochorismatase family
FT                   protein yecD (modular protein) (part 1)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CBJ41392.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            81608..82198
FT                   /pseudo
FT                   /locus_tag="RCFBP_10076"
FT   CDS_pept        81608..82198
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10076"
FT                   /product="fragment of putative isochorismatase family
FT                   protein yecD (modular protein) (part 2)"
FT                   /function="5 : Central intermediary metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CBJ41393.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(82422..83069)
FT                   /locus_tag="RCFBP_10077"
FT   CDS_pept        complement(82422..83069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10077"
FT                   /product="putative response regulator receiver"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10077"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41394"
FT                   /db_xref="GOA:D8NKL0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41394.1"
FT                   /translation="MSPFLSIVAADDHPVILMGLASAIQQFPRQKIVAQAHDGRALLAL
FT                   LESTDCDVVVTDYHMNGDAASDGMQLLTRLRTRHPERAVVVCTMVCNPALLRCMQQLGV
FT                   RRIVSKRDDLAHVGHAVAASARGLPYYSPTIVLEGGFGIGAREAFQGLSAREREVVRLF
FT                   VSGMAVSEIARQLGSSIKTVSTQKAMALRKLGLARDTDLFQYARTAGLPVLH"
FT   gene            complement(83266..84477)
FT                   /locus_tag="RCFBP_10078"
FT   CDS_pept        complement(83266..84477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10078"
FT                   /product="putative response regulator receiver, eal domain"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10078"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41395"
FT                   /db_xref="GOA:D8NKL1"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41395.1"
FT                   /translation="MEGFAQLAVLVVDAQPGQRAAARQVLQTLGVQQILAACDGREALD
FT                   LLRLCQFDLVLCDMAMPGMGGPELMQQMRLHNGRPPERQAPVWAWIGERDGSLLDSHTS
FT                   LAEAMGLAHAHGLCGPLRPEHVLPLLYEAATRDGEIMPLGLARPPVFSDDALAALVHDT
FT                   PGQIEVVLQPQHDLITNRVVGAEALCRWLHPVHGRILPTAFVPRLEALGLADALFFHVL
FT                   GHCVRVQRALAAQAIALPIGVNASAQTLSREGAIERIASVVGDAGIDPARIVVELSDDA
FT                   PVAESARLAVALHQLRQLGHGLAIDDFGVGFAVLKLLVDLPFTILKIDRALTEAVSLSS
FT                   QRGIVCRTMIELAGALHLQCVAEGVETDAQRRALLTLGCATGQGYLWAAPLSTTAFLAR
FT                   VQAE"
FT   gene            complement(85381..86187)
FT                   /gene="metQ"
FT                   /locus_tag="RCFBP_10079"
FT   CDS_pept        complement(85381..86187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metQ"
FT                   /locus_tag="RCFBP_10079"
FT                   /product="DL-methionine transporter subunit ;
FT                   periplasmic-binding component of ABC superfamily"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12169620; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10079"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41396"
FT                   /db_xref="InterPro:IPR004872"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41396.1"
FT                   /translation="MSLFSRIARAALPAIALAVAAGAHAESKPIKLGTMSGPDAQIWEV
FT                   VQKVAKKDGLDVKVIEFNDYAQPNPALDAGDLDANGFQHQPFLDGQVKARGYKIVNVGL
FT                   TYVAPMGFYSKKIKSLAALKEGAKVGIQNDPSNGNRALLLLQKAGVIKLKAGAGTNGNN
FT                   ATPRDVVENPKKIKLVELDSAQLPRSLDDLDAAAINTDYAVKNGLTPAKDAIALEDRQG
FT                   PYANLIAVREKDKNQPWVKTLVHAYQSEEVRKFIETQFKGAILPAF"
FT   gene            complement(86369..89182)
FT                   /gene="kdpD"
FT                   /locus_tag="RCFBP_10080"
FT   CDS_pept        complement(86369..89182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpD"
FT                   /locus_tag="RCFBP_10080"
FT                   /product="sensor histidine kinase in two-component
FT                   regulatory system wtih KdpE, regulation of potassium
FT                   translocation"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="12.3 : Protein interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1532388, 9858692; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10080"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41397"
FT                   /db_xref="GOA:D8NKL3"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41397.1"
FT                   /translation="MDETRPNPDTLLAELHSGEQQAARGKLRIYFGASAGVGKTYAMLS
FT                   AAKAARAEGIDVVVGLVETHGRAETAALVEGLESLPTRRIEYRGRTLPEFDLDAALARK
FT                   PALILVDELAHSNVAGSRHPKRWQDIEDLLAVGIDVWTTVNVQHLDSLNEAVGSITGIR
FT                   VWETVPDAVFDSAAEVILVDLPADELLRRLAEGKVYMPEQAQHAARNFFRKGNLIALRE
FT                   LALRRTADRVDDDVQAYRRARRIENVWRTRETLVACLDPQGDGEQVIRSAARLAAQLEC
FT                   DWHAVAVVMPHLRAVDARTERLHALLKMAEDAGAKIETLAGTNAVEAITGYIRRHNITK
FT                   AVVGRPPARRWRTARAIVVALRLAIGLERRLPSGDFAESLARHCPEVDVIRAAADPARV
FT                   QLPPRAAAIGRADVRDTAQRVAAEADSTWLRPAYLAACVYVGAATVLSSLVRPMFDLAN
FT                   IVMLFLAAVVAVAMRHGRGPAALASVLSVALFDFFFVPPRYSFAVSDVQYLLTFAVMLA
FT                   IGLLVGQLTAGLREQAEVAIQREAAARALYEAARELSAALTLDQIVSIGGRFVNATFGG
FT                   RCAFFFLGPDGRLGAAQVARPEGAPDAPSGMPNLDRVLADWTYQHGQPAGTGTHTLPSG
FT                   SVLYLPLKAPMAIRGVLAVEPETFQVLAQPDNRRQIDACATLIAIAIERVHYVEIAQDA
FT                   LVRIESERLRNSLLAAVSHDLRTPLTGLVGMAETLLRTQPPLSPLQAEAAEAIGEQARR
FT                   MRVMVTNLLDMARLQNHDIKLRLEWQSIEELVGAALKGTPLPAHTVVVDDLADLPLQRC
FT                   DGPLMERVLSNLLENAGKFAPAGTEVRISAGVEHDTVRGDEMRVRVRDHGPGVPAGAER
FT                   VIFEKFTRGDKESATGGVGLGLAVCEAIVSAHGGRIWVETPTDGGACFVVALPASEQPA
FT                   VEDDIPV"
FT   gene            complement(89746..90360)
FT                   /gene="kdpC"
FT                   /locus_tag="RCFBP_10081"
FT   CDS_pept        complement(89746..90360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpC"
FT                   /locus_tag="RCFBP_10081"
FT                   /product="P-type ATPase, high-affinity potassium transport
FT                   system, C chain"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11248697, 9858692; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10081"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41398"
FT                   /db_xref="GOA:D8NKL4"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41398.1"
FT                   /translation="MATTTQPVHTEVPQQGGLLRAALVIFVGLSLITGVLYPVVVTGIG
FT                   KAVFPAQAGGSIIERGGKPVGSALIGQNFSEPQYFWGRLSATSPNPYNATASSGSNFGP
FT                   SNPALADAAKARIAALKEADPANTAPIPADLVTASASGLDPQISPAAAAYQVERVARAR
FT                   HLPVDTVKKLVAAHTMAPVLGVFGEPVVNVLELNLGLDDLK"
FT   gene            complement(90371..92608)
FT                   /gene="kdpB"
FT                   /locus_tag="RCFBP_10082"
FT   CDS_pept        complement(90371..92608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpB"
FT                   /locus_tag="RCFBP_10082"
FT                   /product="P-type ATPase, high-affinity potassium transport
FT                   system, B chain"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15379567, 6146979, 9858692; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10082"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41399"
FT                   /db_xref="GOA:D8NKL5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41399.1"
FT                   /translation="MALRYPESDPVVRTVKQRFDGADAAAQGGAQVRATTTHHGAQHPL
FT                   TAKEVRKLSMFSPALVKPAIIDSFRKLSPRAQAKNPVMFVVYIGSILTTLLWVMALRGQ
FT                   AEAPAGFILAVSVWLWFTVLFANFAEALAEGRSKQQAASLRGIKTTVQAKVLADPQRRD
FT                   RVQPRAATALRRGDIVLIEAGDMVPGDGEVIEGVASVDESAITGESAPVIRESGGDFSS
FT                   VTGGTRVLSDWIVVRITANPGESFLDRMISMVEGAKRQKTPNELALTILLVSLTIILLL
FT                   ATVTLLPYSIFSVEVMKAAGVTSSPITITVLVALLVCLIPTTIGGLLSAIGVAGMSRMM
FT                   QANVIATSGRAVEAAGDVDVLLLDKTGTITHGNRQASRFLPAPGVTVKALAEAAWLSSL
FT                   ADETPEGRSIVTLARQLGEAAVDEAALAQSQPVFVPFSAQTRMSGINVALDGRAHQIRK
FT                   GAADAIRTHVTVLAGKFPDAVLAAVEDVARKGGTPLVVSDDDRVMGVVELKDIVKAGIR
FT                   ERFAELRQMGIKTVMITGDNRLTAASIAAEAGVDDFIAEATPETKLALIREQQAQGRLV
FT                   AMTGDGTNDAPALAQADVAVAMNSGTQAAKEAGNMVDLDSSPTKLIQIVEIGKQMLMTR
FT                   GSLTTFSIANDVAKYFAIIPAAFATTYPQLAALNVMHLATPASAVMSAVIFNALIIVFL
FT                   IPLALKGVKYRPLGAAALLRRNLWIYGLGGLLLPFPGIKLIDMFLAAMGWV"
FT   gene            complement(92643..94415)
FT                   /gene="kdpA"
FT                   /locus_tag="RCFBP_10083"
FT   CDS_pept        complement(92643..94415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpA"
FT                   /locus_tag="RCFBP_10083"
FT                   /product="P-type ATPase, high-affinity potassium transport
FT                   system, A chain"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15292155, 6146979, 9858692; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10083"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41400"
FT                   /db_xref="GOA:D8NKL6"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41400.1"
FT                   /translation="MNAFLLQLAIYLVVLLVLAKPLGTYMARVFGDAPSRAHWLRPVER
FT                   LLYRIAGVDPRAEMGWKHYALAVLAVNVLGALAVYALQRLQQWLPLNPQGFGAVTPDSS
FT                   FNTAVSFVTNTNWQGYSGESTMSYLTQMLGLAVQNFLSAATGIAVVIALIRGFARHSAK
FT                   TIGNFWVDFTRCTLYVLLPLSIVVAVFFVSQGTIQNFDAYKDVTTVTATTYDNPKTDAQ
FT                   GNPIKDAQGNPVTEKATTQKQTLPMGPIASQEAIKMLGTNGGGPFNANSAHPYENPTAL
FT                   TNFVQMLSIFLIPAALCFAFGAMVGDRRQGWAVLASMTILFVVLACFEAWSELHGNPML
FT                   AHLGVDQAVGNMEGKETRFGIVASALFSTITTAASCGAVNAMHDSLTALGGLVPMFLIQ
FT                   LGEVVFGGVGSGLYGMLVYAILAVFIAGLMIGRTPEYLGKKIEVFEMKMTSIAILITPL
FT                   LVLVGTAVAVLASGGRAGIFNPGTHGFSEVLYAFSSAANNNGSAFAGLSANTPFYNVAL
FT                   GIVMWLGRFWIIVPVLAMAGTFAAKKRLPVTVGTLPTHGPLFVVLLIGSVLLVGALTYI
FT                   PALALGPIAEHLAR"
FT   gene            complement(94435..94524)
FT                   /gene="kdpF"
FT                   /locus_tag="RCFBP_10084"
FT   CDS_pept        complement(94435..94524)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpF"
FT                   /locus_tag="RCFBP_10084"
FT                   /product="P-type ATPase, high-affinity potassium transport
FT                   system, F chain, small hydrophobic subunit"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10608856; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10084"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41401"
FT                   /db_xref="GOA:D8NKL7"
FT                   /db_xref="InterPro:IPR011726"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41401.1"
FT                   /translation="MTWLYVLSGAITVALLIYLFAALLWPERF"
FT   gene            complement(94521..94646)
FT                   /locus_tag="RCFBP_10085"
FT   CDS_pept        complement(94521..94646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10085"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10085"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41402"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41402.1"
FT                   /translation="MDLIYLGGLAALALAVGGLLALSARLAKRDQPVTHAMENKQ"
FT   gene            complement(94683..95498)
FT                   /locus_tag="RCFBP_10086"
FT   CDS_pept        complement(94683..95498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10086"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10086"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41403"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41403.1"
FT                   /translation="MQAKQFPSRATVIGGVVFCAAVLNGAVAHAQSTDTAPAPAAAPAN
FT                   ALTANVTLASQYRYRGLMQTNNKPAIQGGFDYAIPGGLLPEGFYVGNWNSSISWLSDAN
FT                   SSVSAPIEMDFYGGYKTEIVKDVPIDVGVLQYYYPGSYPEGFTRPHTTEGYAQIGYGPV
FT                   TFKYSHAFSNLFGFADSHHSQYFDLSGNFDTGFWGLTLNLHFGYQDVKHQNPRASYADW
FT                   KIGVTKDFGSGWTASLAYIDTNASRLAYTNSHGNYMGKATALLAVTKTF"
FT   gene            complement(95748..96533)
FT                   /gene="mtnN"
FT                   /locus_tag="RCFBP_10087"
FT   CDS_pept        complement(95748..96533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtnN"
FT                   /locus_tag="RCFBP_10087"
FT                   /product="5'-methylthioadenosine/S-adenosylhomocysteine
FT                   nucleosidase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number="3.2.2.9"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10087"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41404"
FT                   /db_xref="GOA:D8NKM0"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010049"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41404.1"
FT                   /translation="MNIQSSRPNGPIGIVAALHEEISELLTLLSDARCVRIGSRDFWQG
FT                   ELDGRAVVVVLSRIGKVAAATTAAVLVTQFGVRAVVFAGVAGALASQVAVGDVVVSTEL
FT                   LQHDVDASPLFPRWEIPLTGVARFQADPALVQGLLESARATLGDPCALLGRRVMEAFGI
FT                   AAPQAHTGLVISGDRFVATSAESRMLKDALPDALAVEMEGAAVAQVCHEWGVPFAAIRT
FT                   ISDRADDAASVDFSAFISEVDSRYSVAILRRWLSGTHSA"
FT   gene            96862..97167
FT                   /locus_tag="RCFBP_10089"
FT   CDS_pept        96862..97167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10089"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10089"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41405"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41405.1"
FT                   /translation="MRILLNVRIPHEPFNTFVRDGTIGKVIAKILDEIQPEATYFTEQS
FT                   GGRGAVLVVNLDEPSQIPALAEPWFLMFNADCEFRVVMLEEDLKKAGLESIGARWK"
FT   gene            97526..98536
FT                   /locus_tag="RCFBP_10090"
FT   CDS_pept        97526..98536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10090"
FT                   /product="putative transcription regulator protein, LuxR
FT                   family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10090"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41406"
FT                   /db_xref="GOA:D8NKM2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41406.1"
FT                   /translation="MTLSLADLRTLLDLTGCLHEASPHSLIERPEITQKLSALLGVDVI
FT                   SHIVWKDHGRTPVQTTTWGRAPDMNAEYQQHFHGVDPISPLLRSRPDALLVEGLINRGA
FT                   LQRTEYFTDFLTRYKIYPGMSMYLEDTGGILLDYRLGTSDPKQTFGERELLILDLLRPH
FT                   LINAQRLRSALNAHRNPTDPQADCPCFMLDPAKPPQPNRKARALMAGLDEGEREAVHRL
FT                   LSQVAAHGPSQGLEWCGFNLCVERYLDTEGRFLYKVYLQAHTMGSGAWFQQQFDVTRRE
FT                   GEVCHLLLKGLSDKQIALALGISYWTVRAHVGRILEKLGIESRSAIGTLVLGADR"
FT   gene            complement(98793..100154)
FT                   /locus_tag="RCFBP_10091"
FT   CDS_pept        complement(98793..100154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10091"
FT                   /product="putative ABC transporter, taurine ATPase"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.36"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10091"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41407"
FT                   /db_xref="GOA:D8NKM3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR018632"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41407.1"
FT                   /translation="MATNGESVIELRGVSKIFRTADRTDRAVLEGVDLNLREGEIVAML
FT                   GKSGSGKSTLLRIMAGLVRADRGKVLFRGNEYAGPVQGIAMVFQSFALFPWLTVQQNVE
FT                   LGLEAQGVPKAEREARAEAAIDLIGLSGFNSALPRELSGGMRQRVGIARALVTEPDLLL
FT                   MDEAFSALDVLTGENLRDEMLDLWEDRRTKIKAILIVSHNIEEAVMMADRIVILSSDPG
FT                   RIRAEVRVPFPRPRNRDSSAVRNLIDEVYGLMTTPERVGVRVGAEPAAEQLAYRLPEAE
FT                   IGQMEAILDLLVEAPFNGRADLPHLAEEAGVTDDDLLPACEALALLQLATVERGDIIVT
FT                   PFGKTYMETEPPERKVLFGQKLLERVALAAHIRTELEASEDGEIREEQILRELEAYLKP
FT                   EEAERVLKIGIEWGRYGEVYEYVYNTGMLTLPREEREEREEREAEDGGDGAAAP"
FT   gene            complement(100181..101941)
FT                   /locus_tag="RCFBP_10092"
FT   CDS_pept        complement(100181..101941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10092"
FT                   /product="Putative binding-protein-dependent transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10092"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41408"
FT                   /db_xref="GOA:D8NKM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41408.1"
FT                   /translation="MQQHDNETTIRGPFGVSFGNLLTAPPNRFDLALLPIILAAIVLVA
FT                   YAARQMNVPYTPGEALDVRLDVVQLPYYLLRTSIRMLLALAGSLAFSFAFAAIASKNRT
FT                   AEKVMVPALDILQSIPVLGFLSITVTGFIALFPGNLVGVECAAIFAIFTSQAWNMAFSL
FT                   YQSFRTIPTDLEEAATVFRLSKWQRFWRLEVPFAMPGLLWNMMMSMSGGWFFVVASEAI
FT                   SVSGHDIKLPGIGSYISLAIQQQNLHAIGWAIVAMLIGILLYDQLLFRPLIAWADRFRF
FT                   DAMSSEREPQSWLLDLLRRSEWVKALLERTAALAERTLAWGAERTRPKASGSNSFLPRF
FT                   PWSGRVADVIIMLAALAALWHILQFVRSEVGWAEVGRVVWLGVLTMTRVLLLIALAAVI
FT                   WVPIGIRIGLNPNVARIAQPVAQFLAAFPANLMFPLVVMLIARFSLNPEIWLSPLMIFG
FT                   TQWYILFNVIAGASGIPMELRLAARNFGLRGWLMWKRFLIPAVFPSLLTGLVTAAGGSW
FT                   NASIVSEYVSWGDRTLVATGLGSYIAEMTSKGDFPRIALGIAVMSLFVVGFNRLLWNRL
FT                   YLLAQERTRL"
FT   gene            102179..102466
FT                   /gene="acyP"
FT                   /locus_tag="RCFBP_10093"
FT   CDS_pept        102179..102466
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acyP"
FT                   /locus_tag="RCFBP_10093"
FT                   /product="acylphosphatase"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /EC_number="3.6.1.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10093"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41409"
FT                   /db_xref="GOA:D8NKM5"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41409.1"
FT                   /translation="MSQPLRVIVTVQGRVQGVGYRAACADMARALGLRGWVRNRRDGAV
FT                   EAFLAGPKPNVLRMQKWMEEGPDMALVTQLQTAPGDGEPLPPGFEVRPTV"
FT   gene            102792..103928
FT                   /locus_tag="RCFBP_10094"
FT   CDS_pept        102792..103928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10094"
FT                   /product="Putative Type III effector, AvrPphE family"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10094"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41410"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41410.1"
FT                   /translation="MTPRIGSSRRQALPEPPETPAEPARFLTDGERQFGGYLMAREVDQ
FT                   RPVHGEPLDTLRDANETLLQARRILKHGRGNVQVDIDATNGLSTHIAQGGRSIQESMWR
FT                   AHPKPVVWAAIAMVAGAGNCGEHADLATFLHAAKLKEGETVDNVHIDDFDHFWAVVHRG
FT                   AEPDPERDVFIDPWGKGSALFAVDGAMTYHPGNRNTKFGYDKASGEEAHADMEMLETVL
FT                   ATRMRGGIGETMRQLGPDYRYPPDKVWGVTPIVARAFTDRVKAGMSKPADLDKLAVPPD
FT                   CATPSSAEPPVTNERLMQPLRREIHATRVARMIGAHSVDTMTDAAQRIVEVASDLRGYP
FT                   VQPHPLQAKKDAEDITAAERRRARRAALGKDTPPEPQT"
FT   gene            complement(103939..104796)
FT                   /locus_tag="RCFBP_10095"
FT   CDS_pept        complement(103939..104796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10095"
FT                   /product="conserved protein of unknown function, DUF519"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10095"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41411"
FT                   /db_xref="GOA:D8NKM7"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41411.1"
FT                   /translation="MLSYRHAFHAGNHADVLKHAIVVQLLDHLTQKDKAFWYIDTHAGA
FT                   GLYSLDHAWAKKKAEFETGIGRLWHAVGAGQTLPPLLEAYLEQVRQLNPDGRLKHYPGS
FT                   PWLAWQMLRDHDRLRLFELHSSEIQVLSNNFRGAGRKVILYDGDGFDGIKAILPPPPRR
FT                   ALVLIDPSFEDKEDYARTVQALQDSLQRFATGTYAIWYPQVQRRESAQLPARLKQLGLS
FT                   DWLHVTLTVKRPVEGGLGLHGSGMFIVNPPWTLKAQLQDTMPTLVRLLGQDDGAGFVLE
FT                   GQAR"
FT   gene            complement(104917..106392)
FT                   /locus_tag="RCFBP_10096"
FT   CDS_pept        complement(104917..106392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10096"
FT                   /product="putative CoA-transferase family III, CaiB/BaiF
FT                   family"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.8.3.16"
FT                   /EC_number="5.1.99.4"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10096"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41412"
FT                   /db_xref="GOA:D8NKM8"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41412.1"
FT                   /translation="MPSPPLADRVGLPDHVTTPAQALARIWHTLGQPDEALSRVTLTGA
FT                   EPALPSSFAVGTLAQSTIAAAALGVAHVDTLRTGRRQAVSVDMHHAALEFRSERYFRID
FT                   GQLPPEPWDKIAGLYRCGDGRWVRLHTNFPHHRDGVLRLLGCTHDREAVARALAGWQAL
FT                   AFEDAAAEAGLVASAARTFDEWDRHPQGVAVAGLPLVTLERIGDAPPEPLPPHGQRGQG
FT                   DEGDEERPLSGVRVLDLTRVIAGPVCGRTLAAHGADVLLVTGPHLPSIPPLVIDTGRGK
FT                   RSARLDLRDAADVDRLRALLGEADLFVQGYRPGGLAALQFGPQQAAALRPGIVYVSLSA
FT                   YGHAGPWAGRRGFDSLVQTAAGFNWAEAEAVGETGPRPLPAQALDHAAGYLMAAGAMAA
FT                   LARRITEGGSWHVRVSLAQTAHWLRGLGRPSHGLDTADPRYEDIGAWLETAPSGFGALT
FT                   ALRHAGQLSDTPPRWTLPAMPLGTHAATWPSLR"
FT   gene            complement(106501..106755)
FT                   /gene="minE"
FT                   /locus_tag="RCFBP_10097"
FT   CDS_pept        complement(106501..106755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minE"
FT                   /locus_tag="RCFBP_10097"
FT                   /product="cell division topological specificity factor"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12897015, 2645057; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10097"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41413"
FT                   /db_xref="GOA:D8NKM9"
FT                   /db_xref="InterPro:IPR005527"
FT                   /db_xref="InterPro:IPR036707"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41413.1"
FT                   /translation="MSILSFLLGEKKKTASVAKERLQIILAHERSSHSAPADYLPALQR
FT                   ELVAVISKYVKIGNDDIKVNLERQDNLEVLEVKIEIPQA"
FT   gene            complement(106765..107580)
FT                   /gene="minD"
FT                   /locus_tag="RCFBP_10098"
FT   CDS_pept        complement(106765..107580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minD"
FT                   /locus_tag="RCFBP_10098"
FT                   /product="Septum site-determining protein minD (Cell
FT                   division inhibitor minD)"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11248256, 12519187; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10098"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41414"
FT                   /db_xref="GOA:D8NKN0"
FT                   /db_xref="InterPro:IPR010223"
FT                   /db_xref="InterPro:IPR025501"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41414.1"
FT                   /translation="MTKIIVVTSGKGGVGKTTTSAAFSAGLALRGHKTAVIDFDVGLRN
FT                   LDLIMGCERRVVYDLINVIHGEANLNQALIKDKKCENLFILPASQTRDKDALTREGVEK
FT                   VINGLADMGFEYIVCDSPAGIESGALMAMYFADEAIVVTNPEVSSVRDSDRILGILSSK
FT                   SRRAIEGKEPIQEHLLLTRYNPKRVSEGEMLSLTDVQEILRIKLIGVIPESEAVLQASN
FT                   QGIPAIHLEGTDVAAAYADVIDRFLGKEKPLRYVEYSKPGFLQRLFGGK"
FT   gene            complement(107627..108394)
FT                   /gene="minC"
FT                   /locus_tag="RCFBP_10099"
FT   CDS_pept        complement(107627..108394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="minC"
FT                   /locus_tag="RCFBP_10099"
FT                   /product="cell division inhibitor"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10611296, 10869074; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10099"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41415"
FT                   /db_xref="GOA:D8NKN1"
FT                   /db_xref="InterPro:IPR005526"
FT                   /db_xref="InterPro:IPR007874"
FT                   /db_xref="InterPro:IPR013033"
FT                   /db_xref="InterPro:IPR016098"
FT                   /db_xref="InterPro:IPR036145"
FT                   /db_xref="InterPro:IPR038061"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41415.1"
FT                   /translation="MSQKKAPLFEIRSGTVDALLLSPRTADMDALAAELTRRFADTPEF
FT                   FSNDVIAIDVRRLAAAERLPIDRLVETLTGLRAHAIGVVASPEQAEWAQAHGLPLLDSH
FT                   GRRPRGERSEDAAEAAPAAAEPVPAPAAPPAPPVEAVAMQPGTMIIDKPLRSGQRVYAR
FT                   GDLVVLDLVSDGAEVIAEGNIYVYASLRGRALAGVKGNLGARIFCTCLEPQLISIAGIY
FT                   RTGETPWPDAFASKPAQIRLSENTLVLEPLRMK"
FT   gene            complement(108532..108762)
FT                   /locus_tag="RCFBP_10100"
FT   CDS_pept        complement(108532..108762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10100"
FT                   /product="exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10100"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41416"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41416.1"
FT                   /translation="MPPQAGSDIDNKAASDNAADDNGRTCRDFSLNVFDGCGLRGASAI
FT                   DLRNARGQRAGPGGSEPASIGRARDMSVTAR"
FT   gene            108743..108946
FT                   /pseudo
FT                   /gene="cpdB"
FT                   /locus_tag="RCFBP_10101"
FT   CDS_pept        108743..108946
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpdB"
FT                   /locus_tag="RCFBP_10101"
FT                   /product="2',3'-cyclic-nucleotide 2'-phosphodiesterase
FT                   (fragment)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2172762, 3005231; Product type e : enzyme"
FT                   /db_xref="PSEUDO:CBJ41417.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(108972..109949)
FT                   /locus_tag="RCFBP_10102"
FT   CDS_pept        complement(108972..109949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10102"
FT                   /product="putative 2-dehydropantoate 2-reductase"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /function="4.7 : Pantothenate and coenzyme A"
FT                   /EC_number="1.1.1.169"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10102"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41418"
FT                   /db_xref="GOA:D8NKN4"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41418.1"
FT                   /translation="MTRICIVGAGAVGGYLGARLALAGEAVNVLARGATLQALQTAGLR
FT                   LTEDGATHTLPVRATHDAAVLGEQDVVIVAVKAPALESVAAGIAPLIGPGTCVVVAMNG
FT                   VPWWFFDRPGPLQGQRLQAVDPHGRIAQAIPTRHVLGCVVHLTSATVSPGHIRHGNGRQ
FT                   LILGEPAGGASPRLASIAALFGRAGLQAECSEAIQRDIWFKLWGNMTMNPVSVLTGATC
FT                   DRILDDPLVSAFCLAVMVEAKAIGARIGCPIEQSGEARSAVTRQLGAFKTSMLQDAEAG
FT                   RGPLEIDALVASVREIGRHVGVPTPQIDTLLGLVRLHAQTRGLY"
FT   gene            complement(110172..111155)
FT                   /locus_tag="RCFBP_10103"
FT   CDS_pept        complement(110172..111155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10103"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10103"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41419"
FT                   /db_xref="InterPro:IPR019262"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41419.1"
FT                   /translation="MDVSPVPIMSRPLSRVLRIALPLLLMAPLVWFAGCTTPPARPQAE
FT                   PLPDHEVVATRPGATARDRMIEIALTEWDRWGRQVVRVGRDDTYCVTEGGFPDRPPGRW
FT                   LTVGEPAASPGEDDAAGSGGDLPADRPQAGASDTFPSLPAATCLRYPDGSGGEATARGC
FT                   MLAQRYWRIVGKEPTCQQLTTGAWAWSAVFISWIMRKAGLQNDQFLTGATHAEYVTDAR
FT                   DHLLRQAAFKLERTPAVPRPGDLICSARGADRFMSDPAEIRSGMTPMHCDLVVEVDPLR
FT                   HEVKSIGGNVQQSASMSITELNDANQLDPYTNSVMQWFVILRNQLP"
FT   gene            complement(111287..111565)
FT                   /gene="hupB"
FT                   /locus_tag="RCFBP_10104"
FT   CDS_pept        complement(111287..111565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupB"
FT                   /locus_tag="RCFBP_10104"
FT                   /product="DNA-binding protein HU-beta, NS1 (HU-1), plays a
FT                   role in DNA replication and in rpo translation"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2187099, 9367749, 9683467; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10104"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41420"
FT                   /db_xref="GOA:D8NKN6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41420.1"
FT                   /translation="MTKTELIDAIASGVDGLTKAKAEQALNVTLQAIMESVGKGDAVSL
FT                   IGFGTFSQGERAERMARNPRTGEEIKVEAAKTVKFKAGQKFKDAVNV"
FT   gene            112213..112752
FT                   /locus_tag="RCFBP_10105"
FT   CDS_pept        112213..112752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10105"
FT                   /product="Putative histone-lysine N-methyltransferase
FT                   fragment"
FT                   /function="9 : Transcription"
FT                   /EC_number="2.1.1.43"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10105"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41421"
FT                   /db_xref="GOA:D8NKN7"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR003616"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41421.1"
FT                   /translation="MPRSSTAAKDLDDAHPQIPPQPAGLRRRDRIAVRESGVHGRGVYA
FT                   VATIAQGKKIIEYKGEHISWKEALSRHPHDPSDPNHTFYFSLEDGSVIDAKYGGNRARW
FT                   INHACKPNCEAREKDGRVFIHALRDIEAGEELFYDYGLVIEGRQTKALKAQFACHCGAK
FT                   KCRGTMLAPPEKKAKK"
FT   gene            complement(112767..114455)
FT                   /locus_tag="RCFBP_10106"
FT   CDS_pept        complement(112767..114455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10106"
FT                   /product="putative sensor hybrid histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1791760; Product type prc : putative
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10106"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41422"
FT                   /db_xref="GOA:D8NKN8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41422.1"
FT                   /translation="MLKRHHPATSSSPASGANHATSLRLHLLRALAAPLFGLVVGTGAL
FT                   SYWLAAHYTAQVFDRALVGVANALAGQLRLAGPHVNATQIDDIALAAQTLVQSSGEDRV
FT                   YWRIAGPSGTLAGREAPLGYGSGQVHMGEARVFYSWLDGKQVRAVHLLVPGITADMPWP
FT                   RSPHPQVAPKSENDVTRPALAPTQAQTARSANPLAPPDAVQPEDGIVIEVAELLDRRDL
FT                   AAKEVLLSVSIPLIVLLAVGGLILMLVLKEELQPLQTLADTLNLQSAQSVTPLPAESAG
FT                   RVPAELQPLINAMNALLARLRDALQAQRTFIADAAHQLRTPLTALKLHADRAVDAKTLE
FT                   EARPALLELQASANRAVRLSNQLLTLARAEHGMTLDQLGPPTRLDLVALAFDTGAEWVP
FT                   RALAQGLDLGFEAWPPLASPTAMPPAPVLGNTVLLREAIGNLLDNAIKYVPPGGRVTLR
FT                   AGIETLAGSGAAADAQAGRLGVVCVEDNGPGIPSGRRAEVFQRFFRGDADHRPGQPQGS
FT                   GLGLAIVHDIVRLHGGTVAIDDAVARDGTQVMRFVLRLPLADARA"
FT   gene            complement(114473..115183)
FT                   /locus_tag="RCFBP_10107"
FT   CDS_pept        complement(114473..115183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10107"
FT                   /product="putative response regulator, CheY family"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10107"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41423"
FT                   /db_xref="GOA:D8NKN9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41423.1"
FT                   /translation="MRILLIEDDRAIASGIHAGLTQAGHRVLAVHDGVFAVEHLARQSH
FT                   DLVILDLGLPGIDGMTLLSQYRARDRGTPVLILTARDSLQNKVDGLNAGADDYLLKPFE
FT                   MLELVARVQALLRRRGDNGEPMPRPDIVVGRLRMSGAERRIFVDAAALELSPREFAVLE
FT                   LLMLRQGRVVSKVQLQDHLASFGHALGEAGHDVVGDTAIEVYVHRVRRKIEQTEAEIVT
FT                   VRGFGYLLQARAAP"
FT   gene            115241..115471
FT                   /locus_tag="RCFBP_10108"
FT   CDS_pept        115241..115471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10108"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10108"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41424"
FT                   /db_xref="InterPro:IPR022191"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41424.1"
FT                   /translation="MTDALLTITDLEAAINYWRARSPSRGEELRLCAEASALAKPYALM
FT                   IVQGATRIAPEQLGEKARAALEAWRAATGAS"
FT   gene            complement(115487..115789)
FT                   /gene="phhB"
FT                   /locus_tag="RCFBP_10109"
FT   CDS_pept        complement(115487..115789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhB"
FT                   /locus_tag="RCFBP_10109"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="4.2.1.96"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15262943; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10109"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41425"
FT                   /db_xref="GOA:D8NKP1"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41425.1"
FT                   /translation="MPTLNDEQRKALFAELQGWSTQSDRDAIHKRFTFTDFNAAFGFMT
FT                   RVALKAEQMNHHPEWFNVWNRVDITLSTHDANGLTHRDADLARFIEQAAKLTGAK"
FT   gene            complement(115840..116781)
FT                   /gene="phhA"
FT                   /locus_tag="RCFBP_10110"
FT   CDS_pept        complement(115840..116781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhA"
FT                   /locus_tag="RCFBP_10110"
FT                   /product="Phenylalanine 4-monooxygenase"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="1.14.16.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12096915, 8108417; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10110"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41426"
FT                   /db_xref="GOA:D8NKP2"
FT                   /db_xref="InterPro:IPR001273"
FT                   /db_xref="InterPro:IPR005960"
FT                   /db_xref="InterPro:IPR018301"
FT                   /db_xref="InterPro:IPR019774"
FT                   /db_xref="InterPro:IPR036329"
FT                   /db_xref="InterPro:IPR036951"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41426.1"
FT                   /translation="MAIAPTASAAPSPAPAGFTGTLTDKLREQFADGLDGQTLRPDFTI
FT                   EQPVHRYTAADHATWRTLYDRQEALLPGRVCEEFLQGLATLGMRRESVPSFDQLNETLM
FT                   RATGWQIVAVPGLVPDEVFFEHLANRRFPASWWMRRPDQLDYLQEPDCFHDIFGHVPLL
FT                   INPIFADYMQAYGQGGLKAARLGALDMLARLYWYTVEFGLIRTPAGLRIYGAGIVSSKS
FT                   ESVYALDSASPNRIGFDVRRIMRTRYRIDTFQKTYFVIDSFEQLFDATRPDFTPLYEEL
FT                   GRLPTFGAGDVVDSDTVLNTGTREDWGDTADV"
FT   gene            complement(116904..117014)
FT                   /locus_tag="RCFBP_10111"
FT   CDS_pept        complement(116904..117014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10111"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10111"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41427"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41427.1"
FT                   /translation="MDLLRELLVGRAAIALKGGKQGQIEGIEGNHANLLR"
FT   gene            116922..117398
FT                   /locus_tag="RCFBP_10112"
FT   CDS_pept        116922..117398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10112"
FT                   /product="putative transcriptional regulator, AsnC/Lrp
FT                   family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10112"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41428"
FT                   /db_xref="GOA:D8NKP4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41428.1"
FT                   /translation="MISLDSFDLALLAALQRDGRATHQQLSEQVHLSASQVGRRLARLE
FT                   AERVIEGYRVILSPTGLGLGVTVFASVKLAHHGDAIVERFHEEILLLDAVQECYSVAGD
FT                   ADYMLRVVVPDLPALSEFVMRKLMRVPGVDNVRSNIVLTALKRDGALPLAHLGG"
FT   gene            117474..118247
FT                   /locus_tag="RCFBP_10113"
FT   CDS_pept        117474..118247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10113"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10113"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41429"
FT                   /db_xref="GOA:D8NKP5"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41429.1"
FT                   /translation="MVEGHTTQPAPAPEQRAGGYGMPARVRAWWVAAAVAGVTYGGMLT
FT                   MVAVDVGPGTPLAGRIVAQPLWKMLMALLLARAASLHETPRERRWLIAALLFSALGDLL
FT                   LALPGLRVSFVAGLASFLLAHLCYLRVLVSLRGEYSALRLLGVGAVLGVGIGMLMWYWP
FT                   GLGDLRGPVIAYVIVLSAMVSAALLARLPGPLAAWGATAFAASDAMVGISVFVFPFSDH
FT                   ELAIWWSYAAAQLLIVAGLLTRRAPPRRAMPAVPA"
FT   gene            118282..119286
FT                   /locus_tag="RCFBP_10114"
FT   CDS_pept        118282..119286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10114"
FT                   /product="Ornithine cyclodeaminase"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number="4.3.1.12"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10114"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41430"
FT                   /db_xref="GOA:D8NKP6"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41430.1"
FT                   /translation="MLQTLDATATAARLPYAALADAIAQVLREARAGRAQAPARLVMPV
FT                   PGPGSLLVMPASNAEIAITKMITVHPHNATRGLPAIHGEVVVMDAATGVRRLLLDGPTV
FT                   TAHRTAAVSLLAARLLAPEPAGDLLLIGAGVQARAHLEAFRIGLGTRRVTIVTRTAANA
FT                   EALAAHARKLGLEATAVAAGDAAGMAQAARTVLPYAPLVITATSSTQPVLPDLAEAGTA
FT                   GVGEVWRAQHFVAAVGAFRPEMAELPPWLCVQAAAAGRLFADTLVDLDAEAGDLLQAGV
FT                   PWSRVRPLQQCIDAAPDVGAQATAAVPVVFKSVGSALWDLAACTLALSKAPLV"
FT   gene            119480..120205
FT                   /locus_tag="RCFBP_10115"
FT   CDS_pept        119480..120205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10115"
FT                   /product="putative Outer membrane protein, OmpW family"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10115"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41431"
FT                   /db_xref="GOA:D8NKP7"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41431.1"
FT                   /translation="MAYKKALAAAAGMILATAAHAQSAGSNIFSLGWFRVMPNSSSDPL
FT                   QIDSVGGVPLNRQVANTGAKIKDADTVGLAFTHFFTDNVAVELVGGIPPRHKIEGTDSF
FT                   ARYGQIGSAKQWSPTVLAKWFFGGADSKFRPYVGAGLNYTWFTDEKITNSTFQTQVLGG
FT                   GFPSTSTVSTDSSLNPVLSVGATYAITKDWFVCLSVSYLPLKTTAKIDTTLANGQHSVT
FT                   EAKITINPIVTFLSVGYRF"
FT   gene            complement(120273..120473)
FT                   /locus_tag="RCFBP_10116"
FT   CDS_pept        complement(120273..120473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10116"
FT                   /product="putative Copper ion binding protein; Heavy metal
FT                   transport/detoxification protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10116"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41432"
FT                   /db_xref="GOA:D8NKP8"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41432.1"
FT                   /translation="MTTFSVEGMSCGHCVAAVTRAVQQVDAAAQVQVDLPSQTVAVRSG
FT                   AATEALRQAIEQAGYPVKACA"
FT   gene            120627..122876
FT                   /gene="copA"
FT                   /locus_tag="RCFBP_10117"
FT   CDS_pept        120627..122876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="copA"
FT                   /locus_tag="RCFBP_10117"
FT                   /product="copper transporting P-type ATPase"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12644235, 14663075; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10117"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41433"
FT                   /db_xref="GOA:D8NKP9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41433.1"
FT                   /translation="MTTASLADAASLDLEIQGMTCAACAGRVERALRAVPGVVAASVNL
FT                   ATERARIQRTDDVSGDALVAAVVAAGYEARIASDEVTAAPAAVEPGFWDGPGPVWVSAA
FT                   LSLPLVAPMVAGWLGAGWMLPAWLQWLLATPVQGVIGARFYRAGWKALRAGAGNMDLLV
FT                   ALGTSAAYGLSLWLWWRADAGDMPHLYFESAAVVITLVRLGKWLEARAKRQTAQAIRAL
FT                   QALRPDTARVRGADGTLRDVPVARVRVGDAVSVRAGERIPVDGTVVEGASHVDQSMLTG
FT                   ESLPVPKRAGDHVTAGAIAADGVLLVRTTAIGADTMLSRIIRLVEDAQAAKPPIQQLVD
FT                   RVSAVFVPVVLAAALVTLTGWMIAGAGWEHAIVNAVAVLVIACPCALGLATPSAIMAGT
FT                   GAGARRGILIADAQALERARQVDFVVFDKTGTLTVGQPRVAAVEAAPGLDGDAVLDQLA
FT                   ALQAEHTHPLAQATRDHAAARGRTIAPARSPEVLAGRGVRGVVGGAVLLLGNARWMDEL
FT                   RLDRTRLQARADALEAQGHTVSWLAQGEADGGVRLCGLIAFGDALKPGAREAVAELHRR
FT                   GIRTALVTGDNAGAARGVAEALGIDAVAAQVLPQDKAARVAAWQQSGHVVAMVGDGIND
FT                   APALAAADVGIAMATGTDVAMQAAGITLMRGEPRLVPAALDLSQRTVAKIRQNLFWAFV
FT                   YNVVGIPLAACGLLSPTFAGAAMAFSSVSVVTNALMLRRWRPRWESATATGDRAS"
FT   gene            122873..123349
FT                   /gene="hmrR"
FT                   /locus_tag="RCFBP_10118"
FT   CDS_pept        122873..123349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hmrR"
FT                   /locus_tag="RCFBP_10118"
FT                   /product="Heavy metal-dependent transcription regulator"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10118"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41434"
FT                   /db_xref="GOA:D8NKQ0"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41434.1"
FT                   /translation="MTGTDLHEASPGPVNIGEAAKASGVSAKMIRYYERIGLLPPSPRT
FT                   DGNYRVYDSRALHVLRFIHRARSLGFSLEEIRTLLSLWHDRGRASADVKAVTLRHVADL
FT                   DARIRELQGMRDTLILLADACHGDDRPDCPILEGVAGDASPCCDAASHDRGRRG"
FT   gene            123406..124266
FT                   /locus_tag="RCFBP_10119"
FT   CDS_pept        123406..124266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10119"
FT                   /product="putative monoglyceride lipase (MGL)"
FT                   /function="3.2 : Degradation"
FT                   /EC_number="3.1.1.23"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10119"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41435"
FT                   /db_xref="GOA:D8NKQ1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41435.1"
FT                   /translation="MTQAPAVVDALETRQRMKDGTELFVRTWLPAPEAGAPRGTVILVH
FT                   GMAEHSGRHLHVAKVLCELGLRVRAFDLRGHGRSGGPRMALDAPDNYLTDLAEILDAAV
FT                   AEWNELPFVLGHSMGGLIVARFTTARIRPVRGVLLSSPALRLRLPPGANVVRGLLSAVA
FT                   PKLPVPNPVDPSRLSHDPTVGAAYRADPLVQKTISASVLEFMLNAITQAQRDAPRLEAP
FT                   MLLMAGGSDTIVDPSGSRDFCANAPEDLRTLAWFETAYHEIFNETEPTRGAVFGALREW
FT                   LAGRI"
FT   gene            124320..125987
FT                   /locus_tag="RCFBP_10120"
FT   CDS_pept        124320..125987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10120"
FT                   /product="putative choline dehydrogenase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.99.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10120"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41436"
FT                   /db_xref="GOA:D8NKQ2"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41436.1"
FT                   /translation="METYDYIIIGAGSAGCVLANRLTLDPEVSVLLLEAGGKDDYHWIH
FT                   IPVGYLYCIGNPRTDWLYRTQAEPGLNGRSLGYPRGRVLGGCSSINGMIYMRGQREDYD
FT                   GWAALTGDDTWRWDAVLPFFKASEHYHGGANAWHGVGGEWRVEPQRLRWQILERFIEAA
FT                   VQAGIPRTEDFNRGDNFGVGYFEVNQKRGIRWNTAKGFLRPASQRPNLTIVTGAQVRAL
FT                   RFDGRRCTGVTYHGAGQDYAVAAREEVVLSAGAINSPQLLELAGIGQPQRLQALGIAVR
FT                   HALPGVGENLQDHLQLRSVIKVHGVPTLNTRAANWWGKAMIGMQYAFNRSGPMSMAPSQ
FT                   LGAFARSDPSVARPDVEYHVQPLSLDKFGDPLHAFNAFTASVCNLRPTSRGTVHIASAD
FT                   PFAAPLIAPNYLSTDADRKVAADSLRLTRRIVSQPALARYRPEEYLPGAAFQTDEALAR
FT                   AAGEIGTTIFHPVGTCRMGRADDAGAVVDAQLRVRGIEGLRVVDASVMPTITSGNTNSP
FT                   TIMIAEKASEMIRAARRARARGEPSAGLGLRGFDTAVT"
FT   gene            126198..126968
FT                   /locus_tag="RCFBP_10121"
FT   CDS_pept        126198..126968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10121"
FT                   /product="putative branched-chain amino acid transport
FT                   system permease, ATP binding component"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10121"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41437"
FT                   /db_xref="GOA:D8NKQ3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41437.1"
FT                   /translation="MAQDIILETRGLTKAFRGFTAVSDVNLRVRRGSIHALIGPNGAGK
FT                   TTCFNLLTKFLVPTRGTILFNGLDITPERPAQIARRGVIRSFQISAVFPHLSVLENVRV
FT                   GLQRQLGTAYAFWRSEKTLSVLNDRAMQLLDQVGLTQFADTVTVELPYGRKRALEIATT
FT                   LAMEPELMLLDEPTQGMGHEDVDRVTELIQRVAEGRTILMVEHNMNVVSSIADKITVLQ
FT                   RGQILAEGPYEAVSKNPQVMEAYMGTADAALEGH"
FT   gene            127045..127785
FT                   /locus_tag="RCFBP_10122"
FT   CDS_pept        127045..127785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10122"
FT                   /product="putative leucine/isoleucine/valine transporter
FT                   subunit ; ATP-binding component of ABC superfamily (livF)"
FT                   /function="1.4 : Pyruvate family"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /EC_number="3.6.3.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10122"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41438"
FT                   /db_xref="GOA:D8NKQ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41438.1"
FT                   /translation="MSTPALQIKDLHAWYGESHILHGVDLAVNRGEVVTLLGRNGAGRT
FT                   TTLRAIMGLVGTRKGSIVVHDAGGQGIETIGLPTHKIAHCGIGYCPEERGIFSSLSCEE
FT                   NLLLPPVLKGQVAKNGNAGMSVAEIYEMFPNLKERRNSQGTRLSGGEQQMLAVGRILRT
FT                   GANLLLLDEISEGLAPVIVQALARMILMLKKRGYTVVMVEQNFRFAAPLADRFYVMEHG
FT                   RIVERFEAAQLQDKMPILHELLGV"
FT   gene            127851..129071
FT                   /locus_tag="RCFBP_10123"
FT   CDS_pept        127851..129071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10123"
FT                   /product="putative branched-chain amino acid transport
FT                   system permease, periplasmic component"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10123"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41439"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41439.1"
FT                   /translation="MTLKKLAGALMAAGIGLTAGLAAFGAHAQVSGDKVKIGYITDLSG
FT                   LYADIDGQGGVEAVKMAIEDAGNKVLGKPIELVTADHQNKADIAASKAREWMDQQGIDM
FT                   LLGGTNSATSLAMSKVAAEKKRVFIGIGAGTARLTNEECTPYTIHYAYDTVALAKGTGS
FT                   AVVKQGGKSWFFLTADYAFGHSLENDTAAVVKANGGTVVGSVKHPLSASDFSSYLLQAQ
FT                   ASKAQILGLANAGGDTINAIKAAKEFGITKTMKIAGLLMFINDVHSLGLQTAEGLLMTD
FT                   SWYWDMNDQTRKFAARYFAKMKKMPSSLQAADYSAVSNYIKAVAAAGTDDPDKVIAQLK
FT                   KTQLNDFFSKGTIRADGRYVHDMYLMQVKTPAESKKPWDYMKIVATIPGDQAFTTPAES
FT                   KCPLLKK"
FT   gene            129156..130040
FT                   /locus_tag="RCFBP_10124"
FT   CDS_pept        129156..130040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10124"
FT                   /product="putative Branched-chain amino acid transport
FT                   system permease, membrane component (livH)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10124"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41440"
FT                   /db_xref="GOA:D8NKQ6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41440.1"
FT                   /translation="MEIFGVPLPAMLSQLLLGLVNGSFYAMLSLGLAVIFGLLNVINFA
FT                   HGALFMLGAVLTWMGLSYLDLPYWVMLVAAPLAIGAVGMVIERTMLRFIYKLDHLYGLL
FT                   LTLGVTLVIEGVFRAIYGVSGLPYSTPELLSGATDLGFMVLPNYRAWVVVASLTVCFAT
FT                   WFLIEKTKLGAYLRAGTENPKLVEAFGVNVPLMVTLTYGFGVALAAFAGVLAAPVIQIS
FT                   PLMGQNMIITVFAVVVIGGMGSILGSIVTGLGLGVIEGLTKVFYPQASSTVVFVIMALV
FT                   LLVRPAGLFGKEK"
FT   gene            130062..131054
FT                   /locus_tag="RCFBP_10125"
FT   CDS_pept        130062..131054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10125"
FT                   /product="putative Branched-chain amino acid transport
FT                   system permease, membrane component (livM)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10125"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41441"
FT                   /db_xref="GOA:D8NKQ7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41441.1"
FT                   /translation="MNHSSSFKFILYGLLLAALIAAPLAGAYPVFVAKVLCFVLFASAF
FT                   NLLLGYTGLLSFGHAAFFGGAGYVAGYLMTNQSLHVTPEVGLLAGTAAGALIGLVVGLL
FT                   AIRRQGIYFAMITLALAQMFYFFCLQAPFTGGEDGLQGVPRGKLFGVLDLSSDLTLYYF
FT                   VLVVVVAAFLVIVRTIHSPFGQILKAIKENEPRAISLGYDTDRFKLLAFVLSAALSGLA
FT                   GALKTVVLGFETLTDVHWAMSGSVILMTLVGGLGILSGPILGAALVIALENKLGDIGTF
FT                   LAGVTGVDGFNVLGESVTTVTGAIFVICVLTFRRGIMGEIAARVPWLRR"
FT   gene            complement(131308..131526)
FT                   /locus_tag="RCFBP_10126"
FT   CDS_pept        complement(131308..131526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10126"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10126"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41442"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41442.1"
FT                   /translation="MADPTRALTLQLLQSLAERPRPYTEVLETWRTSCPRLSIWEDACI
FT                   DGLVDCAPDTHLVTVSARGQALLAASA"
FT   gene            131647..132090
FT                   /locus_tag="RCFBP_10127"
FT   CDS_pept        131647..132090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10127"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10127"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41443"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41443.1"
FT                   /translation="MPPSTRLACPEDRARLLSALADACAAAPLQLAHAVDVLLGHPSQH
FT                   PCLLVEEGASLLGAAPVSLVPHPVLGGLAAWLPAGVRVFGGGPRTRDAALAAVGEYARA
FT                   HGILHVLLPPAALSAADAAALGFVQEATGCWLRAERPAPKSLG"
FT   gene            132138..132896
FT                   /locus_tag="RCFBP_10128"
FT   CDS_pept        132138..132896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10128"
FT                   /product="conserved membrane protein of unknown function,
FT                   DUF81"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10128"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41444"
FT                   /db_xref="GOA:D8NKR0"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41444.1"
FT                   /translation="MEFVLLAAAAFLAGLIDAVAGGGGLVQIPALFSAYPNLAPATLIG
FT                   TNKLASMSGTATAAVRYGRTVRIYWGATAPAMVTAFLCSLLGAWALTHIPAEPLRRALP
FT                   FVLVLLLAYTVAKKDLGAEHAPSLSGWRERATALLAGAVLGFYDGVFGPGTGSFLMIVF
FT                   VRVFGYDFLHASASTKIVNLATNVAALLLLAAKGHVWWQLGLVMAVANVLGNQAGSYLA
FT                   LKHGSRFVRKVFIVVVLALILKTAYDAFIR"
FT   gene            133080..133469
FT                   /locus_tag="RCFBP_10129"
FT   CDS_pept        133080..133469
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10129"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10129"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41445"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41445.1"
FT                   /translation="MLKQLHWPKRPASDALIIAALLRDLGHLLNPQGDASTVRGIDDQH
FT                   QSFALPFLGGVFPDAVLESIRPHVEAKRCLCAIDQHYHECLSADSVRSLALQGGRCPPT
FT                   RPTPFCTALTPPMRCACAAGTIAPR"
FT   gene            133379..133537
FT                   /pseudo
FT                   /locus_tag="RCFBP_10130"
FT   CDS_pept        133379..133537
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10130"
FT                   /product="putative HD phosphohydrolase (fragment)"
FT                   /function="8 : DNA metabolism"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="PSEUDO:CBJ41446.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(133523..134479)
FT                   /locus_tag="RCFBP_10131"
FT   CDS_pept        complement(133523..134479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10131"
FT                   /product="conserved protein of unknown function,
FT                   NAD(P)-binding Rossmann-fold domains"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10131"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41447"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41447.1"
FT                   /translation="MEQATRIALVLGATGGIGGEMARRLTAHGWRVRALHRAPDALAHR
FT                   DPAFEWVRGDAMVRDDVIAAARGAAVIVHAVNPPGYRDWAKLVLPMIDHTIAAARACGA
FT                   RVVLPGTVYNFGPDAFPVLCETSAQQPLTRKGKLRAELERRLRAAADDGVRSLIVRAGD
FT                   FFGPDARSNWFAGGLVRPGQPVRAVTYPGARGIGHQWAYVPDVAETMLRLLEQDDRLPA
FT                   FAVFHMRGHWDADGTQMTGAIRSAVGRPIRTRRFPWWALPLMAPFSVLMRELREMRYLW
FT                   RQPIRMDNAKLVRTLGAEPHTPWDDAVRATLRGLRCL"
FT   gene            134580..135476
FT                   /locus_tag="RCFBP_10132"
FT   CDS_pept        134580..135476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10132"
FT                   /product="Transcriptional regulators, LysR family"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10132"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41448"
FT                   /db_xref="GOA:D8NKR4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41448.1"
FT                   /translation="MVNPEPGWELYRTFLAVVREGSLSGAARALGLTQPTAGRHVDALE
FT                   RALGFALFIRTQQGLSPTEAALVLQPYAESLESTSAALLRAASSQGQGVRGTVRITASE
FT                   VVTGEVLPAILADLHAAYPGLTLELVPSNRLEDLLRRDADIAVRMQRPSQGVLIARHIG
FT                   GIELGVHAHRRYLERRGTPATLDDLAGHALIGYDRETAFIRGMKGQVPWMRRDRFALRT
FT                   DSDLAGLAALRAGFGIGICQVGLARRDPDLVRLFADEVAPVLDTWLAMHEDLRDSPCCR
FT                   VVFDALATGLIRYVSGD"
FT   gene            complement(135486..135701)
FT                   /locus_tag="RCFBP_10133"
FT   CDS_pept        complement(135486..135701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10133"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10133"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41449"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41449.1"
FT                   /translation="MTPEDLERLVTTPMPFGKYKGRLIADLPGHYLNWFAREGFPPGQI
FT                   GRLLALMQELDHNGLKGLLNPLRQRG"
FT   gene            complement(135698..136315)
FT                   /locus_tag="RCFBP_10134"
FT   CDS_pept        complement(135698..136315)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10134"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10134"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41450"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41450.1"
FT                   /translation="MPALSVSVDGNTLMTVSTDDGYDLLSINIHGSRIDEAFATLNLSG
FT                   GHYPDDGDSTYLTWIDQIPLQPGQAIAVSWQDQGTTSARGKTIDELATDESIAPFDPAQ
FT                   QPPLSESIAALKKRPLLRGQYAFEWIAPDRAVMAGQTLPEETSLTLSVIWHVLHRDDAA
FT                   RVSLHSTTLDNLAARAPLHYRAQCKLRVGESIRLQLGCLALP"
FT   gene            complement(136410..137306)
FT                   /locus_tag="RCFBP_10135"
FT   CDS_pept        complement(136410..137306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10135"
FT                   /product="putative transcription regulator protein, LysR
FT                   family (aaeR)"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10135"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41451"
FT                   /db_xref="GOA:D8NKR7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41451.1"
FT                   /translation="MDKLRGMETFVAVVDTGNFTEAAVQLEMSAVMVGKYVRELETRLG
FT                   ARLLQRSTRRQSLTDAGRVFYDDAKRVLEQVRWAETSVERLRAQPSGTLRVSAPTTFGA
FT                   CVIAPLAATFQQAHPQVRVELDLSNRMVDLADEGFDLAVRIGPLGDADLVAKPLCAYRM
FT                   AICASPDYLTRHGQPETPADLPAHRCLSHMVWNRRNAWQLSGWDGPTPWRDDPAFSCND
FT                   GHGLQMAAIAGAGLLLQPEVLVAEDLASGRLVRVLQPYAPEPRPIHLVYRQDRRPLPKL
FT                   TGFVDHLLQQMPARGLA"
FT   gene            137414..138019
FT                   /locus_tag="RCFBP_10136"
FT   CDS_pept        137414..138019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10136"
FT                   /product="putative 3-oxoacyl-[acyl-carrier-protein]
FT                   reductase (fabG)"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10136"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41452"
FT                   /db_xref="GOA:D8NKR8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41452.1"
FT                   /translation="MKIVVIGASGTLGRAVVAELQQGGAHEIIRVGRTRSDHQVDITHA
FT                   DSVAALFDKLGRVDAIVSTAGNLFFGPLTQMRAVDFNLGLQDKLLGQVRLALVGQHHLN
FT                   DGGSITLTTGIVGQEPIAQGANATAVNAGVEGFVRAAACELPRGIRINAVSPTVLTESM
FT                   AMYGAFFPGFESVPAARAAMAYRRSVEGVQSGRVYRVG"
FT   gene            138337..139485
FT                   /locus_tag="RCFBP_10137"
FT   CDS_pept        138337..139485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10137"
FT                   /product="putative amino-acid ABC transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10137"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41453"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41453.1"
FT                   /translation="MKVSRATRIALAATALLASTAFAQVKVGITVSATGPAASLGIPEK
FT                   NTVSLLPKEIAGKKIEYIVLDDASDTTTAVKNTRKLITEDKVDLVIGSTITPTSLAMVD
FT                   VVAENETPMISMAASARIVEPVDAKRAWVFKTPQNDSHMATAIAEHMASHGVKTVALIG
FT                   FADAYGESWSQEFDKVATLRKLKIVANERFARPDTSVTGQVLKILAAKPDAVLIAGSGT
FT                   PAALPERTLKERGYKGMLYQTHGVANADFLRVCAKDCEGTFLPAGPILVAEQLPDSNPV
FT                   KKPAMAYKTAYEKAFGGQVSTFGGHMWDAGLLLANALPAALKKGQPGTPAFRKGLRDAL
FT                   EATTNLAVSHGVMNMNAKDHLGLDQRSRVMVEIKDGKWVLQN"
FT   gene            139728..141671
FT                   /gene="mnmG"
FT                   /locus_tag="RCFBP_10138"
FT   CDS_pept        139728..141671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mnmG"
FT                   /locus_tag="RCFBP_10138"
FT                   /product="Glucose-inhibited division protein A, tRNA
FT                   uridine 5-carboxymethylaminomethyl modification enzyme"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11544186; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10138"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41454"
FT                   /db_xref="GOA:D8NKS0"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41454.1"
FT                   /translation="MLYPVEFDVIVVGGGHAGTEAALAAARMGCQTLLLTHNIETLGQM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMALATDEGGIQFRILNSSKGPAVRATRAQADRVLY
FT                   KAAIRHRLENQPNLMLFQQAVEDLLVESDRVVGAVTQVGVRFRARAVVLTAGTFLDGKI
FT                   HVGLNNYTGGRAGDPAAVSLSARLKELKLPQGRLKTGTPPRIDGRTIDFSVLEEQPGDL
FT                   DPVPVFSFLGRADMHPRQVPCWVTHTNERTHDIIRAGLDRSPMYTGVIEGVGPRYCPSI
FT                   EDKIHRFASKDSHQIFLEPEGLTTNEFYPNGVSTSLPFDVQLDLIHSMRGLENAHILRP
FT                   GYAIEYDYFDPRGLKASLESKAITGLFFAGQINGTTGYEEAAAQGLLAGINAGLQVQGK
FT                   EAWTPRRDQAYLGVLVDDLITRGVTEPYRMFTSRAEFRLSLREDNADMRLTEAGRGLGV
FT                   VDDTRWDAFNRKRDAVSRETERLKSTWVNPAILPAADAEPVLGKGIEREYSLADLLRRP
FT                   NVTYESLMGMQGGKYAPEAPLDDEPLLAEQIREQIEIGIKYHGYIARQADEVERLGASE
FT                   NTRLPADFDYKQVRGLSIEVQQKLAQHKPETIGQASRISGITPAAVSLLLVHLKKGVLR
FT                   GKVGPRSEGEAA"
FT   gene            141668..142348
FT                   /gene="gidB"
FT                   /locus_tag="RCFBP_10139"
FT   CDS_pept        141668..142348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="RCFBP_10139"
FT                   /product="Glucose-inhibited division protein B,
FT                   S-adenosyl-L-methionine-dependent methyltransferase"
FT                   /function="15.1 : Cell division"
FT                   /EC_number="2.1.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12001236; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10139"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41455"
FT                   /db_xref="GOA:D8NKS1"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41455.1"
FT                   /translation="MMTNTPTALADARSELDAGARGLGLSLDAAQLDRLLAYQALLGKW
FT                   NRVYNLTAIREAGDMLTHHLLDSLAAVPRIAERVRRVQPEAPRVLDVGSGGGLPGIPLA
FT                   IACPDIGVTMVDIVQKKTAFLTQCRAELGLGNAQSHWGHVEKLTDATGYGVITSRAFAE
FT                   LNDFVRLAGHLLAPGGRMVAMKGVHPAAEIARLPDGWAVESIERLTVPGLAAERHLIIL
FT                   APSA"
FT   gene            142390..143175
FT                   /gene="parA"
FT                   /locus_tag="RCFBP_10140"
FT   CDS_pept        142390..143175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="RCFBP_10140"
FT                   /product="chromosome partitioning protein ParB"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.1 : Cell division"
FT                   /EC_number="2.7.10.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12742016, 14563866, 9054507; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10140"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41456"
FT                   /db_xref="GOA:D8NKS2"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41456.1"
FT                   /translation="MSNIFVIANQKGGVGKTTTTVNLAAGLAAQEQRVLLVDLDPQGNA
FT                   SMGSGIDKHTLETSVYQVLVGLATVPEARQRSESGRYDVLPANRDLAGAEVELVDLDHR
FT                   ESRLKRALAEVADDYDFVLIDCPPALSLLTLNGLCAAHGVIVPMQCEYFALEGLSDLVN
FT                   TIKQVHANLNRDLKVIGLLRVMFDPRVTLQQQVSAQLESHFGDKVFKTVIPRNVRLAEA
FT                   PSYGMPGVAFDASSKGAKAYLDFGAEMIARVRQMADQPA"
FT   gene            143202..144113
FT                   /gene="parB"
FT                   /locus_tag="RCFBP_10141"
FT   CDS_pept        143202..144113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="RCFBP_10141"
FT                   /product="chromosome partitioning protein ParB"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12742016, 14563866, 9054507; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10141"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41457"
FT                   /db_xref="GOA:D8NKS3"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41457.1"
FT                   /translation="MSTIKKKGLGRGLEALLGSPAEIVEAAKQEGAPTVLKLDQMQPGK
FT                   YQPRTRMDEGALQELAASIRAQGLMQPILVRKVESDSTAQKYEIIAGERRFRASRLAGL
FT                   TEVPVLVKDVPDQAAAAMALIENIQREDLNPLEEAQGIARLIREFQFTHEQAAESLGRS
FT                   RSAVSNLLRLLNLAQPVQTMLMAGDLDMGHARALLAVDGATQITLANQIVNKRLSVRET
FT                   EKLVASTLKPFELKSQRQKSAQNGRDVTRLAEDLADSLGLPVQIKLAAKGRGQLVVQFG
FT                   SLDEFDGLLARLRPDGADEAVA"
FT   gene            144484..145041
FT                   /gene="atpI"
FT                   /locus_tag="RCFBP_10142"
FT   CDS_pept        144484..145041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI"
FT                   /locus_tag="RCFBP_10142"
FT                   /product="ATP synthase, protein I (accesory subunit)"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 16545948, 8412691; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10142"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41458"
FT                   /db_xref="GOA:D8NKS4"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41458.1"
FT                   /translation="MQPAERQRPDSHVHASSEDARSTPEPAPKRDWDADDAGEAEPPVH
FT                   ALSHDEAVALFGEKALRASRVTPFSIVLGQVAITLLCALGWYVGSWLAGTGAASAGEAA
FT                   LSALLGGGVCLVPSAWFALRLSTAKGFESIARLVVGEAIKVLGTVALLVVVVVTFKGLH
FT                   WVPLLITLILALKMYWVGLALR"
FT   gene            145275..146156
FT                   /gene="atpB"
FT                   /locus_tag="RCFBP_10143"
FT   CDS_pept        145275..146156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpB"
FT                   /locus_tag="RCFBP_10143"
FT                   /product="ATP synthase, F0 sector, subunit A"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 16545948, 8412691; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10143"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41459"
FT                   /db_xref="GOA:D8NKS5"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41459.1"
FT                   /translation="MATEVAEAAGHAAEHALTPSAYIAEHLQNFNSLGAKQTSIVDFSV
FT                   INWDTMFWSVLMGVIGLVFLGMAARRVTSGIPGRFQAFVELVVEMVDDQAKGIIHGDRT
FT                   WIAPLALMVFVWVTLMNAVDLIPVDWVTGVNHLLGTFGVHVPHHRAVATADLNGTFGMS
FT                   FAVLILMIYYSFKIKGAGGFVHELLSAPFGAKWYLAPFNLILNLIEFLAKAVSLGMRLF
FT                   GNMYAGELVFLLIALLGSIWTFGADFSALGFVGHVVAGAAWAIFHILIVLLQAFIFMML
FT                   TLVYIGQAHDHH"
FT   gene            146237..146503
FT                   /gene="atpE"
FT                   /locus_tag="RCFBP_10144"
FT   CDS_pept        146237..146503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpE"
FT                   /locus_tag="RCFBP_10144"
FT                   /product="ATP synthase, F0 sector, subunit C"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 16545948, 8412691; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10144"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41460"
FT                   /db_xref="GOA:D8NKS6"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41460.1"
FT                   /translation="MQAFLANIQGLTAIGIGIIIGLGAIGACLGIALMGGKYIEACARQ
FT                   PELMNPLQTKMFLLAGLIDAAFLIGVGVAMLFAFANPLLSVIR"
FT   gene            146622..147092
FT                   /gene="atpF"
FT                   /locus_tag="RCFBP_10145"
FT   CDS_pept        146622..147092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpF"
FT                   /locus_tag="RCFBP_10145"
FT                   /product="ATP synthase, F0 sector, subunit B"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 16545948, 8412691; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10145"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41461"
FT                   /db_xref="GOA:D8NKS7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41461.1"
FT                   /translation="MNLNATLVAQMVVFFILWWVVAKFIWPPLVKALDERAKKIADGLA
FT                   AADKGKAELELANKRVEQALTEARNEGAQRIADAEKRAQMSADEIKQNAQAEATRIIAQ
FT                   AKAEAEQQTVRARESLRDQVATLAVKGAEQILKREVNAQVHTDLLNQLKAEL"
FT   gene            147095..147631
FT                   /gene="atpH"
FT                   /locus_tag="RCFBP_10146"
FT   CDS_pept        147095..147631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpH"
FT                   /locus_tag="RCFBP_10146"
FT                   /product="ATP synthase, F1 sector, delta subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 16545948, 8412691; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10146"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41462"
FT                   /db_xref="GOA:D8NKS8"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41462.1"
FT                   /translation="MAELATVARPYAEALFRVAKAGNLGAWSELVSEMGQIAAVPDMKA
FT                   VADDPKLSKADVAGIFLSALKSPVSHEAKELVGLLVANKRLSLLPEIAAQFHVLRNASE
FT                   GAADVEITSAFPLEGAPLTELVATLERKFGKKLQPHVTVDPSLIGGVRVQVGDEVLDTS
FT                   VRARLAQMQSALTAA"
FT   gene            147693..149234
FT                   /gene="atpA"
FT                   /locus_tag="RCFBP_10147"
FT   CDS_pept        147693..149234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="RCFBP_10147"
FT                   /product="ATP synthase, F1 sector, alpha subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 16545948, 8412691; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10147"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41463"
FT                   /db_xref="GOA:D8NKS9"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41463.1"
FT                   /translation="MQLNPSEISDLIKTRIEGLKAGADAKNTGTVISVTDGICRIHGLS
FT                   GVMQGEMLEFPGNTFGLALNLERDSVGAVVLGEYEHISEGDEVKCTGRILEVPVGPELL
FT                   GRVVNALGQPIDGKGPINAKKTDVIEKVAPGVIARQSVSQPVQTGLKSIDSMVPIGRGQ
FT                   RELIIGDRQTGKTAVAVDAIINQKGKGIFCVYVAIGQKASTIANVVRKLEEHGALEYTI
FT                   VVAAAASDSAAMQYLSAYAGCTMGEYFRDRGEDALIVYDDLTKQAWAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERAARVNAEHIEKITNGEVKGKTGSLTALPVIETQAGDVSAF
FT                   VPTNVISITDGQIFLETDLFNAGVRPAINAGISVSRVGGAAQTKVIKKLSGGIRTDLAQ
FT                   YRELAAFAQFASDLDDATRKQLERGRRVTELLKQPQYLPLQVWQLAASLYAANNGFLDN
FT                   VDVKDILAFEKGLHDHLKTKYADLINRIEDTKDLGKEDEAALRAAIEDFKKSAAF"
FT   gene            149299..150174
FT                   /gene="atpG"
FT                   /locus_tag="RCFBP_10148"
FT   CDS_pept        149299..150174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="RCFBP_10148"
FT                   /product="ATP synthase, F1 sector, gamma subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 16545948, 8412691; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10148"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41464"
FT                   /db_xref="GOA:D8NKT0"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41464.1"
FT                   /translation="MAGTKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQERMRSARPY
FT                   AEKIRNVAAHMAQANPEYQHPFMVKRDVKRAGLIVVTTDKGLCGGLNTNVLRAVTNQLR
FT                   ELQGKGVETQATAIGTKGMQFLGRIGAKVVSNVVHLGDTPHLEKLIGAIKVQLDAFTAG
FT                   QIDAVYIAYTRFINTMKQEPVVEQLLPLTADKLTQTEAEKQAYSWDYIYEPDAQTVVDE
FT                   LLIRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKEL
FT                   SEIVGGAAAV"
FT   gene            150211..151620
FT                   /gene="atpD"
FT                   /locus_tag="RCFBP_10149"
FT   CDS_pept        150211..151620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="RCFBP_10149"
FT                   /product="ATP synthase, F1 sector, beta subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 11997128, 8412691; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10149"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41465"
FT                   /db_xref="GOA:D8NKT1"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41465.1"
FT                   /translation="MSIANGNIVQCIGAVVDIQFPRDAMPKVYDALVLDDSNEASFAEK
FT                   GLTFEVQQQLGDGVVRTIALGSSDGLRRGMRVANTGAPISVPVGHGTLGRIMDVLGRPI
FT                   DEAGPIACEEKRGIHQKAPKFDELSPSVDLLETGIKVIDLVCPFAKGGKVGLFGGAGVG
FT                   KTVNMMELINNIAKQHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVFGQMNEPP
FT                   GNRLRVALTGLTMAERFRDEGRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLA
FT                   EEMGKLQERITSTKTGSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALGIY
FT                   PAVDPLDSTSRQLDPQVVGQEHYEVADRVKKTLQRYKELRDIIAILGMDELSPEDKLSV
FT                   GRARKIQRFLSQPFHVAEVFTGSPGKYVPLKETIRGFKMLVDGECDHLPEQAFYMVGSI
FT                   DEAFEKAKKLQ"
FT   gene            151719..152135
FT                   /gene="atpC"
FT                   /locus_tag="RCFBP_10150"
FT   CDS_pept        151719..152135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="RCFBP_10150"
FT                   /product="ATP synthase, F1 sector, epsilon subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.14"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 16545948, 9331422; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10150"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41466"
FT                   /db_xref="GOA:D8NKT2"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41466.1"
FT                   /translation="MATIHVDVVSAEQEIFSGNAKFVALPGEAGELGILPGHTPLITRI
FT                   KPGAVRIEKEDGGEEFVFVAGGILEVQPKKVTVLADTAIRGHDLDEAKANEAKRAAEEA
FT                   LQNQSSDLDLARAQGELAVAAAQLAAIARLRRKR"
FT   gene            complement(152229..154538)
FT                   /locus_tag="RCFBP_10151"
FT   CDS_pept        complement(152229..154538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10151"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10151"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41467"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41467.1"
FT                   /translation="MTTTSCRTGRLSGHRLPRALRAASLAAVLLVCGAQAALAADPAAR
FT                   VARLSDFSGAVSFAPAGSDAWAGATLNRPFTTGDRLWSDQGSRTELHVGSTALRLGQNT
FT                   GATLVDLDDRTTQVKLTQGALSIRVRALPPDQAVEIDTPNLAFQVQEPGEYRLDVAPDG
FT                   STTTVTVWRGNGTAYGDDRSAPLTAGQQVRFGGTDLAQAGGTDYPNRDAFDRWAEARDA
FT                   REDASVSARYVGREMTGYEALDEYGSWREEDGYGAVWVPRAVPVGWAPYRTGHWAWVAP
FT                   WGWTWVDDAPWGFAPFHYGRWAYVGTTWCWVPGPVAPRPVYAPALVAFVGGGGGGVSWG
FT                   INISIGSPGVAWFPLAPGEAYRPVYAASPAYVTNINRTVVVNNVTVNKTIINNNVTNVT
FT                   NVNRVTYINANNPAALTAVPAKTFVSGQPVGPAATTLRPEQMRAQLTHAQFASTPALAP
FT                   VKASLVGAAAASGPHPLPPAQVFSRQALAVRAPQAPAGGHDPLAERFRSQGGALTGAGP
FT                   AWVGGNAARVAPVRGPANVGTPPTAAAAQAAGLRLTRATPAAMSRPGNEPGGPRGPNNP
FT                   AAPGSAQAHGAPSSPVPPQAAMAPSTARPGSQPGAMPMQERRGEEHPATPNAPAQAVHA
FT                   PPQGPTGMTTRPPQAEGQPGIPHDERRPTSSAQQERPHNAAPMQARPEMQVPRQPEARV
FT                   EAPRPVPQPRPVEVRPPQPQPHAIEMHPPQPQPQPQPRPEVRAPQPHVEHHEAAPAQPH
FT                   PPADRNDAQQREGERH"
FT   gene            155122..156264
FT                   /locus_tag="RCFBP_10153"
FT   CDS_pept        155122..156264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10153"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10153"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41468"
FT                   /db_xref="InterPro:IPR021729"
FT                   /db_xref="InterPro:IPR037126"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41468.1"
FT                   /translation="MRGHTVRERALLSALAGVFVTLMVTLWDAGTAHAASEAAPASPAV
FT                   PASAPAGAMPVASAPTAALAKSGEGRERHAGTFWQGTVGKAADSPGWNVWLSIYEPGPK
FT                   AQDEDKDPIAETLTGEAYDDRPQGRTLWAIEGRNAPERRFVWRERADGIDSGGQPITRE
FT                   GGTLSGTVSADGATAVGMWSDGGRSQPFALRRAARYLEVSGASGQAKLTERYPVTGDAA
FT                   IDALVQSLRINRCDPDDIECVIRISVMGVGETVSLLRMVWAYSGGAHGNYGFTAGNWRR
FT                   GPQGFQPITLADVLNPSPACLQSFNAQVVNALRREGAPDAARGALTEKDLRSATFPFTL
FT                   QGDRIVVHYGPYEVGPYALGAFRAAVRIDDLGAVCRRPSV"
FT   gene            156287..156748
FT                   /locus_tag="RCFBP_10154"
FT   CDS_pept        156287..156748
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10154"
FT                   /product="conserved protein of unknown function,
FT                   CoA-binding domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10154"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41469"
FT                   /db_xref="GOA:D8NKT5"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41469.1"
FT                   /translation="MSANPSYVDEQAIMRRLLSGKTIAVVGLSPRPTRPSYDVARYLQQ
FT                   AGYRIVPVNPQHAGEDVLGEPCYATLTEAATRLAAAGRRIDLVDIFRRAEHVLPVVREA
FT                   VALGVGGIWVQLGIVNDEALAAARAAGIPAVQDRCTKIEHWRLGLGERG"
FT   gene            156814..157779
FT                   /locus_tag="RCFBP_10155"
FT   CDS_pept        156814..157779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10155"
FT                   /product="putative hydrolase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="3.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10155"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41470"
FT                   /db_xref="GOA:D8NKT6"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41470.1"
FT                   /translation="MAVDPQILQFYQRLAEQFGALPPPADASAQRARFETIAEVSVRPD
FT                   PEGIEASDLTLPLPGRTLDAVMFRPQGVARPRLLVWFHGGGWVVGAARTTHRLICALLA
FT                   ADTGCAVVSVDYRLAPEHPFPAPADDARDALAYLAEQRLSLSLDPDFLAVGGDSAGGHL
FT                   AVQAAQAVHDTVQPGLVTAQLLVYPATTPAFGSESYNAFAQGPGLTRDEMRWYWTQFIG
FT                   EAALDKPLAEQDARIFPMAHPPGHTPPDTVVIVAAHDVLRDDGLAYADYLVQHGAQVVT
FT                   IEASGMTHAFARIQPEAERAREWMRRAAHAFVGLIGDAAD"
FT   gene            complement(157801..158004)
FT                   /locus_tag="RCFBP_10156"
FT   CDS_pept        complement(157801..158004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10156"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10156"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41471"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR021945"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41471.1"
FT                   /translation="MGTAIADQDEQIDKIAQDTGIPADLVRQTYMETMRALAAEARVHD
FT                   YLSLFVTRRVMAALQGRRVPPR"
FT   gene            complement(158167..159228)
FT                   /gene="pstS"
FT                   /locus_tag="RCFBP_10157"
FT   CDS_pept        complement(158167..159228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstS"
FT                   /locus_tag="RCFBP_10157"
FT                   /product="Phosphate-binding protein pstS precursor (PBP),
FT                   ABC superfamily"
FT                   /function="7.2 : Anions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10157"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41472"
FT                   /db_xref="GOA:D8NKT8"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41472.1"
FT                   /translation="MFKHAVLALAMIASGLPVFARAEILGAGSTAAAPVYRIWSAGYTA
FT                   ASGITLKYDAVGSGEGLKRIRAGSVDFGASDVPLSSADAAKAGLVCVPSVVTGAVPFVN
FT                   LPGVPRGQLRLTGDVLARIFLGKVDTWDAPELHALNPGLALPKLKIHPVVRADGSGTTY
FT                   HFTDYLSAVSADWKAAYGTKSTLAWPADFTAAKGSGDVVKAVQATPGAIGYVDYNYVLD
FT                   DDLNAVQLRNAAGHFVSAQVSGFRDAVLQSAWNRKGDFTAPLVNLPGADTWPITMGTFI
FT                   IVPAVSTNGARTLDALKFLTWGYFHGDELAARAKFVPLPERVQAIAYRELARVTDTSGA
FT                   TIGLQSMPANWAK"
FT   gene            complement(159508..160116)
FT                   /gene="gst"
FT                   /locus_tag="RCFBP_10158"
FT   CDS_pept        complement(159508..160116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="RCFBP_10158"
FT                   /product="glutathionine S-transferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2185038, 9680481; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10158"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41473"
FT                   /db_xref="GOA:D8NKT9"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41473.1"
FT                   /translation="MKLYYAPGACSLAVHIALREVGVPFDLAAVDLARHTTADGADFYA
FT                   VAPRGYVPVLELADGSRHTEGAALLQHVADLDPSQALIGAPGSPRRLAVVQWLTFVSTE
FT                   LHKVFSPWLWHKETAESTRQSVKDKLAARFAELEALFARQPWLTGDYSVADAYAFTVIN
FT                   WANLLALPLTSYPNLKAYLERVAARPKVQEALRAEGLAK"
FT   gene            160227..161120
FT                   /locus_tag="RCFBP_10159"
FT   CDS_pept        160227..161120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10159"
FT                   /product="putative transcription regulator protein, LysR
FT                   family"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10159"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41474"
FT                   /db_xref="GOA:D8NKU0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41474.1"
FT                   /translation="MHAQTQYRLSAADLEVVLAMARTGTLAAAGERLGVDASTVFRSLQ
FT                   RIERGLGQALFARSRTGYLANELAQSLAERAEQVEAALEAARSAANMAPDPVSGTVRIT
FT                   TTDTILHGLVAPALMALHAQHPGLVYDLHVGNELASLTRRDADIAVRATRRPPPHLVGK
FT                   QIGPVRVGLYAGKGSAFQHDADYADVEAGRAPWIGVDDAIPDHPSVVWRKRHFPKAVPA
FT                   YRVNSLQTVMEMVGLGLGVGILPVFLADMRRDLVPLLGVLYAGQTELWLLMHPESRHLR
FT                   RIATVYGHLAQVLRLP"
FT   gene            161388..163187
FT                   /locus_tag="RCFBP_10160"
FT   CDS_pept        161388..163187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10160"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10160"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41475"
FT                   /db_xref="GOA:D8NKU1"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41475.1"
FT                   /translation="MSSLRTRILVISSATVIGALALSGAATYAIVRASTMESIDQNLTA
FT                   IASGNTLAIDKWVAAKTLAVKATAEVVEHGDPRGLVKHMADADDFPITTIGWSDKTFFS
FT                   TSAGTPKDYDPTARPWYKSAIAAGKLIVTKPYGDASTGVPYVSFAAPLMRNGEATGALS
FT                   GAVPLEGVREVVAAVHPTPSSLAFVVARDGQVIAHPDAKLMLKPVTDVAAALTPDALSS
FT                   LAKATAPLEVELVGAAKLLKAQAVQGTDWYLVIALDKAEATAGLRSVVRALGVAVVLLT
FT                   LAAVGLAAFFTAQSFRRLSQVRDAMDTIGSGGGDLTHRLPVVGSDEVAQISASFNTFID
FT                   KIGEVLLDVRASVENMKSATGEIEMGNRDLSLRTETSASNLQETSAALTELTTSVKNSA
FT                   EAAVQATRLAGAASEAAVRGGEVVSGAVSTMDAIAQSSARIGEIIGVIDSIAFQTNILA
FT                   LNAAVEAARAGENGRGFAVVAGEVRTLAQRSAAAAREIKELIQASETSVKAGTERVNAA
FT                   GATMREIVEGIQRVGRIIGEIDGAMHEQSAGISQIDRSVAEMDQATQQNAALVEQSTAA
FT                   SSMLNEQAHGLSRTVGLFRLRGV"
FT   gene            complement(163184..163564)
FT                   /locus_tag="RCFBP_10161"
FT   CDS_pept        complement(163184..163564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10161"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10161"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41476"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41476.1"
FT                   /translation="MQVVFRTPFFQPIKGEDRETNPGVYGKALARWLVDALAARGVTAH
FT                   DVIPEDFGWVVMVSREPCLLWFGCGNVDGSMDTWTIFPVAEPSVLQRLFHRVDIDAEAG
FT                   RLEAHLRALVPGIPQVAEVVWR"
FT   gene            complement(163593..163940)
FT                   /locus_tag="RCFBP_10162"
FT   CDS_pept        complement(163593..163940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10162"
FT                   /product="putative Glutathione-dependent
FT                   formaldehyde-activating enzyme"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10162"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41477"
FT                   /db_xref="GOA:D8NKU3"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41477.1"
FT                   /translation="MTHKGSCHCGRIAFEVEGEPATAMACNCSICQRKGSLLWFVPREH
FT                   LHLLTPDENASTYTFNKHVIRHRFCPVCGMHPYGEGTGPDGRAMAAINIRCLEDIDLAA
FT                   VPVTHFDGRSH"
FT   gene            164122..164598
FT                   /locus_tag="RCFBP_10164"
FT   CDS_pept        164122..164598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10164"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10164"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41478"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41478.1"
FT                   /translation="MHRKRDLGRLRAVCAVVASTTCLGVWAQMPASAPTAPAPPLTPQI
FT                   IDMGAMTATDIGPVMPDMGTLRTKGLVATASGTVGIQVGTVVKHTHTYSDEIQYVMSGT
FT                   ATVWLDNGPREVHAGDLIVIPRGTVHGTLVTSTDFKAMAIKLPPQRAGDTQKVP"
FT   gene            164744..165838
FT                   /gene="hemE"
FT                   /locus_tag="RCFBP_10165"
FT   CDS_pept        164744..165838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemE"
FT                   /locus_tag="RCFBP_10165"
FT                   /product="uroporphyrinogen decarboxylase"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="4.1.1.37"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10165"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41479"
FT                   /db_xref="GOA:D8NKU5"
FT                   /db_xref="InterPro:IPR000257"
FT                   /db_xref="InterPro:IPR006361"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41479.1"
FT                   /translation="MSAPLANDTFLRALRRQPTEYTPLWLMRQAGRYLPEYNATRARAG
FT                   SFLGLAKSPAYATEVTLQPLDRYPLDAAILFSDILTVPDAMGLGLSFEQGEGPRFARPV
FT                   RSEADVAALAVPDMASLQYVFDAVSEIRRALVQDGRQRVPLIGFSGSPWTLACYMVEGG
FT                   GSDDFRTVKSMLYARPDLMHRILEINAAAVTDYLNAQIDAGAQAVMVFDTWGGALADGI
FT                   YQTFSLAYMARVVEGLRAGADGQRVPVILFTKGGGLWLESMAETGADALGVDWTVNLQL
FT                   ARVRTGGRVALQGNLDPTVLFAEPDAIRAQVRRVLEDYAAGGDSDGHVFNLGHGISQFT
FT                   PPESVAVLVDEVHTFSRALRARRP"
FT   gene            166422..168728
FT                   /gene="priA"
FT                   /locus_tag="RCFBP_10166"
FT   CDS_pept        166422..168728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="priA"
FT                   /locus_tag="RCFBP_10166"
FT                   /product="Primosome factor n' (replication factor Y)"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10455182, 12622722, 14762016; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10166"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41480"
FT                   /db_xref="GOA:D8NKU6"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41480.1"
FT                   /translation="MTATCAVADPPTAAQAARPAAIARVVIDTPLDAVFDYRRTQPVVP
FT                   GQLVVVPFGNRRVVALVVATADTTEVPADRLRDIERVLDWVPPLDAEWRALAEFAAGYY
FT                   HRALGEVTLPALPPLWRTPGSWDNLARQATETVYLMHEPARAALLDSIPRRAAGAMRLA
FT                   EALTGDGELSAAAAVALHGQAIAKLRDWAALGWVRAELRPKPLLPAPHEPPPPSVAPPL
FT                   NAEQATAVAGIAQAGAGGGFAPFLLYGVTGSGKTEVYLHAIADALARDPAAQVLMLVPE
FT                   INLTPQLEARIAARFPGVPLAALHSGLAEQPRALNWLAAHRGEARIVLGTRLAMLASLP
FT                   NLALILVDEEHDTSYKQQEGLRYSARDLALWRAKQRGIPVVLGSATPSLETWWRAEQGA
FT                   TTRLVLSQRAQADAVLPRVSLIDLTLERRAGREIRDGLSKPLLDAVADRLARGEQSLLF
FT                   LNRRGYAPVLACDACGWLSGCPRCSAYLVLHKPEHRLRCHHCGYESRIPHHCPDCGNVD
FT                   IAPLGRGTQRIEETLGALFPQARVARIDADSTRRKGSAEALFDTVHEGAVDILIGTQMV
FT                   AKGHDFQRVTLVGVVAPDASLFSHDFRAGEHLFASLMQVAGRAGRAGLAGEVLIQTRYP
FT                   DAPALLALVRHDYAGFARQLLRERKQACLPPFAYQALLTAEHRELARALEFLGAAREAG
FT                   QALAEAQGLPVQLHDPVPMTMVRLANRERAQLLLESGSRAALQRLLAAWTDGFAGIGKT
FT                   VKGVRWQLEIDPLRI"
FT   gene            168890..172900
FT                   /gene="putA"
FT                   /locus_tag="RCFBP_10167"
FT   CDS_pept        168890..172900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="putA"
FT                   /locus_tag="RCFBP_10167"
FT                   /product="multifunctional: transcriptional repressor of
FT                   proline utilization; proline dehydrogenase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="6.5 : Electron transport"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /EC_number="1.5.99.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12514740; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10167"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41481"
FT                   /db_xref="GOA:D8NKU7"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR024090"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41481.1"
FT                   /translation="MATTTLGVKLDDASRERLKRAAQSIDRTPHWLIKQAIFTYLDQVE
FT                   RGQLPNDISGPAADGLPSAAEAVADMADTDGAGAGAEAAVQPFLEFAQSVQPQSVLRAA
FT                   ITAAYRRPETEAIPMLLEQARLPGALSAEARQLARDLAGKLRSQKVGTGREGLVQGLIQ
FT                   EFSLSSQEGVALMCLAEALLRIPDKPTRDALIRDKISNGNWQSHLGQSPSLFVNAATWG
FT                   LLLTGKLVATHNEAGLSKALTRIIGKRGEPLIRKGVDMAMRLMGEQFVTGETISEALAN
FT                   ARKYEAEGFRYSYDMLGEAAMTEADAQRYLASYEQAIRAIGQASGGRGIYEGPGISIKL
FT                   SALHPRYARAQYDRTLNELYPRVKGLAMLAREYDIGINIDAEEADRLELSLDLLERLCF
FT                   APELAGWNGLGFVVQGYQKRCPFVLDYIIDLARRSKHRLMIRLVKGAYWDSEVKRAQVD
FT                   GLEGYPVYTRKVYTDVSYLACARKLLAAPDAVFPQFATHNAHTLAAIYHMAGQNYYPGQ
FT                   YEFQCLHGMGEPLYEQVVGGKPGKLNRPCRIYAPVGTHETLLAYLVRRLLENGANTSFV
FT                   NRIADESIPLDALVADPVAVVETMHAEEGTLGLPHPKIPLPRQLYGDVRANSSGIDLAN
FT                   EQRLASLSSALLASTGMAWAAAPTIGDAPYAGGTPQPVRNPADLRDVVGHVTEATPADV
FT                   DAALTAAAAAAPIWQATPPEARAALLERAADLMEGQMQNLMGLIIREAGKTLPNAISEV
FT                   REAVDFLRYYAAQVRGGFSNDTHRPLGPVVCISPWNFPLAIFTGQVSAALAAGNPVLAK
FT                   PAEQTPLIAAQAVRILREAGVPAGAVQLLPGRGETVGAALVRDARTKGVMFTGSTEVAR
FT                   ILQRTLAGRLDANGAPIPLIAETGGQNAMIVDSSALAEQVVADVLSSAFDSAGQRCSAL
FT                   RVLCLQDDVADRVLAMLKGGMAELAMGNPDRLATDVGPVIDAEARDNIAGHIDAMRAKG
FT                   RRVHQAPVHASVPAACAHGTFVPPTVIELDSLSDLTREIFGPVLHVVRWKRTAKDTDGA
FT                   GLTRLIEQINGTGYGLTLGIHTRIDETIAHIVERAHVGNLYVNRNIVGAVVGVQPFGGE
FT                   GLSGTGPKAGGPLYLLRLLSTCPQDAMRAALALTAGAGTDIETDERRALLAPFDALHDW
FT                   ARKQSPELAAQCDRLAVATATGAVLTLPGPTGERNTYMLLPRDAVLCVAADPADWLRQL
FT                   AAVLAVGSEAVVQENPAIAEVLRALPSAVQSRVRVVASQEDAAFDAVLHHGDSDHLRAL
FT                   CEGLARRTGPIVGVQGLPHGGQGLALERLLIERSLSVNTAAAGGNASLMTIG"
FT   gene            173030..174175
FT                   /locus_tag="RCFBP_10168"
FT   CDS_pept        173030..174175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10168"
FT                   /product="putative ABC-type branched-chain amino acid
FT                   transport system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10168"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41482"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41482.1"
FT                   /translation="MKLKQLWVAAALCVLAGGATTAASAQEVVKLGFAAPMTGAQAQYG
FT                   KDMQNGVTLAIEEFNATKPKIAGKDVKFQLVSEDDQADPKTGTTVAQKLVDGGIKGMLG
FT                   HFNSGTSIPASRVYNQAGIAQIAMATAPEYTKQGYKTTFRMMTSDTQQGSVVGTFAVKK
FT                   LGYKNIAIVDDRTAYGQGLADEFEKAAKAAGATIVRREYTNDKASDFKAILTQIKSKNP
FT                   DAVFYGGAEGQSAPLVKQMRELGMKSTLMSGEMSKTDDFIKLAGAPAAEGVVCSLAGLP
FT                   LEQMPGGAGFKQRYEKRFGSSVQTYSPYAYDGAMALMKAMVAAGSSDPSKYLPILSATN
FT                   TQGVTAKHYAYDDKGDLKDGGITVYKVTGGKWAPLESVGGK"
FT   gene            174380..175603
FT                   /locus_tag="RCFBP_10169"
FT   CDS_pept        174380..175603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10169"
FT                   /product="conserved membrane protein of unknown function,
FT                   Sodium/hydrogen exchanger"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10169"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41483"
FT                   /db_xref="GOA:D8NKU9"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41483.1"
FT                   /translation="MSAMTGLHDLFPSWPPAPGGLFWIGLALVGAALCGEFARVVLRLP
FT                   RIVGYAVAGLAAGVLGRPLIDADMLGETHILIEMALALALFELGHRLSFDWLRANRWLL
FT                   LTSAFESLLTWGLVTWLLQAFGVAVPVAVAAGAIAVATSPTVLLQLKNELRAEGQVTER
FT                   LLSMGALNSIYAGVLVPLTAGWLHSEYGHWGAALLHPLYLLAGSVLMAWVMGKAGHALY
FT                   HRMAGDDHYAFLVLVGLVLFTLALTKLLKLSVPLTLLLAGVVFKHQDAHPRVWPTHFGS
FT                   AGSILIVVMIVSLGLPLRVSDWMIGGVAAVVLVLARFVAKLAGTAALGSFSGLSMRQSV
FT                   ALGLALGPMSGLSWLLMHDTAVLYPQTGGPLSAIILCTLAIQQIAAPILTARALRWAGE
FT                   VRQEEGRR"
FT   gene            175600..176742
FT                   /locus_tag="RCFBP_10170"
FT   CDS_pept        175600..176742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10170"
FT                   /product="ATP-dependent carboxylate-amine ligase"
FT                   /function="4.10 : Glutathione and analogs"
FT                   /EC_number="6.3.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10170"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41484"
FT                   /db_xref="GOA:D8NKV0"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41484.1"
FT                   /translation="MTGMSLEPFAQSEALTFGVELELQLVNRHDYDLASASADLLRMLK
FT                   GKETPGDIKPEITESMIEIATGICHSHDEALWQLREIRDRMVEAAVPLNIGICGGGTHP
FT                   FQQWSQRTISASPRYQYISELYGYLAKQFTVFGQHVHLGCPTPDDALYLLHAMSRYVPH
FT                   FIALAAASPFVQGVDTGFASARLNSVSAFPMSGRAPFMLTWDAFVAYFEKMRATGVIES
FT                   MKDFYWDIRPKPEFGTIEVRVMDTPLTVERAAAVAAYIQALGRWLLLDRPFVPAEDDYL
FT                   VYTFNRFQACRFGLAGEYVDPASGQRGALADHILETSKLLAPHAEALASEGALDMVRDV
FT                   VERRDSDAEWIRATESETRNLHETVRRGCGRWAQATTQPA"
FT   gene            complement(176846..178894)
FT                   /locus_tag="RCFBP_10171"
FT   CDS_pept        complement(176846..178894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10171"
FT                   /product="Oligopeptide transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10171"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41485"
FT                   /db_xref="GOA:D8NKV1"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="InterPro:IPR004814"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41485.1"
FT                   /translation="MQSRPPVHIATKPLPELTLRGMILGAIITVIFTASNVYLGLKVGL
FT                   TFSSAIPAAVISMAVLRAIGGTNILENNMVQTQASAAGTLSSVIFILPGLVMIGHWQGF
FT                   PFWLTLGVCMAGGMLGVVFTIPLRHAMVVETDLPYPEGVAAAEILRVGSGHAADGSVPG
FT                   DDAVPASTGLRDIATGGVVAAVVAFATSGLRVLGEGASWWFAAGASVIRLPLGFSTALL
FT                   GAGYLIGVVAGLAMLVGLVIAWGITVPYLTAITPMPAGQSLSAFGTDVWRTQVRFIGAG
FT                   VIAVAAVWTLATLIGPVVRGVRRSFGSLRPQSGEVPRTDRDMAPRWILLVTLAMVAVLA
FT                   ITFAAFLAPATLSPGSRGLLVACAVLFAVVFGFLVAAACGYMAGLVGSSTSPISGVGII
FT                   AITLVSLLLLAVGADRGLFGSPEAGRLGIALAIFTTSAVLAVATISNDNLQDLKTGWLV
FT                   GATPWRQQVALLIGCVAGAAVISPVLELLYNAYGFSGALPRPGMDAAQALSAPQATLMT
FT                   AIATGIFTHQLQWTMVIAGVGIGAALIAIDWALKQRGGVARLPVLAVGIGIYLPPTVSA
FT                   PLVVGAVLAWGIDRILARRARAAGVPFERYAEVPNRHGVLLASGLIVGESLVGVLMAAV
FT                   IGTSGKEAPLALVGASFEGTAQWLGLIVFALVCRAFARRVLAVRPAP"
FT   gene            179278..181344
FT                   /locus_tag="RCFBP_10172"
FT   CDS_pept        179278..181344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10172"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10172"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41486"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41486.1"
FT                   /translation="MNIREASNNLLLYRERSLDDLATDISAVRALAQAAVNVELFTIPL
FT                   YMTGLYSVFGTHEINAQNISYYQGRRWPGMAPTARPATREDKAFNLVFSVFIQEMLHLQ
FT                   MAANISTAIGGTPSFTSPALQKPDHGWSCYGPEQTTIPHVINLRDTTRYHDTKVSLGAL
FT                   NKNTLDLFCAIEQTEKDAMEILQPGKRKDYFPTVPFKDWNPSKGETDLPMFGSIGHMYE
FT                   CYAQYLRIEYTDGQTLWQKLFDPNCIQQDMFNSMVKGHPRREYPRIETALNQQDLADPV
FT                   KAFNKVITFMSAITDQGEGSQIALGRSLLRYQLGPVQPAPLQLTDVKEKYREDRQSLEI
FT                   DYPSYTATGQHAPSADAEARYHYAAETHLERFEALRLELPHIMTWEKWHADPKNTWTAG
FT                   MLTTPDYDPAKDTEAIPSPQAIADALNRLKQQRATEYPTLSKVAVGAIAGITTVLDTYW
FT                   KIATTAFPYPSMVGSGDRVSLCWAVFGQAPDLGLGIGAPDDKLLYHACQALDLNGDGQD
FT                   SCAAIEIYHSCRGSNGCKAQGGCGFAQLDAGGGSCGHGSAASAGQAAKAAPYRVRGRKS
FT                   HSDATDPNLCGGPTPAPGPYSAPSDNRCGGLGGCAVPISASQLYPEGGTMVLYDFVGPQ
FT                   HEKQQIGEMTFALGDSVYGKAWQAYKEVMASRGKQIGDPPKPTDLRIALPPST"
FT   gene            181439..182449
FT                   /locus_tag="RCFBP_10173"
FT   CDS_pept        181439..182449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10173"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10173"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41487"
FT                   /db_xref="InterPro:IPR007801"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41487.1"
FT                   /translation="MSVPRLGLPNLGFGVGLRTTHLPHILRHGPGVDWFEIISENFIDH
FT                   YGYARHALERIRAEVPIVMHGVSLSIGSTDPLNRGYLAGLKRLADDIQPAWVSDHLCWT
FT                   GVAGINSHDLLPLPLTEACYRHVRQRVEAVQEFLQRPLVLENPSSYLEFAHASITECDF
FT                   LARLARETGCGLLLDVNNVYVSSHNHGFDPEAYLHRLPPEHIVQIHLAGPTDCGDLLVD
FT                   THDQAVPARVWQLYVLAQRLCGATVPDDDPMAKGAVSTLLEWDANIPDYPDLLAELGKA
FT                   RALLRGEMPLPAVSAGLPPRVAAIDPLGDPAPEPIVYSTPLDFHVRECHAVTPAA"
FT   gene            182427..183293
FT                   /locus_tag="RCFBP_10174"
FT   CDS_pept        182427..183293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10174"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10174"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41488"
FT                   /db_xref="InterPro:IPR018640"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41488.1"
FT                   /translation="MPSPPLHDVQHWLMTVMTAPGGADRGLALARHRFALTAEDLIRAG
FT                   GVADPLRRLGVYAHGYQQRLCDCLLADYPMLERVMGRDVFGFFARAYLWENPSQSTTLY
FT                   DLGAGFPDFLLRHLPAGTDPDDGVSLLPIELARLERARTEVLRARGMEQDPTPMPAAAC
FT                   LLGLAPGSAMAWRVPPCVRLLEFRLAMVPFWRAMEADDAVPACPGIAPGHVAISRVHYR
FT                   VGIHSLAGWQYAALRALRDGHPLNEALAAAAQPGTAPAEILAEWMLWAPAAQSLGLLAG
FT                   VADFPPR"
FT   gene            183683..186451
FT                   /locus_tag="RCFBP_10175"
FT   CDS_pept        183683..186451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10175"
FT                   /product="conserved protein of unknown function, Rhs
FT                   element Vgr protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10175"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41489"
FT                   /db_xref="InterPro:IPR006533"
FT                   /db_xref="InterPro:IPR017847"
FT                   /db_xref="InterPro:IPR018769"
FT                   /db_xref="InterPro:IPR028244"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41489.1"
FT                   /translation="MAVSACLSIFREVSPNVPRTELQSVLIQNRRAMRLDFGRAGSAAA
FT                   RALVPQTAEIRQGLCTGLQAQVICLSEHPDLPQHDLLGLPVSIQLATDDGTLYPVNGIV
FT                   TDVQSGQSDGALTCYRLTVGDAMSLMRGRRNMRTFVGKSVPEILETLLGEWQQRSATMG
FT                   RVFDFELLLDRSRYPVRAQTLQLDESDHGFVDRLTRYDGIWCFVKAGTRDGSASDTPVH
FT                   TLVFCDDPMRLPQSAAGTVPYHYGAAVKERDAITRWSEARSLVPGAIRGASPDHETGKV
FT                   DRVEVDTMIDQGKAGNDLARLMTDASVDRPHAGDSREDYQRRGRLRMQAHERRAACVHA
FT                   ASDVRNLTPGFWFALRGHRQVDRREARLREFVVTGQHQRVMNNFPKALGEQARALAEAS
FT                   GWHIDTRSDGDEAEVRYENTFTCVLRGVPLTPDYDPRIDLPHTEPMSAVVVGPPGEDVH
FT                   CDAMGRYKLQFVGLHTEDHAHAQGAGTSGTERDSAWVRVGNLWAGPQYGISMPLRAGME
FT                   VLVAFANGDPDRPYITAVLPGWNNMPATFSNTGSLPGNRYVSGIKTQEIKGPGHNQLRL
FT                   DDTSGEISGQLASTHAHSQINLGYLTHPREEGRGTPRGEGLEARSDAHVALRSGMAMLL
FT                   SAWQRLKASGEQLEREDYVQLMQDCLDLFKSLGSYAEQHQGVAMDTQPQEALASTIKGW
FT                   PDKPGAAQGDPAAQAAIGITAPAGISMATPKAVATYAGANVDTVAQKHVQITSGERTNV
FT                   HAGGGVSLFAHRGGLSAIANQGKLHLQSQADDTQIDSARNIHFTAVDGKLVGIGKEILL
FT                   MTPEGAYLKLHGNTVEVGGSGPFISRTAGHQWEGPAGMSADLPKFDHGALGRVPKLVRA
FT                   SDKNPVTNYQGEASQATEGASPGQTDAAGALAPVQSSRLEQLIVNFFKKRS"
FT   gene            186468..188681
FT                   /locus_tag="RCFBP_10176"
FT   CDS_pept        186468..188681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10176"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10176"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41490"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41490.1"
FT                   /translation="MTDSTSDGPRILMGTVTGVTLFDHRELICVKQTPLPGIVIFVHGV
FT                   NSDGEWFTAAEEGLCKGMNRRTARLDDQLAYKDWQLKPVHYIDGLTADGFINPNMAAET
FT                   YIQPDPSFSPVIHFRWGYKTNKEELKEFGDKIFLNEQNYWGGGPFANGCTALPDLWHEG
FT                   LDTRAFGFISLQGMNPTNRPLYRTPPRAYGVLAALRLAKLIESIRRKQADVPITVVCHS
FT                   QGNMVGLTAAFLGDRMPEVKDPWGRSGRCVADAYVLANAPYSLEENIGMDNWAQRETKD
FT                   NRGRYGRETYSARTQTLKAFFDLLRKRADGEMDAAEIDEEMANTRTSDSGGKPFNAADD
FT                   RKAHGLNGKTYGRVTLYSCPHDQVISATTVRGIGWRGMSDAEVKATGGAGVFTQRVFAS
FT                   GFTVGQWTSGKPPVYDTWKDDWRHDKGETKGFWYPPSPPARFGLVRALSGNETVWGTVA
FT                   TTALAPVLYIVTFATSALNMMCVNANPPEDWKVTADAPPLDEPFAPEARRYGKVVSVQD
FT                   GHARSHFNEGNDPQSAARNADKAAEDKKADDPYDSYKKAGKDGEMLPQGNVSTEAAQRY
FT                   EDHAIVRMRARRTGNRTWVDEDGNVIGEDGKSEMPEGYKDWQTRQVVEILDSGKNNNPS
FT                   NHSTIMTNPMHAEKALAYDVAIGVNYLTLEQMNELRIEADWRFGKGLDDDHPNKKYSRY
FT                   FFTGKLNDKFLQEWVKHDEEAKMPPGIVDEREGGMHLVLGAVA"
FT   gene            188723..190159
FT                   /locus_tag="RCFBP_10177"
FT   CDS_pept        188723..190159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10177"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10177"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41491"
FT                   /db_xref="GOA:D8NKV7"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41491.1"
FT                   /translation="MGILVLSAGLMLAWMVHDAQTTPRFYSDEELMKRLVIMPALLAGI
FT                   VFLFGTVLMQRPAQAATAKAEAATAAAEPAKPFMAQVVGLEWLNPLQRRDYPTEWQLLW
FT                   TLGLVQPNKNDDMVRTDPKKFTTLQKIVGVAFGNWGKETIRGYYRKYVDELLVLLADRY
FT                   VMNRKYFYTVASEDRKEWRELAGIRVELAVPANRLDPVETQTYLSKEMVSFFEIGNRSA
FT                   PNLWSRDTPPDVHLTQGGANAGFTSLNAALDYLQAHPQESVWVMNWDAPDFPSKEAKIN
FT                   ENLAVLFLAGPELKTEREPLAWIGRAATGNINDYERKAGTTRVIQAWKATIEAAAKNTG
FT                   RSTEDIQYTIHDAGKGSDTASGRLAGLSRTLTETMPEFDYQKQTFNTAGLLGDMGAGSA
FT                   LTNVALAIARANHLGGSVLVAGTTDPEHPTAVVVTPPAKLTPIDPDKDWFRARGENNAY
FT                   LPWWGHRHGEKYGTVQGYSW"
FT   gene            190102..190434
FT                   /locus_tag="RCFBP_10178"
FT   CDS_pept        190102..190434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10178"
FT                   /product="conserved protein of unknown function, PAAR
FT                   motif"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10178"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41492"
FT                   /db_xref="InterPro:IPR008727"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41492.1"
FT                   /translation="MVGPSPWREVRHCAGLFLVRRDTMRGIIRVGDATSHGGRVEIGAP
FT                   ASTVMGRAVARKGDRCSCPVPGHQDCTIAEGDAAFIVAGQPAAFEGHKTTCGAVLISSE
FT                   PTSGRT"
FT   gene            190468..190539
FT                   /locus_tag="RCFBP_10179"
FT   CDS_pept        190468..190539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10179"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10179"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41493"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41493.1"
FT                   /translation="MKNVIQSLALVLVPTAQRAYPPA"
FT   gene            complement(190618..191994)
FT                   /gene="sdaA"
FT                   /locus_tag="RCFBP_10180"
FT   CDS_pept        complement(190618..191994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdaA"
FT                   /locus_tag="RCFBP_10180"
FT                   /product="L-serine deaminase I"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="4.3.1.17"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15155761; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10180"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41494"
FT                   /db_xref="GOA:D8NKW0"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41494.1"
FT                   /translation="MAVSVFDLFKIGIGPSSSHTVGPMRAALMFASGLEADGLMPQVAG
FT                   VRVELYGSLGATGKGHGTDRGVILGLMGEAPDTIDPDTIDAKLAALRQSQSLSLLGRHA
FT                   VRFTEKEHIAFYRREAMAEHPNGMKFHAFDAAGERLREARYLSVGGGFVVTAGAPNTQV
FT                   LSAHGQLPHPFRSGRELLAMCGSTGKSIARLMLENELTWRSEAEVRAGLLNIWHVMQAC
FT                   VARGCRTEGELPGPFHVRRRAAELYTRLTGQAERTLSDPLSVIDWVNLYAIAVNEENAA
FT                   GGRVVTAPTNGAAGIIPAVLHYYDRFVPGANDNGVVDFLLTAGAIGLLYKMNASISGAE
FT                   VGCQGEVGVACSMAAGALAAVLGGTPAQVENAAEIGMEHNLGLTCDPVGGLVQIPCIER
FT                   NAMASVKAVNAARMALRGDGTHYVSLDSVIKTMRETGADMKTKYKETARGGLAVNIVEC
FT                   "
FT   gene            complement(192132..195080)
FT                   /gene="gcvP"
FT                   /locus_tag="RCFBP_10181"
FT   CDS_pept        complement(192132..195080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="RCFBP_10181"
FT                   /product="glycine cleavage complex protein P, glycine
FT                   decarboxylase, PLP-dependent"
FT                   /function="4.2 : Folic acid"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="1.4.4.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8375392; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10181"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41495"
FT                   /db_xref="GOA:D8NKW1"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41495.1"
FT                   /translation="MNAPHPASSALANTLAERPTLAALEARDAFAERHIGPSPDEQATM
FT                   LATLGYASRAALIDAVIPPAIRRRDGMPLGEFTQPLTEEAALAKLRGIAGQNRVAKSLI
FT                   GQGYYGTHTPGVILRNILENPAWYTAYTPYQPEISQGRLEAMLNFQQMVMDLTAMDIAN
FT                   ASMLDEATAAAEAMTLLQRVGKHPSNVFFVADDVLPQTLEVVRTRAQPIGVDVVTGPAA
FT                   DAARHNAFGVLLQYPGANGALLGDLAAYKALTDAVHAAGGLVVAAADLLALTLLAAPGE
FT                   WGADVVVGNTQRFGVPFGFGGPHAGYMAVRDAFKRSMPGRLVGVTVDAQGNPAYRLALQ
FT                   TREQHIRREKATSNICTAQVLLGVMASMYAVYHGPQGLKRIAQRVHRLTATLAAGLRAV
FT                   GYTLEADAFFDTLTVATGPRTANLHIAAQAHGFNLRQIDDARLGISVDETVTRADVVAL
FT                   WDIFAHAAHATAPDFDQTEASVADAFPASLVRQSAYLTHPVFNAHHSEHEMLRYLRSLA
FT                   DKDLALDRTMIPLGSCTMKLNATAEMLPVTWPEFANIHPFAPADQTVGYREMIDQLEQM
FT                   LCAATGYAAVSLQPNAGSQGEYAGLLIIHAYHASRGEGHRDVCLIPSSAHGTNPASAQM
FT                   AGMKVVVVACDERGNVDLADLEKKAAEHSANLAAIMITYPSTHGVFEEGVKRVCEIVHS
FT                   HGGQVYVDGANMNAMVGTAAPGHFGGDVSHLNLHKTFCIPHGGGGPGVGPVAVGAHLAP
FT                   FLPGRAASGEDASRNIGAVSAAPFGSASILPISWMYIAMMGAAGLTAATETAILSANYV
FT                   AKRLSPYYPVLYTGAHDLVAHECILDIRPLQKESGISNEDIAKRLMDFGFHAPTMSFPV
FT                   PGTLMIEPTESEPKVELDRFIDAMIAIRGEVDKVISGAFDREDNPLKHAPHTAQVVMAD
FT                   DWSHQYTREQAAYPVASLRARKYWPPVGRADNVYGDRNLFCACVPMSEYAQD"
FT   gene            complement(195145..195528)
FT                   /gene="gcvH"
FT                   /locus_tag="RCFBP_10182"
FT   CDS_pept        complement(195145..195528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="RCFBP_10182"
FT                   /product="glycine cleavage complex protein H, carrier of
FT                   aminomethyl moiety via covalently bound lipoyl cofactor"
FT                   /function="4.2 : Folic acid"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="15.11 : Biosynthesis of natural products"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8375392; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10182"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41496"
FT                   /db_xref="GOA:D8NKW2"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41496.1"
FT                   /translation="MSNTPAELKYTESHEWVRTEADGTLTIGITDLAQEQLGDIVFLEL
FT                   PEAGRKVNKGEAIAVVESVKAASDIYAPVTGEIIGNNADAAGSPESVNEDAYDAWLFKI
FT                   KPANVDDVNALLSADQYKAAAGA"
FT   gene            complement(195575..196702)
FT                   /gene="gcvT"
FT                   /locus_tag="RCFBP_10183"
FT   CDS_pept        complement(195575..196702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="RCFBP_10183"
FT                   /product="glycine cleavage complex protein T,
FT                   aminomethyltransferase, tetrahydrofolate-dependent"
FT                   /function="4.2 : Folic acid"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="2.1.2.10"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8375392; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10183"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41497"
FT                   /db_xref="GOA:D8NKW3"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41497.1"
FT                   /translation="MTLQHTPLNAIHRSLGARMVDFGGWDMPVNYGSQIEEHHAVRCDA
FT                   GIFDVSHMCVVDLTGARVRDFLRGLLANNVDKLQTPGKALYTCMLNPKGGVIDDLIVYF
FT                   FREDWFRLVVNAGTAPTDLEWIVAQNAAAGTGVTVTPRRSDNNTGPEPLGIVAVQGPNA
FT                   RAKTYAALPGTQAVGEALKPFNAGFATVDGVGEIMVARTGYTGEDGFELVVPAAQIAGV
FT                   WERLLQAGVRPCGLGARDTLRLEAGMNLYGQDMDEHVSPLDAGLAWTVDLQSERGFNGK
FT                   AALAANGQRDQFVGLLLRDKGGVLRAHQKVITPAGDGEITSGTFSPSLSQSIALARLPK
FT                   DVAIGTDVQVEIRDRKLTATVVKLPFVRNGKALVS"
FT   gene            complement(196833..196955)
FT                   /locus_tag="RCFBP_misc_RNA_7"
FT   misc_RNA        complement(196833..196955)
FT                   /locus_tag="RCFBP_misc_RNA_7"
FT                   /product="Glycine"
FT                   /inference="profile:Rfam:8.1"
FT   gene            complement(196969..197066)
FT                   /locus_tag="RCFBP_misc_RNA_6"
FT   misc_RNA        complement(196969..197066)
FT                   /locus_tag="RCFBP_misc_RNA_6"
FT                   /product="Glycine"
FT                   /inference="profile:Rfam:8.1"
FT   gene            197707..198558
FT                   /locus_tag="RCFBP_10184"
FT   CDS_pept        197707..198558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10184"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10184"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41498"
FT                   /db_xref="GOA:D8NKW4"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41498.1"
FT                   /translation="MISGALLLDERRVEDAATFYKRRVGRILLPLIFWTIAFLFWNAIK
FT                   ARFSGAEFGLVHAVKSVANGKPHYHMWFLFMIFGLYLFTPLIRTLVRNAGRREIWFFVI
FT                   VMFSLSALDELLGIFFDDEDGFFLFWFLPYIPYFICGHLIATSRRNDGKLISLVVFVAS
FT                   VFVTAIGCYLLTGMKGLDKGIYFYGNLSVSVIPMSIAWMWLLRSLSFSERVAEWFGVMS
FT                   ALTLGIYLIHPIFLESFRFFYFKAKDYYPLLSVPALTVLIFGGSLMFAFVLRKTPYLKR
FT                   VI"
FT   gene            complement(198709..199035)
FT                   /locus_tag="RCFBP_10185"
FT   CDS_pept        complement(198709..199035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10185"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10185"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41499"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41499.1"
FT                   /translation="MSRIAKAIVLTAVTLTAASGAFAQTDWQKDHPRRAEVNQRLANQN
FT                   RRIHNEVKEGEMSKAQARKLHREDHQIRQEERNMAAQNGGHITKPEQRVLNQQENKVSR
FT                   QIGN"
FT   gene            199279..201396
FT                   /gene="rep"
FT                   /locus_tag="RCFBP_10186"
FT   CDS_pept        199279..201396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="RCFBP_10186"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9288744; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10186"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41500"
FT                   /db_xref="GOA:D8NKW6"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41500.1"
FT                   /translation="MSSGLAHGLNAAQSEGVHYLDGPCLVLAGAGSGKTRVITQKIAHL
FT                   ILDKGFEPRHIAAVTFTNKAAKEMQERVAKLMDGKTREDGKRIPIKQLTVCTFHSLGVQ
FT                   ILRAEAEHVGLKPRFSIMDSDDCFGMIQEQLATTDKQLIRRVQSAISLWKNGLVDPEAA
FT                   IAEAIASNSADDHQAALVYRNYVATLHAYQAVDFDDLIRIPAELFANNEAVRLKWQNRL
FT                   RYFLVDEYQDTNACQYQLLKLLAGGSHLRAPAFTAVGDDDQAIYGWRGATLDNLKLLQT
FT                   DFPSLKVIKLEQNYRSTVRILNAANAVIAQNPKLFEKTLWSEHGMGDAINVSGANDEEH
FT                   EAESVVFKLSAHKFERRAQFRDYAILYRGNFQARLFEQILRRERIPYVLSGGQSFFDKA
FT                   EIKDLCAYLRLIANADDDPAFIRAVTTPKRGVGNTTLEVLGAFAGQAKVSLFEAAMMGG
FT                   IEAKLAPRQLEPLRVFCEFIVRLSDRAAREPASTLLDEMMGGIHYEAYLYDTYDERQAQ
FT                   NKWTNVLEFLDWLKRKGTKPENLEAEEATGYDNADGLMDTGKNLLELTQTIALISMLEG
FT                   KEDDPDAVRLSTLHASKGLEYPHVFLVGVEEGILPHCREDDDLTDEKIEEERRLMYVGI
FT                   TRAQRSLHITWCKKRKRARETVVCEPSRFIAEMKLDDGAGQTPEDTMPAMSPKDRLGAL
FT                   KGLLAAKKPAA"
FT   gene            201891..202235
FT                   /locus_tag="RCFBP_10187"
FT   CDS_pept        201891..202235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10187"
FT                   /product="putative sugar-binding lectin protein"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10187"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41501"
FT                   /db_xref="GOA:D8NKW7"
FT                   /db_xref="InterPro:IPR010907"
FT                   /db_xref="InterPro:IPR016927"
FT                   /db_xref="InterPro:IPR036684"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41501.1"
FT                   /translation="MAQQGVFTLPANTSFGVTAFANAANTQTIQVLVDNVVKATFTGAG
FT                   TSDKLLGSQVLNSGSGAIKIQVSVNGKPSDLVSNQTILANKLNFAMVGSEDGTDNDYND
FT                   GIAVLNWPLG"
FT   gene            202336..202839
FT                   /gene="aidA"
FT                   /locus_tag="RCFBP_10188"
FT   CDS_pept        202336..202839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aidA"
FT                   /locus_tag="RCFBP_10188"
FT                   /product="AidA"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15766284; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10188"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41502"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41502.1"
FT                   /translation="MSRITDVMVNVDTEAILARYGKNNSMANPPAIDFKYIYMIVTQGQ
FT                   VVSGQAGGELDIAAAVGDVIRWRETSLSLGFEYSVIFYKFVPTAGGELITPPVPIDAQV
FT                   TVPVPNPSDPTKPKKETIWNYFWNCTTRKTGRVTYHFWFSIYDRAGNLCGCYQWDPFIS
FT                   ISNA"
FT   gene            202948..203487
FT                   /locus_tag="RCFBP_10189"
FT   CDS_pept        202948..203487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10189"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10189"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41503"
FT                   /db_xref="InterPro:IPR021087"
FT                   /db_xref="InterPro:IPR038712"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41503.1"
FT                   /translation="MSTPQSPSHPDTPVRVVDVMLIFDAVTLLSRNPEASRTPAAPTPA
FT                   DPDCCYAFAPAADTLTAPTAGRLRMRAPLGALVRIRATTPSLLAEHAVLVTSLQLSGGP
FT                   ALSDPQPVVNPQAEAFVPQLSEQSHPVRHHQTDAFWQTQVLAHQPVEARIDATVLDREA
FT                   NVLGCFRLQLTIDFDA"
FT   gene            complement(203524..204234)
FT                   /gene="solR"
FT                   /locus_tag="RCFBP_10190"
FT   CDS_pept        complement(203524..204234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="solR"
FT                   /locus_tag="RCFBP_10190"
FT                   /product="Transcriptional activator protein solR"
FT                   /function="9.3 : Transcription factors"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9371457; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10190"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41504"
FT                   /db_xref="GOA:D8NKX0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41504.1"
FT                   /translation="MEPDFQDAYHAFRTAEDEHQLFREVASIARQLGFDYCCYGARMPL
FT                   PVSKPAVAIFDTYPAGWMQHYQANGFLDIDPTVRAGASSSDLIVWPVSIRDDAARLWSD
FT                   ARDAGLNIGVARSSWTAHGAFGLLTLARHADPLTAAELGQLSIATHWLANLAHTLMSPF
FT                   LVPQLVPESNAVLTAREREVLCWTGEGKTAYEIGQILRISERTVNFHVNNVLLKLAATN
FT                   KVQAVVKAIATGLI"
FT   gene            204630..205244
FT                   /gene="solI"
FT                   /locus_tag="RCFBP_10191"
FT   CDS_pept        204630..205244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="solI"
FT                   /locus_tag="RCFBP_10191"
FT                   /product="Acyl-homoserine-lactone synthase, autoinducer
FT                   synthesis protein solI"
FT                   /function="16 : Biological processes"
FT                   /EC_number="2.3.1.184"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10191"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41505"
FT                   /db_xref="GOA:D8NKX1"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR018311"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41505.1"
FT                   /translation="MRTFVHGGGRLPEGIDAALAHYRHQIFVGRLGWHLPMADGTFERD
FT                   QYDRDDTVYVVARDEGGAICGCARLLPTTRPYLLKEVFASLLMHGMPPPESPEVWELSR
FT                   FAARSGAPCPRSGRADWAVRPMLASVVQCAAQRGAQRLIGATFVSMVRLFRRIGVRAHR
FT                   AGPVRCIGGRPVVACWIDIDASTCAALGIPSASAAPGPVLQ"
FT   gene            complement(205262..206359)
FT                   /locus_tag="RCFBP_10192"
FT   CDS_pept        complement(205262..206359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10192"
FT                   /product="putative ABC-type branched-chain amino acid
FT                   transport systems"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10192"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41506"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41506.1"
FT                   /translation="MWKTWVPGCLRTLHGALVMVALAAHAQGSPPLVVGQLIERGGAQA
FT                   DFARDFMAGAKVAFDAANLAGGIRGRRITLIRREVDVAEAVPQAVELIERDRAEVLFGV
FT                   SERLLPALAAAPEIARREIPLLAPLSGATSTADNVWFIRPDYDSEIVAAHNRLRQFGMR
FT                   RIVLVTTAGFDSQLGARLRNTLADGDSAETLDLYTLTGAPGDLATRIAPTKPTAVIVAG
FT                   DTLAYASVGRALAQHGWYGFLVGLSSVNPQVAREILGSGYSGGMLLAQTVPNPAGGSLK
FT                   ITREHIARMKQFLDEPPSAATLSGYIAASFLMQAMSAAGGKASGPELRRALQTRVDLGG
FT                   FTLDFTRGNRGSAFVDLNYIQGVSN"
FT   gene            206595..208070
FT                   /gene="hemN"
FT                   /locus_tag="RCFBP_10193"
FT   CDS_pept        206595..208070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemN"
FT                   /locus_tag="RCFBP_10193"
FT                   /product="Coproporphyrinogen III oxidase"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="1.3.99.22"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12114526; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10193"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41507"
FT                   /db_xref="GOA:D8NKX3"
FT                   /db_xref="InterPro:IPR004558"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41507.1"
FT                   /translation="MFPFAQPAADAAAANDAPFRWSAPQVRALAQRFDTHGPRYTSYPT
FT                   ADRFHSGFGTDAYLDALHRRAAIAPALHAPLSLYVHLPFCANLCYYCGCNKVVTKDHTR
FT                   SARYIRALAREMAMIARHIGPLRQATQLHWGGGTPTFLSHDEMRDVMTATREHFALTSD
FT                   AEISVELDPRHAGDDTLAVLADLGFNRASLGIQDFDADVQRAIHRVQSVEQTRRVVDSA
FT                   RRLGFQSISFDLIYGLPHQHIDTFNATLDRVLEMAPDRLSVYSYAHLPHLFKPQRRIDA
FT                   LALPSADEKLDLLAMTVERLVAAGYVYIGMDHFARPDDALAIAQREGRLQRNFQGYSTH
FT                   ADCDLLAFGMSAISRVGDVYAQNEKELDAYYARIDAGRLPVLRGLTLTPDDHVRRALIG
FT                   ELMCGFELDMCAFGARHGLNFRQTFTDELTALAPLEDAGLVKVGDERIVITPQGRLLVR
FT                   RIAMVFDAHLHLHAVQEAQGQPITIVPRYSKVV"
FT   gene            complement(208075..209574)
FT                   /gene="ttuE"
FT                   /locus_tag="RCFBP_10194"
FT   CDS_pept        complement(208075..209574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuE"
FT                   /locus_tag="RCFBP_10194"
FT                   /product="Pyruvate kinase; tartrate degradation"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /EC_number="2.7.1.40"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7592429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10194"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41508"
FT                   /db_xref="GOA:D8NKX4"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41508.1"
FT                   /translation="MRRFRNTKILATLGPASSDEATIRALFDAGADVFRLNFSHGSHDD
FT                   HRRRCDAVRAVEAQSGRPIGILADLQGPKLRIGTFAGGRVVLRGGERFVLDRDPTPGDA
FT                   ARVHLPHPELFAAAAPGQSLLLDDGKIRLAVEAADPGTIVTRVVDGGPLSDRKGVNVPD
FT                   AVIPIPALTEKDLRDLDFALSLGVDWIALSFVQRAEDVRAARALIGERAGLLAKIEKPA
FT                   ALLHLEDIVQAADALMVARGDLGVELPPERVPGVQKRILRVARQHGKPVVVATQMLESM
FT                   IEAPVPTRAEASDVATAVYDGADAVMLSAESASGKHPVAAVGIMNRIIAETERDPLYRN
FT                   LIDAQHQPPLPTRQDAICAALRDVTHILGAVATVTYTSSGKTSLRAARERPLAPIVSIT
FT                   PRRDTARRLALAWGVHSTVSPDVDNVDEMVEAACRAAAREGFAVAGDPIAITAGMPFGQ
FT                   AGTTNLLRLAEIRPQTGAATAPDQTAQMAQTDAPSKTPAPA"
FT   gene            complement(209681..210997)
FT                   /gene="ttuD"
FT                   /locus_tag="RCFBP_10195"
FT   CDS_pept        complement(209681..210997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuD"
FT                   /locus_tag="RCFBP_10195"
FT                   /product="Hydroxypyruvate reductase oxidoreductase protein;
FT                   tartrate degradation"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.1.1.81"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7592429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10195"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41509"
FT                   /db_xref="GOA:D8NKX5"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41509.1"
FT                   /translation="MHTDRYARAALVAALPNPSPRALLHGLFETAVAAVSAAQCLPGHL
FT                   PPPPRGRTVVIGAGKAAAAMAEAVEQHWQGDLSGLVVTRYGHGRAAGSRGRIEVVEAAH
FT                   PVPDAAGQQAALRMVGMLDGLTRDDLVLCLISGGGSALLAAPAEGLTLADKQSVNRALL
FT                   KSGASIAEMNCVRKHLSSIKGGRLALGCAPARVETLLISDIPGDDPALIASGPTLPDAT
FT                   TCADALAVLAKYGLDVPAPVRRHLESGAGETPKPGDARFAGHGSRVIATAQQALEAAAA
FT                   RARALGYAAHILSDSIEGEARDVAEVHAGIVRQIVARNQPFNRPCVLLSGGETTVTVRG
FT                   TGRGGRNAEFLLALGVALNGLPGVHAIACDTDGIDGSEDNAGALLAPDSLARAEALGLR
FT                   PRQRLDNNDGYGCFEALGDLVVTGPTRTNVNDFRAILID"
FT   gene            complement(211083..212006)
FT                   /gene="glxR"
FT                   /locus_tag="RCFBP_10196"
FT   CDS_pept        complement(211083..212006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glxR"
FT                   /locus_tag="RCFBP_10196"
FT                   /product="tartronic semialdehyde reductase"
FT                   /function="6.11 : Sugars"
FT                   /EC_number="1.1.1.60"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10196"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41510"
FT                   /db_xref="GOA:D8NKX6"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006398"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41510.1"
FT                   /translation="MANALNLGFIGLGIMGAPMAGHLRAAGHTLFVHDVNPAPVALVEA
FT                   GVTVCTSAEEVAKRADIVFIMVPDTPHVEAVLFGEKGVAKALKEAGKDAAVNRTANRIV
FT                   VDMSSISPIATKDFAARINKLGAQYLDAPVSGGEVGAKAASLTIMVGGAQAAFDRVLPL
FT                   FQRMGKNITLVGGNGDGQTTKVANQIIVALNIQAVSEALLFASKAGADPARVREALMGG
FT                   FAASRILEVHGERMVKRAFDPGFRIELHQKDLNLALQGAKALGVALPNTATAQELFNTC
FT                   AANGWAKQDHSALCRAIEIMSNHAIA"
FT   gene            complement(212155..212937)
FT                   /gene="hyi"
FT                   /locus_tag="RCFBP_10197"
FT   CDS_pept        complement(212155..212937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hyi"
FT                   /locus_tag="RCFBP_10197"
FT                   /product="hydroxypyruvate isomerase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="5.3.1.22"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10561547; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10197"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41511"
FT                   /db_xref="GOA:D8NKX7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR017643"
FT                   /db_xref="InterPro:IPR026040"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41511.1"
FT                   /translation="MPKLAANLTMLFNEHAFLERFEAAARAGFRGVEFLFPYAFHADQI
FT                   ADRLNRFQLDLVLHNLPAGHWDKGERGIAVLPDRVGEFQDGVGEAIRYAKALGVRQLNC
FT                   LVGIRPASVSEDVARRTLVGNLRFAAGALAAEKIDLLIEPINTFDIPGFYLNRTQQALE
FT                   LIADVGADNLFVQYDIYHMQRMEGEVANTLRRHLDAIRHVQLADNPGRNEPGTGEINYP
FT                   FLFRWLDEIGYGGWVGCEYKPKAGTVEGLGWRAAHKVA"
FT   gene            complement(212972..214747)
FT                   /gene="gcl"
FT                   /locus_tag="RCFBP_10198"
FT   CDS_pept        complement(212972..214747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcl"
FT                   /locus_tag="RCFBP_10198"
FT                   /product="Tartronate-semialdehyde synthase (glyoxylate
FT                   carboligase)"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="4.1.1.47"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8440684; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10198"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41512"
FT                   /db_xref="GOA:D8NKX8"
FT                   /db_xref="InterPro:IPR006397"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41512.1"
FT                   /translation="MPKMRAIDAAVAVLEKEGITTAFGVPGAAINPLYSALRRAGSIDH
FT                   VLARHVEGASHMAEGYTRAEAGNIGVCIGTSGPAGTDMITGLYSAWADSIPILCITGQA
FT                   PRARLYKEDFQAVDIESIAKPVTKWAVTVREPALVPRVFQQAFHVMRSGRPGPVLIDLP
FT                   FDVQVAEIEFDPDTYAPLPVYKPAATRAQAERAIAMLCEAERPLLVCGGGVINADAARL
FT                   MVEFAELVNVPVVPTLMGWGVLADDHPLNAGMVGLQTSHRYGNANLLASDFVFGIGNRW
FT                   ANRHTGSIDVYTRGRKFIHVDIEPTQIGRVFGPDLGIVSDAKAALERFIEVAREWRDAG
FT                   RLPDRAAWNAEVSKRKRTMLRRSDFDNVPIKPQRVYREMNRYFPRDVRYVSTIGLSQIA
FT                   AAQFLSVNRPRHWINCGQAGPLGWTIPAAIGVKVASPGSDVVAISGDYDFQFMIEELAV
FT                   AAQFKVPYIHVVVNNAYLGLIRQAQRNFDMDYCVQLAFDNVNAPGLDGYGVDHVKVVEG
FT                   LGCKAIRVLRPQDIEPAFAQARLLMAEHAVPVVVEVILERVTNIAMGTEIDNVVEFEET
FT                   VDLEDTLDPAEGATA"
FT   gene            complement(214833..214982)
FT                   /locus_tag="RCFBP_10199"
FT   CDS_pept        complement(214833..214982)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10199"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10199"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41513"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41513.1"
FT                   /translation="MSDTSAPAPIAAARDMAAEWRRCALLRGNPGARIAAPHNLIRYTA
FT                   FAIN"
FT   gene            215095..216006
FT                   /locus_tag="RCFBP_10200"
FT   CDS_pept        215095..216006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10200"
FT                   /product="putative transcriptional regulator, LysR family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10200"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41514"
FT                   /db_xref="GOA:D8NKY0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NKY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41514.1"
FT                   /translation="MDKLKQIEAFIAVVEHGSMAAAALTQDVTPVMIGRRINALEARLG
FT                   VRLLHRSTRRIVVTEQGAVFMEQCKKALSELDRAELLVAEGRHKATGHLIVSAPAAFGR
FT                   KHVAPHAPDFLRANPDVRLSFNLTDRVVDLVREGYDLGIRIGGAIDPNFVAIRLASNKR
FT                   VVCGTPAYFARHGVPSTLDDLSRHNCLAFNLQGGQQRGWYFQHHGRMVTVKVSGNLDCN
FT                   DGELLHRWMGESLGLGWRSTWEIQPELESGALMTVLDDYALPDYDILAVYPQQRPVPAK
FT                   IRFFIEHLKAIYAQPGYWSRAV"
FT   gene            complement(216074..217393)
FT                   /gene="egl"
FT                   /locus_tag="RCFBP_10201"
FT   CDS_pept        complement(216074..217393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="egl"
FT                   /locus_tag="RCFBP_10201"
FT                   /product="Endoglucanase precursor (Endo-1,4-beta-glucanase)
FT                   (Cellulase)"
FT                   /function="15.9 : Pathogenesis"
FT                   /EC_number="3.2.1.4"
FT                   /note="Evidence 1b : Function experimentally demonstrated
FT                   in the studied species; PubMedId : 1735723, 2195024,
FT                   2738021; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10201"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41515"
FT                   /db_xref="GOA:D8NLB1"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41515.1"
FT                   /translation="MESTPRTALAGLLSRCWRFVAVALITTLLGACGGGDAEPTASTQA
FT                   TADTTALKAAATSTAASTSSVWLTVAKESAAFTVTGTQTVRFGAGGAWVEKSVSGKGQC
FT                   TAAFFGQDPLAGNTRVCQQLQGGGSLLWRGVSLAGADFAPDRLPGNYGSDYIYPSADSV
FT                   PYYKNKGMNIVRLPFLWERLQPTLNQPFDATELSRLISFVRAVTLSGQTVLLDPHNYAR
FT                   YRGNVIGSAAVPETAYADFWRRLATQFKGNARVIFGLMNEPHSMPTEQWLSAANAALAA
FT                   IRSANASNVVFVPGNAWTGSRTWSDNWYGTPNSTVMRDVIDPGHNFVFEVHMYLDNDGS
FT                   GSSATCASASIGVERLQNFTTWLRANRYRGFLGEMGAGANALCNQAVSNALAFVRGNAD
FT                   VWTGWTWWAGGPWWGNYIYSIEPSNGVDKPQMSVLSPYLN"
FT   gene            complement(217637..218221)
FT                   /locus_tag="RCFBP_10202"
FT   CDS_pept        complement(217637..218221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10202"
FT                   /product="putative elongation factor"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10202"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41516"
FT                   /db_xref="GOA:D8NLB2"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41516.1"
FT                   /translation="MPTYTLRAPVTAELEIRKSRFIGLAVPVEDRAAAMDVIARLRAEH
FT                   PTATHVCWALLAGGQSGMSDDGEPSGTAGRPILEVLRHHDLDGTLGAVVRYFGGVKLGA
FT                   GGLVRAYTDAIATALTRAERIERIARATLTLVTDYADEARIRRWLEDTGYTLVDAAYDE
FT                   GVTLTVRLPVTEEAAARVTLQDLTQGRVLVA"
FT   gene            complement(218229..218918)
FT                   /locus_tag="RCFBP_10203"
FT   CDS_pept        complement(218229..218918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10203"
FT                   /product="putative transcription regulator, GntR family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9.3 : Transcription factors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10203"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41517"
FT                   /db_xref="GOA:D8NLB3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41517.1"
FT                   /translation="MTEDTQVADISSEGIADDIAQAIVAHRLPPGTKLREEALARVYRV
FT                   SRTKIRAALLMLAKDKLIRIEPDRGAFVAKPDETEAREVFAVRRVLEVALVREFIARAT
FT                   PADYARLEQHLAEEHEVAASTDVPRRNRLMADFHLLMADVVGNSVLKEMLRELSARSSV
FT                   ITMMYQSTYDAVRSSDEHTAFLAAAKRGDVEGAIALMDEHMAHTEASLHFTLMPPGETD
FT                   LVTALLA"
FT   gene            complement(218950..220290)
FT                   /gene="dctA"
FT                   /locus_tag="RCFBP_10204"
FT   CDS_pept        complement(218950..220290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dctA"
FT                   /locus_tag="RCFBP_10204"
FT                   /product="citrate and C4-dicarboxylic acids transport
FT                   protein, Sodium:dicarboxylate symporter (SDF) family"
FT                   /function="6 : Energy metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10482502; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10204"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41518"
FT                   /db_xref="GOA:D8NLB4"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41518.1"
FT                   /translation="MQRITRPLFGQVLIALALGIALGIWAPDFAQHLKPLGDGFLKLIK
FT                   MLVAPIVFSVVVVGICGAGELKKVGRVGGKAVIYFEVVTSIALALGIVLAYAFGPGHGM
FT                   NVDPKTLDPSAMASYLTTAKQVESSGVADFLLRLIPDTFVSGFMKGDILQVLLVSILFG
FT                   CALSLLGERTKPLVGLIDQLSHVLFRMMAVVIRLAPLGVLGAVAFTVGKYGAGSLKQLG
FT                   FLVLLFYVAVTLFVVVVLGSILRLAGFNIFKLIRFLRAELLVVLGTASSDAVLPSIMNK
FT                   LEHMGIKRSVVGLVIPTGYSFNLDAFSIYLTLAAVFIAQATNTPLAMSDLLLILGVALI
FT                   TSKGAHGIPGSAIVILAATLSVIPAIPAIGLVLVLSVDWFIGIARALGNLIGNCVATVV
FT                   IAAWEKDIDRGRANAVLDGKLDITDEGEAVAVGHGVPAPAAHTMPHA"
FT   gene            220603..221613
FT                   /gene="alc"
FT                   /locus_tag="RCFBP_10205"
FT   CDS_pept        220603..221613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alc"
FT                   /locus_tag="RCFBP_10205"
FT                   /product="allantoicase (Allantoate amidinohydrolase)"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="3.5.3.4"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10205"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41519"
FT                   /db_xref="GOA:D8NLB5"
FT                   /db_xref="InterPro:IPR005164"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015908"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41519.1"
FT                   /translation="MAMPTLDPNAPDFTRRYPNLADPRLGAVATFATDEFFAPKDRMLN
FT                   PEPAVFIPGKYDDHGKWMDGWETRRRRNGGYDHCIVKLARPGVVKGVDIDTSHFTGNFP
FT                   PAASIDAAFVPHGEPTDATQWTELVPSTTLQGNSHHYLDVFGTHAYTHLRVNIYPDGGI
FT                   ARLRVYGQPQVDWKGADRATLFDLAAMENGAYVVEVNNQHFGLASNLLMPGRGVNMGDG
FT                   WETRRRREPGNDWCVIALAHPGRIRKIEVDTAHFKGNFADRVSLQAARVTGGTDATLKT
FT                   QAMFWQTLLPEQKLQMDHQHYYEAEIADLGSVTHVRFNMFPDGGVSRLRLWGVLE"
FT   gene            221610..222140
FT                   /gene="allA"
FT                   /locus_tag="RCFBP_10206"
FT   CDS_pept        221610..222140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="allA"
FT                   /locus_tag="RCFBP_10206"
FT                   /product="Ureidoglycolate hydrolase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="3.5.3.19"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 16114032; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10206"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41520"
FT                   /db_xref="GOA:D8NLB6"
FT                   /db_xref="InterPro:IPR007247"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR023525"
FT                   /db_xref="InterPro:IPR024060"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41520.1"
FT                   /translation="MSHDIATTALAIEPLTREAFAPFGDVIELDGAQQFPINQGTTTRF
FT                   HDLADVEVGEGGRALINLFRGQPRALPFEVKMLERHPRGSQAFIPLNDRPYLVVVAPAG
FT                   ELDPARLRAFVTRGWQGVNYARGVWHHPLLALDAVSDFIVIDRGGEGPNCDEQDLPEPV
FT                   WLTEAALRAAQRQ"
FT   gene            222160..223434
FT                   /locus_tag="RCFBP_10207"
FT   CDS_pept        222160..223434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10207"
FT                   /product="Putative acetylornithine deacetylase (argE)"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="3.5.1.16"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1551850; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10207"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41521"
FT                   /db_xref="GOA:D8NLB7"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41521.1"
FT                   /translation="MTQADIATRGIDADIHAFVEAAHAQQVAFLRELVKVPSDNPAGDC
FT                   APHAARAKALLEALGLAVEAHPVPPADVRAAGMISATNLIVRHTFGRGGPTIALNAHGD
FT                   VVPPGLGWTHDPYGGEIVETEHGPTMFGRGVAVSKSDFATYAWALLALIDAERRGARLN
FT                   GTVELHFTYDEETGGNIGPKWLLDQGLTRPDYAISAGFAHGITSAHNGCLHVEVTVRGK
FT                   QAHAAMPHTGLDAIEAATHILQAVYAYRAELATRTSAVPGIDHATLNVGLIQGGINTNV
FT                   VPDRVAFRIDRRMIPEEAGRDAEGELRVVIERAARERPGIAVSVERILLAEPLAELPGV
FT                   HTLIAALRQQALAVFGGEVPVHGVPLYTDARHYTARGVPTVLYGAGPRTLMEARGHNTD
FT                   ENLRLSDLRGATVVVGCAVAALLGG"
FT   gene            complement(223457..223942)
FT                   /locus_tag="RCFBP_10208"
FT   CDS_pept        complement(223457..223942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10208"
FT                   /product="Putative type III effector protein"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10208"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41522"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41522.1"
FT                   /translation="MKRIDVHAIPEPAREPIEAPAPAPDPAAPVPQPTDTTLALLEAAV
FT                   RRLLQEVNGSLVPARRHVKKRRRISQTEVAVLVLVRERKNANGHSEWVVERVRLGERAL
FT                   GVDVLGNSGEFTTQGDFDIGPPQGGASAGAVGVVVEQYASHTTVADTATATATTRPA"
FT   gene            224211..224567
FT                   /gene="arsC"
FT                   /locus_tag="RCFBP_10209"
FT   CDS_pept        224211..224567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="RCFBP_10209"
FT                   /product="arsenate reductase with thioredoxin-like domain"
FT                   /function="15.5 : Detoxification"
FT                   /EC_number="1.20.4.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7721697; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10209"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41523"
FT                   /db_xref="GOA:D8NLB9"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41523.1"
FT                   /translation="MRIYHNPRCSKSRAALEQVEAFTGRAGEPLEVIDYLKTPPTLAEL
FT                   KTLAQQLDTPVRSLVRENEDEYTQLNLADPALSDAALLEAIAAHPKLLQRPVLVRDGRA
FT                   IIGRTPEALDAFLK"
FT   gene            complement(224697..224966)
FT                   /locus_tag="RCFBP_10210"
FT   CDS_pept        complement(224697..224966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10210"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10210"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41524"
FT                   /db_xref="GOA:D8NLC0"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41524.1"
FT                   /translation="MRFSRDALDTHHLRAMTERLHWHRKTSAKAVPLDARAHSHLHRAR
FT                   GDESDDAEVMKVTAVSTAVALAVVLVAMLAIGFGSELARWMGLE"
FT   gene            complement(225241..225945)
FT                   /locus_tag="RCFBP_10211"
FT   CDS_pept        complement(225241..225945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10211"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10211"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41525"
FT                   /db_xref="GOA:D8NLC1"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41525.1"
FT                   /translation="MSDDASSAQTAPAAAPAAPADKPRRKRGNPPPDTRPEIYVSTDIE
FT                   ADGPIPGPHSMLSFASAAYLADKTLVGTFEANLETLPGAEGHPIQMQWWAQQPEAWAAC
FT                   RHNPEAPEAALPRYVEWVESLPGKPVFVAFPAGFDFTFMFWYMMRFAGRSPFGWAALDI
FT                   KTLAFALTGLPYRRNVKAAFPAQWHDPLPHTHIALDDAKEQGALFCNMLAELRRRETEQ
FT                   AALKAAIQPAQD"
FT   gene            complement(225942..226598)
FT                   /locus_tag="RCFBP_10212"
FT   CDS_pept        complement(225942..226598)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10212"
FT                   /product="putative enzyme with
FT                   metallo-hydrolase/oxidoreductase domain"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10212"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41526"
FT                   /db_xref="GOA:D8NLC2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41526.1"
FT                   /translation="MKVVVVPVTPFEQNCTLLIGDDGRAAVTDPGGDIDRILSAARQQG
FT                   ARIEKILLTHGHVDHCAAADALRTQLGVPIEGPHRDEAFWIDQLPTQSQRFGFPPARAF
FT                   VPDRWLEDGDTVEAAGRTLEVFHCPGHTPGHVVFFSRPDRIAIVGDVLFAGSIGRTDFP
FT                   RGNHADLIRSIRTKLWPLGDDVTFVPGHGPVSTFGDERATNPYVADSLFADEGTA"
FT   gene            226802..227509
FT                   /locus_tag="RCFBP_10213"
FT   CDS_pept        226802..227509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10213"
FT                   /product="putative rare lipoprotein A (rlpA)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10213"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41527"
FT                   /db_xref="GOA:D8NLC3"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41527.1"
FT                   /translation="MLKPTHPLPSPSAGRTLRAWLLHGATLAVLAGCAAVPGEPPSTAT
FT                   NAPAPHVADSRDTPDAWGTLAFRGVPESNGLQMAPADTEPGLRADLGTFEQRGLASWYG
FT                   RGFHGRRTASGERFDMNAFTVAHPSLPLSSWVLVRNLANDRVVVAKVTDRGPYHGKRII
FT                   DLSYAAAKRLDFVRRGSTQVEIRRLSHAEVEALRPELTQTDVASNSGDADAGADEPAPP
FT                   RRKAAKRRAKAHR"
FT   gene            complement(227506..228408)
FT                   /locus_tag="RCFBP_10214"
FT   CDS_pept        complement(227506..228408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10214"
FT                   /product="putative Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase, UPF0011"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10214"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41528"
FT                   /db_xref="GOA:D8NLC4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41528.1"
FT                   /translation="MSDPDWTLLAHDQHYPAGALYVVATPIGNVADVSLRARHALGLAD
FT                   AVACEDTRNTGQLLHRLGLSRPMLAAHEHNEREAAARIVERLARGERIAYVSDAGTPGV
FT                   SDPGARIVEAVRAAGHRVIPLPGASAVVTALSAAGELLETSAGQFTFVGFLPPKAGQRE
FT                   AAIRQWAAHGPAWVLYEAPHRIEATLAALAGHLPARRLLIGRELTKLFEQIVVLPAAEA
FT                   PAWLAADASHGKGEFVLVVEGAGAQEAAPTAMAADQVLRLLLAELPAKRAAKLAGAITG
FT                   APVDALYQSALALKNDGKD"
FT   gene            228444..228860
FT                   /locus_tag="RCFBP_10215"
FT   CDS_pept        228444..228860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10215"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10215"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41529"
FT                   /db_xref="GOA:D8NLC5"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41529.1"
FT                   /translation="MHAPQPVASPPMPSPHDSATTGEAGEDRALRYLQARGLSAVARNY
FT                   RCKTGEIDLVMRDAAGTLVFVEVRARVARSTQRFGGAAASVTPAKQRRLIAAAEDFLAH
FT                   HAGRPDEVPACRFDVIAIDGARIEWMRDAFGAEA"
FT   gene            228919..229737
FT                   /locus_tag="RCFBP_10216"
FT   CDS_pept        228919..229737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10216"
FT                   /product="conserved exported protein of unknown function,
FT                   predicted periplasmic or secreted lipoprotein, BON domains"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10216"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41530"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41530.1"
FT                   /translation="MKLPLPTSARLKRTVVLAALAGITATQLTACFPLFAGAVAGGVAL
FT                   ATDRRPTATQTIDRGLQMEAENSLIARYNGLAHVNVTVYNRKVLLTGEARDEQVKQQIG
FT                   QYAQKLENAREVVNEMTVGEFSSFGARTNDTYITTKVKAALAGTEGVPWNSIKVTTEAQ
FT                   AVYLLGVVTESEGNRATDAARTVGGVGKVVKVFDYVSEDERKRLDTNATSSNPSTTSDA
FT                   SQATTPAPQGTPTATQAPAPVTSASPGQPGAGTTVSPTTLPTLPPGKQLP"
FT   gene            229869..230219
FT                   /locus_tag="RCFBP_10217"
FT   CDS_pept        229869..230219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10217"
FT                   /product="putative cytochrome c, soxE homolog"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10217"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41531"
FT                   /db_xref="GOA:D8NLC7"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41531.1"
FT                   /translation="MPVAHRLAAAASLAALSAVPSVAHAAEAPPSNAQARTWAASCASC
FT                   HHADTAPGAKTAAPTLAPLAGRPQAELIATLQAFRNGTRPSTVMGQLMRGYDDAQIAAI
FT                   AGWLSRQPQETP"
FT   gene            230216..231511
FT                   /gene="soxF"
FT                   /locus_tag="RCFBP_10218"
FT   CDS_pept        230216..231511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxF"
FT                   /locus_tag="RCFBP_10218"
FT                   /product="Sulfide dehydrogenase [flavocytochrome c]
FT                   flavoprotein chain precursor"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.8.2.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11863431, 7939681; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10218"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41532"
FT                   /db_xref="GOA:D8NLC8"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR015323"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037092"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41532.1"
FT                   /translation="MSGPTVREDRRALLRAIGATALAGPLAACASLSGLRNARVVVVGG
FT                   GYGGATAAKYVRVFSGGRVDVTLVEPNAAFVSCPLSNLVLSGDRDLASLTVPYDALVAR
FT                   HGVRWVRDRAAAIDLGARQVRLDGGDTLDYDRLILSPGIDFVPGAIPGLANATAAARAP
FT                   HAWKAGAQTLALRHRLEAMPNGGVVAISIPLAPYRCPPAPYERACLIAHWLQRARPASR
FT                   VLILDANDDVTSKGALFKRVWAQRYPNHIEYRPQYNAVDLGAAGRVLKFDVQDDIEADV
FT                   VNLIPPQRAGAIAVGAGLATANGRWCEVDFLSFESTVAPGVHVIGDAIQTAPLMPKSGH
FT                   MANQHGKVAAAAVVAMLAGRAPDPSPLYANTCYSFTAPDEAMHVATVHRYDATERTMVT
FT                   VPGAGGLSDAPSVTEGRLAQGWSRAIWSDMLG"
FT   gene            231641..232537
FT                   /gene="eamA"
FT                   /locus_tag="RCFBP_10219"
FT   CDS_pept        231641..232537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eamA"
FT                   /locus_tag="RCFBP_10219"
FT                   /product="cysteine and O-acetyl-L-serine efflux system,
FT                   DUF6"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10219"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41533"
FT                   /db_xref="GOA:D8NLC9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41533.1"
FT                   /translation="MSPKDLLLALTVVLVWGVNFVIIKVGLHGVPPMLLGALRFLLVAF
FT                   PAVLFVPRPKIALKWLLAYGATISLGQFAFLFSAMYVGMPAGLASLVLQSQVFFTLTIA
FT                   AVVLREPIRWFHLAGMAVAACGLAMIGMAGTGNAGAATGMTTAGFLLTLCAAFSWSSGN
FT                   IVTKRIGPVNVVSLVVWAALIPPVPFFLLSYWMEGPQQIAHSLANLGGSSIGAIAYLAF
FT                   GATLFGYSLWSRLLARYAASQVAPLTLLVPVVGLVSAALLLGEQLAPAQWLGGAVVMAG
FT                   LLLNVFGGRWATRRALA"
FT   gene            232695..233042
FT                   /gene="SoxD"
FT                   /locus_tag="RCFBP_10220"
FT   CDS_pept        232695..233042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="SoxD"
FT                   /locus_tag="RCFBP_10220"
FT                   /product="sulfite oxidation cytochrome c-551"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10220"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41534"
FT                   /db_xref="GOA:D8NLD0"
FT                   /db_xref="InterPro:IPR002324"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41534.1"
FT                   /translation="MKFAASLAAGAVLAGLALSAAPVQAAVDAVRAQAIAGQNACLGCH
FT                   AIDRKLVGPSYQDVAAKYKGDTGAQAKLIQKVRQGGLGVWGQIPMPANPKISDADLKTV
FT                   IDWVLAGAPAK"
FT   gene            233045..233536
FT                   /gene="soxY"
FT                   /locus_tag="RCFBP_10221"
FT   CDS_pept        233045..233536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxY"
FT                   /locus_tag="RCFBP_10221"
FT                   /product="Sulphur oxidation protein"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10221"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41535"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR016568"
FT                   /db_xref="InterPro:IPR032711"
FT                   /db_xref="InterPro:IPR038162"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41535.1"
FT                   /translation="MRAMQDHATHPIHPTRRDVLRAGAMMALLVAAGLATPAQAAEWNK
FT                   SAFDAKGVNDVLKSLGGGAVDKGGAGIQFNAPDIAENGAVVPLVVTSTLPGTDLIAILV
FT                   EKNPNTLAATFAIPAGTEPYINTRVKMGQTSMVYAAVRAGGKWVLTSKEVKVTLGGCGG
FT                   "
FT   gene            233556..233867
FT                   /gene="soxZ"
FT                   /locus_tag="RCFBP_10222"
FT   CDS_pept        233556..233867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="soxZ"
FT                   /locus_tag="RCFBP_10222"
FT                   /product="Sulfur oxidation protein"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10222"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41536"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR014880"
FT                   /db_xref="InterPro:IPR030995"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41536.1"
FT                   /translation="MADPMRIRATENGGVTDVKILMKHDMETGQRKDTAGKIVPAWHIT
FT                   NVTVQHNGKTVLDAQFGPAVSKDPFLNLKFKGAAKGDKVAVTWVDNHGDKRTDEATVQ"
FT   gene            233877..234335
FT                   /locus_tag="RCFBP_10223"
FT   CDS_pept        233877..234335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10223"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10223"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41537"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41537.1"
FT                   /translation="MRRSFFRLSAALAALGVVGRASAQAAAQTRGAAGGRYKVVYQISE
FT                   GTEQAVRAIGNLRNHLNGAPGTRIVVVALGRGIDFLVEGAKDDKGRSFDAPVAALASMG
FT                   VEFRVCHNSLAAFKVPEDKLLLEAKVVPAGVVEITRLQQDEGFAYLKP"
FT   gene            234339..235166
FT                   /locus_tag="RCFBP_10224"
FT   CDS_pept        234339..235166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10224"
FT                   /product="putative cytochrome of the thiosulfate-oxidizing
FT                   multi-enzyme system, soxA homolog"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10224"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41538"
FT                   /db_xref="GOA:D8NLD4"
FT                   /db_xref="InterPro:IPR025710"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41538.1"
FT                   /translation="MHGGHVKRTFGIVALAAGMALTAQAQDDSKDSTAAALAQYRQMLA
FT                   DGNPAELWEAAGEELWKKPAGPKQASLEACDLGLGPGVVKGAYARLPRYFKDTGRVMDV
FT                   EQRLMHCRMTLQGLTQDEASANPFSSPGKPSEIERLVAYITAESRGTVIDIPLAHPQER
FT                   RVYELGRRMFFYRAGAYDFACATCHAQPGQRIRLQELPDLLTSEGARSAYTTWPGYRVS
FT                   QGEVRTMQHRLYDCLRQQRFPEPLYGAEVITALELFLARNANGGKMDAPSIKR"
FT   gene            235163..235816
FT                   /locus_tag="RCFBP_10225"
FT   CDS_pept        235163..235816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10225"
FT                   /product="putative cytochrome of the thiosulfate-oxidizing
FT                   multi-enzyme system, soxX homolog"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10225"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41539"
FT                   /db_xref="GOA:D8NLD5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR016823"
FT                   /db_xref="InterPro:IPR030999"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41539.1"
FT                   /translation="MRPRMLRSTLIALACVAGTAHAADATVIVPPKPDARADAVLTQAI
FT                   RDSFVSKGPATVEGVTARDDVQKTCSQYADRNAVPAAVAAKLQDAQLKTIRYPQDGKWL
FT                   GDWKAGEKIAQSGRGMQFSDPAGTVNGANCYACHRLSKEEVSYGTIGPSLYQYGKLRGD
FT                   SEAILRYTWGKIYNSNAYAACSNMPRFGHKGILTEQQIRDVMALLLDPASPVNQ"
FT   gene            235851..236345
FT                   /locus_tag="RCFBP_10226"
FT   CDS_pept        235851..236345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10226"
FT                   /product="putative disulfite reductase/thioredoxin, soxW
FT                   homolog"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10226"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41540"
FT                   /db_xref="GOA:D8NLD6"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41540.1"
FT                   /translation="MWLAAAMLPMALAAGAAHAVEVGDIVTLPDVQLLDGTRVPGASWR
FT                   GHPVIIAMWASWCPYCALQNPRLQKLYDATRGTGLRILTVSIDANPQLAGDYVAKRGFT
FT                   FPVTMESDALCAATGPRKGLPELLVLDADGRVVKKETGEMLEDDVADLARYAHGTQAPA
FT                   P"
FT   gene            236342..238063
FT                   /locus_tag="RCFBP_10227"
FT   CDS_pept        236342..238063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10227"
FT                   /product="putative 5'-nucleotidase, soxB homolog"
FT                   /function="2.3 : Purine ribonucleotide biosynthesis"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /EC_number="3.1.3.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10227"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41541"
FT                   /db_xref="GOA:D8NLD7"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR030998"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041829"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41541.1"
FT                   /translation="MNRRAFVQALAVAAAAGLRLADARADTDTGLYDLPRFGNVHLLHF
FT                   TDCHAQLLPIEYREPGVNLGVAQWAGQPPHLVGHALLARYGIAPGSRAAHAFTPLDFTE
FT                   AARRYGRMGGFAHLATLIKRLRATRPNALLLDGGDTWQGSATSLWTRGQDMIDAALMLG
FT                   VDVMTPHWEMTYGADRVRHVVDHDFKDKVAFVAQNIQTADFGDPVFDPYVLRELNGVPV
FT                   AIIGQAFPYTPIAHPADFTPDWTFGIQEARLQERVDEARGKGAKAVVLLSHNGMDVDLK
FT                   LASRVRGIDVILGGHTHDAAPAPVRVSNPGGSTLVTNAGSNGKFVGVLDLDVRGGTVHD
FT                   LRYTLLPVFADLLPPDPAMAALIERVRAPYKDTLGEVLAVNRGLLYRRGNFNGTFDQLI
FT                   VDGLMQAQGAEIAFSPGFRWGTTLLPGEPLTLEALMAQTAITYPATTLADMTGATIKTV
FT                   LEDVADNLFNPDPYYQQGGDMVRTGGLRYTIDPTQPIGRRITDLRLGDQPLDADRRYKV
FT                   AGWAAVSAAARHTGGRPVWDVLADWLRDQREVTARPLNTPRIVGMTGNPGIETGRG"
FT   gene            238101..238176
FT                   /locus_tag="RCFBP_tRNA1"
FT   tRNA            238101..238176
FT                   /locus_tag="RCFBP_tRNA1"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            239019..239735
FT                   /locus_tag="RCFBP_10228"
FT   CDS_pept        239019..239735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10228"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10228"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41542"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41542.1"
FT                   /translation="MGVQDRDWYRDRREPQLRNPDWQKEYARWYGKPPKGAKHGVPWTR
FT                   SLMVWGAVLLVVYIAAKQLRLTGNGAALSGQQAASTQSAPTTAPPLRQPAPTAQQPTAQ
FT                   TVAPLGGVNKCVINGQTVYTEAPCAQAMRALVGNAPAQAPGNARQREMEEAAVSVRRAE
FT                   EQLARQWDQRMAQRDRDLAAEQIAVQQQVSAVNAECARLKADRDGILRLSVTTQQMSPW
FT                   RDNLNYIRKRMNELHC"
FT   gene            239823..240770
FT                   /locus_tag="RCFBP_10229"
FT   CDS_pept        239823..240770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10229"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10229"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41543"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41543.1"
FT                   /translation="MELNPGISAEQRYWWRIALELRLRQSNSDGFQDFFSVVMGLLHGD
FT                   DFVRVQPFGKLGDKGCDGYLNSSGQLFQCYGALNGESKQVATLIKKMKGDFGKAATKLA
FT                   VIMREWHMVHNLIEGVPTEAITTLKELEVANPTIKFGFIGVEGFVERVFKLTVEQVSGL
FT                   LGPTASPVDAKNLDISALRELVNDLAAAADAAQLAAVDLRPVPVDKLAYNQLPNHWKSL
FT                   ISGGWINAPVVASYFERHPDPLMGDKMAALFKGKYEYFKTQHLAPGDIMAALFELVTGV
FT                   GNVLPPQQVAAQALLAFLFENCDIFERNPEGAVS"
FT   gene            240767..241015
FT                   /locus_tag="RCFBP_10230"
FT   CDS_pept        240767..241015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10230"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10230"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41544"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41544.1"
FT                   /translation="MILPTKYLPNDRALLSVGAEILAQLEESRTVSELWECVRGARTER
FT                   IAATPLSFDWFVLALNLLYAVSAVEYREGVVQREVSP"
FT   gene            241012..242787
FT                   /locus_tag="RCFBP_10231"
FT   CDS_pept        241012..242787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10231"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10231"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41545"
FT                   /db_xref="InterPro:IPR018760"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41545.1"
FT                   /translation="MILSIDSSLSSFKKVTFREGLNVLLSDKNSASTAKQTRNSAGKTS
FT                   LVEIIHFLYGADCDKDSLFRAPELIDHKFRGHFRIGSKDFIVERGGSEPAKIFLLAGGG
FT                   DGEDIPKKLDKASERFYVSNSNWKTFLGHNLFGLPENESGTVFEEAYTPSFRSMFSYFA
FT                   RRRDSGGFISPERQAEKQHRSDWQVNLSYLLGLDWQIPFEFTKIRLREKTLEELRKAVK
FT                   IGALGQIVGTVAELRPQVAIAEARADKLRRQLANFEVHDSYKELSKRAASAKAEMQTIV
FT                   RRSVSLHENLEHLENALKSERAPQRADIEQLYAAAGIELPGVALRRFDDVSLFYQSVVA
FT                   NRRVHLENEITSVKTQIAAAEAESGRLDKERSTILQNLDGRGALDDFLTLQRELAESDA
FT                   QAATLRERFKSAEVLEGETTKLTVDRANLQRRLQEDHQVRSAALGDAILIIADAIGALY
FT                   DDRTGRLVVEATDNGPEFRISIEGDRGGGISNIEIFCFDLALFKVVTARLGGPGFLLHD
FT                   SHLFDGVDERQIAGALLLGMEATQGKGLQYIVTMNSDIFERLPLPKEIDRRKVVLETRL
FT                   SDDGEDGGLFGFRFG"
FT   gene            242928..243965
FT                   /locus_tag="RCFBP_10232"
FT   CDS_pept        242928..243965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10232"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10232"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41546"
FT                   /db_xref="InterPro:IPR032581"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41546.1"
FT                   /translation="MHYDNFEVLMAELQSKKRKTHLLLGNGFSMAYDPAIFSYNALYDF
FT                   VSSLNDTVLAGVLGAMKTKNFELMMEQLETFSKLLDVFGGSADLKEKVEHAHQGLRKSL
FT                   IDAIKSLHPEHVFTIPAEKSASCAAFVNRFLETGGAIYTSNYDLLLYWVLMRQAVPNAC
FT                   DGFGRELLNPVEVEQKAEPEWSELWWGPNRSRQNVFYLHGALPLFDTGAEVEKEQYDGA
FT                   GYLLENIKVRIEQDHYPVFVTAGNGHEKLAQIRSNPYLADCYDHLSAVDGSLVSFGFGF
FT                   GDYDTHIIDALNRATHHPTKDTPKLWSVYIGVFSDADRQRAAELAKRLHAKVHTYSAQT
FT                   AAIWG"
FT   gene            complement(244286..244738)
FT                   /locus_tag="RCFBP_10233"
FT   CDS_pept        complement(244286..244738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10233"
FT                   /product="putative bacteriophage-related protein"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10233"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41547"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41547.1"
FT                   /translation="MRPRIEATGHAVARERRDGGQVKLSTFIPLKIRKRGASKVVVRPT
FT                   DTPGKPGTAAGQHDRPLLVALARAFYWQQLLDDSVVGSGSEIAKREGVHHSTVNELLRL
FT                   TLLEPAIIQAIVAGRQPRCMSLLWFQHNPLPAGWAAQREVVAAFDA"
FT   gene            complement(244735..246075)
FT                   /locus_tag="RCFBP_10234"
FT   CDS_pept        complement(244735..246075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10234"
FT                   /product="putative site-specific integrase protein"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10234"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41548"
FT                   /db_xref="GOA:D8NLE4"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41548.1"
FT                   /translation="MSAAPLASPKRCAVYCRVSSDERLDQSFNSIDAQKEAGHAFIKSQ
FT                   SHEGWIAVGDDYDDPGFSGGNMDRPALKRLMVDIEAGRIDIVVVYKIDRLSRSLADFAR
FT                   MVEVFDRCRVSFSAVTQQINSATSMGRLMLNVLLSFAQFEREVTGERIRDKIAASKRKG
FT                   LWMGGRVPLGYDLRDRLLVANQQEASLVRRIFDDFVTLRSVTLMVRTYAAEGIVTKDGN
FT                   AFTKQTLGKMLHNRIYLGEIVHKGQRFPGRHEAIVTPAQWDAVHALIASDARERTRATL
FT                   DRGREPVLLRGLLYTPDGERLVPTYTVKKGKKYRYYAPVRQRRLGAWASRHGSLPAGPI
FT                   EALVVEQIMGALSAPHVVQAVWDQVRATRPDLSEPEVVLPMRRLAVVWRQLFPVEQCRL
FT                   AQLLIERVVIADGGLEIVWRDAGWAQLAGELMPGTIGAELQEWEATV"
FT   gene            complement(246072..246536)
FT                   /locus_tag="RCFBP_10235"
FT   CDS_pept        complement(246072..246536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10235"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10235"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41549"
FT                   /db_xref="InterPro:IPR021322"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41549.1"
FT                   /translation="MTDTKNTGSVAAQLAALPNLPMPELWALWDRHFPRRPSHHNRDYV
FT                   ESRIAYRIQELAYGALPAGLRRHLVEAGARLSKIKTATGRGSQLVLMPGTTLIREWDER
FT                   EYRVTVTPDGLFELNGQVFKSLSAAARHITGTQWNGPRFFGLRDGKGGTR"
FT   gene            246957..247181
FT                   /locus_tag="RCFBP_10236"
FT   CDS_pept        246957..247181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10236"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10236"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41550"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41550.1"
FT                   /translation="MTAAPLPVLLSPRQLASRWGLSEKTLERWRMLGTGPMFLKLGARV
FT                   LYRIDEIEAHEQRRTRSSTAGYDAAEGLL"
FT   gene            247181..247426
FT                   /locus_tag="RCFBP_10237"
FT   CDS_pept        247181..247426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10237"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10237"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41551"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41551.1"
FT                   /translation="MNQSEQRQRAWMTQQLHANIARHGIEPMLDKLFGPGSWRYDAREG
FT                   LWIVPDTKYVGPGRSYYCVRANGDWFKAQVGEEIMQ"
FT   gene            247423..249546
FT                   /locus_tag="RCFBP_10238"
FT   CDS_pept        247423..249546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10238"
FT                   /product="putative TOPRIM domain protein"
FT                   /function="8 : DNA metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10238"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41552"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41552.1"
FT                   /translation="MNAPATVSSSPIGRPFLDFNHVPDVVLPQYNKDDIRARLLEQLES
FT                   VLMSLFPHGKRRGPRFVVGNVQGEPGDSLAVELEGQKRGLWIDFATGESGDVLTLWASA
FT                   RGFVLPGDFSQMLEDIGTWLAMPRIACGPLTHASTAFDDLGPHAGKWDYLDVDGRLLAC
FT                   VYRYNTPGGKQYRPWDARARSMRMPDPRPLYNLPALVASDAVVLVEGEKCADALARIGI
FT                   VATTAMGGAATTIDKTDWSPLAGKTVAVWPDHDTAGAKYADAVIPKLQQIGARVRRVTV
FT                   PEDKPKKWDVADAVEEGFDVESLLVASTVVADAMAARSLDITRWHAAERFTGEPQARRW
FT                   LVDGVFPQAQAALVAAAGGVGKSFLLLALAREVAAFNGIGAKAPTLFGGTLAAHGAAVY
FT                   VTAEDDAIEVHNRLNALGPIPDGLYVLPLPDAGGAVPLFAPDPATRGPATTPAWTELER
FT                   QLKAMPGLCLVVLDPLQPLCALDLNVPENAQFVCSRLAALAASTGASVIVSHHFAKREA
FT                   STPEQAREAIRGTGGLVDGVRSVYALWSPKEEQARTLCQALGEPFERARVVMGGVVKAN
FT                   GRANLNVTTFLRDSRGLLIDRSKDVTCAGKTDVDLLPALRDAIARAAIEGKPYTKTGGN
FT                   GVYERRHELPQAFHAIGKHRLADWVGTLLDKQELVMSMAEGSKLVKWLDVPGGPVARGE
FT                   AVFVAGHVGGAGR"
FT   gene            complement(250850..251215)
FT                   /locus_tag="RCFBP_10239"
FT   CDS_pept        complement(250850..251215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10239"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10239"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41553"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41553.1"
FT                   /translation="MPSPEWVDIGLQWIGANRIDRTSEQGAYCVNLVGWCEPPPEQVRT
FT                   AHKAQDPRKRSVDAGLGGYGRFGLGVGAYRANLGSHPDGGQVLRWSPPYWHLARKDPFS
FT                   PCGAIAIMQGRQRWARL"
FT   gene            251878..253575
FT                   /locus_tag="RCFBP_10240"
FT   CDS_pept        251878..253575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10240"
FT                   /product="conserved exported protein of unknown function,
FT                   putative rhs-related protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10240"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41554"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41554.1"
FT                   /translation="MTLAYQSYSIYGGSGGAAQWTSNWQRSLDTSVATYTNAPVTVLRD
FT                   DGSVYGFRKNGSAWSTAGTQDTLSSITDANGNTTGWQYTVADTGAVETYDTKGKLQSVR
FT                   ERNGRTTALSYNAANQLTTVTAPSGRSLGFAYDSQNRVASVTAPDGAATGYGYNGAGML
FT                   STITRPDGTVRQYVYEDSRFPTALTGIVDENGSRYATYAYDDQGRAISSTLSGGANAYQ
FT                   FQYGDNYQTTVTDPTGKTSVYSFLKQNGVLLPTSISAPCGLCGSTRQSSSYDANNNLTQ
FT                   ETDYNGTVTTHTYDSQNRETQRVDGSGTTSARTTTTVWHSQFWNLPTQIASPTKLETYS
FT                   YDSNGNLTRYSETPTADSDGSQGFSAATTGPARTTNWTYAADGLVATSSGPRTDLSTAT
FT                   TYVYRTADDTSTPPQYRKGDRYQIVDPLGHATTINQYDANGRPLQMTDANGAVTAFTYS
FT                   NRGWLTSQTITPASGAGQTTNYSYDAVGQLTKATLPDGGSVSFSYDAAHRLTGAADSLG
FT                   NSISYTLDAMGNRTQEHAKDPSGNLARQVTRVFDSMNRPLKVTVGNTQ"
FT   gene            253603..255906
FT                   /pseudo
FT                   /locus_tag="RCFBP_10241"
FT   CDS_pept        253603..255906
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10241"
FT                   /product="putative rhs-related protein (fragment)"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pcp : putative cell process"
FT                   /db_xref="PSEUDO:CBJ41555.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            256344..256544
FT                   /locus_tag="RCFBP_10242"
FT   CDS_pept        256344..256544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10242"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10242"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41556"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41556.1"
FT                   /translation="MSVAVTDETLPELIALAKDRTQGESRVLLLSALKKRRNKNPLAKQ
FT                   AIEELASDPDLEKEIASWRKR"
FT   gene            complement(256650..256904)
FT                   /locus_tag="RCFBP_10244"
FT   CDS_pept        complement(256650..256904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10244"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10244"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41557"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41557.1"
FT                   /translation="MLTMSGQLVLRPEVEAVESELEANGYAAVPSWRNDGRWELWTREV
FT                   VTIAHDAGVHFTSGPSGTFASRDEALAAGLAWRNSQQQP"
FT   gene            257060..258082
FT                   /locus_tag="RCFBP_10246"
FT   CDS_pept        257060..258082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10246"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10246"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41558"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41558.1"
FT                   /translation="MADTETRPTTYLARLRERLAQKGHTLLDDEWRGENARYRFRCAHG
FT                   HETSRTGARALRFLIDCPTCEAEAKFARLQQIARQAGGECLSTSYINSTAKYRFRCRLG
FT                   HEFETRSGGVMAGQWCRRCADIQAGEAARNPEGPVRMQEAARKRGGQWLPQPYTGLRGS
FT                   YRFRCAEGHEWMASGSMVVLGKWCRLCASKARGEASRRKDGLELLRRIAQEHGGQCLAH
FT                   CYAGGKARYRFRCAQGHEWETRGVTVTQGTWCPTCARDRSRRGIEVMRKMAAQRGGRCI
FT                   SESYVNIATKLEWECARGHRWHSTPRTIRVGHWCPQCAHLSKITRHKTQRKRRYEAVEV
FT                   "
FT   gene            258598..258936
FT                   /locus_tag="RCFBP_10247"
FT   CDS_pept        258598..258936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10247"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10247"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41559"
FT                   /db_xref="InterPro:IPR009957"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41559.1"
FT                   /translation="MREQKHPPQMLALAQQRQLIAQLATQAGRIGKRAKTPVIATARQL
FT                   DTVSEQIYATTEEACARLLNVSTGLIGILQLLDVWSDRAWECRCLHCLLVPLKVELDGA
FT                   LEDVQQML"
FT   gene            complement(258994..259290)
FT                   /locus_tag="RCFBP_10248"
FT   CDS_pept        complement(258994..259290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10248"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10248"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41560"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41560.1"
FT                   /translation="MFKSMRFKTPVIDDVLSSNIDAMLEDKLLDLFKYAMRFIAAALAR
FT                   AAQFETCDFANAAESGCDGFTLAIRQVFPGEREAWLGVFESGEQRLEVVGHLE"
FT   gene            complement(259406..259921)
FT                   /locus_tag="RCFBP_10249"
FT   CDS_pept        complement(259406..259921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10249"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10249"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41561"
FT                   /db_xref="InterPro:IPR021880"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41561.1"
FT                   /translation="MTTPRLTPAQHTILVHAIEHTGGRIEWFPDNINGGARKKVLDGLA
FT                   KRALITPEGDDWFVADAGYDALGRKRSVPAPVTEDPAVETAVTVAEAAWTQEAAGKAPR
FT                   SRENSKQATVIAMLRRPEGATVKQICEETGWLAHTVRGAFAGTFKKRLGLVITSEKLAG
FT                   GERVYRIV"
FT   gene            complement(259918..260145)
FT                   /locus_tag="RCFBP_10250"
FT   CDS_pept        complement(259918..260145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10250"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10250"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41562"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41562.1"
FT                   /translation="MGFRDMVAGSCPEPNRAVEPNSNGTGHISKRWGPLQSGWANRWIV
FT                   GVTAMRMALGFVAEQRVHHVTFKPPRRSYT"
FT   gene            260873..261556
FT                   /locus_tag="RCFBP_10251"
FT   CDS_pept        260873..261556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10251"
FT                   /product="membrane protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10251"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41563"
FT                   /db_xref="GOA:D8NLF9"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41563.1"
FT                   /translation="MMDQDGKVHFPWLPTLLSAPVKTEFDSTAVYQFEVEEHPVGVGAL
FT                   RSYPLDKYWVGIQSAQLILPTQTGQPVARLPLELHVRFDGEPGWDAQRKIGVDTGFHGR
FT                   FDTASISGDQSPGAQACGLVISRSPWYIGLVASLLAVICVPAIYVLRRPQEPAGLELIA
FT                   AILGVATIRTYLIGAPSSLGGLLPFDVLLALIVGAVAFIPLWGPGAGLKTKVRLELPRP
FT                   PNGNE"
FT   gene            complement(261020..261148)
FT                   /locus_tag="RCFBP_10252"
FT   CDS_pept        complement(261020..261148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10252"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10252"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41564"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41564.1"
FT                   /translation="MSIPTRLTVEAHVQFEWEARYRLSRLRWQYQLCRLDTHPILV"
FT   gene            complement(261760..261870)
FT                   /locus_tag="RCFBP_10253"
FT   CDS_pept        complement(261760..261870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10253"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10253"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41565"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41565.1"
FT                   /translation="MESFYWRFELQNFPHVLDQRSVLRCEHPSIDAFRRE"
FT   gene            262300..262947
FT                   /locus_tag="RCFBP_10254"
FT   CDS_pept        262300..262947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10254"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10254"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41566"
FT                   /db_xref="InterPro:IPR031832"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41566.1"
FT                   /translation="MLQQAPAEEQDLAELKVPDHLKPGLEAFPFLFHAPSHRLFFISRE
FT                   TDEHIGPIDAGRYFRELLNHPRLAEHYGQINVTVIPAADTLDRILALPDLRKLHIVITP
FT                   PNPDDLGDLEQEIKERLAEQNAATMVTVLVAEKGESLEPNEDTRKLSEVAQANGYVEAR
FT                   GAMAGGKISTFSTKQHPMLAPSNYDPDVETVQTALLNAANEYIRRHRIRRPN"
FT   gene            262954..263565
FT                   /locus_tag="RCFBP_10255"
FT   CDS_pept        262954..263565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10255"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10255"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41567"
FT                   /db_xref="GOA:D8NLG3"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41567.1"
FT                   /translation="MMLRDLRRSYQNVRNIFGRYWRAYGRWAAILTSPYLHASIVLTLI
FT                   LSHLWIRGGWWSDAIAALPTMVGFAIGAYAIVLGFGDERFRAVIMQRRNGDTSPYVKIS
FT                   ASLAHFIVVQIAALLAAVIAKGMSFGLSTRKGLGALIFAIFGNVDFVHDWIAPGGHFIG
FT                   FVLFIYAIATAMATTMAIFRLTTLVERDEPPSNGGTSDRH"
FT   gene            complement(263804..264277)
FT                   /locus_tag="RCFBP_10257"
FT   CDS_pept        complement(263804..264277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10257"
FT                   /product="putative bacteriophage-related protein"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10257"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41568"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41568.1"
FT                   /translation="MSRNHRGRILGEPVTRSLPAPAGGVQLETFVPWMLVKRGSKKEVI
FT                   TPLDAPQEFVSEARREKRDRDGTQDTPLMRALGLAHYWQWLLDEQRFASVAEIARAEGI
FT                   DASRVYRLLRLTLLAPKVVEQLIGTPGIALEPVMRRTWSAGWDIQIKVMASMR"
FT   gene            complement(264274..264648)
FT                   /locus_tag="RCFBP_10258"
FT   CDS_pept        complement(264274..264648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10258"
FT                   /product="putative bacteriophage-related protein"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10258"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41569"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41569.1"
FT                   /translation="MTSAALETFVPVTFRRRGTRRVVADERATHDTTLLQALARGFYWQ
FT                   RLVDTGAMKSGAAIARAEGLHPTAVNELMRLTLLAPDIIARLLAGRQPRNMTLWWFQHN
FT                   PLPVDWDAQRQLVARFEEEA"
FT   gene            complement(264645..265268)
FT                   /locus_tag="RCFBP_10259"
FT   CDS_pept        complement(264645..265268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10259"
FT                   /product="Putative site-specific integrase protein
FT                   (fragment)"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10259"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41570"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41570.1"
FT                   /translation="MSRKGSWYPGTHSAIIDAALWEQVHAVLAKDSHARSTQTKVLSRT
FT                   DALLRGLLYTPSGERMYPTYSRKNGRQYRYYVSKSESRFGAPGKRYERLPAPEIEGAVI
FT                   AQIRTVLTSPEAVAAVVRHIQRNGAQVDEAATVMAMGRLDDVWDRLFPAERHRIANLMI
FT                   ERVDLVDDGENQGIRVKWREVGWDALIKEFVPGEIGAELLEVEA"
FT   gene            265730..267484
FT                   /locus_tag="RCFBP_10260"
FT   CDS_pept        265730..267484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10260"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10260"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41571"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41571.1"
FT                   /translation="MVRARVSEWLVGGVLLAITGFAPQEFIARLIRNIAAPERVGHWSR
FT                   LALDARPVIVLVGIAIIVVDVLYRNRHRPVVAVPGRPPRPEDGAERLQPDGKALVASEP
FT                   SAPAALPLPLPNHPWRSEGRVILVVLPFESLGGSDKYDYFSEGLTEDMITQLARLSPER
FT                   LGVIARTSAMRYKSTTKTIHQIGQDLGVSHVLEGSVRRAGDRVRIAAQLIRVSDETHLW
FT                   AETYEGNRHDILALQIEVAKAIAREIEIKLTPHEQGRLDRTPAIDAQAHEAYLKGRHFW
FT                   SKRTEEGMRKSIEYFQLAIEHQPNFAAAYDGVADAYTMLACRGVSPARETFHQAKMAAR
FT                   KALQIEPDLGEAYASLAHVRLHDWDWVGLEQDFLRAIELNPGHAIAYYWYAEYLMAAGR
FT                   AEEAIARVRQSRQMDPLNSVLNSSVAIILYLARRYDQAREELHQALEIDPSHFLLHFRL
FT                   GLVYQQQKLFDDAIAEMQTAVTLSGRSTEALTGLAQTYAAADMRAAMQQIVDALENASE
FT                   KHYVHPYNMARVFGSLGDQEQTFGWLEKAYDEHSPDFIELRTEPTFDSVRSDPRFSALL
FT                   SRVGFNQI"
FT   gene            complement(267520..268074)
FT                   /gene="cysC"
FT                   /locus_tag="RCFBP_10261"
FT   CDS_pept        complement(267520..268074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysC"
FT                   /locus_tag="RCFBP_10261"
FT                   /product="Adenylyl-sulfate kinase"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /EC_number="2.7.1.25"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939241, 12072441; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10261"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41572"
FT                   /db_xref="GOA:D8NLG8"
FT                   /db_xref="InterPro:IPR002891"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41572.1"
FT                   /translation="MTPSPSTLWLTGLSAAGKTTLAHALAQALTAAGAACRILDGDAVR
FT                   QELSRDLGFSRADRSENIQRVADRCRQLNEAGSWAIAAVISPYREDRERARQTIGEPRF
FT                   FEIHLATPLTVCERRDPKGLYRRARAGEIAHFTGISDVYEAPQHPDLRFDTGTQSVAEC
FT                   VAATMALLVAGSMAHHDLPKA"
FT   gene            complement(268071..268910)
FT                   /locus_tag="RCFBP_10262"
FT   CDS_pept        complement(268071..268910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10262"
FT                   /product="conserved protein of unknown function,
FT                   alpha/beta-Hydrolases domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10262"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41573"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41573.1"
FT                   /translation="MLLLTGLMSGCTALDRNAHAEAQAAAGLHREQLDAGGFVLTAYVR
FT                   MTRPDAPLDLYIEGDGLAWISRSEPSLDPTPREAVGLALAAADPAPNVAYVARPCQFTP
FT                   MAMNPRCGVPYWTGKRFAPEVVASIDQAVSHFAARVPGQRIHLIGYSGGGALAVLVAAR
FT                   RTGIASIRTVAGNLDHALVNRLHDVSPMPQSENAIDFAEQVASIPQVHFSGADDTVVPP
FT                   IVAQRFVDATGNRCAQARTVPGITHGGDWGGLWPRLLGVTPVCSEPSGITPAHRTKE"
FT   gene            complement(268983..270146)
FT                   /locus_tag="RCFBP_10263"
FT   CDS_pept        complement(268983..270146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10263"
FT                   /product="putative glycosyltransferase, family 9, TPR
FT                   repeat domain"
FT                   /function="6.11 : Sugars"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10263"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41574"
FT                   /db_xref="GOA:D8NLH0"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41574.1"
FT                   /translation="MMSGALSAIQAIEHQVRPLLAAGRFEEAEALVRPPLASGSGPLAL
FT                   WKLLAAALRPQGRLAETRAIQEMLVAHTPGDFPARFDLSETLLLLGEFERGWREYHYRY
FT                   SLAHTAAIERKVQRPRWNGRPIPGQTLLIHDEQGFGDTFQFLRMVPWAKARSGARLILE
FT                   VNAETLSLARRGTGFDHIVARGSLPPAFDVHCELMSLPMAMGLKLSDLPGPVPYLSADP
FT                   LRIAQWQQRLAGLPRPLVALVWAGRPTHCNDANRSLTLARLAPLAHPGITFLSIQKGPA
FT                   AAQSADPPPGMSLVPLSDEIRDFEDTAAILSIADLLVSVDSAPVHLAGALGRPVWVMLP
FT                   FVPDWRWLLERTDTPWYPGMRLFRQHARGNWDGALSAMACELARLVG"
FT   gene            complement(270143..272245)
FT                   /locus_tag="RCFBP_10264"
FT   CDS_pept        complement(270143..272245)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10264"
FT                   /product="conserved protein of unknown function, tpr repeat
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10264"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41575"
FT                   /db_xref="GOA:D8NLH1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037919"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41575.1"
FT                   /translation="MSLPPSRPETLSIPEALNRAHAHWSAGQAAQAELLCQRVLAAWPG
FT                   QADALHLLGLMAHAYGHLDLAIAHLRQACLAPRAPAAYSSNLAEMYRQKGRLAEAEDAA
FT                   RRAVAMDPALVSGWNNLGIVLQEAGKFAESLDCLERVIALQPDGAQAHNNLANTLRRLE
FT                   HLERAESHYRQALELDPAYAEAHSNLAFLLSAQGRYDEAAAAAQHAIELSPRLVDAYLN
FT                   LAEAEIGRHRHEAALRVLDRLSPFAPQHPAALTARATVLRRIERPDEALAVARQAVALA
FT                   PHSAETHHALAMALQALGQTDEALPHFEQAARLPGAVAEDALVGRAILLMEAGRRDAAL
FT                   AAFDQALEQFPGSVQARAGRADARTFKAGDPDIAALQACLADGERRSLRDQISAHFALG
FT                   KAYLDLQDPARAFHHLDAGNRQKRSTFTYDGAASSRWMARIADAFPPEPHDRLHATGEP
FT                   SALPVFIVGMPRSGTTLIEQIVSSHPQVTGAGELSALRLVVEGSGLFPEGMQGLEGEAR
FT                   GALFRQLGQAYLSRVTPLAQGRARLVDKMPSNFLYAGLIPLILPGARIIHARRDPVDTC
FT                   LSCYTKLFAGEQPFAYDQAELGALYRSYARLMAHWRTVLPPERFIEVDYEAVVDDLEGE
FT                   ARRLIDFLDLPWDPACLNFHDNRRVVRTASVNQVRQPIYTTSKGRWQAYADYLGPLLEA
FT                   LGIDAP"
FT   gene            complement(272416..275448)
FT                   /locus_tag="RCFBP_10265"
FT   CDS_pept        complement(272416..275448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10265"
FT                   /product="putative hemagglutinin-related autotransporter
FT                   protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10265"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41576"
FT                   /db_xref="GOA:D8NLH2"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41576.1"
FT                   /translation="MNQHAHHRPRQTAVTLAVAALAAMTQMQTATAATVSSPFVGLYMW
FT                   GAGDLSVTSTISGGPMGVLSFSFSGGAVGTLTNSGLISGGYGVQNSSGMAALNNTIGGS
FT                   ISGTGNDGVFNASSIGALTNDGAITGTHFGILNYYAATIGTLTNSGAITGGGASGGSWA
FT                   GIDNAGSIGTLTNTSTGTISTAGGVFGVYNTYKIDTLSNSGLITASTRGINNSGTITTL
FT                   INNSGGTISHSGSGFGHGIDNSGLIGSLSNDGFIGVTGGTGGTGSGNGINNSGTITTLT
FT                   NDSGGTIVGKYTGLYNSDTIGTLTNHGAIIGGYSAGVANNGSIGTLTNTGTITGSNSYS
FT                   GNEGFGVNNGGTIGTLTNTGTGTISGTVSGSGTAYGIFNSGTIGSVTNSGLITGGTYAV
FT                   FNDTSGTLGPVTNAGVIAGNIGNLSSRDLSISGGTGTTFGTLTGYGGGSTLGTIDNPNA
FT                   SVAFVSGNLLLNDNINLGSGTINAVNNTGSAVVQVNQPVTITGNYNQGSGATLQIGVAS
FT                   GATTQGTLGTDAGYGRLVVTGNTTIAQGSSITLQSNGYAFAAGQRYVVVDTAGTATYNA
FT                   GSLRYAINGYTSTVTGAAVANGSKSDLVLTVVSARSLSAVTTPSPTTSSQTTTSNPASM
FT                   ATVPNAVASLNGLLGYTGIGSATLLNLYNATLGSLSEGSTAGANQIGKQLGATQTGWAP
FT                   AAPTFDALNVVGAHVNTLRLAQAAGATGVATGDSPAQWGVWGQAFGGHAQQSERDQTDG
FT                   YRANYGGLLIGADREINDRWRAGGAFSYSNTSIDNTGDTSGSFARVNGYGLIGYASYTG
FT                   NPWYVNLSGAAVQQRYDTSRAVSMQGFSGTASGHFSGQQYVARTEAGYPLPVGSATLTP
FT                   LASLTYSYLTQDSYTEDGGNGTALSVGATHVGSVKSGLGAKLEKGFTTRYGQIVLEARA
FT                   QWIHEYDHARQVTSASFAADATGQTAFTTVGMTPVSDLADISLGATLLRANNLSLSARY
FT                   ELQAGRGFVSQTGSVRLRQLF"
FT   gene            275613..276311
FT                   /locus_tag="RCFBP_10266"
FT   CDS_pept        275613..276311
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10266"
FT                   /product="putative two component response regulator
FT                   transcription regulator protein"
FT                   /function="13.1 : Two-component systems"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10266"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41577"
FT                   /db_xref="GOA:D8NLH3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41577.1"
FT                   /translation="MCPSSTAAELPAIHVAIVEDDPGFLDALTQALACSPDMRLIGVAG
FT                   SRAEGLRLLDGTPADVLLVDLGLPDGSGIDVIEAAARKWSACSIMVSTHFGDETHVMRS
FT                   IEAGAAGYLLKDSSAARILDEIRSLASGGSPISPIIARQILARFRQGGARGAADEAPPA
FT                   SASPPLLSAREKEVLDLITKGFTTQEIAKLMALSHFTVRTFVRRIYSKLKVTSKAEAIY
FT                   EARTLGLLAD"
FT   gene            276403..278334
FT                   /locus_tag="RCFBP_10267"
FT   CDS_pept        276403..278334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10267"
FT                   /product="putative two component sensor histidine kinase,
FT                   transcription regulator protein"
FT                   /function="13.1 : Two-component systems"
FT                   /function="12 : Regulatory functions"
FT                   /EC_number="2.7.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10267"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41578"
FT                   /db_xref="GOA:D8NLH4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41578.1"
FT                   /translation="MRYRPTHLSAYAIFVFSVALLVIVGAIYLDADGASPPAANVHLTQ
FT                   AEWQVTDARGFTAPPTALDSNSLPNAWRQVALPLDLPIALLRQANANAVTAAGQITWLK
FT                   LAVPSLPPHSGPLALYGVRVKTDGTIAVYADGELVHRAQQQGPLWNSTRTPLWVVLERR
FT                   ADDAPLREILIRLEHTERTQVALSSLWVGPVETLRGRYHVRQWLQQDLPRMLSAAFLAV
FT                   GIFALFVWFKRRRETGYLLFFNLAVTSFLRGLHFYASLPIANDWFAWLTVNSLLWLVTV
FT                   VHFFLCQLHGRKLTWFTRVLVGVTGLIGILTLPGLAVLPNTPKVTPLIYPMAALMGAAV
FT                   GLVGGLSAWRRSNEGVLVAIGVSVCTLLGVSDWLLQNNFVSPEGWYFGAYTNAITFGIF
FT                   GILMCRRYVNAINEVELANANLAQRLRQREAELERSHQRLLEVERQQTISAERQRLMQD
FT                   MHDGLGASLISAIRSVERGAVSEAKVSQILKSCLDDLKLTIDSMEPVEADLLLLLATLR
FT                   FRLEPRLEGTGITLLWEIQKLPTLAWLDPSSALHILRIVQESIANILHHTQASEIRVGT
FT                   ATESTGVQVTIIDNGQGFDLEKTLAAGKGNGLRNQQRRAQAIDGKVNWVSGPAGTRFTL
FT                   WLPLERHV"
FT   gene            278618..279790
FT                   /locus_tag="RCFBP_10268"
FT   CDS_pept        278618..279790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10268"
FT                   /product="putative methyltransferase, Methylase of
FT                   polypeptide chain release factors"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10268"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41579"
FT                   /db_xref="GOA:D8NLH5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41579.1"
FT                   /translation="MALPLSLLAPVTDHPILSWTDASSEPPGATAHTALWRSEAGTPPP
FT                   KRVMVADDRITADAAYRQACEGTAILWRGDFQNARQLLQAMSRRVDRKPRKAATSPIDA
FT                   FNLHRQAQSQRARTLGMLLIPLDADYTIPLRRAPDVREACTEAYGAGEAASVVSLRELL
FT                   GLIGAHEWRKKGVDIPALGGARIHPHYGVFSPVRGEYVDLVANAPLPSQALAFDIGTGT
FT                   GVLAAVLAKRGVKRVVGTDQDARALACARENLARLGLQSQVEVIDADLFPEGRAPLIVC
FT                   NPPWLPARPSSPIERAVYDPDSRMLRGFLDGLAAHLEPNGEGWLILSDFAEHLGLRTRE
FT                   ALLAMIDAAGLRVVGRDDIKPKHPKASDADDPLYQARAAEVTSLWRLKAR"
FT   gene            complement(279831..281117)
FT                   /locus_tag="RCFBP_10269"
FT   CDS_pept        complement(279831..281117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10269"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10269"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41580"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41580.1"
FT                   /translation="MSEPHNAPLVAVIGAGPAGLMAAEVLSRAGVRVEVFDAMPSAGRK
FT                   FLLAGIGGMNITHSEPLDAFLGRYRARREQLAPLIGRFSPDALRDWVHGLGIETFVGSS
FT                   GRVFPTDMKAAPLLRAWLHRLREAGVKLQMRHRWVGWSAAPSDQADQPAQPEALRFETP
FT                   DGERLVHADAVVLAMGGGSWPRLGSDGAWVPRLEARGVQVLPLRPANCGFDADWSAHFR
FT                   ERFAGQPVKSVAIGIASGDDGALHFRQGEFLVTQTGIEGSLVYALSAPIRDALEADGEV
FT                   TIRLDLAPGWSAQRVADELMRPRGARSMSSHLQSKLNITGVKLGLLRECLSKEAFADLA
FT                   QLALAIKALPLRLTRARPIDEAISSAGGVAFEALDANLMIARLPGVFCAGEMLDWDAPT
FT                   GGYLLTACFASAAAAGHGVLAYLATAARG"
FT   gene            281400..282236
FT                   /locus_tag="RCFBP_10270"
FT   CDS_pept        281400..282236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10270"
FT                   /product="conserved protein of unknown function,
FT                   SAM-dependent methyltransferases domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10270"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41581"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41581.1"
FT                   /translation="MSNKTHEIRPNQSLELLKELHILTRDGKMNQDSRRKLKQVYHLFQ
FT                   FIEPLLDDVQKAKGHVSLVDHGAGKSYLGFILYDLFFKELPGDGASHIYGIETREELVA
FT                   KSTELAARLGFKGMSFLNLSVAESITSERLPPAVDVVTALHACNTATDDAIRFALEKHA
FT                   QYIVLVPCCQAEVAGVLRKNKGKSLGHALTEIWRHPLHTREFGSQVTNVLRCLQLEAHG
FT                   YQVSVTELVGWEHSMKNELIIAQYKDLPRRRPTERLAEVLSTLGLEELHARFFAPA"
FT   gene            282488..283717
FT                   /locus_tag="RCFBP_10271"
FT   CDS_pept        282488..283717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10271"
FT                   /product="putative transporter, MFS family"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10271"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41582"
FT                   /db_xref="GOA:D8NLH8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41582.1"
FT                   /translation="MTTLNGVPGYRALVVARVITAGIVWVDFTLIFSLLSYHWHADAVT
FT                   IGVASALYGLPGLLLGPFFGTLADRLNPVTILVVSYLARCLSSVLLMVVPDVNLFVLLV
FT                   LIKGLANLGATPAEQVIVRSMLPTDQLASNASVMTTIDQLTKLCAPLLGAGMASLHDPV
FT                   AGFGFSAALGLAGTFCASFLRKRVDVSKRDETSQQARRHLQALLSLCRENRAFRMAFIA
FT                   AIAQTAVLALYDPLLALFLKGKGMPTAVFGMIVSSTAAGAILGALVFKRVRSSSEQHTA
FT                   IMSLAAFGLTVAVPGLLAVADIAIPTGALLAFWMANGCFYGLTAMSFGVTLQQQCPHQV
FT                   IGTVSATARSVQLAVLVLGPLVGAALANLWTIPSVFILSGVLAMLVAGALWGAPQLKMV
FT                   WRKNNLSTRR"
FT   gene            284270..285448
FT                   /locus_tag="RCFBP_10272"
FT   CDS_pept        284270..285448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10272"
FT                   /product="putative hydrolase protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10272"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41583"
FT                   /db_xref="GOA:D8NLH9"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41583.1"
FT                   /translation="MKHMLCLAAPAIVGAALFCLPGQALATTNTVAAHAAIGEFATPSA
FT                   SSSPQGVDVASDGSVWYSETTAGKIAVLHPDRSSSEFLVPNGGQPFILKAADDGIWFTD
FT                   SKTRAIGHLDPSTGKIEMHAIPSGASPFFLQIAPDGSKWFTETAGIGRLSPSGEFTEWA
FT                   VTLEHPDDNMEQLSLDPWGNVWFVERNFDGVGAAGTNKVRRLNPYSNVISTYRVPTLGG
FT                   TPSGVVANANGSVWVSEYYANAIALLNPFAAPHSDEVVQPNTLKADSQAASVPPVRAAR
FT                   TPGTKTQVASRSSTVKPSVTLGWVEYPLPTANAEPEDMRVDSHGHVWFEEDVGFLGRLD
FT                   PLEARITEYAIPSANSGYYNIALDKRNGLLWFTEAGVFAPVTTKIGYLDTRH"
FT   gene            complement(285601..286173)
FT                   /locus_tag="RCFBP_10273"
FT   CDS_pept        complement(285601..286173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10273"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10273"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41584"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41584.1"
FT                   /translation="MTQDNLAAPDAVQTLVRTVNISNGETWVAIQLPAQYRFFDLVFEN
FT                   VSPSTSGSVLVAQMAPQSGGVYGSNYSGSGWGNDLGGGGFYGYSDAKWMCLWPANRSGP
FT                   NSKTGIYGTCKLMNLNQSNAVPSVISDLFAPTAYKSQPGYANVGGCCQKITGQASSIQF
FT                   AFALAGGNVPQNTDTFSGGTIQVYGWN"
FT   gene            286421..286726
FT                   /locus_tag="RCFBP_10274"
FT   CDS_pept        286421..286726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10274"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10274"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41585"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41585.1"
FT                   /translation="MRDCAALSPALELGQMHRLMLMFAAAARNRASLNFRTSAYAFVRD
FT                   DALRAASTIGKLDSIQLVKPSTRWLTSSPIAVSEYSTCGGTTGKDTRLTKPSSSSA"
FT   gene            complement(286537..286950)
FT                   /locus_tag="RCFBP_10275"
FT   CDS_pept        complement(286537..286950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10275"
FT                   /product="putative transcriptional regulator"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10275"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41586"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41586.1"
FT                   /translation="MHANAPTPDNKDSLAARLSRGDVLSAACPAREVLSDVTSRWGVLV
FT                   LIALRSGTFRYSELRRRIGGVSEKMLAQTLQALELDGFVKRVSLPVVPPHVEYSLTAMG
FT                   EEVSQRVEGLTSWIESNLPMVLAARSASSRTKA"
FT   gene            287127..287639
FT                   /locus_tag="RCFBP_10276"
FT   CDS_pept        287127..287639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10276"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10276"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41587"
FT                   /db_xref="GOA:D8NLI3"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41587.1"
FT                   /translation="MKTLRHTFTALVLSMAGLACAHAQEAVRPAPNAEALFTSSDPKLH
FT                   ANKQVVYQIIRELLEAGHWERADRYLTPRYIQHNPNAQSGREAVVRFFTEVLKVKPRPV
FT                   PLTISTPIVAVMAEGDLVTVLYPRTVNTAQGHYTTTWFDTWRIVDGKADEHWDPALKNE
FT                   TAQIGSR"
FT   gene            complement(287811..288965)
FT                   /gene="aspC"
FT                   /locus_tag="RCFBP_10277"
FT   CDS_pept        complement(287811..288965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aspC"
FT                   /locus_tag="RCFBP_10277"
FT                   /product="Aspartate transaminase"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number="2.6.1.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10277"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41588"
FT                   /db_xref="GOA:D8NLI4"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41588.1"
FT                   /translation="MPVPSNSFWEQWLTAHRAKPEACVTFSLSPSPLLQEFLAELDPGI
FT                   ALDWSSEDYQGVPGLREQVLDRYGYRSACGVNDVLITAGAQEANYLALTQLLSPGDELV
FT                   IDTPGWQQPLVLARQIGATVKRVPRAEASGWALDIDQLEALVTPKTKVIFICNPNNPTG
FT                   RVEDEATLRRIIAAADRVGAYVLSDEVYRGLEWTEVETPRVATMYDRGVSTGSVSKQLG
FT                   LQGLRTGWMVTRDRKLIADAMVLRENTSEIMNVMGERIAEVALRPERFAAAVERSRATG
FT                   RARIDLLDRFVAGQPALHWHRPAAGLLGLARLDLPITADSFAEQLLAPPYNTFVMSGAA
FT                   YACPQHVRLGAGGVSPAELELGLARMGQLLAACVSGEREIALRE"
FT   gene            complement(288977..289768)
FT                   /locus_tag="RCFBP_10278"
FT   CDS_pept        complement(288977..289768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10278"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10278"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41589"
FT                   /db_xref="GOA:D8NLI5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41589.1"
FT                   /translation="MKPNNEAGKRILITGGNGGIGIELIRVFAEASDHVTFTYRPGEDS
FT                   RRRALDLVETFRDYRVDALPLDVGDPESHRQLMQALTEPIDIVIHNAGVGTKTVERASP
FT                   TYKGQDEAFFRVNAIGPLWLSEDILPRMQERGRGKILFVSSVDGGITHFPRFRAADGMS
FT                   KAAVAFLGRQLAATLARTGIDVFTVCPGATDTPMFQASTLQALSPEQRQALEDSLPGGR
FT                   LIEPREIADLCFYLCRDEARILRGAVIDASLGLGVCPAVMA"
FT   gene            complement(289765..290955)
FT                   /locus_tag="RCFBP_10279"
FT   CDS_pept        complement(289765..290955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10279"
FT                   /product="putative isopenicillin N epimerase protein (class
FT                   v)"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number="5.1.1.17"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10279"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41590"
FT                   /db_xref="GOA:D8NLI6"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41590.1"
FT                   /translation="MACLNHGMLGACPADVFERQDALRARIERQPAAFVLNELPSLLDE
FT                   ARQALAGVISADTADLALLPNVTTALSAVLRSRAFAPGDEILTTDHAYLSCSNLLDFVA
FT                   RETGARVVTATVPTPVTGPDAIVDAVLARVTPRTRLAVLDHVTSPTGIVFPIAALVEHL
FT                   DARGVDTVVDGAHAPGMLALDVRAIGAAYYAGNCHKWLCSPRGAGFLHVRRDRQDGLHP
FT                   TVISRGYGATSADRPRLHLEFDWLGTADPTPLLCIPHAIRFLDGLLPGGLPALMAHNHA
FT                   LVVDGARRLAADLPLTRLAPDSMVGSMVAFQLPDDLPGPASDDAASLQRWLYDAHRIDV
FT                   AVGAWPAAQRRVLRVSAQIYNTIDDFIRLGAALRGAPAHPRDTNAATRTPAWSNAS"
FT   gene            complement(291014..292468)
FT                   /locus_tag="RCFBP_10280"
FT   CDS_pept        complement(291014..292468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10280"
FT                   /product="putative dehydrogenase (Flavoproteins) signal
FT                   peptide"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10280"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41591"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41591.1"
FT                   /translation="MKGTRIVVVGASVAGLMSALAFARGGAEVELLDRDPMAVRPPHPG
FT                   ATDTAIEAGWRKGVPQARHTHACAALGRRVLRERAPDVWAALLDAGAVEMPFGGRLEAA
FT                   AAVPRGNDTELFGLSARRSLVEDVLRRIVLAEPNVQVREPITATGLLVRPGAIPVVEGV
FT                   RTSAGDIRADLTIDALGRASPFGRWLDALGARAPEETAESCGLVYLTRWYRIRHRPAVP
FT                   LNAGLSAGGYGASSGCIACPADNGYVSITMMTPHGDTALHPLAEETAFTAAARLHAGIA
FT                   AWLEPGVCEPLSTVLRWPHCENRFRRFVVDGEPIALGWIGVGDSVCVTNPTYTRGMSLA
FT                   ARHAFAVADLVAREGLGDRHRLALGVDALAQRTLRPWFDDSIAQDRARNALWSGEPHPQ
FT                   TPQNGLTLQQIAAAARHDDVVWHALARRSGMLDEPDAIFAHADVLARVRSVLAQHPVYP
FT                   PTGPSRDDLLQVIDAHCDVQSQPALF"
FT   gene            complement(292563..293672)
FT                   /locus_tag="RCFBP_10281"
FT   CDS_pept        complement(292563..293672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10281"
FT                   /product="putative tryptophan-2,3-dioxygenase
FT                   oxidoreductase protein (tdo1)"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.13.11.11"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10281"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41592"
FT                   /db_xref="GOA:D8NLI8"
FT                   /db_xref="InterPro:IPR004981"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41592.1"
FT                   /translation="MKAMNYWDYIKVEELLSLQSGSDEDETRVGNDEALFIIVHQIYEL
FT                   WFKLILRELTSARDLLRQDTVPGHQIIAGVRSLRRAIAVFEQANQHFRVMETMTTRDFL
FT                   DFRERLAPASGFQSAQLREIEILLGLEDEERIAIGHACSFKDALKLPNGAASAATHRVE
FT                   ARIAHGPSFKQCLYEWLSRLPIDGSNEPAAAERFLHDYLRSMRDESRYRLQTAIDRGLA
FT                   AEEVERLRARYQTQDANAEAYLLAEDDPGADAATREQRRAVRAAMVFIESYRELPHLTW
FT                   PREMLESVVELEQAMLIWRQRHARMVERMIGRRVGTGGSAGVDYLDQTALRYRVFSDLW
FT                   TVRSLLLRKASLPAVGQHAHDAFAMEGLQ"
FT   gene            complement(293750..294199)
FT                   /locus_tag="RCFBP_10282"
FT   CDS_pept        complement(293750..294199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10282"
FT                   /product="putative lactoylglutathione lyase and related
FT                   lyases protein, Glyoxylase I (hpx)"
FT                   /function="6 : Energy metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10282"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41593"
FT                   /db_xref="GOA:D8NLI9"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41593.1"
FT                   /translation="MDFYANGIGMKFAATMINHVPSTGLKATNNNVFFEMEDGSYICFF
FT                   EILGSKEPVVPVENDWAQHLALEVHDEARAEEISARLRARGVEVSGPVVHGELARSWYF
FT                   NDPSGHRMELIVKPAVAPTAIWDNFRASAYDDLAKWVELKQHAAG"
FT   gene            complement(295003..297162)
FT                   /locus_tag="RCFBP_10283"
FT   CDS_pept        complement(295003..297162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10283"
FT                   /product="putative tryptophan 2-monooxygenase
FT                   oxidoreductase protein"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number="1.13.12.3"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10283"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41594"
FT                   /db_xref="GOA:D8NLJ0"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41594.1"
FT                   /translation="MGITVMPGLTSMESDMRTQRISTTIGQARENGRFYRHPDSALVSY
FT                   PVAADNVLGVLPDGHYYIAIVGGGAAGIASLYELSRLAEQLTSGTITVTLYESDPDSFL
FT                   TRKHESAIETIDVLGLKAGRVSAARVNKNDTVYEVGAMRFPEIAGLTWHYASVVYGDDK
FT                   PIKVFPNPGKVATEFMFGDRIDRYSGAAAEEWLDPESPARKVFLTVAAGLAGTPEEGTT
FT                   PISLFPIGGRDPALVAKRLKSKETRPEELQAIQYQDWPAFIAAHDGTTLEAAVRRIVTR
FT                   EIGKGGASSLRPIDGLDQAETINYYVELFGRFGFGTGGFKPLFNMSLVEMMRLILWDYS
FT                   NEYTLPVEENVQFISGLYDKALETGGARLKVKVRLEQVSDACHAESSRRPFIVSYDRGG
FT                   KLSVHSYDYVILAAPQNQLALAVSRSGYSATPATLTLGDSALGRETAKFRDGLPPLLLS
FT                   NTSSAPNARIVTALNQLHMVRSSKVFGTIETAKLDDASLVPRFNGQPIKAVVSDSGLAA
FT                   SYVVPSPTDPDTETESDAQPRFSSFLASYTWGDDSTRLQPDFGDYPQNPPTSSGTASGM
FT                   FRTMINRAARNVLDPVNPKAAPSVWWFSRLLSAVREDDRFVFDWSTNGTAGGFKLDSTG
FT                   DHHQSNLCFRYHTHARNPELGNRFFLASDSYSHLGGWLEGAFMSAINAVSGLIVAANRG
FT                   ETAALSDAARPVVTGLQRIVPRAAE"
FT   gene            complement(297240..297482)
FT                   /locus_tag="RCFBP_10284"
FT   CDS_pept        complement(297240..297482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10284"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10284"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41595"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41595.1"
FT                   /translation="MLPRLVRIHDGQLAEFPTHSTTCRSRDDATGSAPIFPRQAVAERC
FT                   KTPCPAHHKPPSQVVARRPASYSESALGAPLVAAS"
FT   gene            complement(297688..298125)
FT                   /locus_tag="RCFBP_10285"
FT   CDS_pept        complement(297688..298125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10285"
FT                   /product="putative type III effector"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10285"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41596"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41596.1"
FT                   /translation="MKNWFRSSSRQAVTHNDVYRTNSSADRNDDTNSSPRVPRHRHSEL
FT                   GNALTSLRDAREQGLKKLRKVDIETSAAETQRNQILNRLESRTATVESNLTEYQRALAP
FT                   DSLTRFEGSPDRQINNALHNAETVAGEWKNIRSTVKDAIGG"
FT   gene            298283..298414
FT                   /locus_tag="RCFBP_10286"
FT   CDS_pept        298283..298414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10286"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10286"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41597"
FT                   /db_xref="GOA:D8NLJ3"
FT                   /db_xref="InterPro:IPR036025"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41597.1"
FT                   /translation="MRRIEETPHAYQPMPIQPVIQAREEAGLIRSAVRLQPWITFKA"
FT   gene            complement(298629..299063)
FT                   /locus_tag="RCFBP_10287"
FT   CDS_pept        complement(298629..299063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10287"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10287"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41598"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41598.1"
FT                   /translation="MWNKFAPALIVAAFAGMTALPAAAGDLSNALGGALGAGGGAAVGG
FT                   ALGGQTGAVIGGAIGGGAGGALTSNSRDRKGAIIGGAIGGGVGTAAGNAVGGRTGGIVG
FT                   AAAGGGAGAALGGHIQRSSNAEQEGPDRGYRKHGKHHHRH"
FT   gene            299918..300781
FT                   /locus_tag="RCFBP_10288"
FT   CDS_pept        299918..300781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10288"
FT                   /product="Putative cytochrome c"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10288"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41599"
FT                   /db_xref="GOA:D8NLJ5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41599.1"
FT                   /translation="MKAWFARWVGWLGCTMALLAVAPCFADTAVLTIAAGAQQRTWTRD
FT                   ELLHDQRLIVVTVEDDNLKRRLTFQAIPVSALLRGLPVTPDSTATTAASDGYVSHLPMR
FT                   MLLADRAEAPRAWLAVENPAAPWPTLKGQDIGPFRLIWTVPPSGQGAAVNESLWTYSIV
FT                   RIDIAASPAERFAAIRPAPGLPADGPVMRGFATFQRVCFSCHSLNRVGDANLGPDLNVP
FT                   HSAVEYLGDARLAELIRDPQSLRWWPNARMPAIGGTTLTDAQLKDLLAYLHHMAGRKAA
FT                   APAKGS"
FT   gene            complement(300876..301217)
FT                   /locus_tag="RCFBP_10289"
FT   CDS_pept        complement(300876..301217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10289"
FT                   /product="putative transcription regulator protein"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10289"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41600"
FT                   /db_xref="GOA:D8NLJ6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41600.1"
FT                   /translation="MLPGMTAKRPDPSTSRPAPILTALGERIKQCRHAADKSQETLAFE
FT                   AHVDRTYISSIERGIANPSIETLANLCYALNVTLAELFGPLDGVSLEPTGTRRINAATP
FT                   PDLKRNRLR"
FT   gene            301364..301798
FT                   /locus_tag="RCFBP_10290"
FT   CDS_pept        301364..301798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10290"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10290"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41601"
FT                   /db_xref="GOA:D8NLJ7"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41601.1"
FT                   /translation="MPCQASTTPGKAVLQPADAVHRANAARGRPLSTGCDAVPPEESAR
FT                   PRDDPMSAPAAADRPRALGGLGHWSAEHRAFGILLLIHSALMAVVMLTKKHPASAECAL
FT                   EASLTLMQDWRTWAAAVAVMLPIGMIVRRIVVRRRRRSGA"
FT   gene            301798..302961
FT                   /locus_tag="RCFBP_10291"
FT   CDS_pept        301798..302961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10291"
FT                   /product="putative abc-type branched-chain amino acid
FT                   transport systems"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10291"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41602"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41602.1"
FT                   /translation="MAAVRPRLTVLMAAATLLMPRSGCADVVTVAQVLPFAGSAGLPTR
FT                   AAVDAAALYLRKVGQGRGVNGHVIQVVTVNAPRGSDAAFRRTAETLRRYRPVALLNVDG
FT                   AARTLALLERGVLEASRTPVIGALVSATPVRAFAGNRWVFYIRPGLKAEADRMAREGTT
FT                   AGRRRVAILYRDDALGEDGMGMATAALQALGVRPVLRLPLAVGMMDAPSLDRLAETVLG
FT                   ADADVILCFADSLSIGGFLRAYRERGGHALIMTDSTPSAQALVRASSTALARGVRIAQP
FT                   LPAPDGQQLQLTRAFAADMRAGGRPDLAASAEALEGYVSARLFVEVLRRMRGPVTGEAV
FT                   RTVLQTRGPFDLGGFEVDYGPSQYEGSQTVGIGVVGREGRLFNSLNN"
FT   gene            303127..303471
FT                   /locus_tag="RCFBP_10292"
FT   CDS_pept        303127..303471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10292"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10292"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41603"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41603.1"
FT                   /translation="MDDNWERIFEADTRINAERLIQIARSREPLARRKGMEWTAGAVPF
FT                   FGTELIRAMKAEELGPAIDDAAIQVAMAAWLLDSIYGGLDAHTFMGCTLQFTMLPGGAV
FT                   EYTRLPARQD"
FT   gene            303801..304706
FT                   /locus_tag="RCFBP_10293"
FT   CDS_pept        303801..304706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10293"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10293"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41604"
FT                   /db_xref="InterPro:IPR025391"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41604.1"
FT                   /translation="MYFAVESHDPASWLDGLLQTVLCAPQVHWFALVDGAFDLGGKPFV
FT                   PPGPCVPLYGRSSALYDLLPAPPYLVPLDHRTGAGLRAMVTALGTHCQGRPMLSFLASW
FT                   KPADELVHLWQPCLQPVVAAEGARHLLRFADTRVLSALPGALDPAAWARLTAPLMHWCY
FT                   VGRAGTLEPLWLAEPRAEPPTYSTQPLVLSQSDVDRLVEAALPDAILDLIERQAPGSLP
FT                   EVGRATAYRLVARARALARAHRVEAAPDIVLLASHALATDGAGLQAPELLAVLGEPRRS
FT                   PGALRAYLLSARSVDARRAG"
FT   gene            complement(304779..306152)
FT                   /locus_tag="RCFBP_10294"
FT   CDS_pept        complement(304779..306152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10294"
FT                   /product="putative diguanylate cyclase (GGDEF domain)"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pcp : putative cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10294"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41605"
FT                   /db_xref="GOA:D8NLK1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033424"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41605.1"
FT                   /translation="MNTFLIQRATHKQAVFAGTTAFAIVLVLAAAAPQADHPLPAVSPF
FT                   MPMCALTVFTTAGIAAFLLGAQFIVTRQPMLGALGGAYAFTSLAVALQLLMFPGVFTPT
FT                   GLFGAHPASAGWMWVFWHGGFPFFVTLALLVRDRFKPEAVDATHIARWTWLLVGGPMAV
FT                   GLLLCGLVLAIDLPPALGRTDGGAGHATALILWALNVVALLLVLARGRLRSVLDLWLAI
FT                   AALACFTDTSLNLLSPDRFTVGWYVARIFSMLAPGVLVCLLVWEVTTLYRRLFEAHVSL
FT                   QQASTHDALTGIYNRSYFNEQFPRAFDEARRKAQPFSLLMIDVDHFKRYNDTFGHLKGD
FT                   GCLVTIAAALEGVLRRHAGFIARYGGEEFAVVLPDATPRDALLLAESAREAVLHLRIEA
FT                   PTPSRYVTISAGCATAMPEASTSLEALIEAADATLYRAKAAGRNLVVPAETLRPARLA"
FT   gene            306453..307079
FT                   /locus_tag="RCFBP_10295"
FT   CDS_pept        306453..307079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10295"
FT                   /product="Undecaprenyl-diphosphatase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number="3.6.1.27"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10295"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41606"
FT                   /db_xref="GOA:D8NLK2"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR033879"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41606.1"
FT                   /translation="MPWAVAGITMEALNHALFLWINAPAQPAAGAVPLAMFFAEYAIWL
FT                   APLALVAGWLWGEPSTRRHALQAAVAAVLALLINVGFGLAWDHPRPFAIGLGHNLLAHV
FT                   ADSSFPSDHLTLLWAVAFSLLGHPRLRRAGVALALLGLPMAWARIYLGVHYPFDMVGAA
FT                   AVAAFSAWLCSGRVAHTLSEPLHRLGLAVHAVALAPCVRRGWVRK"
FT   gene            complement(307580..308059)
FT                   /locus_tag="RCFBP_10296"
FT   CDS_pept        complement(307580..308059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10296"
FT                   /product="putative transcription regulator protein"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10296"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41607"
FT                   /db_xref="GOA:D8NLK3"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41607.1"
FT                   /translation="MNTEVQAPPEATNQGAYQLDTMDRDTNVGRLVHRARHELVTHIDA
FT                   ALATLDLTAAQWTVVVYLAEDLANTPAELSRLLNYDPGAMTRLIDRLEKKNIVKRAPSD
FT                   ADRRSVVVTLTEQGRTLYPEIRPLIVDVLNHLLRGFSQVEVKQLENLLLRMLHNA"
FT   gene            308329..309117
FT                   /gene="fabG"
FT                   /locus_tag="RCFBP_10297"
FT   CDS_pept        308329..309117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG"
FT                   /locus_tag="RCFBP_10297"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number="1.1.1.100"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10297"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41608"
FT                   /db_xref="GOA:D8NLK4"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41608.1"
FT                   /translation="MDLRLQNKLALVTGSTKGIGHAIAVALAAEGARVILNGRTDASVA
FT                   EAVSRLLTEVPGAHVEAFAGDLSDPAQAEALVARFPRVDILVNNLGIFDPKPFEDIDDA
FT                   EWLRFFNVNVMSGVRLSRAYLPGMKAQNWGRIVFISSESGVQIPAEMVHYGVTKTALLG
FT                   LSRGLAELCAGTAVTVNAVLPGPTRSEGVETFTRKLSGGQRFEAFEKTFFETARPTSLI
FT                   KRFATPQEVASLVAYVASPLSSATTGAALRVDGGVVKSAF"
FT   gene            309496..312459
FT                   /locus_tag="RCFBP_10298"
FT   CDS_pept        309496..312459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10298"
FT                   /product="conserved exported protein of unknown function,
FT                   UCP029570"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10298"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41609"
FT                   /db_xref="InterPro:IPR016925"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41609.1"
FT                   /translation="MQVGWVMAGGRQWRWIVWLGTAAALASAPCPAAEPLARPAPQIAV
FT                   YYGSDVPVPELQAFDWVVLDPARVDRFDALEPVATQWLARVDLTRQADAMRGAGWPDTV
FT                   VDRLFAPLLAQGYKGFLLDGLDVLQRSAPQTADAVAALVRTLHARMPEARLLAGGTAWL
FT                   DTLAPALAGVVTPGLVRERTGDIGGGGSGGGLSEVSEADRAARIATLRRIGEQYHLPAV
FT                   ALDYCASYNRACLRDTANVARAAGVTSYATTPAADMIGIGRLEVMPRRVLLVEPQQPGT
FT                   SANTMPAVLYLAMPINYLGYRVEFADAYKPLPTVTPDRYAGVVTWFDGNAPRPGAWATW
FT                   LKRTMGAGVRVAMFNQFGMNMDAPMAQSLGLKAVPGTPSGALTIVSRDPMVGFELQPHP
FT                   DRRDVVGVRVDPNVPQAQSLLRLSAGSYTYDAAAILPWGGYVLRPFGVFRMPEVDQARW
FT                   VIQPMDFLRRALALPAMPVPDTTTENGRRLMTVHVDGDGFASRTEFPPSEFAGQALLRE
FT                   IWARYKVPTTVSVIEGEVSAEGMYPKLAPQLEPIARTIFAEPYVEVASHTFSHPFNWLR
FT                   TVGVQSSDESVDDHRTDTVSHTVAPAFNGSLAPDPTAPPALPEPSAPPKPPAPQPLESL
FT                   ESLQALQALQASQPPAEDVGSDVFGLNIPHYHFSFDREIAGSIHYINTRLAPQGKPVRV
FT                   LLWSGNGQVPPVAVRKTVEAGVLNMNGGDTYITRTNPSWTAVAPLGVDKGDNLFQVFAP
FT                   AQNENIYTNLWHGPYYGFSRAIETFELTDRPLRLKPLGIYYHMYSGTKVASLSALRQVY
FT                   DWALTQPVMPVYASDYIRKVLDFRNFAVARDGDAWVVRGDGDLRTVRWSGAGVPRLADA
FT                   RDVAGFAPAAGGGTYIHLASGSARFAIGEGPEALPYVREAGGRLSHWQRSADGRTLSAD
FT                   VAGYVRPFIRFANAARCRATVDGREVSGAHGDDWRIDLGPGNPARLVAQHVELVCGR"
FT   gene            312579..314564
FT                   /locus_tag="RCFBP_10299"
FT   CDS_pept        312579..314564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10299"
FT                   /product="putative methyl-accepting chemotaxis
FT                   transmembrane protein"
FT                   /function="12 : Regulatory functions"
FT                   /function="15.2 : Chemotaxis and motility"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10299"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41610"
FT                   /db_xref="GOA:D8NLK6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41610.1"
FT                   /translation="MRTSVPQQDSQPAASLGSRLAIAGLAALVLVFGAFALAISQASLR
FT                   TLEGHAQSAMRDQEAAMRDMIALFDGTMRTEADRFLTAFADAVPGPYSVDPAQTVEVAG
FT                   KPTPAFKSGDAVMNLNFTVPDQFFARTGGTIATVFARTGDDFVRVTTSLKKERGERAIG
FT                   TLLDRAHPSYKALMAGESFRGLAWLFGVPYMSKYEPVRDAAGKVVGALYVGVDVRAELA
FT                   LLKDKIRAHGIGKTGGYFVVDGKAGADQGKVLIDRDQGREGRNLLDAKDADGLAWVREM
FT                   IERKDGILRHTLADTDGGPARERFTVFTQYPDWKLVIAGTAYVDELEADLVSARNRFLL
FT                   LGLALGLLLAGGLYGMLRRAVSTPLAEVVSVARRVAAGDLTHRFAATRRDEIGQLMHAI
FT                   NGVGDGLSGIVDKVRVSASTIASSTGQIAAGNADLSARTEAQAGNLERTASSIEQLAAT
FT                   VRQNADSAQHAHDMVQSASQAANAGGETVERLVGTMSGIHATAQKIADITGIIDGIAFQ
FT                   TNILALNAAVEAARAGEQGRGFAVVAGEVRSLAQRSAAAAKEIKELISRSVQEVQAGNE
FT                   AARGAGEAMQDIVTRVERIAGIMGEISHASREQSQGIEEVNRAVTSMDEVTQQNAALVE
FT                   EAAAAAESLRQQAQALRGAVDVFRLA"
FT   gene            complement(314890..315819)
FT                   /locus_tag="RCFBP_10301"
FT   CDS_pept        complement(314890..315819)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10301"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10301"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41611"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="InterPro:IPR024467"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41611.1"
FT                   /translation="MQEGARQPRSLRTRVYVDGYNFYYGCLKGTHHKWLDLYKLFQEHV
FT                   LPSALIERDGQYVRSELLTEAVQFFTATIIERAAKAHDSVSSQARYHTALRKRHDGRIR
FT                   IVEGYYSVAKARAPRIDAAKPDAWPRDCERVPIWRLEEKQTDVNLALHAYHDAMTAQVD
FT                   HVVIASNDTDLVPALRMIREHTSVTVGLVIPTRDSERRPNEDLAKYAHWVRRHLTDAEL
FT                   AAAQLPRVVPGGKTPTVKPDSWYPHPGLFQEALRLAIEVRGSRSKAFQWFDAPCEHLDG
FT                   QLPLNLLESEAGAQRVLAYMRDWLARQG"
FT   gene            complement(316065..316865)
FT                   /locus_tag="RCFBP_10302"
FT   CDS_pept        complement(316065..316865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10302"
FT                   /product="putative ferritin-like protein"
FT                   /function="16.14 : Store"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10302"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41612"
FT                   /db_xref="GOA:D8NLK8"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41612.1"
FT                   /translation="MDDIAYGSIDIARVRNHRTLFYLVASASFIESGSDLYAGNLAQYY
FT                   ADRPETAHWLIHHWEREELQHGRALRRYVETVWPEFDWARGYARFFAEYSVTCAIDQFE
FT                   PTQALEMVARCVVETGTATFYRAIAQAAADTDEPVLRDLASRISADEVRHYKHFYRFFH
FT                   ECNARESVGRARVLKALASRLREIKNEDAAIALRNVLRIERDQDDVPEADVRALNSRVS
FT                   ALVRAHLPIDMAAKMLLKPLRLRPGIERSIRPPLVALVRRVMLH"
FT   gene            complement(317085..318332)
FT                   /locus_tag="RCFBP_10303"
FT   CDS_pept        complement(317085..318332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10303"
FT                   /product="putative transporter, Major Facilitator
FT                   Superfamily"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10303"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41613"
FT                   /db_xref="GOA:D8NLK9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41613.1"
FT                   /translation="MTPLLSPDSPDGRRLVLLLGLAQTVSWGTLYFTFTVFLAPMHDTL
FT                   GWARPFLAGGFSLGLLVWALCSFLVGRTLDRWPARRVMGAGSALAAASLLAWSLIDSKT
FT                   AFLLLWLPMGMAMATTLYDPAFVVLRQTFGDAYQRPIIGLTLIAGFASTICIPLAQWGV
FT                   EHIGWRHTLQAFALLHLLVCLPIHARLRVRPPAQAMAGPAAAAPVTPAAWRMALRMPVF
FT                   WAVVLAFVAVNLVASMLGAHLIPLLSEKGVPTARQLLIAALIGPAQVLGRLAMMRLRFA
FT                   HPVRIAPFTYTAMAAALAMLALSSGPLLLVSAVLYGAANGINTMLRAIAMPELVSRAQY
FT                   ATLNGLMMTPVLLAQASGPWLGALLWKATGGYATVEWAMVGAALVALAAFAHGLRHARA
FT                   STAHADAERRHVTQAP"
FT   gene            complement(318472..319020)
FT                   /locus_tag="RCFBP_10304"
FT   CDS_pept        complement(318472..319020)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10304"
FT                   /product="putative antibiotic resistance protein
FT                   (Acetyltransferase)"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10304"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41614"
FT                   /db_xref="GOA:D8NLL0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41614.1"
FT                   /translation="MNAPEPHDDVRLIDCSEAEHAAAILDILNEAIVNSTALYDYTPRP
FT                   PQAMATWFAAKRAGGFPVVGAVDASGKLLGFASWGTFRAFPAYKYTVEHSVYVHHACRG
FT                   RGLGERLLREVIRRAREAQLHVLVGCIDAANSASAGLHTRLGFVHAGTIREAGFKFGRW
FT                   LDAAFYQLNLETPAQPVDG"
FT   gene            complement(319110..319739)
FT                   /locus_tag="RCFBP_10305"
FT   CDS_pept        complement(319110..319739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10305"
FT                   /product="putative transcription regulator protein"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10305"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41615"
FT                   /db_xref="GOA:D8NLL1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41615.1"
FT                   /translation="MQETAAPPSDDTDAGVNERIARRVRELRATRGYTLDALAARCGVS
FT                   RSMISLIERGAASPTAAVLDKLAAGLGVSLASLFGGEREGLPAQPLMRRAQQTQWRDPE
FT                   SGYVRRNLSPPDWPSPIQLVEVHFPAGARVAYETGGRERVMQQQVWVIEGRIDVMLGNQ
FT                   LHELHQGDCLAMRLDQPLIFSNPTSRAAHYVVAICEAPALAGAWSP"
FT   gene            complement(319843..320838)
FT                   /gene="ldhA"
FT                   /locus_tag="RCFBP_10306"
FT   CDS_pept        complement(319843..320838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ldhA"
FT                   /locus_tag="RCFBP_10306"
FT                   /product="fermentative D-lactate dehydrogenase,
FT                   NAD-dependent"
FT                   /function="6.7 : Fermentation"
FT                   /EC_number="1.1.1.28"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 4297266, 9025293; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10306"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41616"
FT                   /db_xref="GOA:D8NLL2"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41616.1"
FT                   /translation="MRILFFSSHRYDEDSFRAARARGAHGFDLVFQRAHLDMQTASLAA
FT                   GFEVVCPFVNDCLDAGVLAILAAGGTRLIALRSAGFNHVDLAAAQRLGLTVVRVPAYSP
FT                   HAVAEHAVGMILTLNRRLHRACTRTREGDFSLDGLLGFDLAGKTVGVIGTGQIGQVFAR
FT                   IMAGFGCQLLAFDPFPQAALAALGVTYVPLPALLAQSDIVSLHCPLNADTHHLIDADAL
FT                   ASMKMGAMLINTSRGGLIDSPALIDALKSGQLGHLGLDVYEEEADLFFEDRSADVLQDD
FT                   VLARLLTFPNVIVTAHQAFFTREALAGIADTTLANVAAWAAGTPVNAVKA"
FT   gene            complement(320900..321925)
FT                   /gene="adhA"
FT                   /locus_tag="RCFBP_10307"
FT   CDS_pept        complement(320900..321925)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adhA"
FT                   /locus_tag="RCFBP_10307"
FT                   /product="Alcohol dehydrogenase"
FT                   /function="6.7 : Fermentation"
FT                   /EC_number="1.1.1.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9659380; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10307"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41617"
FT                   /db_xref="GOA:D8NLL3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41617.1"
FT                   /translation="MARSMKAAVVHAFGEPLRIEEVPIPTPGRGQILVNIRASGVCHTD
FT                   LHAADGDWPVKPRLPFIPGHEGVGFVAAVGEGVSAVKEGDRVGVPWLYTACGHCEHCLG
FT                   GWETLCHDQQNTGYSVNGGYAEYVLADPNYVGHLPAQVGFEEIAPILCAGVTVYKGIRM
FT                   TDTRPGQWIAISGIGGLGHVAVQYAVAMGLHVVAVDVAPEKLALARELGAMLTVDASQQ
FT                   DPAAVIQKEVGGVHGVLVTAVSRSAFAQALGMVRRGGTVSLNGLPPGDFPLPIFSTVLN
FT                   GITVRGSIVGTRRDLQESLQFAAEGQVRAHIHRDRLDNINQVLADLKAGKVDGRIVLSL
FT                   D"
FT   gene            complement(321992..323905)
FT                   /gene="acoR"
FT                   /locus_tag="RCFBP_10308"
FT   CDS_pept        complement(321992..323905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acoR"
FT                   /locus_tag="RCFBP_10308"
FT                   /product="acetoin catabolism regulatory transcription
FT                   regulator protein, sigma54 interaction domain"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1378052; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10308"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41618"
FT                   /db_xref="GOA:D8NLL4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41618.1"
FT                   /translation="MQDHRMSHHTGQVLTLAQHDAPVAGPFAGPAADPSIARSWLRCLH
FT                   QHGLDPADASAPAVLEAARLRERRERLQPMLRIADGEMHSLHRQLAGNGHVVVLTDADG
FT                   VILDCIADHAERALFRQAGLWSGVDWSEACEGTNGIGTCVVERQALTIYQDEHFRSRHI
FT                   QLSCSASPVFDPHGNLLAVLDVSSIPRELSRQGQFHTTALVNLSAKVIEGGYFLQHFER
FT                   DWLLRFHAQPEYVGLFSEGLLAIGGDGRIRAANQSALNLLGHTRPSLLGQPVEAVFDLS
FT                   ADALLARATESGGVAWPLRTHPGRLLFGLLRAPRRRPATDATPVSPPAPAAPGLCLQAE
FT                   GLRTDFHRALRVFEHDVPLLLHGETGTGKEAFARAVHRASRRAAQPFVAVNCAAIPETL
FT                   IESELFGYRGGSFTGARREGMRGKLQQADGGTLFLDEIGDMPLALQTRLLRVLEERTVM
FT                   PIGGEPQPVDVRIVSASHRDMEACVRDGRFREDLYYRLNGLRITLPPLRERADRATLLA
FT                   HVLAEESRGRPVRLDDDARDALLAQPWPGNVRQLRNALRTLVALSDDGRIRLRDLPPEL
FT                   CPQAAGSAAAPAPLDSAEKTALLAALQAQQWRMTHAAEALGISRNTLYRKLRKHGIARP
FT                   GG"
FT   gene            324161..325681
FT                   /gene="aldA"
FT                   /locus_tag="RCFBP_10309"
FT   CDS_pept        324161..325681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aldA"
FT                   /locus_tag="RCFBP_10309"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="1.2.1.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10309"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41619"
FT                   /db_xref="GOA:D8NLL5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41619.1"
FT                   /translation="MLYAHPGTPGAVVSFQSRYGNYIGGRFVPPVRGQYFTNTTPVTGE
FT                   VIAEFPRSTAEDIDRALDAAHAAADAWGRTSVQDRSLILLKIADRIEQNLERLAVTETW
FT                   DNGKPIRETLNADIPLAVDHFRYFAGCIRAQEGAAAEINEHTVAYHIHEPLGVVGQIIP
FT                   WNFPLLMAAWKLAPALAAGNCIVLKPAEQTPLGICVLMELIGDLLPPGVLNVVHGFGKE
FT                   AGEALATSKRIAKIAFTGSTPVGSHILKCAAQNIIPSTVELGGKSPNIYFEDIMQAEPS
FT                   FIEKAAEGLVLGFFNQGEVCTCPSRALVQESIYGSFMEAVMAKVAAIKRGDPLDTETMV
FT                   GAQASEQQFNKIRTYLEIAQEEGAECLVGGEAEVMSGKLANGYYIKPTLLKGHNSMRVF
FT                   QEEIFGPVIAVATFQDEAQAIQIANDTEYGLGAGVWTRDINRAYRVGRAIKAGRVWTNC
FT                   YHLYPAHAAFGGYKKSGVGRETHKMMLDHYQQTKNLLVSYDTRPLGFF"
FT   gene            325773..327167
FT                   /gene="eutB"
FT                   /locus_tag="RCFBP_10310"
FT   CDS_pept        325773..327167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutB"
FT                   /locus_tag="RCFBP_10310"
FT                   /product="Ethanolamine ammonia-lyase heavy chain"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="4.3.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2197274; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10310"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41620"
FT                   /db_xref="GOA:D8NLL6"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41620.1"
FT                   /translation="MARFSHTLGSETYRFDSLRDVLAKASPARSGDALAGIAAASAAER
FT                   VAAQMALAEIPLKHFLDEAVVPYEADEVTRLIVDTHDADAFAPVRHLTVGDFRDWLLGD
FT                   AADASALAALAPGLTPEMAAAVSKLMRVQDLILVAQKARVVTRFRNTIGLRGRMSTRLQ
FT                   PNHPTDDPAGIAASLLDGLMYGSGDAVIGVNPVSDSPAAICSLLEMLDAVIQRYRIPTQ
FT                   ACVLTHVTTTLDAVNRGMPVDLVFQSVAGTEAANAGFGVNLALLQEAHDAALGLKRGTV
FT                   GDNVMYFETGQGSALSAGAHHGVDQQTCEARAYAVARRFRPLLVNTVVGFIGPEYLYDG
FT                   KQILRAGLEDHFCGKLLGVPMGCDICYTNHAEADQDDMDTLLTLLGAAGVNYIMGVPGS
FT                   DDVMRNYQTTSFHDALYVRRVLGLRPAPEFEDWLARMGICAAGDGRVALADALPDPFRR
FT                   AVAQLA"
FT   gene            327176..327988
FT                   /gene="eutC"
FT                   /locus_tag="RCFBP_10311"
FT   CDS_pept        327176..327988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eutC"
FT                   /locus_tag="RCFBP_10311"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /EC_number="4.3.1.7"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10464203; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10311"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41621"
FT                   /db_xref="GOA:D8NLL7"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41621.1"
FT                   /translation="MTDERDDTPATVTPNPWQALRGLTPARIALGRAGVSLPTRPQLAF
FT                   QAAHAQARDAVHLPFDHAAVQAQLHAQGHATLLLHSAAHDRDRYLQRPDLGRRLDAPSA
FT                   QRLRDHASAHPGGTDVALVVADGLSALAVHRHAAPLIACVVDGVRAQGWSMAPIALVEQ
FT                   GRVAVADEVGERLGARMVVILIGERPGLSSPDSLGLYFTYAPRVGLTDAARNCISNVRP
FT                   EGLGYAAAAHKLLYLMREAWRRQVSGVQLKEAAEVPLVQGGRRNFLLD"
FT   gene            328016..329485
FT                   /gene="sbcB"
FT                   /locus_tag="RCFBP_10312"
FT   CDS_pept        328016..329485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sbcB"
FT                   /locus_tag="RCFBP_10312"
FT                   /product="exodeoxyribonuclease I"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.3 : Degradation of DNA"
FT                   /EC_number="3.1.11.1"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10312"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41622"
FT                   /db_xref="GOA:D8NLL8"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR013620"
FT                   /db_xref="InterPro:IPR023607"
FT                   /db_xref="InterPro:IPR034747"
FT                   /db_xref="InterPro:IPR034748"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038649"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41622.1"
FT                   /translation="MPASLRCPTRLTVTHTFLWHDYETFGAVPRRDRPAQFAGIRTDAE
FT                   LNEIGEPVELFCQPSSDWLPDPVSCLITGITPQQCRRQGIPEYRFAQAIERELATPGTI
FT                   GVGYNSIRFDDEVTRHLFWRNLIDPYAREWQNECGRWDLLDVVRTTWALRPDGVEWPKN
FT                   GDGKPSFKLEHLSQANGLLHEAAHDALSDVRATIALARRVRDAQPRLFDFCFALRKKER
FT                   VLAEIGETPRPLLHVSGMYGVERGCMAVVWPLGWHPTNKNELLVWDLACDPAELFDLGV
FT                   DTIRERLFTRSAELAEGTTRLPVKSIHINKAPIVIGNLKTLQPAQAERWGVDFAAIERH
FT                   AAAAQGAPDMRETWRQVYARELDPIEDVDQNLYGGFVANGDRRTLNELRTLSGEQLARL
FT                   HPDFADARLPELLFRYRARNFPDTLAEDEYEQWEQLRAERLFEGGGGYLTFEAFGERLQ
FT                   QLGAEAAESGDARAQNILQDLFDYAQQIVPG"
FT   gene            329592..330086
FT                   /locus_tag="RCFBP_10313"
FT   CDS_pept        329592..330086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10313"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10313"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41623"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41623.1"
FT                   /translation="MSDYARERSTPGIPACQKALLSLTFDGSHLRGSNGMEFPAVSGKP
FT                   DKQGVFEYALARQQVAYQGPIPEGDYWIQPSQLWENNWFKSLVRTPRASWGNYRLTIHP
FT                   YPGTQTYGRGGFFLHGGTVPGSAGCIDLVGQMDRFVSRLKQALGGLPECYVQLYVRYPQ
FT                   H"
FT   gene            330047..330418
FT                   /pseudo
FT                   /locus_tag="RCFBP_10314"
FT   CDS_pept        330047..330418
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10314"
FT                   /product="conserved membrane protein of unknown function
FT                   (fragment)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="PSEUDO:CBJ41624.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(330466..334041)
FT                   /locus_tag="RCFBP_10315"
FT   CDS_pept        complement(330466..334041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10315"
FT                   /product="putative Indolepyruvate ferredoxin oxidoreductase
FT                   (iorA)"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.2.7.8"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10315"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41625"
FT                   /db_xref="GOA:D8NLM1"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41625.1"
FT                   /translation="MNAPLNDALRRALETVSLDDKYTLERGRIYISGTQALVRLPMLQQ
FT                   ERDRAAGLNTAGFISGYRGSPLGALDQALWKAKKHLSGHSIVFQAGLNEDLAATSVWGS
FT                   QQVNLYPSAKFDGVFGMWYGKGPGVDRTIDVFKHANSAGSSAHGGVLVLAGDDHACKSS
FT                   TLAHQSEHVFKAAGIPVLYPSNVQEYLDYGLHGWAMSRYSGLWVAMKCVTDVVESSASV
FT                   DVDPHRAEIVLPEDFIVPAGGLNIRWPDPPLVQEARLLDYKWYAGLAYVRANKLDRVVL
FT                   DAPQARFGIMTAGKAYLDVRQALVDLGLDDETCRRIGIRLYKVGCVWPLEAHGARAFAE
FT                   GLQEILVVEEKRQILEYQLKEELYNYRDDVRPRVYGKFDEKDNAGGEWSVPMGNWLLPA
FT                   HYELSPALIARAIATRLEKFELPSDVRARIEARIAIIDAKEKALAKPRITAERKPWFCS
FT                   GCPHNTSTNVPEGSRALAGIGCHYMTVWMDRSTSTFSQMGGEGVAWIGQMPFSGDQHVF
FT                   ANLGDGTYYHSGLLAIRASIAAKVNITYKLLYNDAVAMTGGQPVDGPLSVPQIAAQVHA
FT                   EGTSRIVIVTDEPEKYNAAGSAKIELPEGVTVHHRDRLDAIQRELREVKGTSVLIYDQT
FT                   CATEKRRRRKRGTMADPARRAFINDAVCEGCGDCSVKSNCLSVEPLETELGTKRKINQS
FT                   SCNKDFSCVNGFCPSFVTAEGAQVRKPESSGASIDSLPLLPHPELPGIQRAYGVLVTGV
FT                   GGTGVVTIGGLLGMAAHIEGKGVTVLDMAGLAQKGGAVLSHVQIGERPDTIHATRIAMG
FT                   EADLVIGCDAIVSASDEVLSKVQCGQTRAIVNSAQTPTADFIKNPNWRFPGSSAEADIR
FT                   AAVGDACAFEDASALAVRLLGDAIYTNPLVLGFAWQKGWIPLTYDALVRAIELNGVSVD
FT                   KNKTAFEWGRHLAHDRETVLKLAGEAPRAKADVIALPATLDTLIARRIDLLTAYQNAAY
FT                   AAGFRAVVERVRAAEAAVVGAGQPLALTDAVARNLSKLMAYKDEYEVARLYTDPAFLDK
FT                   LRAQFEGEPGRDYQLNFWLAPPTTAKHDDKGRPVKRRYGPNTMHLFKLLAKLKGLRGTA
FT                   FDLFGKTEERRTERALIGEYRALVDELVSGLSAQKLAQAVELARLPEDIRGFGHVKAAN
FT                   LAAARVRWAKLLAQWREPAGAQRAA"
FT   gene            334822..336288
FT                   /locus_tag="RCFBP_10316"
FT   CDS_pept        334822..336288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10316"
FT                   /product="putative transcription regulator, GntR family,
FT                   aminotransferase domain"
FT                   /function="12 : Regulatory functions"
FT                   /EC_number="2.6.1.39"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10316"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41626"
FT                   /db_xref="GOA:D8NLM2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41626.1"
FT                   /translation="MDYGVLLSTYEREIGREAAARMPQQHRLYACLRAAILSGKIEEGT
FT                   QLLASRTLAEELSMARNSVLYAYERLASEGFVVGRRQGTVVARVGVPQAPAVVPGDAPV
FT                   LSRRVAHIERPGDGMDDPLPFLPGTPALDVFPLAQWRRSVERAWRNIGPAQLGYMPVEG
FT                   NAALRQAIAEYLRVSRGVRCEAGQVFVTDGTQNSLDLCARTLADAGDTAWLENPGYLGA
FT                   RHAFQAADLRLVPIPIDADGLAPRPEDWRDRPPRLIYITPSHQYPLGAVMSLERRLALL
FT                   AQARAAGAWIIEDDYDSEFRHQGAPLSAVQGLAEDAPVIYLGTFSKVMFPALRLGFMVV
FT                   PPALAPVLRRTAGALMLRGRVAEQLALADFIDAGHFTRHLRRMRRLYAERRAALQGALE
FT                   ARLSGLLTVSGGAGGMHLSARLDVPARDTEVSRAGRARGLVLRPLSRFCLPGTEGSYNG
FT                   LVLGYGGVDAGQMGGLVQRLGEVIETVLAE"
FT   gene            complement(336320..336475)
FT                   /pseudo
FT                   /gene="gspF"
FT                   /locus_tag="RCFBP_10317"
FT   CDS_pept        complement(336320..336475)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="RCFBP_10317"
FT                   /product="fragment of General Secretory Pathway protein F,
FT                   type II secretion system (part 2)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="PSEUDO:CBJ41627.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(336516..337802)
FT                   /locus_tag="RCFBP_10318"
FT   CDS_pept        complement(336516..337802)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10318"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10318"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41628"
FT                   /db_xref="GOA:D8NLM4"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41628.1"
FT                   /translation="MHLDATTAGAEKPKPKLDEHRTLLLGILFIGLLLWRSPNLFLHPR
FT                   FWAEEGQFYYSTLQDGTSPLTLVMRGNYQLITNLICYVATLVPTEWAAHVTTYSSLLVA
FT                   LWCIILFSRFSIDNGWPLTTTAMAVAIFALCAQGYEVYLNTTNVQWLCALSLLFIGIAS
FT                   WVNLRGIRKTLLYAWVATCALSGVPSAIMAPLFLIKGTFFRSAIHFRLGLILAVGTAIQ
FT                   VTIIVLHPHPDRLLSPTALTMTAPWLLQTVASPIFTGGLTEFLVFFLHWLQSSAALALA
FT                   YAVLLSIAAFALVASYREAKEKITVVVLALVWIFVPIIQSLGALGDTHKLISGWVHGRY
FT                   FFIGVVCFITLLGIAANRASPVVRLPAMALLLMALCSGLYQARHGAWRIYMLDGPSWSD
FT                   QVAACEGRRPCQVQAWPAGPDWTFMLDRK"
FT   gene            complement(337997..339280)
FT                   /locus_tag="RCFBP_10319"
FT   CDS_pept        complement(337997..339280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10319"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10319"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41629"
FT                   /db_xref="GOA:D8NLM5"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41629.1"
FT                   /translation="MYRSATAIGTGPSGLKQVHRALALTALFVGLMLWRSPDLLIHPRL
FT                   WAEEGRFYYNALQNGASPFTLIIRGNYQLITNLIGYLATLVPAEWAAHVTTYCSLLVAL
FT                   WCIILFSRFSVESGWPLTRSATIVAILALLAPGYEIYLSGTNSQWLCALSLLFICIGQW
FT                   DTLRGPRRTLLYAWVAVCALSGVPSSIMTPVFLVRGTIFRSTAHLRFGLVLAAGTAIQA
FT                   IIIALHPHTDRLFSPTMLLMTAPWLLQTVASPLFTAEGTEYLLAFLKGLKNPYAVALAY
FT                   IVLSSIAAFTLATSYRRAKEKAVAVVLAVVWIFVPSIQIFGVLGNSDELVSGWKNGRYF
FT                   FIGAVCFIMLLGITAEKAPSIARRTASALLVMMLCAGIYQMDHGGWKATMLYGPSWSSE
FT                   VAACKGRRPCVVQPWPISSEWTFILHHR"
FT   gene            complement(339664..340875)
FT                   /pseudo
FT                   /gene="gspF"
FT                   /locus_tag="RCFBP_10320"
FT   CDS_pept        complement(339664..340875)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspF"
FT                   /locus_tag="RCFBP_10320"
FT                   /product="fragment of General Secretory Pathway protein F,
FT                   type II secretion system (part 1)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="PSEUDO:CBJ41630.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            complement(340892..342628)
FT                   /locus_tag="RCFBP_10321"
FT   CDS_pept        complement(340892..342628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10321"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type pm : putative membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10321"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41631"
FT                   /db_xref="GOA:D8NLM7"
FT                   /db_xref="InterPro:IPR025291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41631.1"
FT                   /translation="MPSLRLMLIALAQGVGLYLCGRLAGTSLPDAQRALLAAAHTVLVF
FT                   GPTAYYLCERPAAPRRLLGLLALAALLIGALAGYSHWMGGTAKDLLDPDRRLLVSVVLW
FT                   GLALPLIQLRADDRALTDYPALFQASWRDAILVIDAAIFTGVFWSVLFLGAQLFHVIGL
FT                   HLFREIIQKAAFAWPATTLCFAYAVQLCRRHAVMVESIQRHALSACKWLLPLTLLIAAG
FT                   FVLALPFTGLKALWATRYAATLLLWLLAVSVLFINATYGDGTEPPGYPRWLAATLRAGM
FT                   LALPVLGGLALVALGLRIRQHGLTVERIWGMLVAVAGCVYALGYAAAALRRGAWLGGIG
FT                   RINVAVALGLIVAIALLTGPLLEQHRLAADSQVARLATGKVAADKFDYDALRFDMGRPG
FT                   RDALAGLVADTALANHAEIGRRATAALAKQRRWGNDLAVDFDTLLAGTKIYPAGATLPA
FT                   DFIDFARAHQDAFKSLACEVGGSGACGLIMLDLNGDGQIEILPAVPQYRPELYSRTAAG
FT                   WKAIGYLEATEHRCHHDSADTGTDAATAITVVPLWKDVMIGKHRWVVVPDLSADCPTAK
FT                   TP"
FT   gene            complement(342725..344281)
FT                   /gene="gspE"
FT                   /locus_tag="RCFBP_10322"
FT   CDS_pept        complement(342725..344281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspE"
FT                   /locus_tag="RCFBP_10322"
FT                   /product="General Secretory Pathway protein E, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10322"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41632"
FT                   /db_xref="GOA:D8NLM8"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41632.1"
FT                   /translation="MATQASSPDARTLEPPSPSAVRLVPYVFARDARLLVARQDVDTLE
FT                   VWVCPETSRTALAELARVFGALRLVSLDAAALSTATQTAYNAQDGSAAQVVGEVEGEVD
FT                   LSRLMQDIPAVEDLLESEDDAPIIRMINALLTQAAREGASDIHIEPFENASVVRFRVDG
FT                   TLRDVVRPKKALHGALISRIKIMAQLDIAEKRLPQDGRITLRVGGRPVDVRVSTLPTGH
FT                   GERAVLRLLDKEAGRLDLGKLGMGAGTLARFDHLINQPHGIVLVTGPTGSGKTTTLYAA
FT                   LSRLDASSTNIMTVEDPIEYDLDGIGQTQVNPKIDMTFAKALRAILRQDPDVVMIGEIR
FT                   DLETAQIAVQASLTGHLVLATLHTNDSASAVTRLIDMGIEPFLLSSSLLGVLAQRLVRR
FT                   LCVHCRREEVLDLTPTEIEAVAGTPPVDSTAATVPTRRSVWHHVGCEHCGQSGYQGRTG
FT                   VYELLTVTPEIQTMIHRQAPESEIKALAIGQGMHTMRADAQRWLDAGATSLEEVLRVTR
FT                   D"
FT   gene            complement(344316..346745)
FT                   /gene="gspD"
FT                   /locus_tag="RCFBP_10323"
FT   CDS_pept        complement(344316..346745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="RCFBP_10323"
FT                   /product="General Secretory Pathway protein D, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10323"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41633"
FT                   /db_xref="GOA:D8NLM9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41633.1"
FT                   /translation="MNDETMHNASSRHTVRAIVLACCATMVAGSLPVTPALAAPPASQA
FT                   PAASNAGDEVSLNFVNADLETVVKAVGQATGKNFIVDPRVKGTVNLVTEKPVTRAQALE
FT                   SLGSILRMQGYAIVEGNGFTKVVPEADAKLQGSPTSVGTGSARGGEQVVTQVFRLQYES
FT                   ANNLVPVLRPMIAPNNTITAYPANNTLVITDYADNLRRIGRIIASIDSPAAGETELIPL
FT                   KNAVAIDAAATLQKLLDPSGAAGGAGGGAGAALADPSLRTSVVAEPRSNSVLVRASSAA
FT                   RMAQAKQLLARLDVPGTRPGNIWVVPLKNANAVQLATTLRAIVAADATLSASQSSGPGG
FT                   QSAAQGAQAQQPATTGTQSSQGTQTGSYGSGASGSSGSGMGSGNSSFRASFGQSNLPTT
FT                   GGIIQADPATNALIITASEPVYRNLRTVIDDLDARRAQVYIESMIVEVTSDKASQLGIQ
FT                   WMVGAGGPNTYGFGGTNFGSGVGNILNLGVVAATVGSGGIGSTAAQTALGTITGSNVSG
FT                   LNGGNFGVFNKNTGLGAILSALGSDGSVNVLSTPNLITLDNEEAKILIGQNVPITTGSY
FT                   AQTGSSASVTPFQTFDRKDVGITLRVKPQITDGGLVKMQIFQESSAVVNGTQNATQGPT
FT                   TNVRSIETNVLANDGQVIVLGGLLEDNYQDSEQKVPGLGDIPILGALFRSESKERKKTN
FT                   LLVFLRPYILRTAEATGTLSDNRYNYMRQTQQGFVSPNVLPTTSDRDTPVLPSPESMRP
FT                   AQNYGDVSVVPKGQTGVQVPPGAPMPQGTTRSEPRLQNFAPPTSGGYDSNAPRNGG"
FT   gene            complement(346778..347629)
FT                   /gene="gspN"
FT                   /locus_tag="RCFBP_10324"
FT   CDS_pept        complement(346778..347629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspN"
FT                   /locus_tag="RCFBP_10324"
FT                   /product="General Secretory Pathway protein N, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10324"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41634"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41634.1"
FT                   /translation="MSVSIESLPPLRLRRRGPDQEGRAGLGWRIAVAVAALASVAVTVV
FT                   AQYPAAWAAERVAEATSHRVLLADAQGSIWQGSATLALTAGTGAADATVLPGRLSWSLD
FT                   AWPLLTGTLRAHLAHDRAMAQPVTLAVSRGGWQAEAGSMKLPASLLAGIGAPFNTLRLD
FT                   GQLRAQWTPLSGQFGRGKGAPDTVQGALTLTLEQVSSSLSRVRPLGSYRAELAFGGAAG
FT                   GPARLTLSTLAGPLSLQGQGTVGRGAHFDGVARATPESEPLLIGLLSLMGPRDGTGYRL
FT                   RF"
FT   gene            complement(347633..348211)
FT                   /gene="gspM"
FT                   /locus_tag="RCFBP_10325"
FT   CDS_pept        complement(347633..348211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspM"
FT                   /locus_tag="RCFBP_10325"
FT                   /product="General Secretory Pathway protein M, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10325"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41635"
FT                   /db_xref="GOA:D8NLN1"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41635.1"
FT                   /translation="MATSSNASNASAARRRLPRIGVPDALRDAATAFWMQREPRERRIL
FT                   AGGGAILLLVIVYLLFWEPAFEGRRRIEKALPEMRGQLAEMETLGQEARELSAIAAAPV
FT                   PHGNDLQDALNASLTAHGLKASRMALSGESVQVQLDKVPFGAVAEWLQEVRQAQRMKVI
FT                   DAGIRYVGATALVNVTATLQGPSAGAGGH"
FT   gene            complement(348227..349672)
FT                   /gene="gspL"
FT                   /locus_tag="RCFBP_10326"
FT   CDS_pept        complement(348227..349672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspL"
FT                   /locus_tag="RCFBP_10326"
FT                   /product="General Secretory Pathway protein L, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10326"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41636"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41636.1"
FT                   /translation="MTTSLYVRLPHRPIQSPERWSQDALACVPFALVREEGAQGSQRIL
FT                   RDGTSRIDELPAADRLVLLLPAADVLLVPASVPPLALPKLRLALPNLVEERLVQDAQQC
FT                   HIALGPRLGAASAHGWRAPREPQARALMIADRAWIRFVLDSVAGHKHRNCHLLPAQLCL
FT                   PLEAEAAAPVAGDVGNAQAAQARTEPSLEPAGAEAASADAPAEAASPATAAVTTIALDA
FT                   APPSDPDAPPAIDITVRSGPADGYGLRVLPAHIADWLAIAPAPARLMVAPALRDQAPAL
FT                   STDPAAARLDWAVWAAGARAALSAGDADLCQFDFAHGGIAGMDWSAWRWPVALAALIVV
FT                   VQLIGMNTQWLTLRAEQKRLDTAMRTQLQTAFPNTPVILDPPAQMRRQVQQLRLAAGKS
FT                   APEDFLPLADRFAQAAAGLAPDALLALDYHGRALVVTLKEGTDTTMLRTAAATVGLKME
FT                   TAEAPRGGEATVPGSRWTVSIAQ"
FT   gene            complement(349814..350878)
FT                   /gene="gspK"
FT                   /locus_tag="RCFBP_10327"
FT   CDS_pept        complement(349814..350878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspK"
FT                   /locus_tag="RCFBP_10327"
FT                   /product="General Secretory Pathway protein K, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10327"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41637"
FT                   /db_xref="GOA:D8NLN3"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41637.1"
FT                   /translation="MMRRARPTLPRQPRGAAVVTALLVVALAVVIVSGMLWRQQVEIRA
FT                   VENQRLTAQATWIARAGIDWARLILRDDQRRTGAVDHLGEIWAVPIQETRLSDFLGSSL
FT                   RTDVAGEDSYLSGRIFDAQARFNLMNLLALQTLGTRTVVTGRDKEGIKAYGRLLQSLNQ
FT                   DPNLADVTATWLARMLGGIQSSEGAQGGQSDSGGGGGGGDSGNGPRPLDDVDSLLAIPG
FT                   YTADTVRVLRPFVIVLPARTLVNANTAPAEVLAAVVPNLSLDRARALVQARDRAYFRNI
FT                   GDITNQLRGIAPGADNTAVANLLDVQTHYFLVYGMARHERAQVGQVALVSRGDPVNNNA
FT                   TRIVWVRRIDSIPP"
FT   gene            complement(350880..351608)
FT                   /gene="gspJ"
FT                   /locus_tag="RCFBP_10328"
FT   CDS_pept        complement(350880..351608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspJ"
FT                   /locus_tag="RCFBP_10328"
FT                   /product="General Secretory Pathway protein J, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10328"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41638"
FT                   /db_xref="GOA:D8NLN4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41638.1"
FT                   /translation="MHAISSDRVRTRGFTLLELLVAITLLAILAVLAWRGLDSMTRTHE
FT                   ALAQRDERIEALKTAYAQFDADCTQLADPATLSRSPVEIDADRVLLVRDRRDEGQPPAW
FT                   QVVLYRAVNGRLERLQSAPLTNRSDLRGALDSLRQGGANAAVYKLADAVDGIAARAWIE
FT                   PGGWMDNTGALSAALFPGGSNTTTLAELPAASAVSASAPAANGVVVPVATVRAVELALL
FT                   VRMTPQGTPQRFTRICMTGL"
FT   gene            complement(351589..351987)
FT                   /gene="gspI"
FT                   /locus_tag="RCFBP_10329"
FT   CDS_pept        complement(351589..351987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspI"
FT                   /locus_tag="RCFBP_10329"
FT                   /product="General Secretory Pathway protein I, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type m : membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10329"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41639"
FT                   /db_xref="GOA:D8NLN5"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41639.1"
FT                   /translation="MTRARRAARRHGFTLLEVLVALTIVAVALTATMRAMGSMTTASES
FT                   LQTRMLATWSAENHLAGLRLAHAYPEPGTRGFACPQGDAQLWCEETVAPTPNPVFRRVE
FT                   VAVYADAGRAVRLAWLVTLLPNDARNLF"
FT   gene            complement(351984..352445)
FT                   /gene="gspH"
FT                   /locus_tag="RCFBP_10330"
FT   CDS_pept        complement(351984..352445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspH"
FT                   /locus_tag="RCFBP_10330"
FT                   /product="General Secretory Pathway protein H, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10330"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41640"
FT                   /db_xref="GOA:D8NLN6"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41640.1"
FT                   /translation="MRRGFTLLELLVVVVIIGIVLGVVAVNATPNPRSQLADDAQKLAR
FT                   LIELAQEEAQLTARPVAWEGDAQGWRFLEAAPGGWRVMTRDVLAPGHWRQPMDNVQIVA
FT                   GAAAVAGAPQRLVFGREAIGLPWRVALSSRGARIDVVSDGGPRVLTEAP"
FT   gene            complement(352534..353004)
FT                   /gene="gspG"
FT                   /locus_tag="RCFBP_10331"
FT   CDS_pept        complement(352534..353004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspG"
FT                   /locus_tag="RCFBP_10331"
FT                   /product="General Secretory Pathway protein G, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10419967, 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10331"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41641"
FT                   /db_xref="GOA:D8NLN7"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41641.1"
FT                   /translation="MMQGQLRTPVRQRALARRAARGFTLIEIMVVVVILGILAALVVPK
FT                   IMSRPDEARIIAAKQDIASISQALKLYRLDNGRYPTTEQGLAALVTKPSTEPVPNNWKG
FT                   GGYLERLPKDPWGHPYQYLNPGVRGEVDIFSFGADGQPGGTGNDADIGNWDN"
FT   gene            353179..353865
FT                   /gene="gspC"
FT                   /locus_tag="RCFBP_10332"
FT   CDS_pept        353179..353865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gspC"
FT                   /locus_tag="RCFBP_10332"
FT                   /product="General Secretory Pathway protein C, type II
FT                   secretion system"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2124971; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10332"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41642"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41642.1"
FT                   /translation="MTVQQSSRLLSLVLFAALCALLTHWVLTLSSLRSLSAPREARVAQ
FT                   TEALETGAAVTLFGGGPQNGPRDVQVAGVVADLADGSGAAIVSIDGGPPQAIRAGKALS
FT                   PSLKLVEIKARSVVIERNGVRQEIALPASAVAGISPAGRNAPLPGPPSGAAAPMATPAM
FT                   PPPPPGAMAGNPANTAMPGAGLPLTPAPSNTNDILNAPQLGITGPRHHAAAAARKGGSA
FT                   DDDAEH"
FT   gene            353993..354571
FT                   /locus_tag="RCFBP_10333"
FT   CDS_pept        353993..354571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10333"
FT                   /product="Conserved exported protein of unknown function,
FT                   calcium-binding protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10333"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41643"
FT                   /db_xref="GOA:D8NLN9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41643.1"
FT                   /translation="MTNKRVVQTFLATSALFLAMSGMSARAQDTTAPAAAAPSATAPMH
FT                   HHGGGFKKLDTNGDGMVSRDEAKGHRWLEEHFDEIDTNHDGQISKDELAAWHKAHAGEM
FT                   RGKMQARLDAKFKAADKNGDGALTREEMQAGLPKLAKHFDEIDANHDGKVTEDEIRAFM
FT                   KARHEARRAQRNTPAAAAMPGGPSATKGQ"
FT   gene            complement(354664..355740)
FT                   /gene="hpd"
FT                   /locus_tag="RCFBP_10334"
FT   CDS_pept        complement(354664..355740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hpd"
FT                   /locus_tag="RCFBP_10334"
FT                   /product="4-hydroxyphenylpyruvate dioxygenase"
FT                   /function="16.11 : Scavenge (Catabolism)"
FT                   /EC_number="1.13.11.27"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10334"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41644"
FT                   /db_xref="GOA:D8NLP0"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR005956"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041735"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41644.1"
FT                   /translation="MGTAGFEFIEYAAPDPVAMGKLFENMGFSAVAKHRHKNVTLYRQG
FT                   GINFIINAEPDSFAQRFARLHGPSICAIAFRVQDAALAYKRALELGAWGFDTHSGPMEL
FT                   NIPAIKGIGDSLIYLVDRWRGKNGAQAGDIGDIGIYDVDFVPIPGANPNPAGHGLTYID
FT                   HLTHNVYRGRMKEWAEFYERFFNFREVRYFDIEGQVTGVKSKAMTSPCGHIRIPINEEG
FT                   TEKAGQIQEYLDMYHGEGIQHIALGSTDLYRTVDALRANGIKLLDTIDTYYELVDKRIP
FT                   GHGESVAELKKRKILVDGAPGDLLLQIFSENQLGPIFFEFIQRKGNQGFGEGNFKALFE
FT                   SIELDQMRRGVLKADEPA"
FT   gene            355928..356416
FT                   /locus_tag="RCFBP_10335"
FT   CDS_pept        355928..356416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10335"
FT                   /product="transcriptional regulator, AsnC/Lrp family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10335"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41645"
FT                   /db_xref="GOA:D8NLP1"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41645.1"
FT                   /translation="MSKVELDKIDRKILEVLQNNGRLTNLEVAERVNLSPSPCLRRIRR
FT                   LEESGVIRQYAALLDPGKIGLGLSAYINVRLEKQGGAPKGKAPSDIFRAAVATWPEVVT
FT                   CYAMTGEMDYLLKVFVEDMDHFARFIRDQLLAHPAVIDVKSSFALERIKDTTALPVVV"
FT   gene            356504..356695
FT                   /locus_tag="RCFBP_10336"
FT   CDS_pept        356504..356695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10336"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10336"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41646"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41646.1"
FT                   /translation="MLDVFLAPRRVRVMGTAAITFDDQGVRRPPVPASPTTSGRNRPGR
FT                   RGRPEVDGSHPGTFCHSL"
FT   gene            complement(356806..356979)
FT                   /locus_tag="RCFBP_10337"
FT   CDS_pept        complement(356806..356979)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10337"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10337"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41647"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41647.1"
FT                   /translation="MDGKISDWAIRPAEYPLDNATNSAVLKNLELNTETSPGLGNPNIR
FT                   ERHPDHRPVEFY"
FT   gene            356951..358945
FT                   /locus_tag="RCFBP_10338"
FT   CDS_pept        356951..358945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10338"
FT                   /product="putative serine protease protein"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10338"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41648"
FT                   /db_xref="GOA:D8NLP4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR034075"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41648.1"
FT                   /translation="MAQSEILPSRPASSPTATLDGIPSGLSPKAKAERNAAKLDGALIR
FT                   LRRNAPARAMATPDNSLESSAVVARPGNCVNVDIVVQGDAQQAVAQLERLGFQNAVVYR
FT                   NYISGCLPVAKIDEAAAIQQVRRISKVSRSTRSGAVQGQGDYAQLSRSLRQAVKGLGIE
FT                   LTGKGITIGVISDSFNCNSELNQNARYVAQNGHQDTMEDDIARGDLPGNGRIRILKELR
FT                   ECGDGTDEGRAIAEILHDVAPGADIVFYAGGEGLADFAQGVETLALPKDKSNAQGVAGG
FT                   GAQVIVDDMQYSYEPAFQSGIIGAAIDNVVKNRGVAYFTAGGNDGVGASPVSYVNNNAR
FT                   FADQPVDPNGTGTLGRPLNFDASGASQVFSLPVHATRQIVGFYRFSLQLYWDQPFDNST
FT                   SSLQVCLADKNGKPFNVMLDGEPYPSCTDASVIGQQAIAWGTLLGTEPEATLKILLVDG
FT                   TAPRRVRLQTSRVVVDQFGTADAALFGHVLSPNAITAGAANYLATPMCDPSLKTAQLER
FT                   FSSHGGGLMLFDNDGRALPRPVLDGKPDLVGPDGASSVFFGIRAKDGDRGFGVYNLNCR
FT                   YYAAYPYQFYGTSAAAPHLAGVAALMRQAVPRATPEQIYSALRKTAVDMDVPGHDNATG
FT                   AGFVQPERALRELIWQVLNQYRVPAPSGR"
FT   gene            complement(359008..359403)
FT                   /locus_tag="RCFBP_10339"
FT   CDS_pept        complement(359008..359403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10339"
FT                   /product="putative ketosteroid isomerase homolog protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="5.3.3.1"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10339"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41649"
FT                   /db_xref="GOA:D8NLP5"
FT                   /db_xref="InterPro:IPR011944"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41649.1"
FT                   /translation="MTDDERAIRAVVADWLSASQAGDLQTVLNLMTDDVVFLVPGQPPF
FT                   GKPAFAAMSEGMKAARIEGTSDIQEIEVFGDVAYLRNHLRITVTPPGGGPVMHRSGPTL
FT                   SILRKEADGQWRLARDANLVMPDPGPA"
FT   gene            complement(359517..360005)
FT                   /locus_tag="RCFBP_10340"
FT   CDS_pept        complement(359517..360005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10340"
FT                   /product="putative haem peroxidase / cupin, rmlc-type"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10340"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41650"
FT                   /db_xref="GOA:D8NM30"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR028013"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41650.1"
FT                   /translation="MNTQSVRLPLLAAAVLLGLGALPATAQDTGMGDMAMINPAGMKWG
FT                   DAPPTLPKGAKLAVLYGDPGKEGPFVVRIKAPAGYKVLPHWHTQSENLTVISGTLYLGG
FT                   GDTMDMGAAHALKAGGFHFLPGGAHHYAFTRTATVVQIHGTGPLDVHYVDPKDDPSKQ"
FT   gene            complement(360217..360912)
FT                   /locus_tag="RCFBP_10341"
FT   CDS_pept        complement(360217..360912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10341"
FT                   /product="N-acetyltransferase (Acyl-CoA), GCN5-related"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10341"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41651"
FT                   /db_xref="GOA:D8NM31"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41651.1"
FT                   /translation="MNPLELSKAIGVVTQDDIDKTEAAQGAPRTTVLVRELAAHHRSRL
FT                   LKHLLALGEEDRLLRFGQVVGNHVIEAYVDSIDFDHDKVFGVYDDRLTLVGVGHLAYLR
FT                   DNPQGRVAEFGVSVLESARGKGVGSALFQRAAMHGRNTKVRTLYMHCLSRNAAMMHIAK
FT                   KAGMRVQYAYGEADAYLELPPADTMSLLTEAIDGQVADLDYLLKRNLRDVRRFGQRFWR
FT                   SLLPLKRTV"
FT   gene            361314..361862
FT                   /gene="kefF"
FT                   /locus_tag="RCFBP_10342"
FT   CDS_pept        361314..361862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefF"
FT                   /locus_tag="RCFBP_10342"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   ancillary protein, quinone oxidoreductase flavoprotein"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="1.10.99.2"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11053405, 9312097; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10342"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41652"
FT                   /db_xref="GOA:D8NM32"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41652.1"
FT                   /translation="MSPPRILVIYAHPAPRRSRANKPLARMLAGLPGVAMHDLYWRYPE
FT                   FDIDVRAEQQAMEAADVVVFQFPVQWYATPSLLKEWLDVVLEMGWAYGPGGEALRGKHM
FT                   LVLATTGGRAHAYSPDGVHGHAFDLFLLPLQQTAALCGMHWLPPHVLHDADDASQPVLD
FT                   AHLDQVRATLQPWLAAVPA"
FT   gene            361896..363794
FT                   /gene="kefC"
FT                   /locus_tag="RCFBP_10343"
FT   CDS_pept        361896..363794
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefC"
FT                   /locus_tag="RCFBP_10343"
FT                   /product="Glutathione-regulated potassium-efflux system
FT                   antiporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2046548, 3301813; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10343"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41653"
FT                   /db_xref="GOA:D8NM33"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41653.1"
FT                   /translation="MQSHDLLANFVIYLAAAVAVVPLARRLGLGSVLGYLLAGVIVGPW
FT                   GLRLITNVQSILDFSEFGVVLMMFVIGLELEPARLWSLRRSIFGYGGLQLAVCALAVGL
FT                   VVMAVGHPWRAALVAGLGLALSSTAIALATLAERNLMRTPAGTAGFGILLFQDIAAIPM
FT                   IALLPLLAPDTGDAAGGHHWLAAAKAVGVVAAVIFGGRTVLRPVLRVIARTNMREMFTS
FT                   FSLLLVVGIALLMHSVGLSMALGAFIAGVLLADSEYRHALETDIEPFKGLLLGLFFLAV
FT                   GMSIDFGVLMRQPLAVVLLVAVFLVVKIGALRVLAMRFGIARGQAWLFAFLLSQGGEFA
FT                   FVVFGPGVAGDVLGAETAATLNLVVALSMAATPLLLLFHDKILAPRLMAGKKRAPDAIG
FT                   PQDNEVIIAGFGRFGQIVGRLLYSQGHTATVLDHDPDQIDILRRFGFKVFYGDATRMDL
FT                   LETAGADSARIMVVAIDDMETSLEVVDRVRERFPHLKLYVRARNVSHVYQLRDRGVEVI
FT                   EREMFEGSLVLARRVLEGLGKEPYEALRVAQTFRRHTLNAMDQIYPVYRDQKKLVSLAQ
FT                   QGRDELAEMFRRDRVQRKRLRESGMPWGEGGPHTAGADPRDASDDASAETPAARES"
FT   gene            complement(363816..364706)
FT                   /locus_tag="RCFBP_10344"
FT   CDS_pept        complement(363816..364706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10344"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10344"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41654"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41654.1"
FT                   /translation="MPSGRLASAVNPEATPTIPIRGGPIVSISSVSSSSSLYSSAILSS
FT                   TSTSSTSSTSDTSSTTPVRRHHGGGGGGFMQAIEQALSQLGLSTSSTSSTSSASSTSST
FT                   DSTSSTTGTSSTTSASAPPPPPGGMPPPDGGDDGDSDDSSSSTIGQDMQKLTHDLFSAL
FT                   QSASSSSSSSSSSSSSSTSSTSSTSGYGSDLASGLQNLISQLKSGDTSSSGSSALSTLQ
FT                   SDFQKLVSDVQSQSGSSSSGSSSSSSSTSTASSTSSSSSSSTPSLTDFLEKLAQSVAGQ
FT                   SAASMAVGSNISVYG"
FT   gene            364147..364509
FT                   /locus_tag="RCFBP_10345"
FT   CDS_pept        364147..364509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10345"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10345"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41655"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41655.1"
FT                   /translation="MLLVLLVLELDDELELLLELLALCRAENRSCVSFCMSWPMVELLL
FT                   SSLSPSSPPSGGGMPPGGGGGAEALVVLLVPVVLLVLSVDDVDDADDVDDVDEVDRPSW
FT                   LSACSIACMKPPPPPP"
FT   gene            364528..364596
FT                   /locus_tag="RCFBP_10346"
FT   CDS_pept        364528..364596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10346"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10346"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41656"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41656.1"
FT                   /translation="MLDVSLVEDVELVLVDDRIALE"
FT   gene            complement(364818..365693)
FT                   /locus_tag="RCFBP_10347"
FT   CDS_pept        complement(364818..365693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10347"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10347"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41657"
FT                   /db_xref="InterPro:IPR014973"
FT                   /db_xref="InterPro:IPR022123"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41657.1"
FT                   /translation="MTHLKWNIGSTEQNDSMAPCTVATIAAMQYIHVVNGDVAGAALKQ
FT                   ALAQAGRPDSVVVLRDDLAVGPLADVDGAAMARSGFWQRVAPTSNIDFATEMHDALASL
FT                   AELRESATEVAIWHGQSASDQLMLRRVAFHLHQAPQRINEIGMDVRELDTPGAQGMLTT
FT                   IGMYSGARLARRFSTIAPVSVLRIGRLAYEWQQTVRENADVRLWKGNTLVPVSYATVDE
FT                   VILEHVPTDWASARDVVASIMGAIDGLLASDWFVFWRCRELVGNGQLLLRGESDSLTTC
FT                   ELRRNVSVTV"
FT   gene            365811..367121
FT                   /gene="cgp"
FT                   /locus_tag="RCFBP_10348"
FT   CDS_pept        365811..367121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgp"
FT                   /locus_tag="RCFBP_10348"
FT                   /product="Carboxypeptidase G2 precursor"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="3.4.17.11"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3838935, 6396165, 9083113; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10348"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41658"
FT                   /db_xref="GOA:D8NM38"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017150"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41658.1"
FT                   /translation="MRAMSFARGVRPAVLSLLMVAGALVAGQAAAVPPAEIYKRAQQEK
FT                   PALIDTMKTLVSIESGSKDLEGLDKIAGVIADRLRLLGGDVKLVDPTDHAYRMADTPEK
FT                   IGKMVLARFKGEGKRNIMLIAHMDTVYLKGMLAQQPFRIDGDRAYGLGIADDKSGVAVI
FT                   LHTVSILQAVGFRQYGTLTVLVNGDEEISSPGARTLLAKLGAEQDAVFSCEGTRVSTDK
FT                   LSLATSGIGAILLDVKGKASHAGGAPEQGRNALYELSHQVLQLRDLSNPQTGLQVNWTM
FT                   AQAGTNRNVIPATASAQADVRLLRTADADKLEDTINERVKTRLIPDTQVTARFERRRPP
FT                   LEATPASHRLGEHAQKIYGELGKSLEIDDKAEGGGTDAAFAASKTLAPVIERFGLAGFG
FT                   AHSNDAEYVDLNSIVPRLYLLSRMIMDVSRDRVGVVR"
FT   gene            complement(367335..367616)
FT                   /locus_tag="RCFBP_10349"
FT   CDS_pept        complement(367335..367616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10349"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10349"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41659"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41659.1"
FT                   /translation="MRLKQIGMAALLAVGALAAGGAWAQATRLEVFDQAAREARVDVYS
FT                   DGAYTGRFDSCTEGARVRFDPYTDGMRSDPAGRAREAGGTVYGYPVPN"
FT   gene            368106..369236
FT                   /locus_tag="RCFBP_10350"
FT   CDS_pept        368106..369236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10350"
FT                   /product="Outer membrane porin protein"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10350"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41660"
FT                   /db_xref="GOA:D8NM40"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41660.1"
FT                   /translation="MKKSAILVAVGALFAGSAYAQSSVTLYGIVDATIHYTTNANQAGN
FT                   SLLRMDNGAVSNSRWGLKGSEDLGGGNKALFVLESGFDPDTGRVNSGGLFNRQSFVGLS
FT                   NKDYGTLTLGRQYNFGFTMGGNFDPLGVGNYDENSWLYYGVTGLRVSNMLKYEGKWNGL
FT                   YVGLGYGFGEQAGSTANNRYVGGAVSYEFGPALIGAFYQQQQDSTAAGNKQKVWGIGGN
FT                   YTIGPAKLFAGYIDSSDNTGCVNSSTCAGDRSTFGLNLYGNASGPGLTPGATKRRDHIG
FT                   LAGLTYQVTPALALTGAFYYDSISNADLDAGNDGKRYTGVLLAEYALSKRTQLYGTVAY
FT                   DKVKNAAIPEQPGGTGTGVNAKTSQVGVGLGIRHIF"
FT   gene            369367..370392
FT                   /locus_tag="RCFBP_10351"
FT   CDS_pept        369367..370392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10351"
FT                   /product="conserved protein of unknown function, Bug
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10351"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41661"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41661.1"
FT                   /translation="MTSDAVAISAVSVHSTRRRLSAAAALLCLGVPLLSATSALAQDYP
FT                   AKPIRIIVAYPTGGISDNVARALGEKLATQLGQPVVVENRAGAGGSIGMDAVAKSAPDG
FT                   YTLGFSAVSPLTLNPHFGKLPYDPQKDIAPVINVMYAPMILLGTPSFTGKSFADMLAQS
FT                   RAKPGTIRWSTSGMGTVGHLALEQVKVQAHVDITLIPYKGGGQQLTDALGGQVEVMSTN
FT                   VGPTLMQHVSSGKLRPLAVGAPHRLDALPTVPTFAELGYAKANMASTFGVFAPAKTPAP
FT                   IIARLNTEINKALASPDLRERLTQASVVPVGGTPEQFTAAIRAEYDSNSRIVHAAGIKE
FT                   Q"
FT   gene            complement(370396..371100)
FT                   /gene="kdpE"
FT                   /locus_tag="RCFBP_10352"
FT   CDS_pept        complement(370396..371100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kdpE"
FT                   /locus_tag="RCFBP_10352"
FT                   /product="response regulator (OmpR family) in two-component
FT                   regulatory system with KdpD, regulation of potassium
FT                   translocation"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1532388, 9858692; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10352"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41662"
FT                   /db_xref="GOA:D8NM42"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41662.1"
FT                   /translation="MHAMAFTFTPTVLVIDDEPHIRRFVRAALEAEGCEVFEADRVQRG
FT                   LIEAGTRQPDAVILDLGLPDGDGMSLIRDLRTWTEVPVLVLSARVDERDKIDALDTGAD
FT                   DYLTKPFGVGELIARLRVLLRRHAKRGEDGGSIIAFGDVQVDLARRLVSRNGEPVHLTP
FT                   IEYRLLSVLLGRRGAVMTHRELLREVWGPAHSDSSHYLRIYMGHLRHKLERDPARPQHL
FT                   LTEVGVGYRFAA"
FT   gene            complement(371180..371491)
FT                   /gene="hip"
FT                   /locus_tag="RCFBP_10353"
FT   CDS_pept        complement(371180..371491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hip"
FT                   /locus_tag="RCFBP_10353"
FT                   /product="High-potential iron-sulfur protein precursor"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 9119002; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10353"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41663"
FT                   /db_xref="GOA:D8NM43"
FT                   /db_xref="InterPro:IPR000170"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR036369"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41663.1"
FT                   /translation="MSNRRQFLKSIPIVAAAGAVGMAGLARAANPMVAETDPQAAALGY
FT                   KADTTKVDQAKYPKHTPDQHCGNCALYQGGTAAQGGCPLFAGKDVANKGWCSAWAKKA"
FT   gene            371770..372357
FT                   /locus_tag="RCFBP_10354"
FT   CDS_pept        371770..372357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10354"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10354"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41664"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41664.1"
FT                   /translation="MDDFARLLEGYLHAKDDNLPHVIDGVFAPHARLTFSLATQNIAFP
FT                   SQNDGAAAIAKTLVTDFGVQYHRCRTYCVSRRRDLPDVPQAGTGPISLAPMPWLVVMQE
FT                   RAGGALRVGHGVYRWTFDRLGGDWRVSALHIHIARMDVLGDARADAWRVAIQHALPYPW
FT                   VDAAVLRAAMVRLAAGEAGLGWLAAFGEPASA"
FT   gene            372875..373210
FT                   /locus_tag="RCFBP_10355"
FT   CDS_pept        372875..373210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10355"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10355"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41665"
FT                   /db_xref="InterPro:IPR009957"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41665.1"
FT                   /translation="MREPNCSPQLLAFVRQRQLIAQLATPAGKTGKHVKAPAATVQQLD
FT                   IVSGLICETAEAACAQLLNVSAGLAGILQLLDLRSERSAECHSLHCLLAPLKGQLDRAL
FT                   NDVQKML"
FT   gene            373207..373407
FT                   /locus_tag="RCFBP_10356"
FT   CDS_pept        373207..373407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10356"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10356"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41666"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41666.1"
FT                   /translation="MRADVEHRALGTCSRQAFHPLGITCLAVVGNYPESLFAVCVLPVD
FT                   GAGTTCGLANRSWGVPSDPST"
FT   gene            373788..373946
FT                   /locus_tag="RCFBP_10357"
FT   CDS_pept        373788..373946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10357"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10357"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41667"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41667.1"
FT                   /translation="MEQDVVQPITSLGATSVAEDIDADLFALITPILTMTGQGAVADVV
FT                   DGSANQL"
FT   gene            374319..374492
FT                   /locus_tag="RCFBP_10358"
FT   CDS_pept        374319..374492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10358"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10358"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41668"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41668.1"
FT                   /translation="MNGFVVERQELYQASAGAVEIPTITLLGSLDDSQGTTDLSLTAVS
FT                   SKPIFAIIYNGI"
FT   gene            complement(374473..374823)
FT                   /locus_tag="RCFBP_10359"
FT   CDS_pept        complement(374473..374823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10359"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10359"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41669"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41669.1"
FT                   /translation="MTGFALDPAQADIEARTGGDVAHVGFDNRRRFALDIRPDALRRRG
FT                   RTRRVRIGQLQCAPIHFAVGRVAFGNPYASIHSGPFFDFSKMTERRRLVPALNGHQKYA
FT                   RSRCPKIRSRYR"
FT   gene            374835..375779
FT                   /locus_tag="RCFBP_10360"
FT   CDS_pept        374835..375779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10360"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10360"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41670"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41670.1"
FT                   /translation="MRDGLSRNLKSIFAGEEAAIVTDDWRLAEWLAARDVPAMTFDEID
FT                   AGDIDVPTRALAVPLDWDRVPSRQTLRDKWSATSVLWLPLASFSSDLDTAKYSVEMFSE
FT                   VDVSQSVAMNRRVITRLLMAHEEITMTGPDTALKVRLPDTLHAVGRTRVALLDDEHSTL
FT                   GNYFEVGMSPTDMAGRIDASMSVSGVVRVDAVLVAKHREMRRESASSFWAAADVAEALR
FT                   KVCPFQVTIEDNRIVDGFGEWAKAIHTLSGPQYHYALTEVAIGTGALPLGRVEWGLNSV
FT                   LNEGATGIHIGVGNGLNGIHFDFISTEARLDGI"
FT   gene            375766..376119
FT                   /locus_tag="RCFBP_10361"
FT   CDS_pept        375766..376119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10361"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10361"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41671"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41671.1"
FT                   /translation="MTASDAYAHVAGESSRATIRLASSIHLREEPDGGALVVDDRTLTA
FT                   ARINRSAHVLFQALGRPCTLGDLVGIFADAVKCPVGEAFTPVVKLVEEAARLGWLEVQD
FT                   GMLDNGISGAAGF"
FT   gene            376525..376995
FT                   /locus_tag="RCFBP_10362"
FT   CDS_pept        376525..376995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10362"
FT                   /product="putative excisionase (DNA binding domain)"
FT                   /function="8 : DNA metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10362"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41672"
FT                   /db_xref="GOA:D8NM52"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41672.1"
FT                   /translation="MRTVDRIREVTPPPMTERELEMARVAQRCIMEALDHSRAAEITLT
FT                   TDQGEHPTVAVPPPALKLIGQLLGAMSEGRSIMLVPANREFTTVEAAHFLNVSRPFVIK
FT                   EIEEGRLHHRMVGTHRRIAFDDLAAYSKEMRAKQSAALDRMADNAEELGLDY"
FT   gene            376997..377590
FT                   /locus_tag="RCFBP_10363"
FT   CDS_pept        376997..377590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10363"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10363"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41673"
FT                   /db_xref="GOA:D8NM53"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41673.1"
FT                   /translation="MAGYARYTALLDACVLYPLAVADSLMSLATAGLFAAKWTRQIERE
FT                   WMAALEEQRPDLKGKLEVRRDYMREAIPDWEVSETGWVALVNSYELPDPDDRHVLAAAV
FT                   AGHADCIVTANLRDFPPEVLAAYGIEVVNPDRFIINQWDLEPLAAMAAFKCMRARWKRP
FT                   AATPEDFAQALERNGLAATDLPPVLVRSAGRVRG"
FT   gene            complement(377558..378385)
FT                   /locus_tag="RCFBP_10364"
FT   CDS_pept        complement(377558..378385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10364"
FT                   /product="putative ISRSO14-transposase orfB protein"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10364"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41674"
FT                   /db_xref="GOA:D8NM54"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41674.1"
FT                   /translation="MMTERAMGVTRACGLVGISRSLFHYESRRRVDDEALTGRMMAITA
FT                   QKRRYGYRRIHVLLQREGWLANHKRIWRLYSKAGLSVRKRRRKRIAAVERKPLPVPTGP
FT                   NQSWSMDFVSDGLAYGRRFRCLNVVDDYTRECVAIEVDTSLPGLRVKQVLERLKDMRGL
FT                   PASITVDNGPEFAGKVLDAWAYEAGVTLSFIRPGKPVENAYIESFNGRFRDECLNEHWF
FT                   VSMRHARQLIEEWRIEYNTERPHSSLGYMTPVQFAQGHEQKEFLTSDSTCASY"
FT   gene            complement(378421..378681)
FT                   /locus_tag="RCFBP_10365"
FT   CDS_pept        complement(378421..378681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10365"
FT                   /product="ISRSO14-transposase ORFA protein"
FT                   /function="17.3 : Transposon functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10365"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41675"
FT                   /db_xref="GOA:D8NLY8"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D8NLY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41675.1"
FT                   /translation="MKKRFTEEQIICVLKEAEAGLKPAELCRKHGISEATYYNWKAKFG
FT                   GMTVSEAQRLKELEQENNKLKRLLAESMLDNAALKDLLSRK"
FT   gene            complement(378876..378951)
FT                   /locus_tag="RCFBP_tRNA53"
FT   tRNA            complement(378876..378951)
FT                   /locus_tag="RCFBP_tRNA53"
FT                   /product="tRNA-Arg"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(379116..379283)
FT                   /locus_tag="RCFBP_10366"
FT   CDS_pept        complement(379116..379283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10366"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10366"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41676"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41676.1"
FT                   /translation="MVEPLTATIWTPPASITSIAGNAWGRDGGQEDLAMPPHWSEQTCP
FT                   RIFLANIARL"
FT   gene            379298..380182
FT                   /locus_tag="RCFBP_10367"
FT   CDS_pept        379298..380182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10367"
FT                   /product="putative membrane bound protein, weak cytochrome
FT                   c domains"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10367"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41677"
FT                   /db_xref="GOA:D8NM57"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41677.1"
FT                   /translation="MSDAQHDEHEPLIKTPKQLVIAVITAFAVPILVIILLANYVGLGV
FT                   KEGAGSSGMSEEAVNDRIKPVAQLELKDLNAPRVYKTGEQLYKEVCATCHAAGVAGAPK
FT                   FGDAASWASRLPQGLDGLTKVALAGKGGMPARGGTSPDDVSDYEIQRAIVYMANSGGGK
FT                   LQEPAAPAAGATAQASASAPQAAAEVAPATPAAAAPAPAVAAPAAAAPQAAAGDVGKKV
FT                   YDSTCQMCHAAGVAGAPKFGDKAAWAPRIAEGKAKMYDIALHGKGAMPPKGTYAGSDDD
FT                   VKAAVDYMAAAAK"
FT   gene            380355..380768
FT                   /locus_tag="RCFBP_10368"
FT   CDS_pept        380355..380768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10368"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10368"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41678"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41678.1"
FT                   /translation="MQHDRTMAACWMAVALTTAGSPVLAADNWVKLAPLADPAGTLYLD
FT                   QDSIERNTDGTVRATTRDAYDAPRKLSDGKAYQYDSRTSVYDCKNDRILPVSALLQDGQ
FT                   HSTVLAKAIDKPSWEAVVPRSEGEAILRAVCKK"
FT   gene            complement(380992..383976)
FT                   /locus_tag="RCFBP_10369"
FT   CDS_pept        complement(380992..383976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10369"
FT                   /product="Sensor protein"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10369"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41679"
FT                   /db_xref="GOA:D8NM59"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41679.1"
FT                   /translation="MMLRRAFAAPAHLWWRAGTALLLCAAAITLLTASDYTQADDATRA
FT                   LRQMGPPPAPSASARMARCAPAAAIVLWTLTMLSIRHMQLRREHRQRRHAEATLARQLD
FT                   FQHMLMESLPFPLAAQDAQHRYVAVNTAFCHLFGRPREAVLGRTPAHLGLACTRTAARV
FT                   QDIDRRAAAAGQDTREELTIMAADGSERCVLYWVAPLRQPDGQPAGTIASLIDVSEIRE
FT                   AQARAERQAQHLHGSIESLPALVCQFEMRPGTARSRMRYVAGSARETLGVQTGAAPFLL
FT                   PSPARLVHQDDHRRMHEAALQSAMQLTPLDQPFRHVGDDGSVRWLHAHARPRRESDGRT
FT                   VWTGYLRDITQERARADAQETARQAAESALHAKDRFLATMSHEIRTPMNGVLGLVELLL
FT                   QTPLEREQQRMVTLMQESSRALLHILDDILDYAKIEAGHLSVTPTQTDLRELFDSTVGL
FT                   LASRAHERSLSVRVEVDATVPATVSVDGMRLRQVLSNLLSNAIKFTERGSVHLSAACVG
FT                   TAADTAHLIIRIADTGIGIAPEAQATLFTPFVQADNPAARRHGGTGLGLAISRQLARLM
FT                   GGSLDMDSKPGVGTTLTLRLEAPVISARYRLPHLTGATVHVDVDDAACRRGLEQFAAAA
FT                   GLQVVRGGPAALTLMDSARAPADAPRVIPVTGEAPYARTGRNTQGPDTLSTNPLSWRAF
FT                   MQACDAVFAHLPGDSATARMPVSSSAPPPTSATETLGAHILVAEDHPINRELLAKQLRL
FT                   LGYRVTLAEDGAAALQRLSEARFDALLTDCCMPRLNGFELARRIRQREQHTPGGPRLAI
FT                   LAITATTLAEEHARCRAVGMDDCVLKPTTLATLQEALSRLWHIEVRPDPPEALAVAPGN
FT                   ALAFRLDDLHRTLGDGPATISLVRVFATTLEDDARQLSALLATADRPALRKWTHRTGGA
FT                   LALLQHAAIDAELSAFRHAVQGADNSDSADLQDAGTRMTQLLAHLQDVMRLAETTSLGT
FT                   APTHQ"
FT   gene            complement(383991..384659)
FT                   /locus_tag="RCFBP_10370"
FT   CDS_pept        complement(383991..384659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10370"
FT                   /product="putative two component transcriptional regulator,
FT                   LuxR family"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10370"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41680"
FT                   /db_xref="GOA:D8NM60"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41680.1"
FT                   /translation="MQAPVRLAIADDHPGVVVAVRHLVCHLDGLEVVGDADSADALLSL
FT                   LERVRCDMVITDYAMPASRYGDGIALLEFLRRRHPELRIVVLTMLETRAVVDRMLRAGI
FT                   RVIASKADGPQHIVESVHAALDGRRYLSPRFEASLAGEGPGHAAADHDAIERLGKRELE
FT                   VLRMYVGGETVSEIARRLNRSVKTISAQKQKSMRKLRLATEAALFDFAARHGLLGATER
FT                   "
FT   gene            384686..384859
FT                   /locus_tag="RCFBP_10371"
FT   CDS_pept        384686..384859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10371"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10371"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41681"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41681.1"
FT                   /translation="MCGNPFAAESGKHRATGTTGISENSDSWRLDVRCVVVPAGVRGTM
FT                   STHLLPAFCFRP"
FT   gene            384868..386019
FT                   /locus_tag="RCFBP_10372"
FT   CDS_pept        384868..386019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10372"
FT                   /product="cation efflux protein"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10372"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41682"
FT                   /db_xref="GOA:D8NM62"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41682.1"
FT                   /translation="MPPAIPADIRRQHAERTTLVSAAVNCALSAGQIAAGLWSHSQGLV
FT                   ADGLHTLSDLIADGIVFIANRNSHKGPDEDHQYGHARYENAASLGLGLLLLAAGAGMIW
FT                   AALESLRAPHGPASVHGLALWVALTALAAKEGLFRYMLAVARRIGSRMLIANAWHARSD
FT                   AVSSLVAAVGVAGNLMGFRWLDPVAACVVGAMIGRVGIRFSWEALNDLMDRALPPSQVQ
FT                   AIHASLAATPGVINVHDLRTRVTGDQALVDAHIEVDPRVSVSEGHAIAVRARANVLAAH
FT                   TAMAVLDVQIHVDPRERVYTDPLPLPDRDALCAVLARALPPGTPLDAQHCLLHYVDGGV
FT                   DVDLVLSPSLVDHAAQVAEIVGARWHGLVRLRVLTAAPGAAAA"
FT   gene            complement(386034..387290)
FT                   /locus_tag="RCFBP_10373"
FT   CDS_pept        complement(386034..387290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10373"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10373"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41683"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41683.1"
FT                   /translation="MTPSAFLSRRRPALAALAALAALAALAALAALAVLPLPTPAVAAG
FT                   HGEGDLRRFMHGIGAVPAAATGTMNVFFSSSGLPPRGPDRNGNWPHDVYVAQWHADSGV
FT                   LDAPRLFIRKPEAQEPVSVARNRAGQVMVSFEDGWNAPENVTQRFGIYDTALRPIRPYP
FT                   QQVESGGHSGHVAAVGERFVVFYSDGWVDGGGVDNLGSGNGVYAKVYDGHGHQLRDLDI
FT                   AHARREWWPMIAGGDTRALLAWQQFVPGRTDANLKIAVLDPASGHVIGERVLREQLQYY
FT                   TYGVAWLPSIERFLLVGTAQGHGFAELIDNDGKVRASIPCMPASVREAAIAVSGRTAYT
FT                   PTADGRLLQLQAGPDTLTLAGTLMDTNGQPANWRPIGSIGLVRTSGTLDWLSLTEKGLE
FT                   QLRFDPAKAQPANAVDQCR"
FT   gene            387668..387769
FT                   /locus_tag="RCFBP_10374"
FT   CDS_pept        387668..387769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10374"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10374"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41684"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41684.1"
FT                   /translation="MAALADAIWAQRAAYARLSAALETVPELMDESM"
FT   gene            387816..388049
FT                   /locus_tag="RCFBP_10375"
FT   CDS_pept        387816..388049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10375"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10375"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41685"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41685.1"
FT                   /translation="MRLRYCGSLDLEHLLRQPFAQLGRLVRDNATGEPLPPVEVAARAV
FT                   LLRAAGYEVMPMCAHHDRRGFCLGHPESDNAV"
FT   gene            388370..388795
FT                   /locus_tag="RCFBP_10376"
FT   CDS_pept        388370..388795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10376"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10376"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41686"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41686.1"
FT                   /translation="MKTKAYLSKQEIYDGAVRHLFGQGGAAILPRGGAAYHGQGGRCCP
FT                   IGNLIGVRDYTTSMESVPVRYILKPINEIPRYMDAGVTALRRALKKARIDVDDRDTVEL
FT                   LSKLQNAHDVFGIWEWKERLHSIARQFGLNGAVVDAF"
FT   gene            388848..389258
FT                   /locus_tag="RCFBP_10377"
FT   CDS_pept        388848..389258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10377"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10377"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41687"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41687.1"
FT                   /translation="MEGKGTFLAIEDLFERVRAHLLAQQCRSEDADGEPRYRGLGNRRC
FT                   GIGLLIDDAYYRTDIERLGVSLLRVPGNDPLSCALRQSGIDVDDDRVVELLIDLQDIHD
FT                   LQAIECWPAALEAVRHRLPLPCDAPASERRAH"
FT   gene            complement(389322..390038)
FT                   /gene="gstL"
FT                   /locus_tag="RCFBP_10378"
FT   CDS_pept        complement(389322..390038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gstL"
FT                   /locus_tag="RCFBP_10378"
FT                   /product="Glutathione s-transferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.5.1.18"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11327815, 9045797; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10378"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41688"
FT                   /db_xref="GOA:D8NM68"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41688.1"
FT                   /translation="MQTTLYYWPEIQGRGEFVRLALEQAGVRYVDLGREDATAIERFLG
FT                   DAGLATPPFAPPFLVADKLVIPQTANILLYLGQHYGLAPQDEAGGLWTHGLQLTLADFV
FT                   VEIHDTHHPIAAGEYYEDQQDEARRRTADFLANRAPKFLWYFERVLARNPAGPTWAVRD
FT                   ALTYVDLSLFQIVAGLRYAFPRHMQRWEARLPHLVALHARVAALPRIAAYLQSPRRIPF
FT                   NTMGIFRHYPELDALT"
FT   gene            390202..391488
FT                   /locus_tag="RCFBP_10379"
FT   CDS_pept        390202..391488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10379"
FT                   /product="transport protein, MFS family"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10379"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41689"
FT                   /db_xref="GOA:D8NM69"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41689.1"
FT                   /translation="MNAPSSPPATPVPAAHVAHATMELADPARWLVRGSPGYRRANLAL
FT                   FAAGFSTFSLLYCVQPLMPLLGHDFGLSPAQTSLVLSATTMLLAFAILFAGLLSESIHR
FT                   KTLMGVSLVLSSALTLAAAVLPGWHGLLATRAVLGIVLGGVPAVAMAYLAEEVHPQGLG
FT                   MAMGLYVGGTAFGGMAGRVLTGMVADHAGWRFAMGFTGALCLLAALAFTWLLPPSRRFV
FT                   PRRGVALADLFDTLAEHLREPGLRALFAMAFLLMGGFVTIYNYASYRLLGAPYALSHSA
FT                   VGAIFMVYLLGIGASTWFGRLADRHGRGRVLLAGTAAMSAGVLMTLAMPLGLVIGGIAL
FT                   LTFGFFGAHAVASGWVGRRAKRAKGQAAALYLLAYYLGSSIAGTAGGKLYARWGWPGVV
FT                   ALVTAMLACALLSATWLWRRAPLPPGARR"
FT   gene            391594..393876
FT                   /locus_tag="RCFBP_10380"
FT   CDS_pept        391594..393876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10380"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10380"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41690"
FT                   /db_xref="GOA:D8NM70"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41690.1"
FT                   /translation="MRTLLWLLTRRLSPAVLLLMLLSLCFLPGTAGAAPVSFAKLAGLP
FT                   SGTGSASSPAATPAQTRASLDTVITLLDNDQQRTALIDALKQLRDGMAAQQTAQAQQAP
FT                   GLLGAVSSLIESGSLQADAEAGAPRYWLHRIEAADDNLSLLAAPERRLRVLADFAGTFA
FT                   VWAAIAGGLLGLGWGIRRVVGLKAGLGPQPTTRALFIDALRKIGPWAVSFAVLMRLGHE
FT                   ATAGFVLAVVLAYASVWGAIVTAAVAMLFSLFAGSAHRRVAVAFLLRRGMWPIFVAASL
FT                   GACGDALVDPRVALVLGGALSLLLATVCNVASSLMLAVGALCLRRPIGQLIANRSFEQR
FT                   TGQHAGNQFRRAVAVLWPVPVVVLAGATVLATLALPDNVDVVSRRAVMTSLLLAAAFLL
FT                   SAVVRPRAHWRMHVRFGRTSPYFERLKHFFAALVQLAIWAAFFELVTRVWGHTLVEVLH
FT                   SSVNGRRIADALVGLIGTVFSTWLAWILLDTAILQALSPAAGRARLQPSTRARTILPLL
FT                   RNGLKVTLVVAAGIGVLSNLGVNVTPLVAGAGVVGLAVGFGAQSLAQDLITGIFILMED
FT                   TISVGDTVDVGVAAGTVISLTIRTVRLRDGVGAIHSIPFSQIKTVRNLSRDYSFADFEV
FT                   RVAMDADPRQAIELVREAAAGTAGDARFERLLIGVPEVFGLDRFEGGAMIVKGRFKTRP
FT                   QKQADVLRAFNMVLKDGFDAAGVPLAMPGTVLRPSPAFEEWLARAGALPGDADRPPAAQ
FT                   PSPAAPA"
FT   gene            complement(393907..394641)
FT                   /locus_tag="RCFBP_10381"
FT   CDS_pept        complement(393907..394641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10381"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10381"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41691"
FT                   /db_xref="GOA:D8NM71"
FT                   /db_xref="InterPro:IPR032307"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41691.1"
FT                   /translation="MTDLSRPPLSAHPVATKRPARGEHAANHRATAVRWLRKTHGWFGL
FT                   WGAVMGLIFGVSGIWLNHRAVMKLPVAQQKTGSQVALADPVPATPDAMGAWLQQALGMP
FT                   EPPRRVRVKPAQPVPWAERADKGEAGRNAPAAKPLMQPEQWTFDFDSAVTQVQVDYWAG
FT                   NRSASVRQTDNGILGTLISLHLGRGMTVPWILLVDTLAGCLIFLSLSGLALWVLTTKRR
FT                   TVGWTIFGLGSLLAVGLAAARL"
FT   gene            complement(395030..395815)
FT                   /locus_tag="RCFBP_10382"
FT   CDS_pept        complement(395030..395815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10382"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10382"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41692"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41692.1"
FT                   /translation="MRKRLSISCLALLPGIWLSPSQVLAAESSYSLSLNAGVAPRYQGS
FT                   KQYAVTVMPGLRAEFGNGFFIDPTRGGAGYAMHFANGMFASAAVSYDPGRADESRYGRP
FT                   GSDDLRGMGSVKGSLLGAFTVGGRIVGETTASATLEVPISNRDRGWSAHVDVAAPVYSW
FT                   GANKITVSPSLSFGSRKYMQTYFGVTPQQAADSGFAPYTADSGLQAASLTVAWKHTFSR
FT                   NWAMQAAVGTTRLLGNAAKSPIVQNKQSYFGGTGIVYTF"
FT   gene            395993..396724
FT                   /locus_tag="RCFBP_10383"
FT   CDS_pept        395993..396724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10383"
FT                   /product="Transcriptional regulatory protein"
FT                   /function="12 : Regulatory functions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10383"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41693"
FT                   /db_xref="GOA:D8NM73"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41693.1"
FT                   /translation="MVEAPLKTKVLLIEDDDRLAQLVSEYLGNYEFTVEVVRRGDTAVA
FT                   AVREHQPALVILDLMLPHMDGMEVCRRIRAFSRVPVLILTARVDTYDQVAGLEIGADDY
FT                   VLKPVEPRLLVARARALLRRVVPAMPAAEPVVPHDDVLVFGELAISPPNRTVIWRGQPV
FT                   DLKTAEFNLLLILARAAGTVLSRDDILKQLRGIEFDGLDRTVDSGISRLRRRFGDASPE
FT                   PHKIKTIWGRGYLFSPSAWEE"
FT   gene            396731..398026
FT                   /locus_tag="RCFBP_10384"
FT   CDS_pept        396731..398026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10384"
FT                   /product="Histidine kinase, sensor protein"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10384"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41694"
FT                   /db_xref="GOA:D8NM74"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41694.1"
FT                   /translation="MLRSTLKLSLMMLVTGAIAVQVLSWSAGWLFHDTMTQGQREGRKG
FT                   YVFLLREYLDRFPGEARATAIQRLNDNATELFDMVGSDKVADLSTEQRRDLADGKLVVM
FT                   TNRMDYYLPLRDGTVLHAHFEDISYYTAIKVIAFCFIAIATLLPILFWSGLLWRDLRAL
FT                   EEAARGFGGGVLSTRAHLRRGSNVYALAHQFNDMAERIQDSIQHQREMMNGISHELKTP
FT                   IARLEFGIALLQSPVPEAQRKARLDALHSDVRELDELVTELLALSRLEQGATHLVLMHV
FT                   AVGEWLDSVVANIADDVADRQLTLAVHADFAPAHHVCDPRLVARALLNLIRNAMRYARH
FT                   TITVHAEANTHGRLCLTVEDDGPGIPIAERERVFEPFYRLDASRDRHTGGFGLGLAIVR
FT                   RIALVHGGEVRLDASGTGGARFVLSLPPMPTL"
FT   gene            complement(398046..398852)
FT                   /locus_tag="RCFBP_10385"
FT   CDS_pept        complement(398046..398852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10385"
FT                   /product="putative transcription regulator protein, AraC
FT                   family"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10385"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41695"
FT                   /db_xref="GOA:D8NM75"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41695.1"
FT                   /translation="MPAQRLLPTDIEGRIPPSPAHPVRLYTRQMQANSRFPRHTHAWAQ
FT                   VAYSHTGVLRVQAGDTAWVVPPSRAIWIPPGIVHEVWVVEAAFLRTLYIDPSVVTDALA
FT                   QCRVMEVSPLLRELIAAMDVRRPLAPAREQALATLILDELRRSAPLPLDLPMPADKRLR
FT                   ALCERVMADPGTPLTFDALAREVGASTRTLARRFRDELGVNFSQWRQQAVLASAIPLMS
FT                   QGLPLSRIAQELGYNSQSAFSAMFRRAFGQSPSTFLHRPGPEAEAA"
FT   gene            399208..400206
FT                   /locus_tag="RCFBP_10386"
FT   CDS_pept        399208..400206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10386"
FT                   /product="putative substrate-binding periplasmic (Pbp) abc
FT                   transporter protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10386"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41696"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41696.1"
FT                   /translation="MNAGARLYFDWLNLNGGINGETIRLVARDDEQKIEQTVRNVRDMA
FT                   RVDNPVALLTVVGTANVEALMREGVLAEARLPLVGPATGASSMTTDPLVFPIKASYQQE
FT                   IDKMITALVTIGVTRIGVLYQEDALGKEAITGVERTLKAHALAITAMASYPRNTANVGP
FT                   AVDKLLAADVQAIFLGATAEPAAQFVRQYRARGGEAQLLGLSSIDPGILQKVAGLDAVR
FT                   GYSLALVMPNPGKSVNPVIREFNRARAAVGAKDVDLSFRAVEGFVAAKVLAEAIRRAGP
FT                   KPTREQVRHALTELRDYDVGGGFTVDFTDRSRPGSHYIELGVVGPNGLVIQ"
FT   gene            complement(400371..401669)
FT                   /gene="citA"
FT                   /locus_tag="RCFBP_10387"
FT   CDS_pept        complement(400371..401669)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="RCFBP_10387"
FT                   /product="Citrate-proton symporter"
FT                   /function="6 : Energy metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1718953, 2999087, 2999088; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10387"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41697"
FT                   /db_xref="GOA:D8NM77"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41697.1"
FT                   /translation="MHTHNPNESKARAIFRVVSGNFLEMFDFMVYGYYAKAIADTFFPA
FT                   GNEFLSLMLSLMTFGAGFLMRPLGALILGAYIDRHGRRAGLILTLMLMACGTLLIAVVP
FT                   GYNTIGLAAPLLVLIGRLLQGFSAGGEPGGVSVYLSEIATPGRKGFFVSWQSGSQQVAV
FT                   MFASLLGVLLSSVLSPKSMGEWGWRVPFLIGCLIVPFLFFIRRSLRETEEFEQRKHRPT
FT                   LSEIFRSMGENWRLAGAGTLLAVMTTVAFYLITAYTPTFGRNVLHMSEFDSMIVTLCVG
FT                   ASNLFWLPVMGSLSDRIGRRPPLLVFSAVTLLTAYPAMMWLIGAPSFGRLLAVELWLSF
FT                   LYAGYNGAMIVTLTEIMPPALRTTGFSLAYSLATAIFGGFTPAIATGLIHATGNKAMPG
FT                   LWLSFAAICGLVATLIVVKQQPRAASLDPLLEP"
FT   gene            complement(402348..403637)
FT                   /gene="citA"
FT                   /locus_tag="RCFBP_10388"
FT   CDS_pept        complement(402348..403637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citA"
FT                   /locus_tag="RCFBP_10388"
FT                   /product="citrate transporter"
FT                   /function="6 : Energy metabolism"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1718953, 2999087, 2999088; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10388"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41698"
FT                   /db_xref="GOA:D8NM78"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41698.1"
FT                   /translation="MHTHNPNESKARSIFRVVSGNFLEMYDFMVYGYYAKAIADTFFPA
FT                   DNEFLSLMLSLVTFGVGFLMRPLGALILGAYIDRHGRRAGLIVTLGLMACGTLLIALVP
FT                   GYNTIGLAAPLLVLIGRLLQGFSAGVELGGVSVYLAEISTPGRKGFFVSWQSASQQVAV
FT                   MFAALLGVLLSFQLSPKEMGEWGWRVPFLVGCLIVPFLFIIRRSLQETEEFKQRKHRPA
FT                   LGEIFRSMGENWRLVGAGTLLVVMTTVSFYLITAYTPTFGKSVLHLSNLDSLIVTLCVG
FT                   ASNFFWLPVMGSVSDRIGRRPLLITFTALTLLTAYPAMQWLIAEPSFGRLLAVELWLSF
FT                   LYGSYNGAMVVTLTEIMPPAVRTTGFSLAYSLATAIFGGFTPAIATWLIHATGNKAMPG
FT                   LWLSFAAICGLVATLIVVKPAGRHVHTVTA"
FT   gene            complement(403645..404895)
FT                   /gene="manA"
FT                   /locus_tag="RCFBP_10389"
FT   CDS_pept        complement(403645..404895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="manA"
FT                   /locus_tag="RCFBP_10389"
FT                   /product="mannose-6-phosphate isomerase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number="5.3.1.8"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10389"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41699"
FT                   /db_xref="GOA:D8NM79"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41699.1"
FT                   /translation="MTVPAPMLPSFSTSVLPGTIELPDAAAALEAFVRHYDDVLLPMWL
FT                   GPGWNAQAGLCYEALVAEGDRLVPASTSRYRAMACARQLYTFARATVLSPRHAAVCAER
FT                   AAALCHALDTRFRDTIHGGWLFAIDSALAPQDTTKDLYTHAFVLFAAAHWLAVSEDPRA
FT                   AALMEEAHDVISRRFAHEGAVPLPVAAMEGTFAVPQAGVAQNPVMHLTEAYLAAAALPD
FT                   APAWAEAGVHALAEGMAARFIDARTGCIAELPVDRADTDNRIEPGHQFEWFYLVRAHAD
FT                   VFARPEAGQQLADTLGRAVDTACRQGVRADTQGVCLSLELDGSVRDASQRIWAQTEYGR
FT                   ALSLCSETHGTLLASMLSLWSARFLHERGWHEVIDATGQCLRADMPSSTPYHITTFYEA
FT                   VRAALAVRPIVVPQAVE"
FT   gene            405091..406698
FT                   /gene="opgD"
FT                   /locus_tag="RCFBP_10390"
FT   CDS_pept        405091..406698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opgD"
FT                   /locus_tag="RCFBP_10390"
FT                   /product="Glucans biosynthesis protein D 1 precursor"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15175282; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10390"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41700"
FT                   /db_xref="GOA:D8NM80"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023724"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41700.1"
FT                   /translation="MHRRDLLKQLAAGFLALASGLTPTVTPAVSLASASTEPFDEARLR
FT                   QRARALAARPYHPRNAVLPPPLARLGWDAYQSIGYRADHALWAGQRLPFEARFFHLGLF
FT                   FKSPVRMHEVVDGQSRVIAYDPAMFDYGKSGLDHAALPADLGFAGFRLTTRADPTRDVA
FT                   AFLGASYFRAVGGQWQYGMSARGLAIDTGLRRAEEFPDFTEFWLVRPAPQADTLRVYAL
FT                   LDSPSVAGVYRFDIRPGDTLAMDVQATLFVRKPIERLGIAPLTSMFLYGENDRTDRAGD
FT                   RRSAARRWRASDWRPEIHDSDGLAIWRGSGEWIWRPLANPPALRSQRFADDGPRGFGLL
FT                   QRDRNPDHYQDDGVFYEKRPSVWVEPLHGWGEGAVELVELSAADETFDNIVAFWRPAVA
FT                   PQAGQELAFGYRLSWGAQPPAASPLARVVATRTGIGGIVGQPRRYFSWRFVVDFAGGEL
FT                   GRLGGAAVEPVIRVSRGRVEIVSARPLASIDGVRAMFDLVPDADNAPIELRLTLQSADR
FT                   PLSETWAYQWTPPADRAV"
FT   gene            complement(406702..407316)
FT                   /locus_tag="RCFBP_10391"
FT   CDS_pept        complement(406702..407316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10391"
FT                   /product="conserved protein of unknown function,DUF1415"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10391"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41701"
FT                   /db_xref="InterPro:IPR009858"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41701.1"
FT                   /translation="MSSPEFVLLDAPADALDLRPEAASELVGHVQRWLEDAVIGLNLCP
FT                   FAKAVHVKRQVRYAVSLATMDGDVLDHLRAEADMLRSRPASEIDTTLLIVPALADFFDF
FT                   NSLTERAEAQLARAGFEGELQLASFHPDFVFADADPDDIANATNRAPAPILHLLREDSI
FT                   ARATAAVPDAADIYERNIATMERLGPEGWAAMAARFTPRRS"
FT   gene            407533..407904
FT                   /locus_tag="RCFBP_10392"
FT   CDS_pept        407533..407904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10392"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10392"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41702"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41702.1"
FT                   /translation="MIESRPLKTTLTLAAALAASAAFAQMTPAPETAPPTTGTMQAAPP
FT                   GQGPITSSTDPLVQKRIDDKAARDEYKARKAQARAGYRDEMKAAKANRKAEKQEAGTKR
FT                   KEEMMKQGGPAPAPGSGGE"
FT   gene            complement(407980..409476)
FT                   /gene="glpK"
FT                   /locus_tag="RCFBP_10393"
FT   CDS_pept        complement(407980..409476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpK"
FT                   /locus_tag="RCFBP_10393"
FT                   /product="Glycerol kinase (ATP:glycerol
FT                   3-phosphotransferase)"
FT                   /function="6.11 : Sugars"
FT                   /EC_number="2.7.1.30"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2826434, 9141691; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10393"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41703"
FT                   /db_xref="GOA:D8NM83"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41703.1"
FT                   /translation="MEYLLALDQGTSSSRAIVFNRAGQIVASAQQEFPQHFPQPGWVEH
FT                   DPLDIWNSQLATCRAALEQAKLSAADMAALGITNQRETTVVWERATGRPIFNAIVWQDR
FT                   RTEAICERLRAEGLENEVRKRTGLVIDPYFSGTKLRWILDHVDGARERAARGELAFGTI
FT                   DSWLVWQLTRGRLHVTDVSNASRTLLWNIHTGQWDAELMRALDIHPSLLPEVHPSAHRF
FT                   GQTDADWLGAPLTIGGIAGDQQSALFGQACFKPGMAKNTYGTGCFMLLNTGERAVESHN
FT                   GLISTAACQSGAKRSYALEGSVFVGGAVVQWLRDGLRAIQRSADVEGLAASVPDSGGVV
FT                   FVPSFTGLGAPYWDPNAQGAIVGLSRGTTIGHIARAALESIAFQSTALLQAMTRDAVSA
FT                   ISELRVDGGASANNLLLQFQADLLGIPVVRPEIIETTALGAAYLAGIATGFYRGEDEVA
FT                   QQWRASRTFHPVISRDEAQHRMAQWETAVAQVRLPTTHGR"
FT   gene            complement(409648..411384)
FT                   /locus_tag="RCFBP_10394"
FT   CDS_pept        complement(409648..411384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10394"
FT                   /product="putative ABC-type sugar transporter, probable
FT                   sugar binding precursor"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10394"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41704"
FT                   /db_xref="GOA:D8NM84"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR014597"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41704.1"
FT                   /translation="MKTSWRMTLRISAIALASALAAGAAHAGEAEAKKWVTTEFQPSTL
FT                   SQDKQMAEMKWFIDAAAKLKARGVTEIHVVSETLDVHAYESKTLAKAFEEITGIKVKHD
FT                   IMQEGDVVEKLQTSMQSGKSIYDGWISDSDLIGTHYRYGVVMPLSDYMAGEGKEFTNPG
FT                   LDLKDFIGTSFTTASDGKLYQLPDQQFANLYWFRADWFARKDLQDKFKAKYGYDLGVPV
FT                   NWTAYEDIANFFTNDVKELDGKRVYGHMDYGKKDPSLGWRFTDAWLSMAGSADKGIPNG
FT                   LPVDEWGIRVDGCAPVGASVARGGATNSPAAVYALTKYIDWMKKYAPPEATGMTFNEAG
FT                   PVPAQGHIAQQVFWYSAFTAPMTKPGPVVNTDGSPKWRMAPSPHGPYWKDGMQNGYQDV
FT                   GSWTFFKSTPFERRSAAWLYAQFVTSKTVSLKKSVTGLTFIRDSDIHSDYFTKNAAKYG
FT                   GLIEFYRSPARVAWTPTGNNVPDYPKLAQLWWKNVATAVTGEKTAQGAMDNLAKEMDQV
FT                   MGRLQRAGMKNCAPRLNPEGDPAKWLSADHAPWKKLDNERPKGETVAYDKLLAAWKEGR
FT                   VR"
FT   gene            complement(411555..411836)
FT                   /locus_tag="RCFBP_10395"
FT   CDS_pept        complement(411555..411836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10395"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10395"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41705"
FT                   /db_xref="GOA:D8NM85"
FT                   /db_xref="InterPro:IPR018678"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41705.1"
FT                   /translation="MFSWMAWTPEVAIFFGCIALMLAGMTVWEVTRPTVERKGWLPIAT
FT                   TRGDRLFIGLLTAAYINLAWVGLASEETGAWGGFIASMVVLVLILWRG"
FT   gene            complement(411859..412701)
FT                   /locus_tag="RCFBP_10396"
FT   CDS_pept        complement(411859..412701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10396"
FT                   /product="putative sugar ABC transporter permease"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10396"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41706"
FT                   /db_xref="GOA:D8NM86"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41706.1"
FT                   /translation="MPNQNGPKSRNERQRRITRAITLIVYVALAVLPLYWMLSMSLKTN
FT                   EETLAGFSIWPKLVTFDNYKVIFTDPSWYWGYINSIVYVTMNTVLSTVVALPAAYAFSR
FT                   YRFLGDKHLFFWLLTNRMTPPAVFLLPFFQLYSTVGLMDTHLGVALAHMLFNVPLAVWI
FT                   LEGFMSGIPREIDETAYIDGYSFPAFFLKIFLPLIKAGVGVTAFFCFMFSWVELLLART
FT                   LTSVDAKPITAVMTRTVSASGMDWGVLAAAGVLTIIPGALVIWFVRNYIAKGFAMGRV"
FT   gene            complement(412694..413584)
FT                   /locus_tag="RCFBP_10397"
FT   CDS_pept        complement(412694..413584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10397"
FT                   /product="putative ABC transporter permease"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10397"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41707"
FT                   /db_xref="GOA:D8NM87"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41707.1"
FT                   /translation="MNKPLNNKAWFLILPVFLCVAFSAILPLMTVVNYSVQDIISPEQH
FT                   VFVGVDWFRQILRDSDLQDALTRQLIFSLCVLAVEIPLGIGLALAMPSKGWKASAALVV
FT                   LAMPLLIPWNVVGTIWQIFGRSDIGLAGYWLNRMGVDYNYTSHSFDAWITVLIMDVWHW
FT                   TPLVALLAYAGLRSIPDAFYQAAEIDGASRLAVFRYIQLPKMRGVLMIGVLLRFMDSFM
FT                   IYTEPFVLTGGGPGNATTFLSQYLTQKAVGQFDLGPAAAFSIVYFLIILLFCFVLYNWM
FT                   QRLGSASAAVGDDHA"
FT   gene            complement(413581..414678)
FT                   /gene="ugpC"
FT                   /locus_tag="RCFBP_10398"
FT   CDS_pept        complement(413581..414678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="RCFBP_10398"
FT                   /product="sn-glycerol-3-phosphate transport ATP-binding
FT                   protein"
FT                   /function="3.1 : Biosynthesis"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3062310, 6408060, 8407831; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10398"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41708"
FT                   /db_xref="GOA:D8NM88"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41708.1"
FT                   /translation="MARIEFRNLGHSYRPDPQTLSDYALQPMNMTWRDGGAYALLGPSG
FT                   CGKSTLLNIISGLLTPSEGQVLFDGQDVTHANPRERNIAQVFQFPVIYDTMTVFDNLAF
FT                   PLRNRKVPQAEVRQRVEEVAEILELQHALKRRASGLAADAKQKISLGRGLVRKDVAAIL
FT                   FDEPLTVIDPHLKWQLRRQLKKIHQQLKLTLIYVTHDQVEALTFADEVVVMTEGQVVQQ
FT                   GGPEALFERPDHTFVGYFIGSPGMNLYPVAIDGDVIALGGQRLSVGRDTLAALKAGSGP
FT                   LKLGIRPEFVRLAAPGEVGTLAATVHQVQQLGTHQLLTASLGESGDLPIKAKLPNDVAV
FT                   TGPRVWLRLDAPQTLYYRNDERIGR"
FT   gene            complement(414665..415792)
FT                   /gene="ugpC"
FT                   /locus_tag="RCFBP_10399"
FT   CDS_pept        complement(414665..415792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ugpC"
FT                   /locus_tag="RCFBP_10399"
FT                   /product="sn-glycerol-3-phosphate transport ATP-binding
FT                   protein"
FT                   /function="3.1 : Biosynthesis"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3062310, 6408060, 8407831; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10399"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41709"
FT                   /db_xref="GOA:D8NM89"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41709.1"
FT                   /translation="MLELDQVTAAVGAQTHLYSTSVRLAPGAINVLLGPTQAGKTTLMR
FT                   IMAGLDRPTTGRVLVDGKDVTGVGVRDRNLAMVYQQFINYPAMTVYDNIASPLRLQGTA
FT                   RDEIDARVRTVAAKLHIDHLLQRLPAALSGGQQQRCALARALVKRAPLVLLDEPLVNLD
FT                   YKLREELRAELASLFADGGTTVVYATTEPQEALLLGGHTIVMHEGRVLQSGPTLQMYDV
FT                   PVSVDAAAIFNDPPMNVFHATVVEGNHIRLQDWNNPGIDVPWARPLPMHAGTRCRVGLR
FT                   PSHIRLATRTSRCVALPGLVELAELSGSETYLHLRAHAPGEPGSIGLVAQLPGVHEFEL
FT                   GAALDVFVDPAELFLFDDAGKLVSAPKQGDVHGAH"
FT   gene            complement(415840..417417)
FT                   /gene="glpD"
FT                   /locus_tag="RCFBP_10400"
FT   CDS_pept        complement(415840..417417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpD"
FT                   /locus_tag="RCFBP_10400"
FT                   /product="Glycerol-3-phosphate dehydrogenase"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.1.5.3"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11955283, 1987111, 8157588; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10400"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41710"
FT                   /db_xref="GOA:D8NM90"
FT                   /db_xref="InterPro:IPR000447"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR031656"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR038299"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41710.1"
FT                   /translation="MHHTDTSHLDCDLLVVGGGINGVGIARDAVGRGLSVVLCEKDDLA
FT                   QHTSSASTKLIHGGLRYLEYYEFNLVRKALQEREVLLRMAPHIMWPLRFVMPHDRSQRP
FT                   AWMIRAGLFLYDHLARRRFLPGSEAVRLAQHPAGRPLKPGLTRGFVYSDGWVDDARLVV
FT                   LNARDAADRGARILTRTRCLHAERRADGWHASLAGPEGIRAVRAKAIVNAAGPWAAEFA
FT                   RAAHALPDTRGLRLIKGSHIIVRRMFDHPFAYIFQNPDGRIVFAIPYQDDFTLIGTTDL
FT                   EYTGTLDRVAIDAGEIDYLCEMANRYFAQQLTPADVVWSYSGVRPLLDDSAASASAITR
FT                   DYLVECETGADGRAAPLINVWGGKITTYRKLAEEALDQLAPHLPAAAGPSWTATAALPG
FT                   GDLEVPGQLVAQYTFADFVTRLQKRLPWLPPRLATRYAHQYGTRVTLLLAGATRLEDLG
FT                   AEVTPGLYEAEIRYLIEHEWARTAQDILWRRTKLGLYADEADRSRLEGWLARRLPAAEA
FT                   DPVAQRAP"
FT   gene            417558..418322
FT                   /gene="glpR"
FT                   /locus_tag="RCFBP_10402"
FT   CDS_pept        417558..418322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpR"
FT                   /locus_tag="RCFBP_10402"
FT                   /product="Glycerol-3-phosphate regulon repressor, DeoR
FT                   family"
FT                   /function="6.3 : Anaerobic"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8752340, 8955387; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10402"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41711"
FT                   /db_xref="GOA:D8NM91"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41711.1"
FT                   /translation="MLPRHRQILEYVRQHGDASVDALARVLGVTTQTIRRDIRQLEDER
FT                   LLARYHGGVGLPSSVENIDYDQRQVLHIDAKRRIAQVVARHIEPGRSLIINIGTTTEEI
FT                   SKALVGRKGLRVITNNLNVASILSGSPDAEVIVAGGLVRNRDRGIVGEATIDFMKQFRV
FT                   DIGIIGVSSIDEDGTLLDYDYREVRVAQTIIEQSREVWLAADHSKFGRRAVVRLGHITQ
FT                   IDKFFTDLPVPEPLAEAFRAAEVDVVVASEAG"
FT   gene            418439..419296
FT                   /locus_tag="RCFBP_10404"
FT   CDS_pept        418439..419296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10404"
FT                   /product="conserved protein of unknown function, CHAD
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10404"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41712"
FT                   /db_xref="InterPro:IPR007899"
FT                   /db_xref="InterPro:IPR038186"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41712.1"
FT                   /translation="MSKRSPSRILSVFAGIVLEQIEALREALAKLAAPAPTDEDLHQYR
FT                   VSLRRLRSAWVTFAPVLPVALVAVWKPRLRELAVATGPVREWDVLLLDWLPAARAAVDP
FT                   ADTRSLNWLGRAATKASAARRRAWAALRTELVSPGLAAMLDALRDVIEPFHDEVPSSSL
FT                   RAFAHSRARVLRKKVLKRGRKPKHAPAAELHRARIAAKQWRYLYESFYPALGAHASKRR
FT                   CNHLRSLQDALGEIHDADASLARLAEAAGIEPPVAIAALFHARAEIARAHAARQLRWVR
FT                   ARSA"
FT   gene            complement(419745..419840)
FT                   /locus_tag="RCFBP_10405"
FT   CDS_pept        complement(419745..419840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10405"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10405"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41713"
FT                   /db_xref="UniProtKB/TrEMBL:D8NJH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41713.1"
FT                   /translation="MPPAFNLSQDQTLQFNLLFSLYYERSLTLRI"
FT   gene            419803..421326
FT                   /locus_tag="RCFBP_16s_rRNA_1"
FT   rRNA            419803..421326
FT                   /locus_tag="RCFBP_16s_rRNA_1"
FT                   /product="ribosomal RNA 16s_rRNA"
FT   gene            421391..421467
FT                   /locus_tag="RCFBP_tRNA2"
FT   tRNA            421391..421467
FT                   /locus_tag="RCFBP_tRNA2"
FT                   /product="tRNA-Ile"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            421500..421575
FT                   /locus_tag="RCFBP_tRNA3"
FT   tRNA            421500..421575
FT                   /locus_tag="RCFBP_tRNA3"
FT                   /product="tRNA-Ala"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            421831..424707
FT                   /locus_tag="RCFBP_23s_rRNA_1"
FT   rRNA            421831..424707
FT                   /locus_tag="RCFBP_23s_rRNA_1"
FT                   /product="ribosomal RNA 23s_rRNA"
FT   gene            424821..424932
FT                   /locus_tag="RCFBP_5s_rRNA_1"
FT   rRNA            424821..424932
FT                   /locus_tag="RCFBP_5s_rRNA_1"
FT                   /product="ribosomal RNA 5s_rRNA"
FT   gene            425109..425306
FT                   /locus_tag="RCFBP_10406"
FT   CDS_pept        425109..425306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10406"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10406"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41714"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41714.1"
FT                   /translation="MASNPLPRVGGHRLVVLRAFEGVPVRLHAYMLRSGPYGVGCVPHA
FT                   LQSVCQAGHRVEGALQAVIG"
FT   gene            425381..425465
FT                   /locus_tag="RCFBP_tRNA4"
FT   tRNA            425381..425465
FT                   /locus_tag="RCFBP_tRNA4"
FT                   /product="tRNA-Tyr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            425523..425596
FT                   /locus_tag="RCFBP_tRNA5"
FT   tRNA            425523..425596
FT                   /locus_tag="RCFBP_tRNA5"
FT                   /product="tRNA-Gly"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            425618..425692
FT                   /locus_tag="RCFBP_tRNA6"
FT   tRNA            425618..425692
FT                   /locus_tag="RCFBP_tRNA6"
FT                   /product="tRNA-Thr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            425736..426926
FT                   /gene="tufB"
FT                   /locus_tag="RCFBP_10407"
FT   CDS_pept        425736..426926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="RCFBP_10407"
FT                   /product="protein chain elongation factor EF-Tu"
FT                   /function="10.4 : Translation factors"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1542116, 6997043, 7021545; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10407"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41715"
FT                   /db_xref="GOA:D8NM95"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41715.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAK
FT                   KYDEIDAAPEEKARGITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIKGSAKLALEGDKGELGEVAIMNLADALDSYIPTPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRIERGVIKVGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLCKPGSIKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPEGKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            427013..427088
FT                   /locus_tag="RCFBP_tRNA7"
FT   tRNA            427013..427088
FT                   /locus_tag="RCFBP_tRNA7"
FT                   /product="tRNA-Trp"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            427148..427528
FT                   /gene="secE"
FT                   /locus_tag="RCFBP_10408"
FT   CDS_pept        427148..427528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="RCFBP_10408"
FT                   /product="preprotein translocase membrane subunit"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10348856, 10698927; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10408"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41716"
FT                   /db_xref="GOA:D8NM96"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41716.1"
FT                   /translation="MANPNVETVNPSSGKWLLVVAFLLVVAGVIGFYLLAQQPGYIRAA
FT                   SLIGGLALGAGVALVSAPGQGFLEFARESYREVRKVVWPTRKEAGQMTGLVFAFVVIMA
FT                   VFLWSADKLIEWVIFSLVLGWK"
FT   gene            427541..428125
FT                   /gene="nusG"
FT                   /locus_tag="RCFBP_10409"
FT   CDS_pept        427541..428125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="RCFBP_10409"
FT                   /product="transcription termination factor"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10383769, 9571053; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10409"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41717"
FT                   /db_xref="GOA:D8NM97"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41717.1"
FT                   /translation="MTDNTANDTASASSAPVSKQRWYVVHAYSGMEKSVQRSLQERIDR
FT                   AGLQHMFGRILVPSEEVVEMKGGHKAVTERRFFPGYVLVEMEMTDETWHLVKNTSKVTG
FT                   FVGGTGNRPTPISQREVDKIMTQIQEGVEKPRPKTLFEVGEMVRVKEGPFTDFNGNVEE
FT                   VNYEKSRLRVSVTIFGRATPVELEFGQVEKV"
FT   gene            428294..428725
FT                   /gene="rplK"
FT                   /locus_tag="RCFBP_10410"
FT   CDS_pept        428294..428725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="RCFBP_10410"
FT                   /product="50S ribosomal subunit protein L11, N-terminal
FT                   believed to regulate RelA"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11244072; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10410"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41718"
FT                   /db_xref="GOA:D8NM98"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41718.1"
FT                   /translation="MAKKIIGFIKLQIPAGKANPSPPVGPALGQRGLNIMEFCKAFNAQ
FT                   TQGMEPGLPVPVVITAFADKSFTFVMKSPPATVLIKKAAGVQKGSSKPHTDKVGKITRA
FT                   QAEEIAKAKNADLTAADLDAAVRTIAGSARSMGITVEGL"
FT   gene            428728..429423
FT                   /gene="rplA"
FT                   /locus_tag="RCFBP_10411"
FT   CDS_pept        428728..429423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="RCFBP_10411"
FT                   /product="50S ribosomal subunit protein L1, regulates
FT                   synthesis of L1 and L11"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3298242, 365581, 4018095, 7556101; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10411"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41719"
FT                   /db_xref="GOA:D8NM99"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41719.1"
FT                   /translation="MAKISKRVAANKAKVERTKFYPIDEALSLIKECASAKFDESIDVA
FT                   VQLGIDAKKSDQVVRGSVVLPAGTGKSVRVAVFAQGEKAEQAKAAGAEIVGMEDLAEQI
FT                   KAGKMDFDVVIASPDTMRVVGTLGQILGPRGLMPNPKVGTVTPDVATAVKNAKAGQVQF
FT                   RVDKAGIIHATIGRRSFESAALKSNLAALLDALNKAKPASSKGVYLRKIAVSSTMGVGV
FT                   RIDQATLAG"
FT   gene            429794..430300
FT                   /gene="rplJ"
FT                   /locus_tag="RCFBP_10412"
FT   CDS_pept        429794..430300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="RCFBP_10412"
FT                   /product="50S ribosomal subunit protein L10"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2448482, 377281, 782920; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10412"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41720"
FT                   /db_xref="GOA:D8NMA0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41720.1"
FT                   /translation="MALNLEDKKAVVAEVTAQVAKASSIVVAEYRGITVGDLTKLRAQA
FT                   RQQGVYLRVLKNTLARRAVEGTPFAELAEQMTGPLIYGISEDAVASAKVLNDFAKGNDK
FT                   LVLRAGSYDGKVLDAAGVKALASIPSREELLSQLLFVMQAPVSGFARALAALAEKKQSE
FT                   EGAAA"
FT   gene            430367..430741
FT                   /gene="rplL"
FT                   /locus_tag="RCFBP_10413"
FT   CDS_pept        430367..430741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="RCFBP_10413"
FT                   /product="50S ribosomal subunit protein L7/L12"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3309338, 377281; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10413"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41721"
FT                   /db_xref="GOA:D8NMA1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41721.1"
FT                   /translation="MAITKDDILEAVGAMSVMELNDLVKAFEEKFGVSAAAVAVAGPAG
FT                   GAAAPAAEEKTEFDVILKGAGANKVGVIKAVREITGLGLKEAKDLVDGAPKAVKEAMPK
FT                   ADADAAAKKLIEAGAEVEVK"
FT   gene            431189..435295
FT                   /gene="rpoB"
FT                   /locus_tag="RCFBP_10415"
FT   CDS_pept        431189..435295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="RCFBP_10415"
FT                   /product="RNA polymerase, beta subunit"
FT                   /function="9 : Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10834976, 6266829, 9893021; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10415"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41722"
FT                   /db_xref="GOA:D8NMA2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41722.1"
FT                   /translation="MAYSFTEKKRIRKSFAKRATVHQVPFLLATQIQSYAQFLQEHVSV
FT                   AQRKTEGLQAAFNAIFPIVSHNGLARMEFVSYHLSHPPFDVKECQQRGLTFHSALRAKV
FT                   RLIINDRENPTKVKEIKEQEVYMGEIPLMTSTGSFVINGTERVIVSQLHRSPGVFFEHD
FT                   KGKTHSSGKLLFSARIIPYRGSWLDFEFDPKDILYFRVDRRRKMPVTILLKSIGLTPEQ
FT                   ILAHFFVFDNFTLKSDGALMEFVPERLRGEVARFDISDKNGKVVIEKDKRINAKHIRDL
FT                   DAAGTKLISVPEDYLLGRVLAKNIVDPDTGEVLANANDELTEGVLEKLRDAGVKEIQTL
FT                   YTNDLDQGPYMSQTLRTDDTVDQTAARIAIYRMMRPGEPPTEDAVEALFQRLFYSEDSY
FT                   DLSRVGRMKVNSRLNRSEGIGPMVLTDDDILDTIKLLVNLRNGKGEVDDIDHLGNRRVR
FT                   CVGELAENQFRAGLSRVERAVKERLGQAETENLMPHDLINSKPISSAIREFFGSSQLSQ
FT                   FMDQTNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHPTHYGRVCPIETPEGPNIGLI
FT                   NSLALYAQLNDYGFLETPYRKVENSKLTDEVHYLSAIEEGKYVVAQANATVDKDGNLVD
FT                   ELVSAREGSERETRMVTPDRVQYIDVAPSQIVSAAASLVPFLEHDDANRALMGANMQRQ
FT                   AVPCLRADKPLVGTGIERTVAVDSGTAVQATRGGVVDYVDANRVVIRVNDDEAVAGEVG
FT                   VDIYNLIKYTRSNQNTNINQRPMVKVGDIVARGDVIADGASTDMGELALGQNMLVAFMP
FT                   WNGYNFEDSILISERVVAEDRYTSIHIEELSVVARDTKLGPEEITRDISNLAEAQLARL
FT                   DESGITYIGAEVEAGDVLVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGM
FT                   SGTVIDVQVFTREGVTRDKRAQSIIDEELKRYRLDLNDQLRIVEGDAFQRLERLLVGKV
FT                   ANGGPKKLSKGTALTKEYLADLDKWHWFDIRPSDEEVAAQLEAVKEAIEQKRHDFDLAF
FT                   EEKRKKLTQGDELPPGVIKMVKVYLAVKRRLQPGDKMAGRHGNKGVVSKITPIEDMPYM
FT                   ADGTPADIVLNPLGVPSRMNVGQILETHLGWAARGLGERIGNMLKAQAKAAEIRKLLGQ
FT                   IYNESGKVEDLDSLSDAEVLELAENLKKGVPFATPVFDGAHEDEIRRMLDLAYPADIAK
FT                   EKGLTASKQQVTLFDGRTGEAFERPVTLGVMHMLKLHHLVDDKMHARSTGPYSLVTQQP
FT                   LGGKAQFGGQRFGEMEVWALEAYGASYVLQEMLTVKSDDVNGRTKVYENIVKGEHSIDA
FT                   GMPESFNVLVKEIRSLGIDIDLERN"
FT   gene            435410..439639
FT                   /gene="rpoC"
FT                   /locus_tag="RCFBP_10416"
FT   CDS_pept        435410..439639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="RCFBP_10416"
FT                   /product="RNA polymerase, beta prime subunit"
FT                   /function="9 : Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6278450, 6287430; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10416"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41723"
FT                   /db_xref="GOA:D8NMA3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41723.1"
FT                   /translation="MKALLDLFRQVQQEEQFDAIKIGLASPEKIRSWSYGEVKKPETIN
FT                   YRTFKPERDGLFCAKIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRERMGH
FT                   IELAAPTAHIWFLKSLPSRLGMVLDMTLRDIERVLYFEAFVVVEPGMTPLKKSQIMSED
FT                   DYLAKCDEYGEGEFVALMGAEGIRELLRGIDIEKQIETIRAELQATGSEAKIKKFAKRL
FT                   KVLEAFQRSGIKPDWMIMEVLPVLPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRLK
FT                   RLLELKAPEIIVRNEKRMLQEAVDSLLDNGRRGKAMTGANKRPLKSLAEMIKGKGGRFR
FT                   QNLLGKRVDYSGRSVIVVGPTLKLHQCGLPKLMALELFKPFIFHKLETMGIATTIKAAK
FT                   KEVESQTPVVWDILEEVIREHPVMLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAF
FT                   NADFDGDQMAVHVPLSLEAQMEARTLMLASNNVLFPANGDPSIVPSQDVVLGLYYTTRD
FT                   KINGRGEGMTFADISEVIRAYENKEVELASRVNVRITEYDLVNPEAAGDARFAPKITLQ
FT                   ATTVGRAILSEILPKGLPFSVLNKPLKKKEISRLINTAFRKCGLRETVIFADKLLQSGF
FT                   RLATRAGISIAIDDMLVPPAKEKIISEAAAKVKEYDKQYMSGLVTDQERYNNVVDIWGA
FT                   AGDQVGKAMMEQLQTEDVVDRNGNTVKQESFNSIYMMADSGARGSAAQIRQLAGMRGLM
FT                   AKPDGSIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVTQD
FT                   LVVVEDDCGTSNGVAMKALVEGGEVIEALRDRILGRVVVNDVVNPETQETAIEAGTLLD
FT                   EDLVELIDAIGVDEVKVRTPLTCDTRYGLCAKCYGRDLGRGVLVNSGEAVGVIAAQSIG
FT                   EPGTQLTMRTFHIGGAASRAAVASSVEAKATGTVRFTATMRYVTNAKGEQIVISRSGEA
FT                   LITDDHGRERERHKIPYGATLLVHDGQAIKAGTQLATWDPLTRPIISEYSGTIKFENVE
FT                   EGVTVAKQMDEVTGLSTLVVIDAKRRTASTKGIRPQVKLLDSSGAEVKIPGTDHSVTIG
FT                   FQVGALITVKDGQQVHVGEVLARIPTESQKTRDITGGLPRVAELFEARSPKDAAVLAEV
FT                   TGTTSFGKDTKGKQRLVITDLDGNAHEFLIAKEKQVLVHDGQVVNKGEMIVEGPADPHD
FT                   ILRLKGVEELATYIVDEVQDVYRLQGVKINDKHIEVIVRQMLRRVQIVDVGDTKFIPGE
FT                   QVERSELLDENDRVIAESKRPATYENLLLGITKASLSTDSFISAASFQETTRVLTEAAI
FT                   MGKVDDLRGLKENVIVGRLIPAGTGLAYHRARKAKETADRDRAAAIAEEEAASIFETPA
FT                   VQQEGDA"
FT   gene            439853..441694
FT                   /locus_tag="RCFBP_10417"
FT   CDS_pept        439853..441694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10417"
FT                   /product="conserved secreted protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10417"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41724"
FT                   /db_xref="InterPro:IPR018671"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41724.1"
FT                   /translation="MKLTRKKIAIGAAALVAGAVVIAQLVWHPFGRTHALRARAVRLDL
FT                   TLPDALIDSQSLSQLPRDVLRVPLLRDVLTEDFVAYYEGNDDRLSVAGALRRLAYEQKL
FT                   DLAETVLKHVFDEPARVMLWRGPDDKLRYWVLSMQRNGLAKALEAVGTVAAGDAQLSKV
FT                   ADALGDSGAPVYALKLGSARSILIASKGDRLVALSEPGILLDKDGKPMAAQAKALGALL
FT                   SDDAGQRNAQGKVFALPAAEPAGHHVLVSANYLSFGYQQFFPGIEALRFDFGTGVSGNG
FT                   WKSAALIDPDRLAGKWDNAALWHALPADPAACATLPVDWKAAGALLRNVAGEAKAINEA
FT                   AARVGDAFTGPAAVCWYGKSSLVAPLFVARLASAQQGEAVKPALGALFGQIVGAYEAKA
FT                   QADKVDEGAGAYKRLPVTTRPGPASATLWQRPVSARYGTAQSAGAPFSAQLSADRYFPV
FT                   TLAVASDVVVFSPDARLVDDALAVLAKRFPAVADSLPRDKAGRIVLTMTPASLAPLIRR
FT                   EAGAALPAEQEAVFLTAAQTHLFPKLKALARYAPVSLALDGAAPSSRGWVPVTWLSSGR
FT                   GLPAGGDGTQPAAEATPDAASAEAAAAPASDDSTGTQ"
FT   gene            441691..442419
FT                   /locus_tag="RCFBP_10418"
FT   CDS_pept        441691..442419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10418"
FT                   /product="conserved exported protein of unknown function,
FT                   DUF1175"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10418"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41725"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009558"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41725.1"
FT                   /translation="MMPRTPAYMPMASPSRRRWLTAAAAGLLAQTFAPGARALSGWADA
FT                   AAAGPDALTPEQSAVFRAWFARIVNEQLRQGPTPRWTHRDCAGLVRFAAAEALRAHDAR
FT                   WLRANGMRDAESARQLPPELNLTPAQRTLTQRWTRIDGSTGAYVSALALIQQNSRFIAK
FT                   DVNQALPGDLLFFDQGDDQHLMIWMDRYIAYHTGTVTRTDTGLRAVPVSELMQWKDSRW
FT                   QPQGGNPNFIGVFRLAFLTR"
FT   gene            442338..447209
FT                   /locus_tag="RCFBP_10419"
FT   CDS_pept        442338..447209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10419"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10419"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41726"
FT                   /db_xref="GOA:D8NMA6"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41726.1"
FT                   /translation="MERLALAAAGRQSQLHRRVSSGLFDAIGKQMRNRWLSNLIAVICL
FT                   AALAAAVPAHADDAAAARDRPNPTLAEVPASGYAPFTGQPFFLLSDASYGTDQEALVRL
FT                   EAPGREYKDELARYGGADILVYRVPQPLEFLKAQKNLHRIDVKANYTGEGLANTLAYLW
FT                   DNWTRQARRAWQRVLSFATRSKAVEAAPQFSMGDQMAAPTRFSNNPQYAPLKGYELLGR
FT                   FRYPIWDAKPIAPPKDVKLEGSSSEWLPQNVGNVMIPVGKLPAGLYIVEAVIGAYRAHT
FT                   LLFVSDTVAVTKGTSQGMMAWTAERKSGKPVAGSTVNWTDGVGVLASGTTQADGTAELR
FT                   HVAPERSYVLGADRAGGVFISENFYYDSEIYNTKLYAFTDRPLYRPGDEVRVKFIGRNF
FT                   RNATESTAPAAGDIKLDVIDPTGSPVATATTRLSGETGADARFTLPSNAPAGGYTLRFD
FT                   YGGNTYGGAFRVAEYIKPHFDVNLSLDKAGYGTGEVIKGKISLRYPDGKPVKDGKVSVS
FT                   LRAQQVTMVEGELQYAGLFPVKLEQQELTTDGDGNAALTLPAAKEPSRYVVTVFANDGA
FT                   AYRVKVTRELLVARGATPYKLSSAANFTTPGQSVSFNLQPLPAVDGVRGAGAPPAKWEL
FT                   VRLESRTRTEGALQPDAKGSATFPVKFDQPGSYTLSVRDAAGNLLAASSHWVAGDGVQT
FT                   VPGNIEIVFDRDRYQVGDTAEALITFPLPVDDALLTLERDKVERHALLSGGGDWLSLQR
FT                   VTPSQYRARIKIGAEFSPNMTFSALYVRDGDMVFQNAGIVVTQPTLDLTVRADKAVYAP
FT                   GETVTLDLTSVLAGKPVPANLTVSVVDEMVYVLQPEVAPSIVDFFYHPRRNSVRTTSSQ
FT                   SFISYDLALSSLPGKPGGTYGRHNERGVKVLERPRRDEQDTAAWVANLQTGADGRARMT
FT                   FTMPDSLARWRVTVRAVSTTGAADGLVGQRTASIRSDKALYLKWTGPQHFRESDQPRLD
FT                   MVAFNQTDKDITADWIVSGAGLNINQRVTLKRGANYLHAPLSGPQALQPGVVNAELKQD
FT                   DKVSDRLQTTVKLDATGWLADRESIVPLTQLQGTRLPLGLPADARDVRLRVVGSTATQF
FT                   ARVADDLIEYPYGCAEQTASRLIPLALAQQSLAATGTRLPDGNPAGTQGVDALLRTQRQ
FT                   RLALLAGTNGTFGWWGELTTSSALITSYAYYADWLASRAVGISLPADNWKQVLEAYKRT
FT                   SPNEPLLHRALALWFANEMGLPVATPLSGVAAELTRNAKAPADAEPAPGDSLIFVAPDS
FT                   PRGRQVAMVLTAQLMRQIGQPVPEALVSADIAARTALANDTSPLVQSLLLMGGGRSAAD
FT                   PAPLLARASAAMPTMDRAVALVWLQKGLGGLQGANVATIQPALSAGGWQAVRSAVGVPT
FT                   WRWAGAQPPAALDLTAAPSDVTTQSAIVSYRSRAPEASRLPITVERKLYRLDPIAPAAP
FT                   KEDAKTPKRAAADAAANAGITFKAKPVKPGDTLDSNALYVDEIVLTPRQGAYRYGLVEV
FT                   PLPPGAEVEASTWGIQIDGLKGEPNEGNGPQPFERRAAYEMGQLSYNQPVPALERPTAL
FT                   RQLVRFSLPGRFVLPPARYFRMYQPEAKALQGDGKTASYPFKVE"
FT   gene            447244..448947
FT                   /locus_tag="RCFBP_10420"
FT   CDS_pept        447244..448947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10420"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10420"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41727"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR018748"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41727.1"
FT                   /translation="MLTGLVWAGGALASGQAVAAAPQAEPLRYAILQGGPEGDVAQLWQ
FT                   FRSDLAAGAELPPPVPLARDVETPLGSLWKLFVYSYLVSRRIPTPDYTCHGNDPEEVYC
FT                   CTAGQSIDRERALIQSCGRYFEPVRLGLDPADWRRFWQQAGSPAWLRDVRTLLPTRRVP
FT                   VADVLGALRSMPADGREAAAHTLVSVLTVGRGEGTVSHFGSLLRAKTWTMPDPQRPGAS
FT                   IGGAAGWLADGTPVWLGGSGASNRVLAAAAPRLMPLLAHLSVPDDDACVAVDFFARYPI
FT                   DAVRDAGGKPADAGRLDGRYAVRFVNGNTLPIESRGELALSRESGAPVITGHLGMNDYV
FT                   ARVVEREGDLAEPQAARALAVAARSYLVQHATRDKGCYRIADSSRAQRVLPRPPSAAAR
FT                   SAAAFTDALVLAGQPVQYHGTVSARGRMGWPDARAAAQRGLGFDAILAQWWPQATLTSF
FT                   RSPVAGDCLPVAGAQPWLRVQAPRWSVRLAAEPGYEAPSLPAVCAIREGRPYADARRNR
FT                   LYIQRFATEEDRIALAHEYLHLAFARHPRGQDEGFVEATARRLIRGEGLL"
FT   gene            448956..449747
FT                   /locus_tag="RCFBP_10421"
FT   CDS_pept        448956..449747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10421"
FT                   /product="conserved exported protein of unknown function,
FT                   UCP012281"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10421"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41728"
FT                   /db_xref="InterPro:IPR012039"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41728.1"
FT                   /translation="MTRIGAAGAAWLLAGAACAEPVADLDGPIGGWRHSGLTNELERYT
FT                   AAYPKPPVDRGAQKYRTLIAGRLRAAGTDRRPPVLVVNGNAMPLYGDSEGRFARPWAFG
FT                   PGSNSVEIVSPDGKTRQRLQFYEADATKTSAKLRAILTWDDPRAEVDMHVISPIGDHAF
FT                   WAQPLLSDGGGLDVDSVDGAGPEIFSTAAPRSGVWLFYVNYWGNFNAAGYNFDEKAHDR
FT                   DLITAQLTLIYNENTPSERREFVTVPLRKIGELALMKSIRF"
FT   gene            449769..450614
FT                   /locus_tag="RCFBP_10422"
FT   CDS_pept        449769..450614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10422"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10422"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41729"
FT                   /db_xref="InterPro:IPR012039"
FT                   /db_xref="InterPro:IPR019220"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41729.1"
FT                   /translation="MTLSPIRFAAALMLAAVGAPGSAFAQSDAGNIEMTAPLNGWRNSA
FT                   GDDSRYTQDVHYPAVSVATPQGQGAASMIAGRIRNTPKAAVPADGESRPRRRRGADGSS
FT                   VGTLVVNGVAMPQRIEADGTFSRPYAFGAGSNSVEVRTARGDAKRVQFYDTYAGRTRPR
FT                   LRVVLSWDTDGTDLDLHVISPDGQHAWYGNRVTANGGALDVDVTTGYGPEIYSNPAPLP
FT                   GTYLVYVNYYGSGNDSSVITTAQVTLITDENTPAERQQTFVMPMRKAGELTLVRTFTMK
FT                   "
FT   gene            450634..451224
FT                   /locus_tag="RCFBP_10423"
FT   CDS_pept        450634..451224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10423"
FT                   /product="Putative SAM dependent methyltransferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10423"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41730"
FT                   /db_xref="GOA:D8NMB0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41730.1"
FT                   /translation="MDTQTVAAYDTLADTFAREWREQPAPDDLYALLRRVFKAGGDTVD
FT                   IGCGAGREVAWLNANGYPAVGYDASAGLLEAARTQYPGLSFRRATLPELAGIADGAFDN
FT                   VVCETVIMHLPPAQIGAAVQRLLALLRPDGTLYLSWRVTPEADQRDGRGRLYTAFDAVG
FT                   VREALAGAQVLLDEAVVSQSSGKTIHRIVARQP"
FT   gene            451339..453252
FT                   /gene="recQ"
FT                   /locus_tag="RCFBP_10424"
FT   CDS_pept        451339..453252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recQ"
FT                   /locus_tag="RCFBP_10424"
FT                   /product="ATP-dependent DNA helicase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2164680, 3027506; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10424"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41731"
FT                   /db_xref="GOA:D8NMB1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41731.1"
FT                   /translation="MFDSPAIDHALDALPEDTAAATRAVLHDVFGYSAFRGPQADIVTH
FT                   VADGGDCLVLMPTGGGKSLCYQIPALVRHRRGQGAGIVVSPLIALMQDQVAALEEAGVR
FT                   AAYLNSALTGAEAARVERDLAAGRLDLVYVAPERLMTPRFLELLERSRIGLFAIDEAHC
FT                   VSQWGHDFRPEYIQLSVLHERFPHVPRIALTATADAVTRDEIVERLALGGERVFLSSFD
FT                   RPNIRYTIVEKDSARQQLLRFIRAEHLGEDGCDAGIVYCLSRKKVEETAQWLAEQGIRA
FT                   LPYHAGMDVETRARHQAIFRKEEGVVMVATIAFGMGIDKPDVRFVAHLDLPKSLEGYYQ
FT                   ETGRAGRDGLPANAWMAYGLADVVQQRRMIDESDADDVHKRVSTAKLDALLGLCESAGC
FT                   RRVALLAYFGESSQPCGNCDTCLSPPQTWDATREAQMALSCVYRVQQASRVSFGAGQLI
FT                   DILRGNATERVKQWHHETLSTFGVGNTLSEAAWRGVFRQLVAQGLLAVDHGGHGALVLT
FT                   DAARPVLKGEHCVTLRRQAEKVRAATASGTKTERRADPAADLSAEAQVRWQALRVWRAQ
FT                   TAREHSVPAYVIFHDSTLARIAESDPASREALAELPGIGVAKLDRYGQALLDVLAKCRG
FT                   ES"
FT   gene            453684..454061
FT                   /gene="rpsL"
FT                   /locus_tag="RCFBP_10425"
FT   CDS_pept        453684..454061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="RCFBP_10425"
FT                   /product="30S ribosomal subunit protein S12"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1552908; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10425"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41732"
FT                   /db_xref="GOA:D8NMB2"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41732.1"
FT                   /translation="MPTINQLVRKPRVSEKLKSKSPALENCPQRRGVCTRVYTTTPKKP
FT                   NSALRKVAKVRLTNGFEVISYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGSLDL
FT                   QGVKDRKQARSKYGAKRPKAA"
FT   gene            454249..454719
FT                   /gene="rpsG"
FT                   /locus_tag="RCFBP_10426"
FT   CDS_pept        454249..454719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="RCFBP_10426"
FT                   /product="30S ribosomal subunit protein S7, initiates
FT                   assembly"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10772857, 12244297; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10426"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41733"
FT                   /db_xref="GOA:D8NMB3"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41733.1"
FT                   /translation="MPRRREVPKREILPDPKFGNVEVAKFMNVLMLDGKKSVAERIVYG
FT                   AFDQIEKKAGKVPVEVFTLAINNIKPVVEVKSRRVGGANYQVPVEVRPSRRLALAMRWL
FT                   REAAKKRSEKSMALRLAGELLEASEGRGGAMKKRDEVHRMAEANKAFSHFRF"
FT   gene            454834..456939
FT                   /gene="fusA"
FT                   /locus_tag="RCFBP_10427"
FT   CDS_pept        454834..456939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fusA"
FT                   /locus_tag="RCFBP_10427"
FT                   /product="protein chain elongation factor EF-G,
FT                   GTP-binding"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2587224, 8070396, 8070397; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10427"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41734"
FT                   /db_xref="GOA:D8NMB4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41734.1"
FT                   /translation="MARKTPIERYRNIGISAHIDAGKTTTTERILFYTGVNHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWKGMGNNYPEHRINIIDTPGHVDFTIEVERSMR
FT                   VLDGACMVYCAVGGVQPQSETVWRQANKYGVPRLAFVNKMDRTGANFFKVYDQLRLRLK
FT                   ANPVPVVVPIGAEENFKGVIDLIKMKAIIWDEASQGTKFDYLDIPAELQATAEEWREKM
FT                   VEAAAESNEALMEKYLGGESLTEAEIVKALRDRTIACEIQPMLCGTAFKNKGVQRMLDA
FT                   VIDFLPSPVDIPPVKGELENGETAERRAADDEKFAALAFKIMTDPFVGQLIFFRVYSGV
FT                   VESGNTLLNATKDKKERLGRILQMHANQREEIKEVRAGDIAAAVGLKDATTGDTLCDPA
FT                   HPIVLERMVFPEPVISQAVEPKTKADQEKMGMALNRLAQEDPSFRVKTDEESGQTIISG
FT                   MGELHLEILVDRMKREFGVEATVGKPQVAYRETIRKSAADVEGKFVKQSGGRGQYGHAV
FT                   ITLEPQEQGKGFEFVDAIKGGVIPREFIPAVEKGIVDTLPSGVLAGFPVVDVKVTLTFG
FT                   SYHDVDSNENAFRMAGSMAFKEAMRKANPVLLEPMMAVEVETPEDYMGNVMGDLSGRRG
FT                   IIQGMDDMVGGGKIIKAEVPLSEMFGYSTSLRSATQGRATYTMEFKHYAEAPKNVAEAV
FT                   MAAKGTK"
FT   gene            457021..458211
FT                   /gene="tufB"
FT                   /locus_tag="RCFBP_10428"
FT   CDS_pept        457021..458211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tufB"
FT                   /locus_tag="RCFBP_10428"
FT                   /product="protein chain elongation factor EF-Tu"
FT                   /function="10.4 : Translation factors"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1542116, 6997043, 7021545; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10428"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41735"
FT                   /db_xref="GOA:D8NM95"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:D8NM95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41735.1"
FT                   /translation="MAKEKFERTKPHVNVGTIGHVDHGKTTLTAAIATVLSSKFGGEAK
FT                   KYDEIDAAPEEKARGITINTAHIEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLARQVGVPYIIVFLNKCDMVDDAELLELVEMEVRELLSKYDF
FT                   PGDDTPIIKGSAKLALEGDKGELGEVAIMNLADALDSYIPTPERAVDGTFLMPVEDVFS
FT                   ISGRGTVVTGRIERGVIKVGEEIEIVGIKATQKTTCTGVEMFRKLLDQGQAGDNVGILL
FT                   RGTKREDVERGQVLCKPGSIKPHTHFTGEVYILSKDEGGRHTPFFNNYRPQFYFRTTDV
FT                   TGSIELPEGKEMVMPGDNVSITVKLIAPIAMEEGLRFAIREGGRTVGAGVVAKIIE"
FT   gene            458318..458632
FT                   /gene="rpsJ"
FT                   /locus_tag="RCFBP_10429"
FT   CDS_pept        458318..458632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="RCFBP_10429"
FT                   /product="30S ribosomal subunit protein S10"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094780; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10429"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41736"
FT                   /db_xref="GOA:D8NMB6"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41736.1"
FT                   /translation="MQQNQKIRIRLKAFDYRLIDQSAAEIVETAKRTGAIVKGPVPLPT
FT                   RIQRFDVLRSPHVNKTSRDQFEIRTHQRLMDIVDPTDKTVDALMKLDLPAGVDVEIKLQ
FT                   "
FT   gene            458918..459580
FT                   /gene="rplC"
FT                   /locus_tag="RCFBP_10430"
FT   CDS_pept        458918..459580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="RCFBP_10430"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 365579; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10430"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41737"
FT                   /db_xref="GOA:D8NMB7"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41737.1"
FT                   /translation="MSLGLVGRKVGMTRVFTDDGDSIPVTVLEVGGNRVTQIKTDETDG
FT                   YTAVQVTFGSRRASRVTKPLAGHLAKAGVEAGEIIAEFRIDAAKAAELKLGDTIDVDLF
FT                   AAGQKIDVQGTTIGKGYAGTIKRYNFSSGRASHGNSRSHNVPGSIGMAQDPGRVFPGKR
FT                   MTGHMGDVTRTVQNLVIVRVDAERKLLLVKGAVPGAKSGFVVVSPAVKAKPQVAAAA"
FT   gene            459592..460212
FT                   /gene="rplD"
FT                   /locus_tag="RCFBP_10431"
FT   CDS_pept        459592..460212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="RCFBP_10431"
FT                   /product="50S ribosomal subunit protein L4, regulates
FT                   expression of S10 operon"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3298242; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10431"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41738"
FT                   /db_xref="GOA:D8NMB8"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41738.1"
FT                   /translation="MELKLLQADGQLGAGVAASPEVFGRDYNEALVHQIVVAYQANARS
FT                   GNRKQKDREEVKHTTKKPWRQKGTGRARAGMSSSPLWRGGGRIFPNSPEENFSQKVNKK
FT                   MYRAGMRSIYSQLAREGRINVVDGFGIEAPKTKLLADKFRAMGLDSVLVITDNMDENLY
FT                   LASRNLAHVFVVEARHVDPLSLVHYKKVLVTKAAVAQIEELLK"
FT   gene            460209..460523
FT                   /gene="rplW"
FT                   /locus_tag="RCFBP_10432"
FT   CDS_pept        460209..460523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="RCFBP_10432"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1960726, 3892488, 391594; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10432"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41739"
FT                   /db_xref="GOA:D8NMB9"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41739.1"
FT                   /translation="MTQVAKNDHRLMQVLLSPVVSEKATLVADKNEQVVFEVARDANKG
FT                   EVKAAVELLFKVEVESVQILNQKGKQKRFGRFMGRRDHVKKAYVSLKPGQEINFEAEAK
FT                   "
FT   gene            460526..461356
FT                   /gene="rplB"
FT                   /locus_tag="RCFBP_10433"
FT   CDS_pept        460526..461356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="RCFBP_10433"
FT                   /product="50S ribosomal subunit protein L2"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3892488, 7556101, 9531480; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10433"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41740"
FT                   /db_xref="GOA:D8NMC0"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41740.1"
FT                   /translation="MALVKTKPTSPGRRSMVKVVNADLHKGAPHAPLLEKQHQKSGRNN
FT                   NGHITTRHKGGGHKHHYRVVDFKRNDKDGIPAKIERLEYDPNRSANIALVLFADGERRY
FT                   IIAPKGAVVGQAVANGPEAPIKAGNNLPIRNIPVGTTIHCVEILPGKGAQIARSAGTSA
FT                   VLLAREGIYAQVRLRSGEVRRVHIECRATIGEVGNEEHSLRQIGKAGATRWRGIRPTVR
FT                   GVAMNPVDHPHGGGEGKTAAGRDPVSPWGTPTKGYRTRRNKRTNSMIVQRRHKR"
FT   gene            461379..461654
FT                   /gene="rpsS"
FT                   /locus_tag="RCFBP_10434"
FT   CDS_pept        461379..461654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="RCFBP_10434"
FT                   /product="30S ribosomal subunit protein S19"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3279034, 348496, 3892488; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10434"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41741"
FT                   /db_xref="GOA:D8NMC1"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41741.1"
FT                   /translation="MTRSAKKGPFIDAHLLKKVEAAASGKDKKPIKTWSRRSTILPDFI
FT                   GLTIAVHNGRQHVPVYVTENMVGHKLGEFALTRTFKGHAADKKAKR"
FT   gene            461664..461993
FT                   /gene="rplV"
FT                   /locus_tag="RCFBP_10435"
FT   CDS_pept        461664..461993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="RCFBP_10435"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3892488; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10435"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41742"
FT                   /db_xref="GOA:D8NMC2"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41742.1"
FT                   /translation="MEVKAIHRGARISAQKTRLVADQIRGLPIERALNVLTFSPKKAAG
FT                   IVKKVVESAIANAEHNEGADIDELKVKSIYVDKATSLKRFTARAKGRGNRIEKQTCHIT
FT                   VTLGN"
FT   gene            462003..462797
FT                   /gene="rpsC"
FT                   /locus_tag="RCFBP_10436"
FT   CDS_pept        462003..462797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="RCFBP_10436"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2459390, 2657655, 3892488; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10436"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41743"
FT                   /db_xref="GOA:D8NMC3"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41743.1"
FT                   /translation="MGQKIHPTGFRLAVSRNWASRWYASNTQFAGMLKEDIEVREFLKK
FT                   KLKNASVGRVVIERPAKNARITIYSSRPGVVIGKKGEDIELLKAELQRRMGVPVHVNIE
FT                   EIRKPEVDAQLIADSITQQLERRIMFRRAMKRAMQNAMRLGAQGIKIMSSGRLNGIEIA
FT                   RTEWYREGRVPLHTLRADIDYGFSEAETTYGIIGVKVWVYKGDHLGRNDAPVVEEPQEE
FT                   RRKRPGRPEGRRREGEGRPAGQRRGAGAGGRRSGGADAKTGE"
FT   gene            462800..463216
FT                   /gene="rplP"
FT                   /locus_tag="RCFBP_10438"
FT   CDS_pept        462800..463216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="RCFBP_10438"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3892488, 786730, 9371452; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10438"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41744"
FT                   /db_xref="GOA:D8NMC4"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41744.1"
FT                   /translation="MLQPKRRKYRKEQKGRNTGIATRGNAVSFGEFGLKAMGRGRLTAR
FT                   QIESARRAMTRHIKRGGRIWIRIFPDKPISKKPAEVRMGNGKGNPEYYVAEIQPGKMLY
FT                   EMDGVGEELAREAFRLAAAKLPIATSFVVRQVGT"
FT   gene            463229..463423
FT                   /gene="rpmC"
FT                   /locus_tag="RCFBP_10439"
FT   CDS_pept        463229..463423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="RCFBP_10439"
FT                   /product="50S ribosomal subunit protein L29"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1092361, 3892488; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10439"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41745"
FT                   /db_xref="GOA:D8NMC5"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41745.1"
FT                   /translation="MKASELRDKDVAGLNQELSELLKAQFGLRMQKATQQLQNTSQLKK
FT                   VRRDIARVRTVLGQKGSQK"
FT   gene            463420..463689
FT                   /gene="rpsQ"
FT                   /locus_tag="RCFBP_10440"
FT   CDS_pept        463420..463689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="RCFBP_10440"
FT                   /product="30S ribosomal subunit protein S17"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 344065, 3892488; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10440"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41746"
FT                   /db_xref="GOA:D8NMC6"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41746.1"
FT                   /translation="MTEAATSLKRTLVGRVVSNKMDKTVTVLVENRVKHPLYGKYVVRS
FT                   KKYHAHDEANQYNEGDRVEIVESRPISRTKAWVVSRLLEAARVI"
FT   gene            463954..464322
FT                   /gene="rplN"
FT                   /locus_tag="RCFBP_10441"
FT   CDS_pept        463954..464322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="RCFBP_10441"
FT                   /product="50S ribosomal subunit protein L14"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2643112, 352727, 8805509; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10441"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41747"
FT                   /db_xref="GOA:D8NMC7"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41747.1"
FT                   /translation="MIQTESRLEVADNTGAREVMCIKVLGGSKRRYASVGDIIKVSVKD
FT                   AAPRGRVKKGDIYNAVVVRTAKGVRRPDGSLIKFDGNAAVLLNTKLEPIGTRIFGPVTR
FT                   ELRTERFMKIVSLAPEVL"
FT   gene            464334..464642
FT                   /gene="rplX"
FT                   /locus_tag="RCFBP_10442"
FT   CDS_pept        464334..464642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="RCFBP_10442"
FT                   /product="50S ribosomal subunit protein L24"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2993250, 3526091; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10442"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41748"
FT                   /db_xref="GOA:D8NMC8"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41748.1"
FT                   /translation="MNKIRKGDRIIVRTGKDKGKQGTVLAVLGEHVTVEGVNVAKKHVR
FT                   PNPMLGTTGGVVDKVMPIHISNVALVDANGKPSRVGIKVEGGVKTRVLKTTGAAVGA"
FT   gene            464669..465211
FT                   /gene="rplE"
FT                   /locus_tag="RCFBP_10443"
FT   CDS_pept        464669..465211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="RCFBP_10443"
FT                   /product="50S ribosomal subunit protein L5"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12515387, 8647295; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10443"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41749"
FT                   /db_xref="GOA:D8NMC9"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41749.1"
FT                   /translation="MTARLQEFYKEKVVAELIKQFGYKSVMEVPRITKITLNMGLGEAV
FT                   NDKKVIEHATGDLTKIAGQKPVVTKARKAIAGFKIRQGYPIGTMVTLRGQRMYEFLDRF
FT                   ITVSLPRVRDFRGVSGRAFDGRGNYNIGVKEQIIFPEIEYDKIDALRGLNISITTTAKS
FT                   DEEAKALLAAFKFPFRN"
FT   gene            465221..465526
FT                   /gene="rpsN"
FT                   /locus_tag="RCFBP_10444"
FT   CDS_pept        465221..465526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="RCFBP_10444"
FT                   /product="30S ribosomal subunit protein S14"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2438658, 3533932, 9746356; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10444"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41750"
FT                   /db_xref="GOA:D8NMD0"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41750.1"
FT                   /translation="MAKLSLIEREKKRAKLVAKYAEKRAALEAIVADQSKSEEERYEAR
FT                   LKLQQLPRNANPTRQRNRCSITGRPRGTFRKFGLARNKLREIAFKGEIPGLTKASW"
FT   gene            465554..465949
FT                   /gene="rpsH"
FT                   /locus_tag="RCFBP_10445"
FT   CDS_pept        465554..465949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="RCFBP_10445"
FT                   /product="30S ribosomal subunit protein S8"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10639126, 12823975, 12914937; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10445"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41751"
FT                   /db_xref="GOA:D8NMD1"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41751.1"
FT                   /translation="MSMSDPIADMLTRIRNAQAVEKASVVMPSSKLKVAIAKVLKDEGY
FT                   IDEFAVTEQGGKATLTIGLKYYAGRPVIERLQRVSRPGLRVYKGRNEIPQVMNGLGVAI
FT                   ISTPQGLMTDRKARATGVGGEVICYVA"
FT   gene            465963..466496
FT                   /gene="rplF"
FT                   /locus_tag="RCFBP_10446"
FT   CDS_pept        465963..466496
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="RCFBP_10446"
FT                   /product="50S ribosomal subunit protein L6"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 6222285, 7026977, 8262035; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10446"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41752"
FT                   /db_xref="GOA:D8NMD2"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41752.1"
FT                   /translation="MSRVGKAPIALPKGAEVNFAGGLLTVKGPLGTLTQLIHDLVKVVI
FT                   DNGTITFSPANDSREANALQGTMRALVANMVKGVTTGFERKLTLVGVGYRAALQGTALK
FT                   LQLGFSHDVIHEMPEGVKAETPTQTEIIIKGSDKQKVGQVAAEVRGYRPPEPYKGKGVR
FT                   YANERVILKETKKK"
FT   gene            466508..466864
FT                   /gene="rplR"
FT                   /locus_tag="RCFBP_10447"
FT   CDS_pept        466508..466864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="RCFBP_10447"
FT                   /product="50S ribosomal subunit protein L18"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10529214, 2472486; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10447"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41753"
FT                   /db_xref="GOA:D8NMD3"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41753.1"
FT                   /translation="MNKNDSRLRRARQTRLKIAELNVARLAVHRTNLHIYAQVFSEDGT
FT                   KVVASASTVEAEVRKELNGNGGNAAAATLVGKRIAEKAKAAGIEAVAFDRSGFRYHGRV
FT                   KALADAAREAGLKF"
FT   gene            466886..467404
FT                   /gene="rpsE"
FT                   /locus_tag="RCFBP_10448"
FT   CDS_pept        466886..467404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="RCFBP_10448"
FT                   /product="30S ribosomal subunit protein S5"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1105158, 2828880, 6211592; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10448"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41754"
FT                   /db_xref="GOA:D8NMD4"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41754.1"
FT                   /translation="MAKNQPKVQVDERDDGLREKMIAVNRVTKVVKGGRILGFAALTVV
FT                   GDGDGRIGMGKGKAKEVPVAVQKAMDEARRKMVKVPLKNGTLQHEVVGKHGAAKVLMAP
FT                   AKEGTGVIAGGPMRAIFEVMGVTNIVTKSHGSTNPYNMVRATLDGLRKMSTPAEIAAKR
FT                   GKSVEEILG"
FT   gene            467427..467609
FT                   /gene="rpmD"
FT                   /locus_tag="RCFBP_10449"
FT   CDS_pept        467427..467609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="RCFBP_10449"
FT                   /product="50S ribosomal subunit protein L30"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10531479, 3463963, 9705143; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10449"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41755"
FT                   /db_xref="GOA:D8NMD5"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41755.1"
FT                   /translation="MSQKTVKVQLVRSLIGTREDHRATVRGLGLRRMNSVSELQDTPAV
FT                   RGMINKVSYLVKVIG"
FT   gene            467628..468059
FT                   /gene="rplO"
FT                   /locus_tag="RCFBP_10450"
FT   CDS_pept        467628..468059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="RCFBP_10450"
FT                   /product="50S ribosomal subunit protein L15"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6222285, 6389119; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10450"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41756"
FT                   /db_xref="GOA:D8NMD6"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41756.1"
FT                   /translation="MQLNNLKPAAGSKHAKRRVGRGIGSGLGKTAGRGHKGQKSRSGGF
FT                   HKVGFEGGQMPLHRRLPKRGFTSLTKEFTAEVRLGDLAGLPVAEVDLLTLKQAGLVGEL
FT                   VKSAKVILSGSIDKKVTLKGLGATAGAKAAIEAAGGSLA"
FT   gene            468116..469438
FT                   /gene="secY"
FT                   /locus_tag="RCFBP_10451"
FT   CDS_pept        468116..469438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="RCFBP_10451"
FT                   /product="preprotein translocase, membrane component,
FT                   transport across inner membrane (General Secretory
FT                   Pathway)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1633829, 2202723, 2254269, 2828030; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10451"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41757"
FT                   /db_xref="GOA:D8NMD7"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41757.1"
FT                   /translation="MAQAKNTAKYGDLRRRLVFLVLALLVYRIGAHIPVPGIDPDQLAQ
FT                   LFQRQSGGILGMFNLFSGGALSRFTVFALGIMPYISASIIMQLLTIVLPQLESLKKEGQ
FT                   AGQRKITQYTRYGTVVLATFQALGIAVALEAQPGLVLDPGLMFRATAVITLVTGTMFLM
FT                   WLGEQITERGLGNGISIIIFGGIAAGLPNAIGGLFELVRTGSMGIFSAILVVAIIGAVT
FT                   FVVVFIERGQRKILVNYAKRQVGNKIYGGQSSHLPLKLNMAGVIPPIFASSIILFPATI
FT                   AGWFTAGNSTNPVTRFVKDLAATLSPGQPVYILLYAAAIIFFCFFYTALVYNSREVADN
FT                   LKKSGAFIPGIRPGEQTTRYIDKILVRLTLAGAIYITLVCLLPEFLVLRWNVPFYFGGT
FT                   SLLIIVVVTMDFMAQVQSYVMSQQYESLMKKANFKGNLTLR"
FT   gene            469465..469683
FT                   /gene="infA"
FT                   /locus_tag="RCFBP_10452"
FT   CDS_pept        469465..469683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infA"
FT                   /locus_tag="RCFBP_10452"
FT                   /product="Translation initiation factor IF-1"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3037488, 376343, 8331068, 9135158; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10452"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41758"
FT                   /db_xref="GOA:D8NMD8"
FT                   /db_xref="InterPro:IPR004368"
FT                   /db_xref="InterPro:IPR006196"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41758.1"
FT                   /translation="MAKDDAIQMQGEVLENLPNATFRVKLENGHVVLGHISGKMRMHYI
FT                   RILPGDKVTVELTPYDLSRARIVFRAK"
FT   gene            469714..469830
FT                   /gene="rpmJ"
FT                   /locus_tag="RCFBP_10453"
FT   CDS_pept        469714..469830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="RCFBP_10453"
FT                   /product="50S ribosomal protein L36"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094780, 3298224, 6154696; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10453"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41759"
FT                   /db_xref="GOA:D8NMD9"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41759.1"
FT                   /translation="MKVLASVKRICRNCKIIKRKGVVRVICSSDPRHKQRQG"
FT   gene            469852..470217
FT                   /gene="rpsM"
FT                   /locus_tag="RCFBP_10454"
FT   CDS_pept        469852..470217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="RCFBP_10454"
FT                   /product="30S ribosomal subunit protein S13"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094780, 12244297, 12809609, 2989779, 3279034, 330375,
FT                   615469; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10454"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41760"
FT                   /db_xref="GOA:D8NME0"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41760.1"
FT                   /translation="MARIAGVNIPNHQHTVIGLTAVYGIGRSRARKICEVTGVPTNKKV
FT                   KDLTDADLEKLRDEVNKFTVEGDLRRETTMNIKRLMDLGCYRGVRHRKGLPMRGQRTRT
FT                   NARTRKGPRKAGVALKK"
FT   gene            470243..470644
FT                   /gene="rpsK"
FT                   /locus_tag="RCFBP_10455"
FT   CDS_pept        470243..470644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="RCFBP_10455"
FT                   /product="30S ribosomal subunit protein S11"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11684020, 12244297, 12809609, 2989779; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10455"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41761"
FT                   /db_xref="GOA:D8NME1"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41761.1"
FT                   /translation="MAKAANTAAQRARKKVRKNVADGIAHVHASFNNTIITITDRQGNA
FT                   LSWATSGGQGFKGSRKSTPFAAQVAAESAGRVAQDQGIKNLEVRIKGPGPGRESAVRAL
FT                   NNLGIKIQLIEDVTPVPHNGCRPPKRRRI"
FT   gene            470850..471473
FT                   /gene="rpsD"
FT                   /locus_tag="RCFBP_10456"
FT   CDS_pept        470850..471473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="RCFBP_10456"
FT                   /product="30S ribosomal subunit protein S4"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 4567160, 6211432, 6757661; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10456"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41762"
FT                   /db_xref="GOA:D8NME2"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41762.1"
FT                   /translation="MARYIGPKAKLSRREGTDLFLKSARRSLADKCKLDSKPGQHGRTS
FT                   GARTSDYGNQLREKQKVKRIYGVLERQFRRYFAEADRRKGNTGANLLQLLESRLDNVVY
FT                   RMGFGSTRAEARQLVSHKAILVNGQALNVPSAQIKAGDVVAIREKSKKQVRIAESLSLA
FT                   EQSGFPTWVAVDAKKMEGTFKQAPDRVDIAGDINESLIVELYSR"
FT   gene            471715..472695
FT                   /gene="rpoA"
FT                   /locus_tag="RCFBP_10457"
FT   CDS_pept        471715..472695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="RCFBP_10457"
FT                   /product="RNA polymerase, alpha subunit; RNA polymerase
FT                   alpha chain family"
FT                   /function="9 : Transcription"
FT                   /EC_number="2.7.7.6"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6379605; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10457"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41763"
FT                   /db_xref="GOA:D8NME3"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41763.1"
FT                   /translation="MQTALLKPKIIAVEPLGDHHAKVVMEPFERGYGHTLGNALRRVLL
FT                   SSMVGYAPTEVTIAGVVHEYSTIDGVQEDVVNLLLNLKGVVFKLHNRDEVTVSLRKEGE
FT                   GVVTAADIELPHDVEIINPGHVIASLSAGGKLDMQIKVEQGRGYVPGNVRKFGDESSKV
FT                   IGRVVLDASFAPVRRVSYAVESARVEQRTDLDKLVMNIETNGVISPEEAIRQSARILVD
FT                   QLSVFAALEGTESAAEAAAARAPQIDPILLRPVDDLELTVRSANCLKAENIYYIGDLIQ
FT                   RTENELLKTPNLGRKSLNEIKEVLASRGLTLGMKLENWPPAGLEK"
FT   gene            472834..473232
FT                   /gene="rplQ"
FT                   /locus_tag="RCFBP_10458"
FT   CDS_pept        472834..473232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="RCFBP_10458"
FT                   /product="50S ribosomal subunit protein L17"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2989779, 6379605; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10458"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41764"
FT                   /db_xref="GOA:D8NME4"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41764.1"
FT                   /translation="MRHRHGLRKLNRTSSHRLAMLRNMSNSLFQHELIKTTLPKAKELR
FT                   KVVEPLITLAKKDTVANRRLAFARLRDRDMVTKLFTELGPRYATRPGGYTRILKFGFRQ
FT                   GDNAPMALVELLDRPEVAEAVDAEAAAE"
FT   gene            473390..473728
FT                   /gene="cutA"
FT                   /locus_tag="RCFBP_10459"
FT   CDS_pept        473390..473728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cutA"
FT                   /locus_tag="RCFBP_10459"
FT                   /product="Divalent-cation tolerance protein cutA"
FT                   /function="15 : Cellular processes"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10459"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41765"
FT                   /db_xref="GOA:D8NME5"
FT                   /db_xref="InterPro:IPR004323"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41765.1"
FT                   /translation="MSSETDILLVLTNLPDADSADRVTRVVLESHAAACVNRMPACASA
FT                   YWWNGAIEHATEIPLLIKTTRAAYPGLEAAVRRAHPYEVPEIIAVPVVAGLPTYLAWVA
FT                   GETAGPAV"
FT   gene            473747..475573
FT                   /gene="dipZ"
FT                   /locus_tag="RCFBP_10460"
FT   CDS_pept        473747..475573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dipZ"
FT                   /locus_tag="RCFBP_10460"
FT                   /product="thiol:disulfide interchange protein, cytochrome
FT                   c-type biogenesis, N-terminal interacts with and activates
FT                   DsbC"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.8.1.8"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10545108, 10712691, 10760137, 8917542; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10460"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41766"
FT                   /db_xref="GOA:D8NME6"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR022910"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036929"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41766.1"
FT                   /translation="MTLSAFLPLRRLLQLGMLLVAMVTVVLPARAADDFLPPEQAFRFS
FT                   AVQVDGQTVEVKFAIADGYYMYRERLAVAADPATVTFAPLELPPGQVKFDETFNKDVET
FT                   YRHTLAFRVKARDAAGPFSLIVTSQGCADQGVCYPPMKSRFRVEPASASPAAPVNPPDA
FT                   AESSDVLGGRIASTLSGGNLGAIAALFFGLGLLLTFTPCVLPMLPILSAIVVGEHATRM
FT                   RATAVSLAYVLGMAVVYTAVGVAAGLAGQGLQAALQNAWVLGAFATLMVVLSLSMFGLY
FT                   ELQLPAAWHHHLTQASNRLSGGQVAGAAVMGALSALIVSPCVTPALAGALAYIAQTGKA
FT                   TVGGAALFSMAIGMGVPLVLVGVGAGNLLPRAGYWLVVTKAVFGFILLGVALWIVQPVL
FT                   PAWLAMVAWAVLLIAAAVFLRTFDSLPADAGPLPRLGKVVGVVLALAGTVQLVGMAAGG
FT                   RDPLQPLAGVMRASTGAQADARGVVFRRVKSVSEVDEAVRAASATGRPVMLDFYADWCV
FT                   SCKEMERLTFTDARVRAALADVVLLQADVTADSADDRALLKRFGLFGPPATIFFDAQGG
FT                   QVSARVVGFERAETFLASLRRVFGAVQAKPST"
FT   gene            complement(475579..476538)
FT                   /gene="hemB"
FT                   /locus_tag="RCFBP_10461"
FT   CDS_pept        complement(475579..476538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemB"
FT                   /locus_tag="RCFBP_10461"
FT                   /product="5-aminolevulinate dehydratase (porphobilinogen
FT                   synthase)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number="4.2.1.24"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10194344, 11444968, 2464127; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10461"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41767"
FT                   /db_xref="GOA:D8NME7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41767.1"
FT                   /translation="MRRDDFSRRMMRESRLSADDLIYPVFILEGTNVRQAVPSMPGVER
FT                   VSVDVLLGVAEQCVQLGIPVLALFPVIEPNLKTPDGIEATNANGLIPRAVKALKARFPE
FT                   LGILTDVALDPYTSHGQDGVLDDTGYVLNEETVDILTRQALVQAEAGVDIVAPSDMMDG
FT                   RIGAIRLALENEDHIYTRIMAYAAKYASAFYGPFRDAVGSAANLGKSNKMTYQMDPANS
FT                   DEALREVALDIAEGADMVMVKPGMPYLDIVRRVKDEFRFPTYVYQVSGEYAMLKAAAQN
FT                   GWLDHDKVVLESLLAFKRAGANGILTYFALDAARLLRG"
FT   gene            complement(476714..477415)
FT                   /gene="engB"
FT                   /locus_tag="RCFBP_10462"
FT   CDS_pept        complement(476714..477415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engB"
FT                   /locus_tag="RCFBP_10462"
FT                   /product="probable GTP-binding protein engB"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12880769; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10462"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41768"
FT                   /db_xref="GOA:D8NME8"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR019987"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030393"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41768.1"
FT                   /translation="MSLLHQARFFTTVNHLRDLPATAVPEVAFAGRSNAGKSTAINVLC
FT                   NQKRLAFSSKTPGRTQHINYFSVMPAKALDPLGFLVDLPGYGYAEVPGEAKSHWEHLLG
FT                   DYLQTRPQLAGLIIMMDARRPFTDLDCQMVEWFLATGKPIHVLLTKADKLTNNDASRAL
FT                   MSARKVLADYRTQIEGDVSLTVQLFSSLKRRGIEEAQRTVAGWLCLPEAMPPSPDAEQA
FT                   KKTPSPDAQRG"
FT   gene            477695..478354
FT                   /locus_tag="RCFBP_10463"
FT   CDS_pept        477695..478354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10463"
FT                   /product="Cytochrome c4"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10463"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41769"
FT                   /db_xref="GOA:D8NME9"
FT                   /db_xref="InterPro:IPR008168"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR024167"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NME9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41769.1"
FT                   /translation="MNRIANVLAVAALSLASALPLAHAEEQKVAKADAARGETLFNTGV
FT                   PANGVPACTSCHGPGGNSTANANPKLAGQHAAYIEKQLKDFKAKTERNQPVMSLYAGAL
FT                   SDQDMKDIGAYVAKQPAWKPGSAKNKDTIELGQKLYRGGDAKRGIAACAGCHGPTGAGI
FT                   PAQYPRIGGQFAEYTEAQLVAFQNGSRSNSVQMHDLAGRMTAQQIKAVADYIAGLR"
FT   gene            478512..480644
FT                   /locus_tag="RCFBP_10464"
FT   CDS_pept        478512..480644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10464"
FT                   /product="putative cytochrome C biogenesis transmembrane
FT                   protein, ResB-like family"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10464"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41770"
FT                   /db_xref="GOA:D8NMF0"
FT                   /db_xref="InterPro:IPR007816"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41770.1"
FT                   /translation="MRETVELLSSMRFAISLLTVIAIASVIGTVLKQNEPYPNYVNQFG
FT                   PFWADVFRALTLPTVYSAWWFLLILAFLVVSTSLCIVRNAPKMLADMRVWREHVREGSL
FT                   RAFHHKDEFDTPAEAATVTARLAALAQNRGFRIRAFARDGGATLITAKAGTGNKIGYIL
FT                   AHAAIVIICIGGLLDGDMMIRLQMWFGGKSPIKGNAVISQIGPEHRLPVSNPGFRGNAF
FT                   VPEGATVGTAILNIGDGALIQDLPFSITLKKFTVEHYSTGMPKLFASDIVVTDHRTGKQ
FT                   TDARVEVNKPFVYDGIAIYQSSFEDGGSRLKLAGFPMRGADAKTFALSGTVGENTRLSG
FT                   PGADYTVEFTDFRLMNIETVTDASGKQDARGVGKGGGDTGLRAELGNATRMTRERELRN
FT                   VGPSVQYKLRDANGQAREFSNYMLPVTLDGQSVFLAGVRAQPDEPFRYLRIPADAQGTV
FT                   NDWMRLRAALQSSAMRGEAARRFALLSMPGDDRAVLRAQLAESARRALDLFAGATDIKG
FT                   APADGQGGFAAVAGFLQKSVPEGEREKAADVLMKIINSAMWELWQLARTQDGLAAPSVD
FT                   AASSQWLQTAINSLSDSFFYAAPVYLQLADFQQVQASVFQLTRAPGKNIVYLGSLLLVL
FT                   GVFSMFYVRERRWWLWIRPQAGGSAHGAHVLTAMSTTRRTLDFDREFERLKQDVRAAAG
FT                   APGPATAAAAEQPPTK"
FT   gene            480652..481839
FT                   /locus_tag="RCFBP_10465"
FT   CDS_pept        480652..481839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10465"
FT                   /product="putative cytochrome c-type biogenesis
FT                   transmembrane protein"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10465"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41771"
FT                   /db_xref="GOA:D8NMF1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR017562"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41771.1"
FT                   /translation="MEATNLPQPSAPVDLGALQRPSYFRRLGAFDWLFAVLLALGAGYA
FT                   FSRYGAYMDGYERGILVAVVPAFAWLGWTWKPVRLLMIGLAVLSLFAIAQYSGPNGPEL
FT                   ARADRVFFLKYFLASQSAILWMSALIFLSTLFFWTGLAARWPAGGAIGSKLCWAAVVLG
FT                   LTGMLVRWYESYLVGADIGHIPISNLYEVFILFTLITSLFYLYYEQRYQTRALGPFVML
FT                   VVSAAVGFLLWYTVSRGAQEIQPLVPALQSWWMKIHVPANFIGYGTFALAAMVGAAYLL
FT                   KEHGMLVDRLPSLEVLDDVMYKAITVGFAFFTIATILGALWAADAWGGYWSWDPKETWA
FT                   LIVWLNYAAWLHMRLMKGLRGRMAAWWALVGLLVTTFAFLGVNMFLSGLHSYGEL"
FT   gene            481942..482379
FT                   /locus_tag="RCFBP_10466"
FT   CDS_pept        481942..482379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10466"
FT                   /product="conserved protein of unknown function, putative
FT                   lipoprotein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10466"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41772"
FT                   /db_xref="InterPro:IPR005297"
FT                   /db_xref="InterPro:IPR014558"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41772.1"
FT                   /translation="MSQSAAFPRLSSPRLTLAAGAVALAALGLGGCSNMGMGMGMSSAP
FT                   SAVKVTNGTLTDAHGMTLYTFDRDTMAGKSACNGNCANNWPPLTANDADKASGDYTIIV
FT                   RDDGKKQWAYHGKPLYLWSKDKMPGDQTGDGFMNAWHIAKP"
FT   gene            482405..482938
FT                   /locus_tag="RCFBP_10467"
FT   CDS_pept        482405..482938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10467"
FT                   /product="putative RNA polymerase sigma factor"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10467"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41773"
FT                   /db_xref="GOA:D8NMF3"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41773.1"
FT                   /translation="MSDLAGRLIALTPRLRRHARGLVGDAARADDLVQDTLERAWRYRW
FT                   RFQLRPRLGATGEADGLFAWLLTIMHRLHLNAVRRPDRLEITDAPPEIPVDDDPGLRRD
FT                   LLRALASLPDDQRAVLLLVGLEQLAYREAAAVLGVPLGTVMSRLSRARERMRVALDGAP
FT                   AASGDSGTTLHRVK"
FT   gene            482947..483807
FT                   /locus_tag="RCFBP_10468"
FT   CDS_pept        482947..483807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10468"
FT                   /product="conserved protein of unknown function, predicted
FT                   transmembrane transcriptional regulator (anti-sigma
FT                   factor)"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10468"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41774"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41774.1"
FT                   /translation="MSAAPIHIEELHAYVDGRLPAVRRAAVEAYLAAHPAAAAEMAAWR
FT                   RIDGRLHRVLDPLLNEPVPQRRIPSAILAAAQRPQASGKAGAIRGGGALALGIGCLAVG
FT                   IGAGWMGRGALEPSLPMQRFANDALVSHVVYAPESKHMVEVPAAEEAHLVTWLSRRLDA
FT                   QLHIPDLAPLGYRLIGGRQTVVADAPTAMLMYEGQDGTRISVQLRRMPNNRDTGFRLET
FT                   LAPDSRVLAALHPAVDRPPPMAFYWADHGLGFAVSGPLARPQLLAVAQAVYRQYSEFTG
FT                   SAQQR"
FT   gene            483906..484901
FT                   /locus_tag="RCFBP_10469"
FT   CDS_pept        483906..484901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10469"
FT                   /product="putative exported heme-molybdoenzyme
FT                   molybdopterin-containing subunit YedY; TAT export"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10469"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41775"
FT                   /db_xref="GOA:D8NMF5"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR022867"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41775.1"
FT                   /translation="MLIKTDRWLRGDDIPAGEITPQHIFEQRRRLLAAAALGTAGAVLS
FT                   PWAARQAFAANPALAKLAAKPNPAYTTVEKPTPFEEVTTYNNFYEFGTDKSDPAHYAGT
FT                   LRPHPWQVSIEGLVKTPKTYDLDDLMKMAPMEERIYRQRCVEGWSMVIPWVGFPLAELI
FT                   RRVEPQGGAKYIQFISLADKRQMPGVGSPVLDWPYSEGLRMDEAMHPLALLTFGLYGQV
FT                   LPNQNGAPVRVIVPWKYGFKSAKSIVRIRFVDRQPPTSWNIAAPDEYGFYSNVNPNVDH
FT                   PRWSQATERRIGEDKGGFGGLFAPKRKTLMFNGYDQVASLYSGMDLRKFF"
FT   gene            484917..485570
FT                   /locus_tag="RCFBP_10470"
FT   CDS_pept        484917..485570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10470"
FT                   /product="conserved membrane protein of unknown function,
FT                   Ferric reductase-like domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10470"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41776"
FT                   /db_xref="GOA:D8NMF6"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR022837"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41776.1"
FT                   /translation="MLPSMLPPKQLRVVKIAVWLLALVPFLRLAVLGATDQYGANPLEF
FT                   VTRSTGTWTLVLLCCTLAVTPLRRLTGMNWLIRIRRMLGLYTFFYGTLHFLIWLLVDRG
FT                   LDPASMVKDIVKRPFITVGFAAFVLMIPLAATSTNAMVRRLGGKRWQWLHRLVYVTGVL
FT                   GILHYWWHKAGKHDFAEVSIYAAVMAVLLGLRVWWAWRATRQGAVAGGAMAVRD"
FT   gene            complement(485643..486902)
FT                   /gene="lysA"
FT                   /locus_tag="RCFBP_10471"
FT   CDS_pept        complement(485643..486902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="RCFBP_10471"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number="4.1.1.20"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3143046; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10471"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41777"
FT                   /db_xref="GOA:D8NMU0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41777.1"
FT                   /translation="MSESLIRQDGALMVEGVALEAIAAQFGTPTYVYSRAALTANYRAY
FT                   AAACEGRNARVQYAMKANSNLAVLQIFAQLGAGFDIVSGGELRRVLAAGGKAADVVFSG
FT                   VGKTADEMRLALEAGVACFNVESIPELHRLNEVAGSLGKTAPVSLRVNPDVDAKTHPYI
FT                   STGLKGNKFGIAFEEVLPTYRAAAAMPNLRVVGIDCHIGSQITEVSPYLDAIDKVLDVV
FT                   ARLDAEGIRLSHIDVGGGLGITYTDETPPDITAFARTLLDRIEQRGFGDRTVLFEPGRS
FT                   LVGNAGLLLTRVEFLKPGAAKNFCIVDAAMNDLARPAMYEAYHHIVPVRERGGAATVYD
FT                   VVGPVCESGDWLGRDRALDVQPGDLLAILSAGAYGFTMSSNYNTRNRAAEVIVDGDRVH
FT                   VARERERFEDLVRGEQLLPA"
FT   gene            complement(486965..487195)
FT                   /locus_tag="RCFBP_10472"
FT   CDS_pept        complement(486965..487195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10472"
FT                   /product="putative lipoprotein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10472"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41778"
FT                   /db_xref="InterPro:IPR032831"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41778.1"
FT                   /translation="MIRTAAIVATVGLALTAAGLSGCGIRGPLYLPTVPSAPTAPTTTD
FT                   PGIAGPNAVPQPPVPGTRAKPDAASAVPASR"
FT   gene            487312..487653
FT                   /gene="cyaY"
FT                   /locus_tag="RCFBP_10473"
FT   CDS_pept        487312..487653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyaY"
FT                   /locus_tag="RCFBP_10473"
FT                   /product="frataxin, iron-binding and oxidizing protein"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10452520, 10908679, 14512742, 15276847; Product type c :
FT                   carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10473"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41779"
FT                   /db_xref="GOA:D8NMU2"
FT                   /db_xref="InterPro:IPR002908"
FT                   /db_xref="InterPro:IPR020895"
FT                   /db_xref="InterPro:IPR036524"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41779.1"
FT                   /translation="MPPLTESEFLALADAELGRIERTVERAADEADADIEIGRVGNVLT
FT                   LEFDDGSKIIINSQAPMQELWVAARAGGFHFRRNDGRWVDTRTGEELYVALSRYVSQQS
FT                   DADVSLVAD"
FT   gene            complement(487718..490126)
FT                   /gene="mrcA"
FT                   /locus_tag="RCFBP_10474"
FT   CDS_pept        complement(487718..490126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrcA"
FT                   /locus_tag="RCFBP_10474"
FT                   /product="fused penicillin-binding protein 1a:
FT                   transglycosylase (N-terminal); transpeptidase (C-terminal)"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number="2.4.2.-"
FT                   /EC_number="3.4.-.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3882429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10474"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41780"
FT                   /db_xref="GOA:D8NMU3"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031376"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41780.1"
FT                   /translation="MATAQTAPASPKPPKARRPLWLRLILWMLGLFVAMGVVGALLLGY
FT                   ALLVAAPNLPSLDAITDYRPKIPLRVYTADNVLIGEFGEERRSFVPIAQMPDVMKRAVL
FT                   AIEDDRFYEHGGVDFIGVLRAGLANLHGGLSQGASTITMQVARNFFLSSEKTYTRKIYE
FT                   MLLSYKIEASLTKDQILELYMNQIYLGQRAYGFASAEQIYFGKNMKDITLAEAAMLAGL
FT                   PKAPSAYNPVVNPKRAKIRQEYILQRMRDLHYITPEQYDQAIHEQLPVRGEGHEFDVHA
FT                   EYVAEMVRQLMYAQYHEETYTRGLNVYTTLRKGDQETAYESVRRGILDYERRHGYRGPE
FT                   AFIDLPADADEREQAIDDALVEHPNSDDLQSAVVVSAAPKLVRATMLSGETIDLAGDGL
FT                   KFAQAALSASAQPKIKLRPGAVIRVIQDPKTSKWSITQLPEVASGFVSLDPQNGAIYSM
FT                   VGGFDFNRSKFNHVTQAWRQPGSSFKPFIYSAAVDKGFSPSTVINDAPLSIPAGDTGGQ
FT                   VWEPKNYGGGYDGPMTMRRALQKSKNLVSVRILRTIGTQYAQQYITRFGFEPDKHPAYL
FT                   PMALGAGSVTVLQMAGAYSVFANGGYRVNPYIIDRVTDARGTVIQQSRPMAAGKDAVRV
FT                   IDPRNDFIMDSLLRSVVSGGTGYLAKQKLGRNDMAGKTGTTNDSFDAWFCGYTPKLVGV
FT                   AWIGYDNPRSLGDRETGGGLALPIWINYMNYALKGQPETERQPPEGVVQMAGDWAYEEY
FT                   ANGQGIASVGLGDALPGSGTPASGAEASPSLAPTPEQEKQRILDMFRGN"
FT   gene            490574..491644
FT                   /gene="pilM"
FT                   /locus_tag="RCFBP_10475"
FT   CDS_pept        490574..491644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilM"
FT                   /locus_tag="RCFBP_10475"
FT                   /product="Fimbrial typa-4 assembly protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10475"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41781"
FT                   /db_xref="GOA:D8NMU4"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41781.1"
FT                   /translation="MSGLLRRNIVGIDIGSSSVKVVELSANGKQGDFRLEKCASELIER
FT                   SAVADGNLVNIDAVGSALKRAVAKAGIRSKDAVLAIPASLTESQTVSLPDNLTEDELFV
FT                   QVESEANRLFPPSQNVNFDYVVIGPSETEGGVGVRVTATVSERVTERVTAAEMAGLKPI
FT                   VMDVEEHAIQRAMTHMRAVKAAATEAEVRDMPVVAMFHLGGAHSQALFFQGWKELYEQP
FT                   LSGSGDQLTQSISRLFSLDLLKAEVKKRKNTLPDEYRSQLLKPSLETLAMEVSQAIQNF
FT                   LSASSVGRVDEIVLSGGHASLLGVQTAIQQQTQINTTLANPFANMGAAKNVNARYLQRD
FT                   LPAYIVSAGLALRGLQ"
FT   gene            491654..492286
FT                   /gene="pilN"
FT                   /locus_tag="RCFBP_10476"
FT   CDS_pept        491654..492286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilN"
FT                   /locus_tag="RCFBP_10476"
FT                   /product="Fimbrial type-4 assembly transmembrane protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10476"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41782"
FT                   /db_xref="GOA:D8NMU5"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41782.1"
FT                   /translation="MANESVNALPSVNLLPYHAERRADKRKKVFMSLGGAAAVGAVLVF
FT                   LGGMVIDQQTEEAQRINDILTQKNAEMDKQIAEVNTLKKDIDDLLQRQQAVESLQNLRN
FT                   RPVQLLEELVRQVPDGIYLTALKQDGDRYTVSGVAQSNERVSDLLRALGTVPWLDRAEL
FT                   GESVATTMTNNLKEQRRLFNFTIRFTWKAESAKPAKPGSAASAGAGK"
FT   gene            492289..492948
FT                   /gene="pilO"
FT                   /locus_tag="RCFBP_10477"
FT   CDS_pept        492289..492948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilO"
FT                   /locus_tag="RCFBP_10477"
FT                   /product="fimbrial type-4 assembly transmembrane protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10477"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41783"
FT                   /db_xref="GOA:D8NMU6"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41783.1"
FT                   /translation="MALSTELSLEELVSQFRGLNLNEPETWQIAPRILFMILAAVLVVV
FT                   LGWQFYWSGKLDERDAKRTEQDQLKSAYQSKLAQVVNLEALRKQKAEVERRVAQLELQL
FT                   PNKTEMDALLADVNHAGIARGLTFDLFRPQSAVVKPYYAEIPVSVKVNGRYHDMALFAA
FT                   DVAALSRIVTLQNISLAGNKDGSLVMEARAEAYRALDPDEQAAQRRANAAIKGGSQ"
FT   gene            492945..493490
FT                   /gene="pilP"
FT                   /locus_tag="RCFBP_10478"
FT   CDS_pept        492945..493490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilP"
FT                   /locus_tag="RCFBP_10478"
FT                   /product="fimbrial type-4 assembly lipoprotein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10478"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41784"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41784.1"
FT                   /translation="MKGQAMIHRRVPRLTHVLPLCLVVVLAACGASADDELEQWMQQAR
FT                   SSVSNKLAPLPEPKPYAPREYTTTKQTDPFSVLKVAELSRAQNESPEPGHRREPLEDYP
FT                   LEAFKLLGTMKRNGESEAVLSVGDKTQHVHVGQYIGQNYGRIVRIGDQELTLRELVREG
FT                   TAEWKEKMTTLKVQEGAQ"
FT   gene            493487..495628
FT                   /gene="pilQ"
FT                   /locus_tag="RCFBP_10479"
FT   CDS_pept        493487..495628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pilQ"
FT                   /locus_tag="RCFBP_10479"
FT                   /product="fimbrial type-4 assembly protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.1 : Surface structures"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14729699, 7901733; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10479"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41785"
FT                   /db_xref="GOA:D8NMU8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013355"
FT                   /db_xref="InterPro:IPR021731"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41785.1"
FT                   /translation="MTMRRVKDGLAQAVRVARGGATAWLSLCMLMVGGQALAQQAVTAP
FT                   ASNAIERVEQASAGESTVVTVTMKDAPAQKPVEFSTQQPARIAIDFFGTAFAQGRANYQ
FT                   YGGKLLRAASVVQIGDRTRVVLDLARQSQYKSEIRGNQYVLTLGAAPTASTAPVPTFAA
FT                   PVPVAGAERPAVRNIDFRRGEELAGRVVVDLSTPNSTINIAQQGQNLVVDFAGTMLPQS
FT                   LRRRYDVSDYGTPVQAMRATDSGSGARLIIEPRGNWQYSSYQTDTQFVVEVRPTKEDPN
FT                   KLISGPGYRGERMSLNFQNIDIRSLLQVFADFTNLNIVTSDSVTGTLSLRLKDVPWDQA
FT                   LQIVLDSKGLASRRNGNVLWVAPRGELATKEKAELESQQQVTELEPLRSQVFRLNYQRA
FT                   DDVRNMLLGTGTGAAGATASRILSKRGSLTSDARTNQLFISDIPSKLEEVQAFLLKIDI
FT                   PVRQVMIEARIVEADDTFSRNLGAKLGFASKTNGAGYGNSYTNVTSPVTTNGTWTTDPA
FT                   VSLPANGINGVNAASVAVSLFNAGAGRFLALELSALEADGRGKIISSPRVVTADNIKAL
FT                   IEQGTELPYQAATSSGATSVQFRKANLKLEVTPKITPDGNVFLDVDVNKDSVGTQTTNG
FT                   FAINTKHVQTQVLVENGGTVVIGGIYTQNERTDVNKVPLLGDIPVLGNLFKSTAKTNDR
FT                   TELLVFLTPRVLSDQMSLK"
FT   gene            495803..496342
FT                   /gene="aroK"
FT                   /locus_tag="RCFBP_10480"
FT   CDS_pept        495803..496342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="RCFBP_10480"
FT                   /product="Shikimate kinase (SK)"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="2.7.1.71"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1309529, 7612934, 7901733; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10480"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41786"
FT                   /db_xref="GOA:D8NMU9"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR023000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMU9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41786.1"
FT                   /translation="MGAGKTTVGRAVARRLDLPFFDSDHEIEARCGVRVPVIFEHEGEM
FT                   GFRDRETQVIDELTARHGVVLATGGGAVLRPENRAFLRERGTVIYLRANPHDLYLRTRH
FT                   DKNRPLLQTENPRAKLEELHAIRDPLYREVAHFVIETGKPTVAQLVNMVLMQLEVAGIV
FT                   APPAASSPTSQVSRQS"
FT   gene            496339..497445
FT                   /gene="aroB"
FT                   /locus_tag="RCFBP_10481"
FT   CDS_pept        496339..497445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroB"
FT                   /locus_tag="RCFBP_10481"
FT                   /product="3-dehydroquinate synthase"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number="4.2.3.4"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15381397, 7901733, 9613570; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10481"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41787"
FT                   /db_xref="GOA:D8NMV0"
FT                   /db_xref="InterPro:IPR016037"
FT                   /db_xref="InterPro:IPR030960"
FT                   /db_xref="InterPro:IPR030963"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41787.1"
FT                   /translation="MITVDVDLGERAYPIHIGTGLLSQAELFAPHIRGTRAVIVTNETV
FT                   APLYAARVEAAIRSLGKTVDTVVLPDGESFKTWETLNRIFDALLAAGADRKTTLVALGG
FT                   GVIGDMTGFAAASYMRGVPFIQVPTTLLAQVDSSVGGKTGINHPLGKNMIGAFHQPQAV
FT                   LADIDTLRTLPPRELAAGMAEVIKHGAIADADYFAWIERHIAGLNACDVDLTAEAVRGS
FT                   VRIKAAVVAQDERESGLRAILNFGHTFGHAIEAGLGYGEWLHGEAVGCGMAMAADLSHR
FT                   LGFIDIDTRNRVTALTRAANLPVVAPDLGLARFIDLMRVDKKAEAGEIKFVLLRKLGQA
FT                   FVTTVPDADLRATLQHAVLRPPTEAPVA"
FT   gene            497464..498627
FT                   /gene="dgt"
FT                   /locus_tag="RCFBP_10482"
FT   CDS_pept        497464..498627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dgt"
FT                   /locus_tag="RCFBP_10482"
FT                   /product="deoxyguanosine triphosphate triphosphohydrolase
FT                   (dGTPase)"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number="3.1.5.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2826481; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10482"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41788"
FT                   /db_xref="GOA:D8NMV1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41788.1"
FT                   /translation="MNDRLDLLPAPFDLEGHLAPYAAHAAQSRGRVHAEPPSTSRTEFQ
FT                   RDRDRIVHCTAFRRLEYKTQVFVNHEGDLFRTRLTHSLEVAQIARSIARSLRLNEDLVE
FT                   AISLAHDLGHTPFGHAGQDALNDCMKPYGGFEHNLQSLLVVDRLEERYGGFDGLNLTFE
FT                   TREGILKHCSRNNAATLGDLGRRFLEGQQPSLEAQLANLADEVAYNNHDIDDGLRSGLI
FT                   TLEQLEGVPLWSRHRCEAEAACPGVGGRRMINETIRRIINALIVDLIASTRAAIAGAAP
FT                   QGIDDVRAAPPLVAFSEPMRDEARMLKRFLFDNLYRHYLVMRMAAKARRIIDDLFRAFL
FT                   DDPRLLPPQYQAKDSADQPRWIAHYIAGMTDRYAIKEHRRIFAVEVL"
FT   gene            complement(498780..499454)
FT                   /locus_tag="RCFBP_10483"
FT   CDS_pept        complement(498780..499454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10483"
FT                   /product="putative outer membrane protein W precursor
FT                   (ompW)"
FT                   /function="14 : Cell envelope"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10483"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41789"
FT                   /db_xref="GOA:D8NMV2"
FT                   /db_xref="InterPro:IPR005618"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41789.1"
FT                   /translation="MACARPAIVAAAAGLIAAAVCPAAYAEGSDLSPATGNWMVRLRAV
FT                   NLTAANKSDAIPALAVPDDAIHINNKAFPELDISYFFTPNLAVELILTYPQQQDVTVMQ
FT                   SALGGPTKIGSFRHLPPILTLQYHFRPESRFKPYLGAGLNYTRISGVDLQVPGVGPLDL
FT                   SRNSFGPALQAGFDYRLTDHVYLNVDIKKTWISADVKLAGQTISKVRVDPWLVGVGLGY
FT                   RF"
FT   gene            499726..500451
FT                   /locus_tag="RCFBP_10484"
FT   CDS_pept        499726..500451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10484"
FT                   /product="Putative transposase and inactivated derivatives
FT                   protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10484"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41790"
FT                   /db_xref="GOA:D8NMV3"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41790.1"
FT                   /translation="MARLPRLSPVDSPVHVLQRGNNRQAVFRADEDYAFYLDTLRMAAR
FT                   EHDFAIHAFALMPNHVHLVGTPKAADSLSRTLQAVGRRYTRYFNAAAGRSGTLWEGRFR
FT                   STVLDPAEWVLPMLLYVEANAVRAGLITTPEEDRWSTYRHHVGIQSIPWVSDHYCYWRL
FT                   GNTPFERQSRYRTHWHEGLGSDQLARIRQHVHSGWPLGSEAFLATLARAGGRRVAPLPK
FT                   GRPPRDPADVGTETEGEAG"
FT   gene            500701..505449
FT                   /gene="gltB"
FT                   /locus_tag="RCFBP_10485"
FT   CDS_pept        500701..505449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltB"
FT                   /locus_tag="RCFBP_10485"
FT                   /product="glutamate synthase, large subunit"
FT                   /function="1.3 : Glutamate family"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /EC_number="1.4.7.1"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3326786; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10485"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41791"
FT                   /db_xref="GOA:D8NMV4"
FT                   /db_xref="InterPro:IPR002489"
FT                   /db_xref="InterPro:IPR002932"
FT                   /db_xref="InterPro:IPR006982"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR036485"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41791.1"
FT                   /translation="MEQHSFPAAPQSAESTSHQGMPSAQGLYDPSNEHDACGVGFVAHI
FT                   KGKKSHEIVQQGLRILHNLDHRGAVGADPLMGDGAGILLQIPDRYYREEMARQGVNLPP
FT                   AGEYGVGMIFLPKEHASRLACEQELERTVRLEGQVVLGWRDVPVDKAMPMSPTVQKTEP
FT                   VIRQIFIGRGRDIMTTDALERKLYVIRKTASHAIQALKLKHGKEYFVPSMSARTVVYKG
FT                   LLLCEQVGRYYQDLADPRTVSALALVHQRFSTNTFPAWELAHPYRMVAHNGEINTVKGN
FT                   VNWINARTGGISSPVLGDDLPKLWPLIYPGQSDTASFDNCLELLTMAGYPLAQAMMMMI
FT                   PEAWEQHTLMDDNRRAFYEYHAAMMEPWDGPAAICFTDGRQIGATLDRNGLRPARYYVT
FT                   DDDMVVMASEAGVLPIPESRIVKKWRLQPGKMFLIDMEQGRIIDDKELKDNLANAKPYK
FT                   SWIDAVRIKLDELEAKAEDVAAETKPAAKLLDRQQSFGYTQEDVKFLMAPMAANGEEAT
FT                   GSMGNDSPLAVLSSKNKTLYHYFKQLFAQVTNPPIDPIRENMVMSLVSFIGPKPNLLEL
FT                   NNINPPMRLEVSQPVLDFKDMAKIRNIEHYTGGKFMAYELNICYPVAWGKEGIEARLAS
FT                   LCAEAVDAVRSGYNILIVSDRAVDEKQAAIPALLATSAVHHHLVEKGLRTSTGLVVETG
FT                   SAREVHHFALLAGYGAEAVHPYLAMETLADMAAGMDLSSEKAVKNFVKAIGKGLQKVMS
FT                   KMGISTYMSYTGAQIFEAIGLSRELVDKYFHGTASNVGGIGIFEVAEEALRLHRDAFGD
FT                   APVLANMLEAGGEYAFRIRGEEHMWTPDSIAKLQHATRANSYQTYKEYANLINDQSRRH
FT                   MTLRGLFEFKVDPARAISLEEVEPAKEIVKRFATGAMSLGSISTEAHTTLAVAMNRIGG
FT                   KSNTGEGGEDERRYRNELRGIPIKQGTKLSEVIGREAVERDLELQEGDSLRSRIKQVAS
FT                   GRFGVTAEYLASADQIQIKMAQGAKPGEGGQLPGHKVTDYIGKLRYSVPGVGLISPPPH
FT                   HDIYSIEDLAQLIHDLKNVNPRSDVSVKLVSEVGVGTVAAGVAKAKADHVVIAGHDGGT
FT                   GASPWSSIKHAGSPWELGLAETQQTLMLNGLRNRIRVQADGQMKTGRDVVIGALLGADE
FT                   FGFATAPLVVEGCIMMRKCHLNTCPVGVATQDPVLRKKFSGKPEHVVNYFFFVAEEVRE
FT                   IMAQLGIRSFDELIGRADLLDTKAGIEHWKARGLDFARIFHQPPKKEGQPCYQVDVQDH
FT                   GLDRALDHQLIEKARAAIDKGERVSFIQPVRNVNRTVGAMLSGEVAKRYGHEGLPDDSI
FT                   HIQLQGTAGQSFGAFLAHGVTLDLVGDGNDYVGKGLSGGRVIVRPPHEFRGEPTGNIIV
FT                   GNTVLYGALAGEAFFNGVAGERFAVRNSGATAVVEGTGDHGCEYMTGGTVVVLGTTGRN
FT                   FAAGMSGGVAYVYDEDGLFDKRCNTAMVALESVLAAADQEKAHTQATWHKADGERVLDE
FT                   QLLKSLVEKHFRYTGSERAKELLADWSNARRRFVKVFPTEYKRALTEMYEREQESAREQ
FT                   IAA"
FT   gene            505578..507041
FT                   /gene="gltD"
FT                   /locus_tag="RCFBP_10486"
FT   CDS_pept        505578..507041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gltD"
FT                   /locus_tag="RCFBP_10486"
FT                   /product="glutamate synthase, small subunit,
FT                   nucleotide-binding, 4Fe-4S protein"
FT                   /function="1.3 : Glutamate family"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /EC_number="1.4.1.13"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 16143852, 2185218; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10486"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41792"
FT                   /db_xref="GOA:D8NMV5"
FT                   /db_xref="InterPro:IPR006005"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41792.1"
FT                   /translation="MGKATGFLEFPRQNEAYEAPEARVKHYKEFVFALADSEAKIQGAR
FT                   CMDCGIPFCNNGCPVNNVIPDFNDLVYRQDWKTAIEVLHSTNNFPEFTGRICPAPCEAA
FT                   CTLGINEAPVGIKSIEHAIIDKAWAEGWVHPQLARHKTGKTVAVVGSGPAGLAAAQQLA
FT                   RAGHDVTLFEKNDRIGGLLRYGIPDFKLEKTQIDRRVQQMEAEGVTFRAGVMVGDKTVP
FT                   AGICNDARETIAADDILKQFDAVVLTGGSEVPRDLPVPGRDLDGVHYALEFLIPQNKEV
FT                   AGDAPNPIRADGKHVIVIGGGDTGSDCVGTSNRHGAASVTQFELLPRPPEEENKPLVWP
FT                   YWPIKLRTSSSHDEGCERDWSVATKALIGENGRVTGLTAVRLEWKDGKMSEVEGSEFTL
FT                   KADLVLLAMGFTNPVGGVLDAFGVSKDARNNARASTEGDNAYATNVPKVFAAGDVRRGQ
FT                   SLVVWAIREGRQAARAVDTFLMGHSELPR"
FT   gene            507221..508255
FT                   /locus_tag="RCFBP_10487"
FT   CDS_pept        507221..508255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10487"
FT                   /product="conserved protein of unknown function"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10487"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41793"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41793.1"
FT                   /translation="MRADARTSLTDPYDMARAGRRRALAVLSAMPVLLKAWPARGELLG
FT                   YPSHAMRLVVPTAEGSAFDALARALAAQLAGQLGMAASVEDRPAANGMAAGELVARASS
FT                   DGHTWLLQQTTFVAQPALEPAPYDPLRDFQPVAMVATLPLFLAVDARLPVASIGELVAQ
FT                   ARGQSASVNCGSEAVGTWSHLVAEQFVRDYAIHAPHVAVKGEGVLIQQVLAGRMTACFA
FT                   TYPGLAAGVNVGQLRLLGVTGSVRSLFAPAVPTLREAGVAGFDHSAWVGMFAPARTPRP
FT                   LSLRVAAELKRVLASGDVRATMLAGGYQPEWEPAESFAAAVRRDAVHWQSLIREADLQL
FT                   DERG"
FT   gene            508492..509331
FT                   /locus_tag="RCFBP_10488"
FT   CDS_pept        508492..509331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10488"
FT                   /product="putative ABC transporter, atp-binding component"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.25"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10488"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41794"
FT                   /db_xref="GOA:D8NMV7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41794.1"
FT                   /translation="MSSQSSTAVVELDQVDFAYQPGARRILSGLCMRVPKGSVVAVMGG
FT                   SGCGKTTVLRLIGGQVAAAAGAVRVHGADIGAMDKPALYAARRQMGMLFQFGALFSDMS
FT                   VFDNVAFPLREHTELPEPLIRDLVLMKLNAVGLRGARDLMPSQISGGMARRVALARAIA
FT                   LDPSLILYDEPFAGLDPISLGLTASLIRSLNDALGATSIIVSHDVQETFQIADYVYFVA
FT                   NGGIAAEGTPAELSASTDPFVRQFVRGEPDGPVPFHYPGVSLAEDFGVGGQRGGEGR"
FT   gene            509328..510095
FT                   /locus_tag="RCFBP_10489"
FT   CDS_pept        509328..510095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10489"
FT                   /product="conserved membrane protein of unknown function,
FT                   DUF140"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10489"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41795"
FT                   /db_xref="GOA:D8NMV8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41795.1"
FT                   /translation="MISSIGFLVRVLISRLGYAARMLMALLGAWRDVLRRPRLLIEQLR
FT                   FIGNDSFIIIAVSGLFVGFVLGLQGYYTLNRYGSEQALGLLVALSLVRELGPVVTALLF
FT                   AGRAGTSLTAEIGLMKANEELIAMEMMAVDPLARVLAPRFWGGFIAMPLLAAIFSAVGI
FT                   VGGYFVGVGLIGVDPGAFWSQMQAGVDVVDDVINGVIKSVVFGVAVTFVALYQGYEAKA
FT                   TPEGVSRATTRTVVIASLAVLALDFVLTALMFS"
FT   gene            510124..510639
FT                   /locus_tag="RCFBP_10490"
FT   CDS_pept        510124..510639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10490"
FT                   /product="putative ABC-type transporter, periplasmic
FT                   binding component"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10490"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41796"
FT                   /db_xref="GOA:D8NMV9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMV9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41796.1"
FT                   /translation="MRKSLLDFWVGLFVLVGIIALLFLALKAGNMSSFSFAKTYQVRAA
FT                   FDNIGGLKVRAPVKSAGVVVGRVSQILFDDKSYQATVVIDMDQRYQFPKDTSAKILTSG
FT                   LLGEQYVGLEPGGDSAMLASGSKITMTQSAVVLENLISQFLYSKAADAGAGNAGGAGKP
FT                   AEGGSGSK"
FT   gene            510643..511452
FT                   /locus_tag="RCFBP_10491"
FT   CDS_pept        510643..511452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10491"
FT                   /product="putative vacJ-like lipoprotein; transmembrane"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10491"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41797"
FT                   /db_xref="GOA:D8NMW0"
FT                   /db_xref="InterPro:IPR007428"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41797.1"
FT                   /translation="MTTTTSNRTLRGLVLGMAAGAALLAGCATGPNANPADPIEPFNRE
FT                   VFRINDDLDKAILKPVAQEYVDVVPSPARTAVSNFFSNAGDVYSAVNNLLQLKGAAALE
FT                   DTMRVAINTVLGLGGLIDIASDAGLPKHKEDFGQTLGVWGVPAGAYIVWPLLGPSTVRD
FT                   TAGFLVDWQMDPLTYFHNGAVTYSLAALRVVDTRANLLSASNLLEEAAVDKYTFMRDAY
FT                   LQRRRYLIYDGNLPEESDGKNPPEGTEEGGTMSPYHRFTPNWPVFRR"
FT   gene            511607..512242
FT                   /locus_tag="RCFBP_10492"
FT   CDS_pept        511607..512242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10492"
FT                   /product="putative ABC-type toluene transporter, auxiliary
FT                   component"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10492"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41798"
FT                   /db_xref="InterPro:IPR008869"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41798.1"
FT                   /translation="MLKKLFHSLFAGLTFVVAVAAVPAHAQETDAQATVKTAVDDVLTT
FT                   IKGDPDLHGGNLQKVFQLVDQKIVPRADFKRTTQIAMGRFWSQATPEQQQQIQDGFKTL
FT                   LIRTYAGALANVRNQTVSYKPFRAAADDTDVVVRSTVNNNGEPVALDYRVEKSPNGWKV
FT                   YDINISGLWLSETYKNQFADVISKRGGVGGLVQFLDERNAQLAKGPAK"
FT   gene            512308..512622
FT                   /locus_tag="RCFBP_10493"
FT   CDS_pept        512308..512622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10493"
FT                   /product="conserved protein of unknown function, STAS
FT                   domain"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10493"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41799"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41799.1"
FT                   /translation="MLTLSGPLTHREAPRILREGEAQLSQASQAGTMAVRVDCAGLSQI
FT                   DSSALAVLLSWQRTAQAAGIALDIAAAPEALRNLATLYGVDALLAVAPATTASHHPARH
FT                   "
FT   gene            512858..513814
FT                   /locus_tag="RCFBP_10494"
FT   CDS_pept        512858..513814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10494"
FT                   /product="putative ABC transporter, ATPase component,
FT                   putative sulfate-transporting"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.25"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10494"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41800"
FT                   /db_xref="GOA:D8NMW3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41800.1"
FT                   /translation="MKAIEIADVRKRYKSLQALKGVSLSVEQGEFFGLLGPNGAGKTTL
FT                   ISILAGLNRADSGQVRVLGHDVVSDYRMARRMLGVVPQELVFDPFFSVRETLRLQSGYF
FT                   GLTRNDDWIDEVMANLDLTSKADANMRALSGGMKRRVLVAQALVHRPPVIVLDEPTAGV
FT                   DVELRQTLWKFIARLNREGHTVVLTTHYLEEAESLCDRIAMLKFGEVVALDRTANLLSQ
FT                   FAGLQLVLSFAQGALPASLEGLRMPGNHGERGVRLRLSGYGEVEQILSTCRQAGCEIDD
FT                   MEIAKADLEDVFVQVMRREGGMTAVPAIPDSALEPAA"
FT   gene            513811..514599
FT                   /locus_tag="RCFBP_10495"
FT   CDS_pept        513811..514599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10495"
FT                   /product="putative ABC transporter permease protein,
FT                   membrane component"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10495"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41801"
FT                   /db_xref="GOA:D8NMW4"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41801.1"
FT                   /translation="MSAIPQIRPGRWIGFRTLLYKEVLRFWKVSFQTVAAPVLTALLYL
FT                   LIFGHVLEDHVQVFGQISYTAFLIPGLVMMSVLQNAFANSSSSLIQSKITGNLVFIMLP
FT                   PLSDWEMFGAYVVASVIRGLAVGAGVLAVTAWFAHLHFAQPLWIIVFAILGAAVLGTLG
FT                   LIAGIWAEKFDQLAAFQNFLIVPATFLAGVFYSIHSLPPFWQAVSHANPFFYMIDGFRY
FT                   GFFGVSDVPVATSLGVMVIALVVVGGIALQMLRTGYKLRH"
FT   gene            514658..514894
FT                   /locus_tag="RCFBP_10496"
FT   CDS_pept        514658..514894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10496"
FT                   /product="putative transcriptional regulator, BolA family"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10496"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41802"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41802.1"
FT                   /translation="MLPTPEQVKQYIEAGLPCAHLEVEGDGQHFFATIVSAQFEGKRLI
FT                   QRHQLVYAALGDRMRAEIHALSMKTLTPAEWTS"
FT   gene            514896..516257
FT                   /gene="murA"
FT                   /locus_tag="RCFBP_10497"
FT   CDS_pept        514896..516257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murA"
FT                   /locus_tag="RCFBP_10497"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number="2.5.1.7"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7608103, 8181716, 9485407; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10497"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41803"
FT                   /db_xref="GOA:D8NMW6"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41803.1"
FT                   /translation="MAELDPTPAAADTDSDSDLALAERPVRRDVSLMDKLLIEGNGPLS
FT                   GEIRVSGAKNAALPIMCAALLTPEPLMLRNVPNLQDVRTMFKLLRQMGVEGTQNGHDVT
FT                   LDAADIHAPEAPYDLVKTMRASILVLGPLLARFGHARVSLPGGCGIGARPVDQHIKGLQ
FT                   QMGAEIVIEHGYIEAKLADGAKRLRGARIVTDMVTVTGTENLLMAAVLADGETVLENAA
FT                   REPEVTDLANLLVKMGACIEGIGTDRLVVQGVDAIKGAEHTVIADRIEAGTFLCAVAAA
FT                   GGDVTLRGVPPGILDAVLDKLREAGVTLTTGDDWIRVQMHGRPKAVSFRTSEYPAFPTD
FT                   MQAQFMMLNCIAEGTSLVTETIFENRFMHVQELNRLGANIVTEGNTAAVTGVEQLSGAT
FT                   VMATDLRASASLVIAGLVAQGETLVDRIYHLDRGYDRIEDKLSAVGAKIRRIQG"
FT   gene            516276..516977
FT                   /gene="hisG"
FT                   /locus_tag="RCFBP_10498"
FT   CDS_pept        516276..516977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="RCFBP_10498"
FT                   /product="ATP phosphoribosyltransferase (ATP-PRTase)
FT                   (ATP-PRT)"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="2.4.2.17"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10430882, 10795825, 16051603, 17154531; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10498"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41804"
FT                   /db_xref="GOA:D8NMW7"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41804.1"
FT                   /translation="MNAFQSASNQLTLALSKGRIFEETLPLLKAAGIEVTEDPETSRKL
FT                   ILPTSDPALRVIIVRASDVPTYVQYGAADFGVAGRDVLMEHGMAGLYAPIDLNIARCRM
FT                   SVAVPAGFDYASAVRQGARLSVATKYLNTAREHFAKKGVHVDLIKLYGSMELGPLVGLA
FT                   DAIVDLVSTGGTLRANNLVEVEEIMQISSRLVVNQAALKLKRERLAPILDAFERASRPA
FT                   GAEAKRVGEPV"
FT   gene            516974..518302
FT                   /gene="hisD"
FT                   /locus_tag="RCFBP_10499"
FT   CDS_pept        516974..518302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="RCFBP_10499"
FT                   /product="Histidinol dehydrogenase (HDH)"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="1.1.1.23"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10795825, 3018428, 7687248; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10499"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41805"
FT                   /db_xref="GOA:D8NMW8"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41805.1"
FT                   /translation="MSLTIRKLDSADAGFAAQLRQVLAFEASEDEAIDRAAAQILADVK
FT                   ARGDAAVLETTHRFDRIEADSVAALELSPAALQAALDGLEPKRRAALEAAAARVRAYHE
FT                   KQKIECGSHSWEYAEADGTVLGQKVTPLDRVGIYVPGGKAAYPSSVLMNAIPARVAGVK
FT                   EIIMVVPTPGGVRNELVLAAACIAGVDRVFTIGGAQAVGALAYGTETVPAVDKIVGPGN
FT                   AYVAAAKRRVFGTVGIDMIAGPSEILVICDGTTDPDWVAMDLFSQAEHDELAQSILLCP
FT                   DAGFIAQVEASIRRLLDDMPRKDVIAASLSGRGALIRVRDMDEACEIANDIAPEHLEIS
FT                   AEHPRQWAERIRHAGAIFLGKYTSESLGDYCAGPNHVLPTSRTARFSSPLGVYDFIKRS
FT                   SLIEVSEAGAQMLGEIASELAYGEGLQAHARSAEYRLQRTTTE"
FT   gene            518313..519443
FT                   /gene="hisC"
FT                   /locus_tag="RCFBP_10500"
FT   CDS_pept        518313..519443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="RCFBP_10500"
FT                   /product="Histidinol-phosphate transaminase"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="2.6.1.9"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11518529, 2999081, 3062174; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10500"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41806"
FT                   /db_xref="GOA:D8NMW9"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMW9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41806.1"
FT                   /translation="MTMNANAPRQPSLDDLLGRIVRDDVRAMGAYHVPDASGMVKLDAM
FT                   ENPYHLPAMLRDVLGKRLAEVALNRYPVPTADALKAQLKRVMRVPAGAEVLLGNGSDEI
FT                   ISLIAIAAAKPGATVLAPVPGFVMYAMSAQLMGLKFVGVPLKADLTLDREAMLAAMAEH
FT                   QPAVIYLAYPNNPTGNLFDAADMDAIIRAARGPVCQSLVVVDEAYQPFAQHSWMPRLPE
FT                   FDHLLVMRTVSKLGLAGIRLGYVAGHPKWIAELDKVRPPYNVNVLTEATASFVLDHVDV
FT                   LDAQAATLRTERTRLIDALSAQPGVTVFPSAANFLLLRVPDAAGLFERLLKRRVLVKNV
FT                   SKMHPLLVNCLRVTVSNPEENAQFLDAFAASLQDTP"
FT   gene            519440..520030
FT                   /gene="hisB"
FT                   /locus_tag="RCFBP_10501"
FT   CDS_pept        519440..520030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="RCFBP_10501"
FT                   /product="Imidazoleglycerol-phosphate dehydratase"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="4.2.1.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15042344, 2664449; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10501"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41807"
FT                   /db_xref="GOA:D8NMX0"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41807.1"
FT                   /translation="MSRRAEVTRNTSETQIRVALDLDGTGKQTLNTGVPFLDHMLDQIA
FT                   RHGMVDLDVTATGDTHIDDHHTVEDVGITLGQAVARAIGDKKGIVRYGHSYVPLDEALS
FT                   RVVIDFSGRPGLEFHVPFTRARVGSFDVDLSIEFFRGFVNHAGVTLHIDNLRGVNAHHQ
FT                   IETVFKAFGRALRMAVELDPRAAGTIPSTKGAL"
FT   gene            520078..520701
FT                   /locus_tag="RCFBP_10502"
FT   CDS_pept        520078..520701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10502"
FT                   /product="putative antibiotic resistance protein, MarC
FT                   family"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10502"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41808"
FT                   /db_xref="GOA:D8NMX1"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41808.1"
FT                   /translation="MDLTKSFFSLLALINPIGAIPFFISLTESLTDEEKRRTIKTASIS
FT                   VALVIGISALLGEQIIGFFGFSVGSLQVGGGIIMIMIALNMLNAQTSRTKATPEEEDEA
FT                   GVRASIAVVPLAIPLLTGPGSISTVIVYAGKTQHWYELFFLAGVGVLIALVVWVVLRAA
FT                   EPIARVIGRTGINVGTRLMGLILAALAVEFIVDGLKTLLPVLKS"
FT   gene            520698..521351
FT                   /gene="hisH"
FT                   /locus_tag="RCFBP_10503"
FT   CDS_pept        520698..521351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="RCFBP_10503"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit with HisF"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11551184, 8494895; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10503"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41809"
FT                   /db_xref="GOA:D8NMX2"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41809.1"
FT                   /translation="MTTIAIVDYGMGNLRSVAQALRAVAPDADVRISAQADEIRTADRV
FT                   VLPGQGAMPDCMAAFDLSGLHDAVLEAARTKPMLGVCVGEQMLLERSTEARPGREFTRG
FT                   LGLIAGDVVRFDLDGQLQPDGSRYKVPQMGWNRVHQSQAHALWAGVPDQSYFYFVHSYY
FT                   ARPAHPEESVGETEYGVRFTCAIARDNIFATQFHPEKSAQAGLQIYRNFVHWNP"
FT   gene            521430..522173
FT                   /gene="hisA"
FT                   /locus_tag="RCFBP_10504"
FT   CDS_pept        521430..522173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="RCFBP_10504"
FT                   /product="1-(5-phosphoribosyl)-5-((5-phosphoribosylamino)
FT                   methylideneamino)imidazole-4-carboxamide isomerase"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="5.3.1.16"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2664449, 7687248, 8028028; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10504"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41810"
FT                   /db_xref="GOA:D8NMX3"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41810.1"
FT                   /translation="MLLIPAIDLKDGQCVRLKQGDMDQATVFSEDPAAMARHWVDQGAR
FT                   RLHLVDLNGAFVGKPRNEAAIKAILAEVGGEIPVQLGGGIRDLNTIERWLDDGLSFVII
FT                   GTAAVKNPGFLQDACTAFGGHIIVGLDAKDGKVATDGWSKLTGHEVVDLARKYEDYGVE
FT                   AIIYTDIGRDGMLQGINIDATVKLAQSVSIPVIASGGLSSLKDIDHLCAVETEGVEGVI
FT                   CGRAIYSGDLNFRQAQEHADKLGAA"
FT   gene            522225..523013
FT                   /gene="hisF"
FT                   /locus_tag="RCFBP_10505"
FT   CDS_pept        522225..523013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="RCFBP_10505"
FT                   /product="imidazole glycerol phosphate synthase, subunit
FT                   with HisH"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="2.4.2.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10505"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41811"
FT                   /db_xref="GOA:D8NMX4"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41811.1"
FT                   /translation="MGARLIMLAKRIIPCLDVTNGRVVKGVNFVELRDAGDPVEIARRY
FT                   DEQGADEITFLDITATSDGRDLILHIIESVASQVFIPLTVGGGVRALEDVRRLLNAGAD
FT                   KISMNSSAVANPQLVSDASARYGAQCIVVAIDAKKVSADGEPPRWEVFTHGGRKATGLD
FT                   AVAWAREMAQRGAGEILLTSMDRDGTKSGFDLELTRAVSDAVPVPVIASGGVGNLQHLA
FT                   DGIKLGHADAVLAASIFHYGEHTVGEAKQFMAQQGIPVRK"
FT   gene            523016..523441
FT                   /gene="hisI"
FT                   /locus_tag="RCFBP_10506"
FT   CDS_pept        523016..523441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisI"
FT                   /locus_tag="RCFBP_10506"
FT                   /product="Phosphoribosyl-AMP cyclohydrolase (PRA-CH)"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="3.5.4.19"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3018439; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10506"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41812"
FT                   /db_xref="GOA:D8NMX5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41812.1"
FT                   /translation="MSKKWLNKVKWDDHGLVPVIVQEQGSNDVLMFAFMNREALQKTVE
FT                   TGEAVFWSRSRKRLWHKGEESGHIQKVHEVRLDCDEDVVLLRVTQIGGIACHTGRHACF
FT                   FQKFEGTAEDGDWHTVEPVLKSPDEIYAGKPGHSHHE"
FT   gene            523434..523808
FT                   /gene="hisE"
FT                   /locus_tag="RCFBP_10507"
FT   CDS_pept        523434..523808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisE"
FT                   /locus_tag="RCFBP_10507"
FT                   /product="Phosphoribosyl-ATP pyrophosphatase (PRA-PH)"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number="3.6.1.31"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11006846, 15740738; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10507"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41813"
FT                   /db_xref="GOA:D8NMX6"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41813.1"
FT                   /translation="MSDTLRRLGEVLESRKLANGGDPEKSYIARLFHKGDDAILKKIGE
FT                   EATETVMAAKDARAAGMTDEARSKVVYEVADLWFHTMVLLSHFNLTPDDVVNELARREG
FT                   LSGLEEKALRKSQARDAAGD"
FT   gene            523858..524232
FT                   /locus_tag="RCFBP_10508"
FT   CDS_pept        523858..524232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10508"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10508"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41814"
FT                   /db_xref="GOA:D8NMX7"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41814.1"
FT                   /translation="MDKYGSAIAMTDDAERLAGLRRLTHILYALYAIFWLTGGITALIA
FT                   IIVGYVKRDDVRGTLYESHFRWQIRSFWWCVLWGVIGVLLIPLAFLGFAVLWALGIWML
FT                   YRIVKGWLYLNDSKPMYANP"
FT   gene            524295..524552
FT                   /gene="tatA"
FT                   /locus_tag="RCFBP_10509"
FT   CDS_pept        524295..524552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="RCFBP_10509"
FT                   /product="Sec-independent protein translocase protein
FT                   tatA/E homolog"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9649434; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10509"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41815"
FT                   /db_xref="GOA:D8NMX8"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41815.1"
FT                   /translation="MGSFSIWHWLIVLVIIMMVFGTKKLRNIGSDLGSAVKGFKEGMRE
FT                   GSEDKPAGSQQGQQAAGQPPRELHDATTIDVEARDKSKQG"
FT   gene            524571..525089
FT                   /gene="tatB"
FT                   /locus_tag="RCFBP_10510"
FT   CDS_pept        524571..525089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatB"
FT                   /locus_tag="RCFBP_10510"
FT                   /product="Sec-independent protein translocase protein tatB
FT                   homolog"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9649434; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10510"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41816"
FT                   /db_xref="GOA:D8NMX9"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMX9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41816.1"
FT                   /translation="MIDLGISKLALIGAVALVVIGPERLPKVARTAGALIGRAQRYIAD
FT                   VKAEVSREIELEELRKMRTEFEEAARNVEQTIHQEVSKHTSEINERLNEALGDPAARQT
FT                   ATQAPEWRPAPAKSRNGRNSWRNKQLSMPKWYRRKQGVSMWAQSGAARVKRHRPPIVAA
FT                   QSRGRSFFE"
FT   gene            525142..525939
FT                   /gene="tatC"
FT                   /locus_tag="RCFBP_10511"
FT   CDS_pept        525142..525939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="RCFBP_10511"
FT                   /product="Sec-independent protein translocase protein tatC"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11007775; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10511"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41817"
FT                   /db_xref="GOA:D8NMY0"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41817.1"
FT                   /translation="MSAAPHDPQDSPEDGAQETFISHLVELRERIVKAGAGVLLIFLGL
FT                   VYWAPDIFNLFSRPLIQALPKNGHMIVTDVTGSFFVPMKVTLLVAFLVALPWVLYQIWR
FT                   FVAPGLYAHEKRMILPLVVSSYVLFLCGVAFAYFLVFPTVFKFMAHYNAPLGAEMSTDV
FT                   DKYLSFAMTTFLAFGITFEVPVVVIVLVRFGIVSLEKLRQIRPYVVVGAFVIAAVVTPP
FT                   DVMSQLLLAVPLWLLYELGLILAAVFIRKTAAPEAQTLPAVKD"
FT   gene            complement(526001..527077)
FT                   /locus_tag="RCFBP_10512"
FT   CDS_pept        complement(526001..527077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10512"
FT                   /product="putative atp-binding abc transporter protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10512"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41818"
FT                   /db_xref="GOA:D8NMY1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41818.1"
FT                   /translation="MIELTVNDLHLEYGNNPVLKGVSMQLQKGEVVSLLGPSGSGKTTL
FT                   LRAVAGLEQASRGTVKIGERVMFNGAAGLDVPAEARNLGLVFQSYALWPHKTVAENVAY
FT                   PLKLRKTPPAQIKERVQAVLQQLGLGHLGERFPSQLSGGQQQRVAIARALVYNPPVILL
FT                   DEPLSNLDAKLREEARAFLRELIVRLGLSALMVTHDQSEAMAMSDRILLLNNGVIEQQG
FT                   TPEQMYGAPETLFTAEFMGSNNRVNGKIAEVRDGMARLVDEAGGWSLWGVARGDLKPGA
FT                   AAHGVIRLEQVRVGLDNADNTIRLPLATRMYLGDRWECLFRGAGAAGTGLRAYASNAPG
FT                   DGEYALTFPREQFWLFAA"
FT   gene            complement(527070..528881)
FT                   /locus_tag="RCFBP_10513"
FT   CDS_pept        complement(527070..528881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10513"
FT                   /product="putative Ferric transport system permease protein
FT                   fbpB"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10513"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41819"
FT                   /db_xref="GOA:D8NMY2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41819.1"
FT                   /translation="MRSLTHDRAAASQTIPQRSPWTRLGQALPRGVVILLTALAIFTPL
FT                   ALIFYQSFLSAPFFMPDALAGLDAYRFIFTDPDFWHAFEKSGALAFGLAVISVPLGGIL
FT                   AFLMVRSDLPGRRIIEPMLMIPVFVSPMVLAFGYVVSAGPVGFYTIWFRQLFGGAPWNV
FT                   YSFTSIIIIAGLTHVPHVYLYVSSALRSLGSDVEEAARISGASPLSVALNVSLPMVRPA
FT                   LLYAAVLVIFLGFEVFGLVLVLGDPEGHLVLATYLYKLTNKLGTPAYHLMAAVAVCLVM
FT                   VTFPLVLLQRYMLRSANRFVTVKGKVTRSRPLPLGKWRWPAWAVVVLWFFVTVVVPLSG
FT                   IALRAFVSNWGEGVSLTEAISTTAFHQIFEQPQFLRAIVNTVLIGVLGGALAVACYTCI
FT                   GLAMHRKPDGWTRFLDYSVLVPRAIPGLLAGLAFLWVFLFVPNWIETALTDSSVPFAGW
FT                   MIEHVVPTLRNLRSTIFSVWIAYSVVWLAYGLRLISAALLQVGPELEEAARSVGASRAR
FT                   TTRDVTVPLTRYGLLGAWLLIFLIFEREYSTGVYLLSPGTETIGSMLVSLWAGGAIDIV
FT                   AALSFVNIVLVAVGLGIALRFGVKLHD"
FT   gene            complement(528965..530068)
FT                   /locus_tag="RCFBP_10514"
FT   CDS_pept        complement(528965..530068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10514"
FT                   /product="putative iron(III)-binding periplasmic protein
FT                   precursor (fbpA)"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10514"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41820"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41820.1"
FT                   /translation="MLRGHFAPARAAVAVAVAALTLGTAAFAQVPAGYPASYADTVAAA
FT                   KKEGKVVVYATTDTKAADPLIKDFESLYPGVKVEYNDMNSSELYNRFISEQAAGGASAD
FT                   MMWNSSMDSQLKLAQTYAMMYQSPEAASLPKWAVYKGLAYGTTYEPAVFLYNKRLVKDS
FT                   EVPQTHADLAKLVSSQPERFKNKVTTYDIEKSAVGFMMAAQDSQDSPQYFDFIKAVGPN
FT                   LVLQSSTGTMMERVASGENLLAYNILGSYAMARAKKDPSIGIVYPKDYTLVVSRVAMIA
FT                   KKAQHPNAAKLWLDYILSKRGQDILANKSDLHSLRDDVSGEATAAGLKQILGQSIKPIP
FT                   VDESVLTFLEPKKRLDFIKQWRTAAGR"
FT   gene            complement(530185..531696)
FT                   /locus_tag="RCFBP_10515"
FT   CDS_pept        complement(530185..531696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10515"
FT                   /product="Sensor protein, histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type rc : receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10515"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41821"
FT                   /db_xref="GOA:D8NMY4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41821.1"
FT                   /translation="MTRRFALLPRSLKLTLLWLLLPGLVGVLAIDTLSTYQSLRTATDR
FT                   AYDRALLGSVRAIENGVTIERGQVQVNVPYVALSMFESTAQSNVYYRVAYEQAAGAPAQ
FT                   AALTGYDDLPLPAGALDNDTPRFYDALYHGEPVRIAAVAKPLYQPGLPTRIVIQVAETI
FT                   ETRRALQQSVWRGTLVRDAALVAVSVALLWLGVTLTLRPLKRLARGIAVRASDDLRPLD
FT                   ATDVPAEVRPLVQAINHHIHRYAELAAAQSQFLADASHQLRTPLAVLLTQAEYALRETD
FT                   PARVREGLAAIIARLQSTNRLTSQLLALARARHTGQDAPPETFDLGELARSVVVDALPL
FT                   AREKQQDLGWDDSGLDTLLPVSGYPAFLREALSNLVHNAIRYTPPGGRITVRAIADGGA
FT                   ALVCVDDTGPGMSAVERAHAFERFRRAHEGGTRPGQPKDARYAAEGSGLGLAIARAYAA
FT                   RSGGQIELADGEPNGHGGVGLSARIRVPLARAADTAQHAATQQVQ"
FT   gene            complement(531693..532400)
FT                   /locus_tag="RCFBP_10516"
FT   CDS_pept        complement(531693..532400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10516"
FT                   /product="putative response regulator, CheY family"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10516"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41822"
FT                   /db_xref="GOA:D8NMY5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41822.1"
FT                   /translation="MRILLVEDEEELAAWLSRALAQSSFVVERAADGLAAEAFLASGEF
FT                   DAVVLDLRLPRKDGFAVLADMRARDDRTPVLILTAQGALDERVRGLNAGADDFLTKPFA
FT                   LTELEARLMALIRRSRGRAFPRLRCGPLEFDTGRKAFLLAGEALSLTPREHAALSALLH
FT                   KTGQPISKVHLFDKVFNLDSDSSPDAVEVVVHRLRKKLAGSGVQIVTVRGLGYLLEAET
FT                   DGIPQAADDTSAL"
FT   gene            532496..533638
FT                   /locus_tag="RCFBP_10517"
FT   CDS_pept        532496..533638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10517"
FT                   /product="putative iron(III)-binding periplasmic protein
FT                   precursor (fbpA)"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10517"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41823"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41823.1"
FT                   /translation="MPSIPDTRRRWLCQAAALLAAGGLAAAESPAQWLGRPAPELPSYY
FT                   PRDYGVVFDAARREGRVTVYSTTDFAAAHPLIRAFEARYPGVTVDYREQNSDDLYRRYL
FT                   AELASGAPGADVVWSSSMPEQFKLVNDGHALPYASPERPYLPSWAIWKNEAYGTSYEPV
FT                   VFVYNARQLPADLVPATHADFARILTVHRDLLRGRVASYDIEHSGSAYLFAAEDARTTP
FT                   VFWDVARALGAANVNLYITTAAMLERVAAGESLLAYNVIGSYAARYADRNPALAIKMPA
FT                   DYTLVATRVAFIARRSTHPNAARLWLDFVLSREGQSVMANRAFLFSLRQDVETGLTAKR
FT                   LLAELGNTHRPIAVGPGLLAHQDQLRRADFLKRWHAALGR"
FT   gene            533975..535123
FT                   /locus_tag="RCFBP_10518"
FT   CDS_pept        533975..535123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10518"
FT                   /product="putative porin"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10518"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41824"
FT                   /db_xref="GOA:D8NMY7"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41824.1"
FT                   /translation="MKMKLFAAAVAALAAGGAYAQSSVTLYGVADVGVEWANKVPGGDG
FT                   QGHSRVAMQSGNLSGSRWGLRGVEDLGGGLKGIFNLESGFSLDTGASGQSSRLFGRNAY
FT                   VGLQGQWGQLTLGRQQNLLYDFALAYDPMAIAGRYSITSQDAYLAGRADNAIKYIGTFG
FT                   GLSVSALYAFNRDGQETAGVNKLGREWSLGANYAAGPFSLGAVYDQSNGVYSNSSSLTA
FT                   AQNFANATTQADIKEQRATIAGTYAFGPAKLYAGYRWYKTNLVGTSGSVRSNLYWLGAG
FT                   YQATPALTLTGTAYYQQFKNTGTGNPWLFVVGTDYALSKRTDAYFNVAYAKNSSGSTLG
FT                   VAGFNGSSTNNNTVVSTDNQVFSNATNTNNQIGAVVGIRHKF"
FT   gene            complement(535552..536763)
FT                   /locus_tag="RCFBP_10519"
FT   CDS_pept        complement(535552..536763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10519"
FT                   /product="putative serine protease do-like precursor
FT                   (degP)"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10519"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41825"
FT                   /db_xref="GOA:D8NMY8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41825.1"
FT                   /translation="MLRRFWLFFAQAVTVVLAVLFVIATLKPEWLQRGKVAVQSGSPIV
FT                   ALKEVAPLGHSGTPSNSYAEAAKVAMPAVVNIFSSKNAPKRNNPQANADPWFRFFFGDR
FT                   LPEQRQEPVASLGSGVIVSPEGYILTNHHVVDGADEIEVALTDGRKANAKVVGTDPETD
FT                   LAVLKISLTNLPAITLGRLENVRVGDVVLAIGNPFGVGQTVTMGIVSALGRSHLGINTF
FT                   ENFIQTDAAINPGNSGGALVDAEGNLLGINTAIYSRSGGSLGIGFAIPVSLAKQVMESI
FT                   ISTGSVVRGWIGVEPQDVTPEIAESFGLSRKDGALIAAVVQGGPADRAGLRPGDILTNV
FT                   NGESIPDTTALLNSIAQLKPGTEAKVTVSRKGKPVELAIMVGKRPPPVRRNVPMPSSPE
FT                   DEQQ"
FT   gene            536783..537529
FT                   /locus_tag="RCFBP_10520"
FT   CDS_pept        536783..537529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10520"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10520"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41826"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMY9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41826.1"
FT                   /translation="MDRKELELYLNDLLQAARFRDYCPNGLQVQGREPITHIVTGVTAS
FT                   LALIDAAINIHADAILVHHGYFWKGEDARVVGQKHARLKQLLAHDVNLFAYHLPLDAHP
FT                   ELGNNAQLGALLGIRPTGRFGDDELGWIGTLPEATTLGAFAETVAVRLDRMPLVIGGAD
FT                   RPVQTVGWCTGGAQGWFDAAVSAGVDVYLSGEASEQTTHLARESGVAYIGAGHHATERG
FT                   GVRALGNHLAEHFGVRHTFIDIPNPV"
FT   gene            complement(537543..537968)
FT                   /gene="mscL"
FT                   /locus_tag="RCFBP_10521"
FT   CDS_pept        complement(537543..537968)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="RCFBP_10521"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 7511799, 8890153, 9632260; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10521"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41827"
FT                   /db_xref="GOA:D8NMZ0"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41827.1"
FT                   /translation="MALMQDFKKFAMRGNVIDLAVGVIIGAAFGKIVDSLVNDLIMPLV
FT                   ARIVGKLDFSNLFIQLADAPAGVPQTLADLKKAGVPVFAYGNFITVAVNFLILAFIVFL
FT                   MVRAITRVIDTSPPPADTPENTLLLRDIRDSLKSKNQ"
FT   gene            538214..538822
FT                   /gene="petA"
FT                   /locus_tag="RCFBP_10522"
FT   CDS_pept        538214..538822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="RCFBP_10522"
FT                   /product="Cytochrome bC1 complex (ubiquinol:ferricytochrome
FT                   c oxidoreductase), Rieske iron-sulfur subunit"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.10.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12441394, 12729720, 2176269; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10522"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41828"
FT                   /db_xref="GOA:D8NMZ1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41828.1"
FT                   /translation="MSDQQNVDKGRRNLLIATSVAGGVGGVAVAAPFVCTFAPSEKARA
FT                   AGAPVEADVSDLAPGQMKVVEWRGKPVWLLKRTPEMLESLKKTDAEVADPKSDVPFTMK
FT                   TPDYCKNETRSRAEHKDLLVVVGICSHLGCSPSGPFVSGANPQLGADPGFVCPCHGSTF
FT                   DLAGRVFKNKPAPQNLDVPPYMFLSDTKLMIGKDEKGEA"
FT   gene            538819..540228
FT                   /gene="petB"
FT                   /locus_tag="RCFBP_10523"
FT   CDS_pept        538819..540228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="RCFBP_10523"
FT                   /product="cytochrome bC1 complex (ubiquinol:ferricytochrome
FT                   c oxidoreductase), transmembrane subunit"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.10.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10978350, 1645718, 1647023, 2176269; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10523"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41829"
FT                   /db_xref="GOA:D8NMZ2"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41829.1"
FT                   /translation="MIMAAEKKVETTGLLGWIDARFPLTETWKAHLSEYYAPKNFNFWY
FT                   FFGSLALLVLVIQIVTGIFLVMNYKPDGTLNASGIPVAYASVEFIMREVPWGWLVRYMH
FT                   STGASAFFIVVYLHMFRGMLYGSYRKPRELVWIFGCLIFLCLMAEAFMGYLLPWGQMSY
FT                   WGAQVIVNLFSAIPLIGPDLSLWIRGDYVVSDATLNRFFSFHVIAVPLVLLGLVVAHVI
FT                   ALHEVGSNNPDGVEIKAKKDERGIPLDGIPFHPYYSVHDIVGVAVFLFLFSAVVFFAPE
FT                   MGGYFLEANNFIPADSLKTPPHIAPVWYFTPFYSMLRATTSAFLPILWGFLAIMLGLLF
FT                   VRCKSMRVKGVAVAVAVILALGFAFIDAKFWGVLVMGGSVVIFFFLPWLDQSPVKSIRY
FT                   RPGFHKVLLGIFVVAFGVLGYLGIQPPSPAGSIVSQIGTIVYFAFFLSMPIWSRMGTFK
FT                   PVPERITFKPH"
FT   gene            540255..541001
FT                   /gene="petC"
FT                   /locus_tag="RCFBP_10524"
FT   CDS_pept        540255..541001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="RCFBP_10524"
FT                   /product="Cytochrome bC1 complex (ubiquinol:ferricytochrome
FT                   c oxidoreductase), transmembrane subunit"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.10.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2176269, 2176595; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10524"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41830"
FT                   /db_xref="GOA:D8NMZ3"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41830.1"
FT                   /translation="MKKLLAIFALAGFIIAAPVFANEGGVRLDPAPNQAEDISALQRGA
FT                   KLFVNYCLNCHGASAMRYNRLRDLGLSEEQIKQNLLFTSDKVGDTMRVALDREDAKKWF
FT                   GVVPPDLSVIARARGSDWLYTYLRTFYRDDTRPTGWNNLVFDKVGMPHVLWELQGQRVP
FT                   KYEEVKSEHGGEMEHRLVGFEQVTPGKLNTVEYDQAVADIVTYLDWMAEPASKLRKRLG
FT                   VWVLLFIGVFFVLAWRLNAAYWKDIK"
FT   gene            541148..541759
FT                   /gene="sspA"
FT                   /locus_tag="RCFBP_10525"
FT   CDS_pept        541148..541759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspA"
FT                   /locus_tag="RCFBP_10525"
FT                   /product="stringent starvation protein A, regulator of
FT                   transcription"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 3029697; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10525"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41831"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41831.1"
FT                   /translation="MMVLYSGTTCPFSQRCRLVLFEKGMDFEIRDVDLFNKPEDIAVMN
FT                   PYGQVPILVERDLILYESNIINEYIDERFPHPQLMPADPVQRARARLFLFNFEKELFTH
FT                   VAVLENEKGKAAEKSHEKARAAIRDRLTQLAPIFLKNKYMLGEEFSMLDVAIAPLLWRL
FT                   DHYGIELSKNAAPLMKYAERIFSRPAYIEALTPSEKVMRR"
FT   gene            541820..542317
FT                   /gene="sspB"
FT                   /locus_tag="RCFBP_10526"
FT   CDS_pept        541820..542317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="RCFBP_10526"
FT                   /product="stringent starvation protein B, ClpXP protease
FT                   specificity-enhancing factor"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 17090685, 1721886; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10526"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41832"
FT                   /db_xref="GOA:D8NMZ5"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41832.1"
FT                   /translation="MSETSTKPYLIRAIYEWCTDNGFTPYIAVFVDNSTNVPREFVKND
FT                   EIVLNVSFDATSQLDMGNEWITFHARFSGVSRKIEVPINNVLAVYARENGQGMAFPVER
FT                   STPPAQAATERENNPPPKLSAVESESMPAPATVETQGGSDDEPTPPSVPRIGGKPSLKV
FT                   VK"
FT   gene            542347..542422
FT                   /locus_tag="RCFBP_tRNA8"
FT   tRNA            542347..542422
FT                   /locus_tag="RCFBP_tRNA8"
FT                   /product="tRNA-Thr"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(542618..543487)
FT                   /locus_tag="RCFBP_10527"
FT   CDS_pept        complement(542618..543487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10527"
FT                   /product="putative transcriptional regulatory protein, LysR
FT                   family"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10527"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41833"
FT                   /db_xref="GOA:D8NMZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41833.1"
FT                   /translation="MQTFVKAVELGSISAAATDLDLSPQLAGKHVRVLEQSLGIKLLNR
FT                   TTRRQNLTDSGRIFFERAKNILAEMAAAEALVAEARSVPRGRLRISAPITFGSHALAPA
FT                   IPEYLKVHPEVSVDLSLTNRTVDLIDEGFDVVFRTGELPDSGLLARNLAPLRLVLCAAP
FT                   AYLESAAKLRRPEDLQAHECLVFSHTSLRTQWSFDGPHGRVTIPIDGRFSTDSGEALRA
FT                   AAVGGLGIILQPHVLLEDEIEAGRLVRLLPKYEPPPRPLHAIYAPDKRMTPKLRSFLDF
FT                   AVRKFGLN"
FT   gene            543572..544420
FT                   /locus_tag="RCFBP_10528"
FT   CDS_pept        543572..544420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10528"
FT                   /product="putative hydrolases or acyltransferases
FT                   (Alpha/beta hydrolase superfamily)"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10528"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41834"
FT                   /db_xref="GOA:D8NMZ7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41834.1"
FT                   /translation="MGHPQQVLRKPLAFARSTLKGNLMQSLTKKAIVAATLGGAALISS
FT                   AASPGAADNQKPTVVLVHGAFADGSAWNKVIPILQEKGLKVVAVQNPLTSLADDVAATR
FT                   RVLDMQTGPVVLVGHSWGGAVITEAGQHDRVKSLVYVAAFAPSEGQSVADLTKDYPTPS
FT                   GFAHIVADKEGFLTLSPEGVEKHLAQDLPAEETKLMAATQGPVCAKNFEQKVAAAAWKT
FT                   KPSWYIVSEQDHMIQPALQAAMATKMSAHVLSLPAGHAPHLSRPAEVANVILAATNALV
FT                   K"
FT   gene            complement(544630..546027)
FT                   /locus_tag="RCFBP_10529"
FT   CDS_pept        complement(544630..546027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10529"
FT                   /product="exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10529"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41835"
FT                   /db_xref="InterPro:IPR018756"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41835.1"
FT                   /translation="MLTTILLNMVTRQMMMSLTRILLLIAALVSVSPALATPGQPLPAR
FT                   DWHRKAVGFSIGLYYLTVPGTDPVKIAHALAADKRFALRVVDKLDKSAQSQALLQILYS
FT                   SKVASDYAPPSIHSLHYVGRGLSPEQAEAVQKAPRALILTFAHPANQSITGLRRAEQFV
FT                   AELAKKGQAIIWDDETREAFTPEAWETSRLGTWDGDIPDISKQTVIHAYNNGKAIRAIS
FT                   LGMARFGLPDLVINDSTWSLNRPLGHTINAVGQQLVEAGPPSDSATVQLGLASIRHAAV
FT                   RKRLTDSILSGGKGEGRLRLLEAAPEAGDPNNALAALSFDTYPGRDTTERQINFVMTVF
FT                   GAQPDEVAYVKQSTALRAASERARSQLPALQQAFQRGLAPGEQLQVKAPFTTRDGSREW
FT                   MWIEVTEWKGDRIKGMLRNVPRNVPGLKAGQMVEARQSELFDYLRVFPDGRTEGNETAT
FT                   VLKQTAR"
FT   gene            complement(546034..546282)
FT                   /locus_tag="RCFBP_10530"
FT   CDS_pept        complement(546034..546282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10530"
FT                   /product="protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10530"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41836"
FT                   /db_xref="GOA:D8NMZ9"
FT                   /db_xref="UniProtKB/TrEMBL:D8NMZ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41836.1"
FT                   /translation="MKPALARKMMRLRWFVLGAWLLGVGIHLSIFISLPLPPNGVEWYA
FT                   SLAGFRGIVFLLTRLPLWVAGLCMLALVGYRIRHGRG"
FT   gene            complement(546279..546584)
FT                   /locus_tag="RCFBP_10531"
FT   CDS_pept        complement(546279..546584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10531"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10531"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41837"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41837.1"
FT                   /translation="MRKHFPALKEVSRVWVNVADHDGLREEPLSRLMDEYIAAEPLLIE
FT                   AHRKVAAALPKAEAIQYVREHLGRGTIRISDRAFRGFVVVAVNGVATGWSSPLADK"
FT   gene            547457..548755
FT                   /locus_tag="RCFBP_10532"
FT   CDS_pept        547457..548755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10532"
FT                   /product="Sensor protein, Histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number="2.7.13.3"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10532"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41838"
FT                   /db_xref="GOA:D8NN01"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41838.1"
FT                   /translation="MTQDSAIRQYPDRGLARMWRRLMSAVLNAIVADGARPMQLRRVRL
FT                   AGIIGVVGHPLYFVIWSYVFPQPYESVWLRGVCTLLFVPLLFAGRVAKYRWLPAYEAFA
FT                   ITVGLPFALVFLYLENAGVTVWAESLLVAIVILFHFRTAFAVFSLVTGATAATALFLLT
FT                   GRAAAGFPWHALLEQVPVLAFFFVVGVLVVIRLDRQILIEQKQHGMALALGTVAHELRT
FT                   PLASIALTANGIGSRLPQAVRPDHPDLPALQQAVERMRADVIRATNSIELLVANSKDPQ
FT                   AVGTAWFDPHEAICAAIDAYPFEPGARSHVHIAPGLGLRVLGNAGLFEHIITNLTKNAL
FT                   EAIQRVGKGDLRFGYERMPQAVEIVVRDTGAGVSPVVLKRMFQPFYSHPAHRGTGIGLT
FT                   FCRKVLHGWGAGISCRSVEHEFTEFRIRFPNPR"
FT   gene            complement(548769..550820)
FT                   /locus_tag="RCFBP_10533"
FT   CDS_pept        complement(548769..550820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10533"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10533"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41839"
FT                   /db_xref="GOA:D8NN02"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41839.1"
FT                   /translation="MAGPMSAFAGGLQQPEVQLEATTVVGSAAAAAATSEAASQGYVPH
FT                   AQLENRPLLRPGELLETVPGLIVTQHSGDGKANQYFLRGFNLDHGTDLATTVAGMPVNM
FT                   RTHAHGQGYTDLNFVIPELVSGIAYKKGTYFAEEGDFSAAGAVRIDYADKLPHGLAQFE
FT                   LGEYGYRRGLLANSNTVGPGTLLYGFEWLGENGPWVVPEGVHKLNGVLRYTLPLGGGER
FT                   VTVTGMAYKNTWQSTDQVPQRAIDEGLISRFGAIDPTDGGMASRYSLSADWLRPLADGQ
FT                   FKANAYVIKSRLTLFSNFTYALANPALGDQFEQFENRVTTGLNASRTWFGEIAGHDSET
FT                   EVGSQTRYDRLDPILLADTVARQPYAVVRSDTVNETSTALYLRNSIQWRPWLRTLAGLR
FT                   ADQFWYNVGSSNPLNSGSGAEHIVSPKLGVVLSPTAGTDVFINWGRGYHSNDVRGAATT
FT                   VDPVSGNPVQKVSVLVPATGYEIGVRTKELARGLQLSASLWRLDIGSELVFAGDTGTTE
FT                   PSRPSRRTGVELAAYYKPSPELILDADAAFSRARFRDADPVGDYIPEAIQTTASAGASW
FT                   THGRWTLGARLRYFGPRPLIEDNSVRSASSFLVNLKVGYRVQKNVRVFVEVLNALNRKV
FT                   NDIDYYYASLLKGETSPVDANSVATGINDRHIHPAEPRTVRAGIAWEF"
FT   gene            551317..553191
FT                   /gene="ggt"
FT                   /locus_tag="RCFBP_10535"
FT   CDS_pept        551317..553191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="RCFBP_10535"
FT                   /product="Gamma-glutamyltransferase"
FT                   /function="4.10 : Glutathione and analogs"
FT                   /EC_number="2.3.2.2"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8763966; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10535"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41840"
FT                   /db_xref="GOA:D8NN03"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41840.1"
FT                   /translation="MAFQASSLARVRGPLASAAALALLGACSTQTAVPAAATTPDGPAP
FT                   IGSEAPASEVASGYRSGMATVYAEKHMAAAANPLATEAGRRILRQGGSAIDAAVAMQAV
FT                   LTLVEPQASGIGGGAFLLYWDGKRVRAYDGRETAPAGVDANLFLRPDGTPMGFNEARIG
FT                   GRSVGAPGVLRVLELAHRQHGKLPWARLFQPAIELAEQGFPISPRLFTQVAADPFVAGA
FT                   PELAALYLTPDGKPKPVGTIVKNPQLAQTLREIARHGPGAFYTGPIAADIVKRVNGAGN
FT                   PGALSLADLRGYRAKARDPLCTDYKRWKVCGMPPPSSGGIAIAQMLGTLQALEARDPKY
FT                   ALAAMAPRQTTRAAGFEPTIDAVHAVSEAGRQADADRGLYVADADFVPVNVKGLTDPGY
FT                   LALRAGLIGDRSTGRADPGTPPGTSIALAPDRSPPRVSTSQIVAVDNAGGAVSMTTAIA
FT                   GDFGSHLMVRGFVLNSGLIDFSFAPNENGKPVANRVQAGKRPRSPMAPTLVFERDSGRL
FT                   VAALGSPGGSQITEYVSKTLIGLLDWDMDVQNAINLPNFGSRNGPTEVERGLVTQTLVQ
FT                   GLKARGHDVAQIEMTSGTQAIVRRPRDDGKQAWAGGADPRREGVVLGD"
FT   gene            complement(553275..555680)
FT                   /locus_tag="RCFBP_10536"
FT   CDS_pept        complement(553275..555680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10536"
FT                   /product="putative TonB-dependent siderophore receptor"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type prc : putative receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10536"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41841"
FT                   /db_xref="GOA:D8NN04"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41841.1"
FT                   /translation="MNRHRRPVRRSRVPRLATLAAAALFTSAAVAQSRVAIDIPAEPLD
FT                   VALNALARQAGVQLVFASALTAGKTAPRVQGHYSVEETLHRLLAQTGLTARRQGDDTFT
FT                   IEAAGSGAEVTLPATVATAAQAESANGPVRGYVARRSATGTKTDAPTEEIPQSISVVTR
FT                   DRFEAQGAQSVNEALRYTASVSSYGAGTRSDWYTAVRGFVPATDLDGLQLPNTINLASW
FT                   RVDPWQIERVELLRGPASVLYGQGDPGGTVNIVTKQPTTEPIHEIEVQYGSHARKQVAG
FT                   DFAGALDADGKLSYRLTALARDGNLPLGPFNDQRLMIAPSLTWKPSADTTLTLLASYLR
FT                   DKTNASDSFLPAQGTILPNPNGRIPATLFTGSPDFDAYEKTQYSLGYQFEHRLNDTWTV
FT                   RQNARYMHLKLDDRMTYGVGLDPSDPAQRTLLRYAGIAQPSYGRLDLDTQAQARFATGA
FT                   VRHTLLAGVDYQRQTAKDPENYALTSSLDLYNPVYRPTDLSIFSGTGASPQDIRQRQTL
FT                   LGLYLQDQVKLGERWVFTLGGRHDWSETRTDDLLGGTTAGQRDSAFTGRVGVVYLAPYG
FT                   ISPYLSYATSFNPTIGTDRNGQAFRPTKGRQVEAGVKVQAGSKASVTASVFRIHQTNVL
FT                   TPDLDDPSGTHSTQAGEVRSQGFELEATVQPIAGWNVIAAYTYQDVRNTRANDATLDKW
FT                   PIAIPTPRQIASLWMDYRIRTGVLQGVGIGAGVRYVSPVAGAPDNALKVPGYALFDAAL
FT                   FYNVGRHWRLALNGTNLANREVISGCYDATRCIYANGRTVLASAKYAW"
FT   gene            complement(555767..556591)
FT                   /locus_tag="RCFBP_10537"
FT   CDS_pept        complement(555767..556591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10537"
FT                   /product="putative iron transport-sensory transduction
FT                   protein (fecR)"
FT                   /function="13 : Signal transduction"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10537"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41842"
FT                   /db_xref="InterPro:IPR006860"
FT                   /db_xref="InterPro:IPR012373"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41842.1"
FT                   /translation="MSHTPEEFTREEASLARHRAALRQRFAMPPSPARTPRRRGPLIVA
FT                   GMVAVLGALLWADPAFHTQRYATAAGARQQIDLSDGTAVTLNTRTVAEVEWHLRSRQVQ
FT                   LVEGEALFDVARAWQPFIVRAGGTKVRVVGTAFNVRRADPRVTVTVLRGRVHVEDASGD
FT                   AVLLGPRQAADTGAGTLNAHTEPDPAAAVAWKDGKLLFDHTPLAQAVADINRYRVAPVT
FT                   LADPALGRLQISGVFDNARTDTLLDLLPSILPVTIRREADDAIRVLARNVPH"
FT   gene            complement(556594..557118)
FT                   /locus_tag="RCFBP_10538"
FT   CDS_pept        complement(556594..557118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10538"
FT                   /product="putative sigma 70 factor"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10538"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41843"
FT                   /db_xref="GOA:D8NN06"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41843.1"
FT                   /translation="MSCNPTTLPLLAALVRHYDELVDLLRRRFGTDRSAAHDVVHDVCV
FT                   SLLAEPPRQTVAAPAAYVRRATLNLAIDRHRTESTRGTWVESTADLPEHADETPGHDRH
FT                   IDAGRELDRLSAAIAQLPPRCREVFVLHKIHDMPQAEVAVTLGISRKAVEKHIRRGMSA
FT                   CRVALDRPGPR"
FT   gene            557689..558702
FT                   /gene="cyoA"
FT                   /locus_tag="RCFBP_10539"
FT   CDS_pept        557689..558702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoA"
FT                   /locus_tag="RCFBP_10539"
FT                   /product="cytochrome o ubiquinol oxidase, subunit II"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8618822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10539"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41844"
FT                   /db_xref="GOA:D8NN07"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR006333"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR010514"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR034227"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41844.1"
FT                   /translation="MSGSIDGATVQDMKNQSFPRLKRLLAASIPLLLSGCNLTVLDPKG
FT                   MIGAEEKTLIIVATALMLLVVIPVIVLTLVFAWKYRASNTKARYEPDWAHSNAIEVVVW
FT                   LIPCLIIIALGVITYRSTHALDPYKPIESDVKPITVEAVSLDWKWLFIYPELKIATVNQ
FT                   IAFPANTPVNFKITSDSVMNAFFIPQLGSQVYAMAGMQTKLHLIANETGTFDGMSSNYS
FT                   GAGFTGMKFKATAMTNEEFDAWVKQVRASSQNLTKEGYAELAKPSEKVPPAMYATVDPT
FT                   LYHSILHKYMGDSDKVLTLDEALEGATCNTATADAATRPLPVQSALPASAAARTNS"
FT   gene            558712..560691
FT                   /gene="cyoB"
FT                   /locus_tag="RCFBP_10540"
FT   CDS_pept        558712..560691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoB"
FT                   /locus_tag="RCFBP_10540"
FT                   /product="cytochrome o ubiquinol oxidase, subunit I"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8618822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10540"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41845"
FT                   /db_xref="GOA:D8NN08"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014207"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41845.1"
FT                   /translation="MFGKLSLEAIPLHEPIVVVTVSAILLGGAGLFGLITYLKKWSYLW
FT                   NEWITSVDHKKIGVMYCILAIVMLLRGFADAVMMRSQLALASGGGAGYLPPEHYDQIFT
FT                   AHGVIMIFFMAMPLMTGLINLIVPLQIGARDVAFPFLNTLSFWLAAAGVVLVNLSLGVG
FT                   NFARTGWLAYPPLSELAYSPDVGVDYYIWALQISGLGTLLTGVNFVATIFKMRAPGMTL
FT                   MRMPIFTWTALCANILIVAAFPVLTVALALLGADRYLDMHFFTNTAGGNPMLYVNLIWI
FT                   WGHPEVYILILPAFGMFSEIVSTFSRKKLFGYTSMVYATAGITVLSFLVWLHHFFTMGS
FT                   GANVNAFFGIATMIISIPTGVKIFNWLFTMYRGRVELNSMMLWTIGFMITFVIGGMTGV
FT                   LLAVPGADFLLHNSLFLIAHFHNTIIGGVVFGYLAGITFWFPKAFGFKLDEKWGKRAFW
FT                   CWFVGFYMAFMPLYVLGFMGMTRRLNHTDNPAWQPWLIVAVCGAALIACGIASQLIQIF
FT                   VSIRNRKALADVTGDPWGGRTLEWATSSPPAHYNFASVPVVRDIDAFADMKARGEVSTQ
FT                   VAASYEKIHMPKNTGAGFIMGMFSVVMGFGLIWHIWWMAALGLAGMIVSFIFRSNNDDI
FT                   DYYVPAQEVHETESAYFQRIGSQA"
FT   gene            560695..561330
FT                   /gene="cyoC"
FT                   /locus_tag="RCFBP_10541"
FT   CDS_pept        560695..561330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoC"
FT                   /locus_tag="RCFBP_10541"
FT                   /product="cytochrome o ubiquinol oxidase, subunit III"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8618822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10541"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41846"
FT                   /db_xref="GOA:D8NN09"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR014206"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033946"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41846.1"
FT                   /translation="MATNVLDGHAAHAADHGHAHDHAHHHDAADTKVFGFWVYLMSDLI
FT                   LFASLFATFCVLRSATAGGPNGKELFDLSYVLIETGILLVSSITYGMVMIGLQSGRKDQ
FT                   VMLWLGITFLLGAAFVGMEINEFHHLIAEGAGPSRSAFLSSFFTLVGTHGLHVASGLLW
FT                   IAVLMWQISRKGLTATNSTRLACLSLFWHFLDVVWIGVFTVVYLLGAM"
FT   gene            561331..561699
FT                   /gene="cyoD"
FT                   /locus_tag="RCFBP_10542"
FT   CDS_pept        561331..561699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyoD"
FT                   /locus_tag="RCFBP_10542"
FT                   /product="cytochrome o ubiquinol oxidase, subunit IV"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number="1.10.3.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8618822; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10542"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41847"
FT                   /db_xref="GOA:D8NN10"
FT                   /db_xref="InterPro:IPR005171"
FT                   /db_xref="InterPro:IPR014210"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41847.1"
FT                   /translation="MEQTNVSPNAVQGGAHGHAAGGAGHATVKGYLIGFVLAVILTVIP
FT                   FKMVMGGGFSHDTVLVTVMALAVVQIVVHLIYFLHLDGSSAQRWNVMAFLFTLLILAIV
FT                   IVGSLWVMHNMNINMMTH"
FT   gene            561836..563503
FT                   /locus_tag="RCFBP_10543"
FT   CDS_pept        561836..563503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10543"
FT                   /product="putative ATPase component of ABC transporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10543"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41848"
FT                   /db_xref="GOA:D8NN11"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41848.1"
FT                   /translation="MSQYVFTMNRVGKIVPPKRQILKDISLSFFPGAKIGVLGLNGSGK
FT                   STVLKIMAGLDKDIEGEATPMPNLNIGYLPQEPQLDPAKTVREEVESGLGEVMAAQKQL
FT                   EAIYAAYAEPDADFDKLAEEQARLEAIIAAGAGDNIELQLEIAADALRLPPWDAKIEHL
FT                   SGGEKRRVALCKLLLSRPDMLLLDEPTNHLDAESVEWLEQFLTRFPGTVVAVTHDRYFL
FT                   DNAAEWILELDRGHGIPWKGNYSSWLDQKENRLQQEEATESARQKALKKELEWVRQNPK
FT                   GRQAKSKARLARFDELNSQEYQKRNETQEIFIPTGERLGNEVIEFTNVSKGYGDRLLID
FT                   DLSFTIPAGAIVGIIGPNGAGKSTLFRMLTGKEQPDVGTIKMGPTVKLAYVDQSRDALD
FT                   GSKTVFEEISGGSDILTVGRYETPSRAYIGRFNFKGGDQQKHVGTLSGGERGRLHLAKT
FT                   LIAGGNVLLLDEPSNDLDVETLRALEDALLEFAGCVMVISHDRWFLDRIATHIIAFEGD
FT                   SHVEFFPGNYQEYEADKKKRLGEEGAKPKRIRYKPVIR"
FT   gene            complement(563500..563727)
FT                   /locus_tag="RCFBP_10544"
FT   CDS_pept        complement(563500..563727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10544"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10544"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41849"
FT                   /db_xref="GOA:D8NN12"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN12"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41849.1"
FT                   /translation="MADDVVITARNNGPYHIKGNFRIVTQGGRELPVEQGQAWLCRCGH
FT                   SLNKPFCDGSHKRIEFASDLDAPAAPEPPA"
FT   gene            complement(563754..564242)
FT                   /locus_tag="RCFBP_10545"
FT   CDS_pept        complement(563754..564242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10545"
FT                   /product="conserved protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10545"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41850"
FT                   /db_xref="GOA:D8NN13"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41850.1"
FT                   /translation="MSISSTLDSCLRSKGCLYEVVRHPHTHTSTETAQSAHIPGDRLAK
FT                   TLLLEDKYGYVAAVLPSTYHLHLSELQKQSGRSELTLSDESELREVFKDCDMGAVPPVG
FT                   MAYGMPTYVDDSLIQHRDVYFEAGDHENLVHMDMDQFMALMRDAQTAHFAHRMQGILF"
FT   gene            complement(564408..564728)
FT                   /locus_tag="RCFBP_10546"
FT   CDS_pept        complement(564408..564728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10546"
FT                   /product="putative signal peptide virulence protein Vrg-6"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10546"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41851"
FT                   /db_xref="InterPro:IPR024446"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41851.1"
FT                   /translation="MKRTLLAFVLGGAALCASTAALAHIDVGVSIGVPAPVYVAPAPVY
FT                   VPPPPVVYQPAPVYAPAPVYAPAPVVVGGGYYRDPYWREREWRRREWREREWHHHRGWD
FT                   RD"
FT   gene            complement(564905..567493)
FT                   /gene="opgH"
FT                   /locus_tag="RCFBP_10547"
FT   CDS_pept        complement(564905..567493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opgH"
FT                   /locus_tag="RCFBP_10547"
FT                   /product="Glucans biosynthesis glucosyltransferase H"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="2.4.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15313617, 7934824; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10547"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41852"
FT                   /db_xref="GOA:D8NN15"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR023725"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41852.1"
FT                   /translation="MELPATSGLNAQPGNAEGTAAAARRATALSVAERYLEALPLPAEA
FT                   RAALQREAGIVPADADAAALAKLHRALARLDATQAASLEGSAPAYASIGSRLDAAYGTA
FT                   RASAVTPEPAPPLEHDPAGRIHLDTGPEPARRSMVPWPWVLGPIWRARRAIGRLFAGGT
FT                   APEPYETPDSPDPKGIWRFVGARRRLTLLGLMIAQTVAATWAMSTVLPYHGHDWLEAII
FT                   IALFALLFCWVSAGFWTAITGFLLLAFHGDRFVISRRAAPNAPIPDDARTAIVMPICNE
FT                   DVQRVFAGLRATYESLQRTGHLEHFDFFVLSDSGDPDIRTAEADAWLHICRALDGFGRV
FT                   FYRWRRHRVKRKSGNIDDFCRRWGGRYRYMIVLDADSVMSGDCLTRLVQLMEGAPSAGI
FT                   IQTAPLAAGRDTLYARIQQFATRVYGPLFTAGLHYWQLGESHYWGHNAIIRLDPFIKHC
FT                   ALAPIPGKGSLSGEIMSHDFVEAALMRRAGWSVWIAYDLDGSYEEMPPNLLDELGRDRR
FT                   WCHGNLMNFRLFGSPGFHPVHRAVFVTGVMAYLSAPLWFLFLLLSTALLAKHTLIAPEY
FT                   FTQPRQLFPIWPEWHPEKAAALFSATATVLFLPKILSVLVLWAQGPRRFGGALHLALSM
FT                   MIEATFSVLAAPVRMLFHSRFVTAAFLGWKVHWKSPPRDDAQTHWGDAVRRHGLHTLLG
FT                   LGWAALVYWLNPSFLWWLSPVVGALIVSIPLSVFSSRVGLGRRMRRWRLFMIPEEVRPP
FT                   RELRAMRKHLRNAPSTPDFRLAVVDPVTNALMCAIGTARFPHDPKLLEVRDATVLQALA
FT                   AGPDKLTNKQKLVLLSDPLALSALHLAVWSSDLHRAAWLPPSAYVPQTTA"
FT   gene            complement(567466..568992)
FT                   /gene="opgG"
FT                   /locus_tag="RCFBP_10548"
FT   CDS_pept        complement(567466..568992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="opgG"
FT                   /locus_tag="RCFBP_10548"
FT                   /product="Glucans biosynthesis protein G precursor"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15313617, 7934824; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10548"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41853"
FT                   /db_xref="GOA:D8NN16"
FT                   /db_xref="InterPro:IPR007444"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014438"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR023704"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41853.1"
FT                   /translation="MAGCMRLAAGLLALASAQAVLAFGLNDVAARARQLAAKPYQAPAD
FT                   TLPHELRDLRYDQYREIRFKSDQAYWRKDKLPFELGFFHEGSYYDQPVNINEVSPAGVR
FT                   EIRFDPRLFDYGPVKLNPKQLRNLGFAGFRVHYPMNTPKYKDEVIVFLGATYFRGIGKG
FT                   QVYGLSARGLAIDTALNSGEEFPRFTDFWIERPAANAKELTIYALLNSRRATGAYRFVI
FT                   KPGTDTEVDVKAQLYMRENVSKLGIAPLTSMFFFGENQPAGALDFRPEVHDSDGLSVLS
FT                   GTGEWIWRPLTNPKRLLVSSFSTTNPGGFGLMQRDRAFSSYQEIGDRYELRPSAWVEPV
FT                   GKWGAGRVELVQIPTPDETNDNVVAYWVPETPPKPQQPFNLEYRLLWQKEGDKKPGLSW
FT                   VTQTRRSHGWTTKRPDERKPDDTIALVIDFEGPALAKLPPNAPVEPVFTADANGKIESI
FT                   FGQPNTATGGWRVTVRLKRVDDDKPIELRGYLRSGGTGLSETWSYLLPPG"
FT   gene            569339..570058
FT                   /locus_tag="RCFBP_10549"
FT   CDS_pept        569339..570058
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10549"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10549"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41854"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41854.1"
FT                   /translation="MTRWTHRAAALAFSTSLLAPMALAAPAAKDPAGQAPAKAVRDPGD
FT                   VAVLLDAFPLGKPLPKLPSCDDVRVGGGKDVSAYCSDALESHGRTRSLGVPSAKRPELM
FT                   DGPQAVLLVDQGNVAGLFVPTRGVDTEQRVYQALADRYGQPAQQAKVALQLKSGKAVDS
FT                   LRARWATHQTVVTMYAIPEEPQNGTVEFLWVPRAGAVMDQMRAEVDPDAPKPASGVAAS
FT                   APAANGKPAGANAAPQR"
FT   gene            570180..570341
FT                   /locus_tag="RCFBP_10550"
FT   CDS_pept        570180..570341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10550"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10550"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41855"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41855.1"
FT                   /translation="MKIVALALLAAVLGGCAVYPAPVAVAPAPVYVAPAPAYYGYWGPS
FT                   VRFNYYHR"
FT   gene            complement(570371..571012)
FT                   /gene="ubiX"
FT                   /locus_tag="RCFBP_10551"
FT   CDS_pept        complement(570371..571012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiX"
FT                   /locus_tag="RCFBP_10551"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /function="4.5 : Menaquinone and ubiquinone"
FT                   /function="6.1 : Aerobic"
FT                   /EC_number="4.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12799002, 782527, 9658014; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10551"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41856"
FT                   /db_xref="GOA:D8NN19"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41856.1"
FT                   /translation="MTSPLDVGFGPTASAQPATVRRIIVAITGASGAIYGVRLLQVLQG
FT                   LRDSAGVESHLLMSPAGLMNVQHELHMTREEVEALAHVVHNVRDIGATIASGSFAAEAM
FT                   VVAPCSMKTLAAVAHGLSDNLIARAADVTLKERRRLILMVRETPLNLAHLRNMTAVTEM
FT                   GGIVFPPVPGFYQRPKTIDDLVDHTVGRVLDLLGLPQTLAASWPGLYSAE"
FT   gene            complement(571033..571344)
FT                   /locus_tag="RCFBP_10552"
FT   CDS_pept        complement(571033..571344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10552"
FT                   /product="putative glutaredoxin-related protein"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pc : putative carrier"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10552"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41857"
FT                   /db_xref="GOA:D8NN20"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41857.1"
FT                   /translation="MSTTHEKIDQIVKSHPVVLFMKGTAQFPMCGFSGRAIQILKACGV
FT                   DQPHTINVLEDDEIRQGIKEYANWPTIPQLYIKGEFIGGSDIMMEMYQSGELQPLLSA"
FT   gene            complement(571421..572266)
FT                   /gene="prmC"
FT                   /locus_tag="RCFBP_10553"
FT   CDS_pept        complement(571421..572266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmC"
FT                   /locus_tag="RCFBP_10553"
FT                   /product="N5-glutamine methyltransferase, modifies release
FT                   factors RF-1 and RF-2"
FT                   /function="10.4 : Translation factors"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="12.3 : Protein interactions"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10553"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41858"
FT                   /db_xref="GOA:D8NN21"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41858.1"
FT                   /translation="MADALTALTGAGLPALEARMLVSHVTGLSRVQLITQDTYAIDNGV
FT                   RTRLAELATRRLAGEPMAYLLGEREFFGRLFQVTPAVLIPRPDTELLVEQALDRIEDRD
FT                   APDVLDLGTGSGIIAVTIALARRDARVWATDASADALAVAAGNAQALGAANVHVAHGDW
FT                   YGALPESDAPPAFDLIVSNPPYIASADAHLGQGDLRFEPAGALTDHGDGLRHLRTIVAG
FT                   APARLAADGWLLLEHGYDQGPAVRALLAEAGFADVFTARDLAGHDRCSGGRRLAAQDAA
FT                   "
FT   gene            complement(572410..572754)
FT                   /locus_tag="RCFBP_10554"
FT   CDS_pept        complement(572410..572754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10554"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10554"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41859"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41859.1"
FT                   /translation="MQTRLLTLAVAASLALGLAACGKQEGNPADAAKNVIQQSADAAKQ
FT                   AVDSASAAVGKAADAAQSGMTEVASGAQAAVNAASGAMADAKDAAKDAANKVADTAKEG
FT                   ADKVKEAAKQ"
FT   gene            complement(572940..574010)
FT                   /gene="prfA"
FT                   /locus_tag="RCFBP_10555"
FT   CDS_pept        complement(572940..574010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="RCFBP_10555"
FT                   /product="peptide chain release factor RF-1"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 3049538, 3889910; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10555"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41860"
FT                   /db_xref="GOA:D8NN23"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41860.1"
FT                   /translation="MLSKLDQLAERTVEINALLAREDATANLDQYRKLTREHAELEPVV
FT                   AQYATWKQAEDDVATAQELLADPDMKAFAEDELRAARERMTALEAELQRLLLPKDPNDH
FT                   RNIFLEIRAGTGGDESALFAGDLLRMYTRYAERQRWQVEIVSESASDLGGYKEVIARLV
FT                   GEGAYSRLKFESGGHRVQRVPATEAQGRIHTSACTVAVMPEADALADIQINPADLRIDT
FT                   FRASGAGGQHINKTDSAVRITHLPTGLVVECQDDRSQHRNKDRAMQVLAARLKDRQERE
FT                   AQAKEASARKSLIGSGDRSDRIRTYNFPQGRVTDHRINLTLYKIDALMDGDLDELLGTL
FT                   AAEHQAEQLAALGEDA"
FT   gene            complement(574118..575425)
FT                   /gene="hemA"
FT                   /locus_tag="RCFBP_10556"
FT   CDS_pept        complement(574118..575425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hemA"
FT                   /locus_tag="RCFBP_10556"
FT                   /product="Glutamyl-tRNA reductase (GluTR)"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number="1.2.1.70"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1569081, 2548996, 2664455; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10556"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41861"
FT                   /db_xref="GOA:D8NN24"
FT                   /db_xref="InterPro:IPR000343"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR015895"
FT                   /db_xref="InterPro:IPR015896"
FT                   /db_xref="InterPro:IPR018214"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036343"
FT                   /db_xref="InterPro:IPR036453"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41861.1"
FT                   /translation="MQLLTLGINHHTAPLSLREKVAFPLEQLKPALATLRQHLPHRKST
FT                   AEAAILSTCNRTELYCATDGNLPEDTAHEHAIRWLALHHNIDASELAPHVYALGQSQAV
FT                   RHAFRVASGLDSMVLGETQILGQMKDAVRTATEAGALGTYLNQLFQRTFAVAKEVRGNT
FT                   EIGAHSVSMAAAAVRLAQRIFESIAEQRVLFIGAGEMIELCATHFAAQKPREVVIANRT
FT                   LERGEKLAETLSNQGLNARAVRLAELPARLGEFDIVVSCTASTLPIIGLGAVERAIKQR
FT                   RHRPMFMVDLAVPRDIEPEVARLSDVFLYTVDDLGAIVREGNALRQAAVAQAEAIIETR
FT                   VQNFMHWLDARSVVPVIRDLHAHAEALRQGELERAQRMLARGDDPALVLEALSQALTKK
FT                   FLHGPTHALNHAQGEGREQLIDLLPGLFRQSSHSER"
FT   gene            575634..575876
FT                   /locus_tag="RCFBP_10557"
FT   CDS_pept        575634..575876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10557"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10557"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41862"
FT                   /db_xref="GOA:D8NN25"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41862.1"
FT                   /translation="MGWIGPLWVGLAVGAAARWLHPRGMRLGLLSAMLAGAAGALLAYY
FT                   GGQFARLYADGQVLAWTAAVVGAMVVPAAWGLLRG"
FT   gene            complement(575967..577061)
FT                   /gene="engD"
FT                   /locus_tag="RCFBP_10558"
FT   CDS_pept        complement(575967..577061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="engD"
FT                   /locus_tag="RCFBP_10558"
FT                   /product="GTP-dependent nucleic acid-binding protein engD"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12837776; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10558"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41863"
FT                   /db_xref="GOA:D8NN26"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41863.1"
FT                   /translation="MSLQCGIVGLPNVGKSTLFNALTKAGIAAENYPFCTIEPNVGVVE
FT                   VPDLRLSALADIVKPERVLPAVVEFVDIAGLVAGASKGEGLGNQFLANIRETDAITHVV
FT                   RCFEDENVVHVAGKVDPIADIEVINTELALADLATVEKAQARYSKAAKSGNDKEAAKLV
FT                   AVLDKARSVLDEAKAVRTLSLSDEEWALLKPLCLITAKPTMYVANVKDDGFENNPHLDA
FT                   VRAYAAQTGSPVVAVCAAIEAEIADLDDADKIEFLADMGMDEPGLNRVIRAAFKLLGLQ
FT                   TYFTAGVKEVRAWTIHIGDTAPRAAAAIHTDFERGFIRAQTIAYDDFIQYKGEQGAKEA
FT                   GKMRAEGKEYIVKDGDVLHFLFNV"
FT   gene            577512..577895
FT                   /locus_tag="RCFBP_10559"
FT   CDS_pept        577512..577895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10559"
FT                   /product="putative type III effector protein"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type ph : phenotype"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10559"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41864"
FT                   /db_xref="InterPro:IPR008622"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41864.1"
FT                   /translation="MSRTLATPRTPTLRPQQGSNSLFASYEAIASLSEEMVEAAEAGDW
FT                   EGVSALERECALYMERLGRAPSRPALSQEELQRKRDLMIRILANDARVRALVCPRQDQL
FT                   LRSMDTARRSIGARQAYAAVSYY"
FT   gene            complement(577924..578436)
FT                   /locus_tag="RCFBP_10560"
FT   CDS_pept        complement(577924..578436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10560"
FT                   /product="putative lytic transglycosylase, catalytic
FT                   protein"
FT                   /function="15.9 : Pathogenesis"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10560"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41865"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41865.1"
FT                   /translation="MVSPTPAQPVRCALPGGRRSPGLRWVHAGAALALCLSSLAALAAG
FT                   DCFEQAGAYQGVNPTVLRAIVWFESKGDPRAVHRNADGSVDIGQAQINSIHFGTLARYG
FT                   VPRHALTDACVNIYVAAWLLKQKMVKHGNTWRAIGAYHSETPAQRDAYARSIQRVLVTW
FT                   GELKPGQ"
FT   gene            complement(578463..578786)
FT                   /locus_tag="RCFBP_10561"
FT   CDS_pept        complement(578463..578786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10561"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10561"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41866"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41866.1"
FT                   /translation="MRRIRLSLFGLGLLAAVPSFAGPADTLASAATAAPDRVYPPLPTL
FT                   AMLPPPQTGGSEPAAPAATGRRKTATIKLRKSAEPTPRMVVSDTSHAYLASLEHQLEQA
FT                   LQK"
FT   gene            complement(578797..579183)
FT                   /locus_tag="RCFBP_10562"
FT   CDS_pept        complement(578797..579183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10562"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10562"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41867"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41867.1"
FT                   /translation="MFKAHSLSRLTGGAAILALVGCAQLPLPPGSTPQANRGPSGEIMT
FT                   FTIPPDALGAHDPQLTAVLTKAGALAAAQRQPATILVTALTQDFRYLNQALWNGVPAQR
FT                   ASHVHLENLTVGASQPYTVTIKTD"
FT   gene            579626..580786
FT                   /gene="ubiF"
FT                   /locus_tag="RCFBP_10563"
FT   CDS_pept        579626..580786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiF"
FT                   /locus_tag="RCFBP_10563"
FT                   /product="2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol
FT                   oxygenase"
FT                   /function="4.5 : Menaquinone and ubiquinone"
FT                   /function="6.1 : Aerobic"
FT                   /EC_number="1.14.13.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10802164; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10563"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41868"
FT                   /db_xref="GOA:D8NN31"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41868.1"
FT                   /translation="MAPVTSPAPMPTGPDAWDARVYAFSSSSQALLEQLRIWPALDMSR
FT                   VQPVQDMRVFGDEAAARGEYAHADLHFSAYAAGAPQLAWIAESSLIERALETALRFAHT
FT                   VQTFTHAATGFEMEADAVRLTLANGQAIRAECVVGADGKQSWVRQQAGISADAKPYRQL
FT                   GVVANFQAEHWHQDTAWQWFLGTSAEGARAPDDQAPARGEILAMLPLPDRRVSMVWSAD
FT                   EDHARDLLALSPDALCRAVEAAAGGAVAARFGRLSCITPAQGFPLVLQHAGRLVAPRVA
FT                   LVGDAAHVIHPLAGQGMNLGLRDVAELGRVMAERETMRDHGDLRLLRRYERARREDLLS
FT                   LTAATDGLHTLFALPGTLPRVVRNAGMRVASLTPFIKRLLVRHALG"
FT   gene            580819..581565
FT                   /locus_tag="RCFBP_10564"
FT   CDS_pept        580819..581565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10564"
FT                   /product="putative thiol:disulphide interchange protein
FT                   (DsbC-like)"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10564"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41869"
FT                   /db_xref="GOA:D8NN32"
FT                   /db_xref="InterPro:IPR009094"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR018950"
FT                   /db_xref="InterPro:IPR033954"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41869.1"
FT                   /translation="MSFRIRVAAIASAALVAAMGAGYALTAGAAEPALDKVKVSVQKAL
FT                   GPSVEIKGVAKSPLPGLYEVNLGNQVVYTDATGRYVLNGDLLDTQTATNLTQERMTEIN
FT                   RVKWSDLPLDQAVKWVKGNGARKIAVFSDPNCPYCHKLEQMFSQVDNITVYTFLLPILS
FT                   EDSSVKAKQIWCSADRAKAWRDWMVSKSAPGGAGNCDTPLEDNLKLGRALNVNGTPAII
FT                   FMDGSRAPGLIDAAALERKFASLKKS"
FT   gene            581646..582662
FT                   /locus_tag="RCFBP_10565"
FT   CDS_pept        581646..582662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10565"
FT                   /product="putative NADPH:quinone reductase, GroES-like
FT                   domain"
FT                   /function="6.5 : Electron transport"
FT                   /function="16.7 : Manage energy"
FT                   /EC_number="1.6.5.5"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:RCFBP_10565"
FT                   /db_xref="EnsemblGenomes-Tr:CBJ41870"
FT                   /db_xref="GOA:D8NN33"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8NN33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBJ41870.1"
FT                   /translation="MSFRALMLEKQEGGTLARVTDLDDAALSSPAALADALTAGDVLVR
FT                   IDWSTINYKDGLAITGRGPVVRKWPMVAGIDGAGTVIESSHPDWKAGDAVVLNGWGVGE
FT                   THWGCLAQRARLSGDWLVALPAGLDTRSAMAIGTAGYTAMLSVLALERSGVRPGDGEVL
FT                   VTGASGGVGSIAIAVLGKLGYRVVASTGKTAEADFLRGLGAAEVIDRAELSAPGKPLQK
FT                   ERWAAVVDSVGSHTLANACAQVRHGGTVTACGLAQGMDFPATVAPFILRGITVHGIDSV
FT                   TAPRALRQTAWQRLSTDLAPDRLAAITHEITLGEAIGAAHDILAGKIRGRVVVDVNR"
FT   gene            582693..584600
FT                   /locus_tag="RCFBP_10566"
FT   CDS_pept        582693..584600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCFBP_10566"
FT                   /product="putative metallopeptidase M61 family"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homolog