(data stored in ACNUC7421 zone)

EMBL: FP929003

ID   FP929003; SV 1; circular; genomic DNA; STD; PRO; 4317083 BP.
AC   FP929003;
PR   Project:PRJEA46433;
DT   13-JUL-2010 (Rel. 105, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 2)
DE   Candidatus Nitrospira defluvii chromosome, complete genome.
KW   .
OS   Nitrospira defluvii
OC   Bacteria; Nitrospirae; Nitrospirales; Nitrospiraceae; Nitrospira.
RN   [1]
RP   1-4317083
RA   Genoscope - CEA;
RT   ;
RL   Submitted (10-MAR-2010) to the INSDC.
RL   Genoscope - Centre National de Sequencage : BP 191 91006 EVRY cedex -
RL   FRANCE (E-mail : seqref@genoscope.cns.fr - Web : www.genoscope.cns.fr).
RN   [2]
RP   1-4317083
RX   DOI; 10.1073/pnas.1003860107 .
RA   Lucker S., Wagner M., Maixner F., Pelletier E., Koch H., Vacherie B.,
RA   Rattei T., Sinninghe Damste J., Spieck E., Le Paslier D., Daims H.;
RT   "A Nitrospira metagenome illuminates the physiology and evolution of
RT   globally important nitrite-oxidizing bacteria";
RL   Proc. Natl. Acad. Sci. U.S.A. 0:0(2010).
DR   MD5; 16d72509af187086382d657ccf9ff467.
DR   BioSample; SAMEA2272290.
DR   EnsemblGenomes-Gn; EBG00001436353.
DR   EnsemblGenomes-Gn; EBG00001436354.
DR   EnsemblGenomes-Gn; EBG00001436355.
DR   EnsemblGenomes-Gn; EBG00001436356.
DR   EnsemblGenomes-Gn; EBG00001436357.
DR   EnsemblGenomes-Gn; EBG00001436358.
DR   EnsemblGenomes-Gn; EBG00001436359.
DR   EnsemblGenomes-Gn; EBG00001436360.
DR   EnsemblGenomes-Gn; EBG00001436361.
DR   EnsemblGenomes-Gn; EBG00001436362.
DR   EnsemblGenomes-Gn; EBG00001436363.
DR   EnsemblGenomes-Gn; EBG00001436364.
DR   EnsemblGenomes-Gn; EBG00001436365.
DR   EnsemblGenomes-Gn; EBG00001436366.
DR   EnsemblGenomes-Gn; EBG00001436367.
DR   EnsemblGenomes-Gn; EBG00001436368.
DR   EnsemblGenomes-Gn; EBG00001436369.
DR   EnsemblGenomes-Gn; EBG00001436370.
DR   EnsemblGenomes-Gn; EBG00001436371.
DR   EnsemblGenomes-Gn; EBG00001436372.
DR   EnsemblGenomes-Gn; EBG00001436373.
DR   EnsemblGenomes-Gn; EBG00001436374.
DR   EnsemblGenomes-Gn; EBG00001436375.
DR   EnsemblGenomes-Gn; EBG00001436376.
DR   EnsemblGenomes-Gn; EBG00001436377.
DR   EnsemblGenomes-Gn; EBG00001436378.
DR   EnsemblGenomes-Gn; EBG00001436379.
DR   EnsemblGenomes-Gn; EBG00001436380.
DR   EnsemblGenomes-Gn; EBG00001436381.
DR   EnsemblGenomes-Gn; EBG00001436382.
DR   EnsemblGenomes-Gn; EBG00001436383.
DR   EnsemblGenomes-Gn; EBG00001436384.
DR   EnsemblGenomes-Gn; EBG00001436385.
DR   EnsemblGenomes-Gn; EBG00001436386.
DR   EnsemblGenomes-Gn; EBG00001436387.
DR   EnsemblGenomes-Gn; EBG00001436388.
DR   EnsemblGenomes-Gn; EBG00001436389.
DR   EnsemblGenomes-Gn; EBG00001436390.
DR   EnsemblGenomes-Gn; EBG00001436391.
DR   EnsemblGenomes-Gn; EBG00001436392.
DR   EnsemblGenomes-Gn; EBG00001436393.
DR   EnsemblGenomes-Gn; EBG00001436394.
DR   EnsemblGenomes-Gn; EBG00001436395.
DR   EnsemblGenomes-Gn; EBG00001436396.
DR   EnsemblGenomes-Gn; EBG00001436397.
DR   EnsemblGenomes-Gn; EBG00001436398.
DR   EnsemblGenomes-Gn; EBG00001436399.
DR   EnsemblGenomes-Gn; EBG00001436400.
DR   EnsemblGenomes-Gn; EBG00001436401.
DR   EnsemblGenomes-Gn; EBG00001436402.
DR   EnsemblGenomes-Gn; EBG00001436403.
DR   EnsemblGenomes-Gn; EBG00001436404.
DR   EnsemblGenomes-Gn; EBG00001436405.
DR   EnsemblGenomes-Gn; EBG00001436406.
DR   EnsemblGenomes-Gn; EBG00001436407.
DR   EnsemblGenomes-Gn; EBG00001436408.
DR   EnsemblGenomes-Gn; NIDE0154.
DR   EnsemblGenomes-Gn; NIDE0291.
DR   EnsemblGenomes-Gn; NIDE1424.
DR   EnsemblGenomes-Gn; NIDE_16S_1.
DR   EnsemblGenomes-Gn; NIDE_5S_1.
DR   EnsemblGenomes-Gn; NIDErRNA1386600D.
DR   EnsemblGenomes-Gn; NIDEtRNA1.
DR   EnsemblGenomes-Gn; NIDEtRNA10.
DR   EnsemblGenomes-Gn; NIDEtRNA11.
DR   EnsemblGenomes-Gn; NIDEtRNA12.
DR   EnsemblGenomes-Gn; NIDEtRNA13.
DR   EnsemblGenomes-Gn; NIDEtRNA14.
DR   EnsemblGenomes-Gn; NIDEtRNA15.
DR   EnsemblGenomes-Gn; NIDEtRNA16.
DR   EnsemblGenomes-Gn; NIDEtRNA17.
DR   EnsemblGenomes-Gn; NIDEtRNA18.
DR   EnsemblGenomes-Gn; NIDEtRNA19.
DR   EnsemblGenomes-Gn; NIDEtRNA2.
DR   EnsemblGenomes-Gn; NIDEtRNA20.
DR   EnsemblGenomes-Gn; NIDEtRNA21.
DR   EnsemblGenomes-Gn; NIDEtRNA22.
DR   EnsemblGenomes-Gn; NIDEtRNA23.
DR   EnsemblGenomes-Gn; NIDEtRNA24.
DR   EnsemblGenomes-Gn; NIDEtRNA25.
DR   EnsemblGenomes-Gn; NIDEtRNA26.
DR   EnsemblGenomes-Gn; NIDEtRNA27.
DR   EnsemblGenomes-Gn; NIDEtRNA28.
DR   EnsemblGenomes-Gn; NIDEtRNA29.
DR   EnsemblGenomes-Gn; NIDEtRNA3.
DR   EnsemblGenomes-Gn; NIDEtRNA30.
DR   EnsemblGenomes-Gn; NIDEtRNA31.
DR   EnsemblGenomes-Gn; NIDEtRNA32.
DR   EnsemblGenomes-Gn; NIDEtRNA33.
DR   EnsemblGenomes-Gn; NIDEtRNA34.
DR   EnsemblGenomes-Gn; NIDEtRNA35.
DR   EnsemblGenomes-Gn; NIDEtRNA36.
DR   EnsemblGenomes-Gn; NIDEtRNA37.
DR   EnsemblGenomes-Gn; NIDEtRNA38.
DR   EnsemblGenomes-Gn; NIDEtRNA39.
DR   EnsemblGenomes-Gn; NIDEtRNA4.
DR   EnsemblGenomes-Gn; NIDEtRNA40.
DR   EnsemblGenomes-Gn; NIDEtRNA41.
DR   EnsemblGenomes-Gn; NIDEtRNA42.
DR   EnsemblGenomes-Gn; NIDEtRNA43.
DR   EnsemblGenomes-Gn; NIDEtRNA44.
DR   EnsemblGenomes-Gn; NIDEtRNA45.
DR   EnsemblGenomes-Gn; NIDEtRNA46.
DR   EnsemblGenomes-Gn; NIDEtRNA5.
DR   EnsemblGenomes-Gn; NIDEtRNA6.
DR   EnsemblGenomes-Gn; NIDEtRNA7.
DR   EnsemblGenomes-Gn; NIDEtRNA8.
DR   EnsemblGenomes-Gn; NIDEtRNA9.
DR   EnsemblGenomes-Tr; EBT00001814481.
DR   EnsemblGenomes-Tr; EBT00001814482.
DR   EnsemblGenomes-Tr; EBT00001814483.
DR   EnsemblGenomes-Tr; EBT00001814484.
DR   EnsemblGenomes-Tr; EBT00001814485.
DR   EnsemblGenomes-Tr; EBT00001814486.
DR   EnsemblGenomes-Tr; EBT00001814487.
DR   EnsemblGenomes-Tr; EBT00001814488.
DR   EnsemblGenomes-Tr; EBT00001814489.
DR   EnsemblGenomes-Tr; EBT00001814490.
DR   EnsemblGenomes-Tr; EBT00001814491.
DR   EnsemblGenomes-Tr; EBT00001814492.
DR   EnsemblGenomes-Tr; EBT00001814493.
DR   EnsemblGenomes-Tr; EBT00001814494.
DR   EnsemblGenomes-Tr; EBT00001814495.
DR   EnsemblGenomes-Tr; EBT00001814496.
DR   EnsemblGenomes-Tr; EBT00001814497.
DR   EnsemblGenomes-Tr; EBT00001814498.
DR   EnsemblGenomes-Tr; EBT00001814499.
DR   EnsemblGenomes-Tr; EBT00001814500.
DR   EnsemblGenomes-Tr; EBT00001814501.
DR   EnsemblGenomes-Tr; EBT00001814502.
DR   EnsemblGenomes-Tr; EBT00001814503.
DR   EnsemblGenomes-Tr; EBT00001814504.
DR   EnsemblGenomes-Tr; EBT00001814505.
DR   EnsemblGenomes-Tr; EBT00001814506.
DR   EnsemblGenomes-Tr; EBT00001814507.
DR   EnsemblGenomes-Tr; EBT00001814508.
DR   EnsemblGenomes-Tr; EBT00001814509.
DR   EnsemblGenomes-Tr; EBT00001814510.
DR   EnsemblGenomes-Tr; EBT00001814511.
DR   EnsemblGenomes-Tr; EBT00001814512.
DR   EnsemblGenomes-Tr; EBT00001814513.
DR   EnsemblGenomes-Tr; EBT00001814514.
DR   EnsemblGenomes-Tr; EBT00001814515.
DR   EnsemblGenomes-Tr; EBT00001814516.
DR   EnsemblGenomes-Tr; EBT00001814517.
DR   EnsemblGenomes-Tr; EBT00001814518.
DR   EnsemblGenomes-Tr; EBT00001814519.
DR   EnsemblGenomes-Tr; EBT00001814520.
DR   EnsemblGenomes-Tr; EBT00001814521.
DR   EnsemblGenomes-Tr; EBT00001814522.
DR   EnsemblGenomes-Tr; EBT00001814523.
DR   EnsemblGenomes-Tr; EBT00001814524.
DR   EnsemblGenomes-Tr; EBT00001814525.
DR   EnsemblGenomes-Tr; EBT00001814526.
DR   EnsemblGenomes-Tr; EBT00001814527.
DR   EnsemblGenomes-Tr; EBT00001814528.
DR   EnsemblGenomes-Tr; EBT00001814529.
DR   EnsemblGenomes-Tr; EBT00001814530.
DR   EnsemblGenomes-Tr; EBT00001814531.
DR   EnsemblGenomes-Tr; EBT00001814532.
DR   EnsemblGenomes-Tr; EBT00001814533.
DR   EnsemblGenomes-Tr; EBT00001814534.
DR   EnsemblGenomes-Tr; EBT00001814535.
DR   EnsemblGenomes-Tr; EBT00001814536.
DR   EnsemblGenomes-Tr; NIDE0154.
DR   EnsemblGenomes-Tr; NIDE0291.
DR   EnsemblGenomes-Tr; NIDE1424.
DR   EnsemblGenomes-Tr; NIDE_16S_1-1.
DR   EnsemblGenomes-Tr; NIDE_5S_1-1.
DR   EnsemblGenomes-Tr; NIDErRNA1386600D-1.
DR   EnsemblGenomes-Tr; NIDEtRNA1-1.
DR   EnsemblGenomes-Tr; NIDEtRNA10-1.
DR   EnsemblGenomes-Tr; NIDEtRNA11-1.
DR   EnsemblGenomes-Tr; NIDEtRNA12-1.
DR   EnsemblGenomes-Tr; NIDEtRNA13-1.
DR   EnsemblGenomes-Tr; NIDEtRNA14-1.
DR   EnsemblGenomes-Tr; NIDEtRNA15-1.
DR   EnsemblGenomes-Tr; NIDEtRNA16-1.
DR   EnsemblGenomes-Tr; NIDEtRNA17-1.
DR   EnsemblGenomes-Tr; NIDEtRNA18-1.
DR   EnsemblGenomes-Tr; NIDEtRNA19-1.
DR   EnsemblGenomes-Tr; NIDEtRNA2-1.
DR   EnsemblGenomes-Tr; NIDEtRNA20-1.
DR   EnsemblGenomes-Tr; NIDEtRNA21-1.
DR   EnsemblGenomes-Tr; NIDEtRNA22-1.
DR   EnsemblGenomes-Tr; NIDEtRNA23-1.
DR   EnsemblGenomes-Tr; NIDEtRNA24-1.
DR   EnsemblGenomes-Tr; NIDEtRNA25-1.
DR   EnsemblGenomes-Tr; NIDEtRNA26-1.
DR   EnsemblGenomes-Tr; NIDEtRNA27-1.
DR   EnsemblGenomes-Tr; NIDEtRNA28-1.
DR   EnsemblGenomes-Tr; NIDEtRNA29-1.
DR   EnsemblGenomes-Tr; NIDEtRNA3-1.
DR   EnsemblGenomes-Tr; NIDEtRNA30-1.
DR   EnsemblGenomes-Tr; NIDEtRNA31-1.
DR   EnsemblGenomes-Tr; NIDEtRNA32-1.
DR   EnsemblGenomes-Tr; NIDEtRNA33-1.
DR   EnsemblGenomes-Tr; NIDEtRNA34-1.
DR   EnsemblGenomes-Tr; NIDEtRNA35-1.
DR   EnsemblGenomes-Tr; NIDEtRNA36-1.
DR   EnsemblGenomes-Tr; NIDEtRNA37-1.
DR   EnsemblGenomes-Tr; NIDEtRNA38-1.
DR   EnsemblGenomes-Tr; NIDEtRNA39-1.
DR   EnsemblGenomes-Tr; NIDEtRNA4-1.
DR   EnsemblGenomes-Tr; NIDEtRNA40-1.
DR   EnsemblGenomes-Tr; NIDEtRNA41-1.
DR   EnsemblGenomes-Tr; NIDEtRNA42-1.
DR   EnsemblGenomes-Tr; NIDEtRNA43-1.
DR   EnsemblGenomes-Tr; NIDEtRNA44-1.
DR   EnsemblGenomes-Tr; NIDEtRNA45-1.
DR   EnsemblGenomes-Tr; NIDEtRNA46-1.
DR   EnsemblGenomes-Tr; NIDEtRNA5-1.
DR   EnsemblGenomes-Tr; NIDEtRNA6-1.
DR   EnsemblGenomes-Tr; NIDEtRNA7-1.
DR   EnsemblGenomes-Tr; NIDEtRNA8-1.
DR   EnsemblGenomes-Tr; NIDEtRNA9-1.
DR   EuropePMC; PMC2922143; 20624973.
DR   EuropePMC; PMC3243026; 22190904.
DR   EuropePMC; PMC3834237; 24312089.
DR   EuropePMC; PMC4032944; 24904540.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; FP929003.
DR   SILVA-SSU; FP929003.
CC   Annotation results relative to BLAST similarities, COG assignations,
CC   enzymatic function prediction (PRIAM software), TMHMM and SignalP
CC   predictions, and synteny conservation (Syntonizer software) are available
CC   in the MaGe annotation system
CC   http://www.genoscope.cns.fr/agc/mage.
FH   Key             Location/Qualifiers
FT   source          1..4317083
FT                   /organism="Nitrospira defluvii"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:330214"
FT   gene            158..1498
FT                   /gene="dnaA"
FT                   /locus_tag="NIDE0001"
FT   CDS_pept        158..1498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="NIDE0001"
FT                   /product="Chromosomal replication initiator protein DnaA"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11948168, 12682358, 2558436, 3040670, 6234204, 9255428;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0001"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39789"
FT                   /db_xref="GOA:D8P7E7"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7E7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39789.1"
FT   gene            1521..2651
FT                   /gene="dnaN"
FT                   /locus_tag="NIDE0002"
FT   CDS_pept        1521..2651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="NIDE0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12832762, 1349852, 14592985, 1575709; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0002"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39790"
FT                   /db_xref="GOA:D8P7E8"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7E8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39790.1"
FT   gene            2805..5279
FT                   /gene="gyrB"
FT                   /locus_tag="NIDE0003"
FT   CDS_pept        2805..5279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="NIDE0003"
FT                   /product="DNA gyrase, subunit B"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1646964, 2174443, 3029031, 3029692, 7793912, 9464408;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0003"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39791"
FT                   /db_xref="GOA:D8P7E9"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7E9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39791.1"
FT                   QQHALEVRNLDV"
FT   gene            5457..7919
FT                   /gene="gyrA"
FT                   /locus_tag="NIDE0004"
FT   CDS_pept        5457..7919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="NIDE0004"
FT                   /product="DNA gyrase, subunit A"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1311298, 1850970, 2160946, 2828631, 3031051, 8388872,
FT                   8849216, 9278055; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0004"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39792"
FT                   /db_xref="GOA:D8P7F0"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39792.1"
FT                   GVPEEGES"
FT   gene            7993..8580
FT                   /locus_tag="NIDE0005"
FT   CDS_pept        7993..8580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0005"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0005"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39793"
FT                   /db_xref="GOA:D8P7F1"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39793.1"
FT   gene            complement(8519..9025)
FT                   /locus_tag="NIDE0006"
FT   CDS_pept        complement(8519..9025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0006"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0006"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39794"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39794.1"
FT                   ARRSP"
FT   gene            9078..9557
FT                   /gene="smpB"
FT                   /locus_tag="NIDE0007"
FT   CDS_pept        9078..9557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="NIDE0007"
FT                   /product="SsrA-binding protein"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10393194, 11724528, 11927568, 12904796; Product type f :
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0007"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39795"
FT                   /db_xref="GOA:D8P7F3"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39795.1"
FT   gene            9878..10324
FT                   /locus_tag="NIDE0008"
FT   CDS_pept        9878..10324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0008"
FT                   /product="conserved membrane protein of unknown function,
FT                   DoxX family"
FT                   /function="18 : Unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 15306018"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0008"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39796"
FT                   /db_xref="GOA:D8P7F4"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39796.1"
FT   gene            10346..11203
FT                   /locus_tag="NIDE0009"
FT   CDS_pept        10346..11203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0009"
FT                   /product="conserved protein of unknown function, NmrA-like"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11726498, 12764138"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0009"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39797"
FT                   /db_xref="InterPro:IPR008030"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39797.1"
FT                   RGLA"
FT   gene            11217..12101
FT                   /locus_tag="NIDE0010"
FT   CDS_pept        11217..12101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0010"
FT                   /product="conserved protein of unknown function,
FT                   Pirin-like"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10802738, 11264412,
FT                   12426136, 14573596, 9079676"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0010"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39798"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39798.1"
FT                   VHDYQAGKMGHLS"
FT   gene            12098..12739
FT                   /locus_tag="NIDE0011"
FT   CDS_pept        12098..12739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0011"
FT                   /product="putative thiol oxidoreductase, DsbA family, FrnE
FT                   subfamily"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15755450, 17110337, 1934062, 8413591,
FT                   8494885, 8521518, 9149147, 9655827; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0011"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39799"
FT                   /db_xref="GOA:D8P7F7"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39799.1"
FT   gene            12753..13202
FT                   /locus_tag="NIDE0012"
FT   CDS_pept        12753..13202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0012"
FT                   /product="putative Glyoxalase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7684374, 9338493; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0012"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39800"
FT                   /db_xref="GOA:D8P7F8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39800.1"
FT   gene            13195..13653
FT                   /locus_tag="NIDE0013"
FT   CDS_pept        13195..13653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0013"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0013"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39801"
FT                   /db_xref="InterPro:IPR031849"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7F9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39801.1"
FT   gene            13690..14796
FT                   /locus_tag="NIDE0014"
FT   CDS_pept        13690..14796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0014"
FT                   /product="putative Dioxygenase, ferredoxin subunit, and
FT                   Flavodoxin (modular protein)"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0014"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39802"
FT                   /db_xref="GOA:D8P7G0"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39802.1"
FT   gene            14826..15248
FT                   /locus_tag="NIDE0015"
FT   CDS_pept        14826..15248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0015"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0015"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39803"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39803.1"
FT   gene            15245..15691
FT                   /locus_tag="NIDE0016"
FT   CDS_pept        15245..15691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0016"
FT                   /product="putative Glyoxalase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10913283, 7684374; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0016"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39804"
FT                   /db_xref="GOA:D8P7G2"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39804.1"
FT   gene            16025..16261
FT                   /locus_tag="NIDE0017"
FT   CDS_pept        16025..16261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0017"
FT                   /product="conserved protein of unknown function, contains
FT                   CDGSH-type FeS domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0017"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39805"
FT                   /db_xref="GOA:D8P7G3"
FT                   /db_xref="InterPro:IPR018967"
FT                   /db_xref="InterPro:IPR042216"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39805.1"
FT   gene            16307..17047
FT                   /locus_tag="NIDE0018"
FT   CDS_pept        16307..17047
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0018"
FT                   /product="putative Ferredoxin-NAD(+) reductase"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15789405, 16128574, 1748631, 1908607,
FT                   1986412, 2319593, 8027025; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0018"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39806"
FT                   /db_xref="GOA:D8P7G4"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39806.1"
FT   gene            complement(17041..17220)
FT                   /locus_tag="NIDE0019"
FT   CDS_pept        complement(17041..17220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0019"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0019"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39807"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39807.1"
FT                   KERRQRRDEGVLRQ"
FT   gene            17355..17696
FT                   /gene="pchC"
FT                   /locus_tag="NIDE0020"
FT   CDS_pept        17355..17696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pchC"
FT                   /locus_tag="NIDE0020"
FT                   /product="4-cresol dehydrogenase (hydroxylating),
FT                   cytochrome c subunit"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10565539, 10623531, 1646017, 17146057, 1846290, 3790500,
FT                   7929007; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0020"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39808"
FT                   /db_xref="GOA:D8P7G6"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39808.1"
FT                   YVSKAAANQ"
FT   gene            17711..18589
FT                   /locus_tag="NIDE0021"
FT   CDS_pept        17711..18589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0021"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0021"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39809"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39809.1"
FT                   TQRFVSFVMDM"
FT   gene            18608..20152
FT                   /gene="pchF"
FT                   /locus_tag="NIDE0022"
FT   CDS_pept        18608..20152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pchF"
FT                   /locus_tag="NIDE0022"
FT                   /product="4-cresol dehydrogenase (hydroxylating),
FT                   flavoprotein subunit"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10565539, 10623531, 3790500, 588247, 7391034, 7929007;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0022"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39810"
FT                   /db_xref="GOA:D8P7G8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016170"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39810.1"
FT   gene            20211..21341
FT                   /gene="xylB"
FT                   /locus_tag="NIDE0023"
FT   CDS_pept        20211..21341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xylB"
FT                   /locus_tag="NIDE0023"
FT                   /product="Aryl-alcohol dehydrogenase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1176436, 1593644, 1989592, 3622514, 8496150, 8504864;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0023"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39811"
FT                   /db_xref="GOA:D8P7G9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7G9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39811.1"
FT   gene            21380..21910
FT                   /locus_tag="NIDE0024"
FT   CDS_pept        21380..21910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0024"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0024"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39812"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7H0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39812.1"
FT                   MHRADIGGGGRKD"
FT   gene            21949..22590
FT                   /locus_tag="NIDE0025"
FT   CDS_pept        21949..22590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0025"
FT                   /product="putative NADH-flavin reductase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0025"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39813"
FT                   /db_xref="GOA:D8P7H1"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7H1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39813.1"
FT   gene            22619..23938
FT                   /gene="ndh"
FT                   /locus_tag="NIDE0026"
FT   CDS_pept        22619..23938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ndh"
FT                   /locus_tag="NIDE0026"
FT                   /product="respiratory NADH dehydrogenase"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /function="6.5 : Electron transport"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1404382, 15292214, 6265208; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0026"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39814"
FT                   /db_xref="GOA:D8P7H2"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8P7H2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39814.1"
FT   gene            complement(23922..24029)
FT                   /locus_tag="NIDE0027"
FT   CDS_pept        complement(23922..24029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0027"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0027"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39815"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9A6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39815.1"
FT   gene            complement(24072..24557)
FT                   /locus_tag="NIDE0028"
FT   CDS_pept        complement(24072..24557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0028"
FT                   /product="putative Nucleotidyltransferase"
FT                   /function="8 : DNA metabolism"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7482698; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0028"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39816"
FT                   /db_xref="GOA:D8P9A7"
FT                   /db_xref="InterPro:IPR041633"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9A7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39816.1"
FT   gene            24670..26751
FT                   /gene="fhlA"
FT                   /locus_tag="NIDE0029"
FT   CDS_pept        24670..26751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhlA"
FT                   /locus_tag="NIDE0029"
FT                   /product="Formate hydrogenlyase transcriptional activator"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="6.7 : Fermentation"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10848985, 11032796, 11183780, 12618438, 2118503,
FT                   2280686, 2694934, 7536730, 8407777, 9433123, 9738943;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0029"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39817"
FT                   /db_xref="GOA:D8P9A8"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9A8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39817.1"
FT   gene            26846..27286
FT                   /locus_tag="NIDE0030"
FT   CDS_pept        26846..27286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0030"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0030"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39818"
FT                   /db_xref="GOA:D8P9A9"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9A9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39818.1"
FT   gene            27290..28393
FT                   /locus_tag="NIDE0031"
FT   CDS_pept        27290..28393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0031"
FT                   /product="putative Secretion protein HlyD"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.7 : Unknown substrate"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1495479, 15226509, 1558765; Product
FT                   type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0031"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39819"
FT                   /db_xref="GOA:D8P9B0"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39819.1"
FT   gene            28390..30369
FT                   /gene="ybhF"
FT                   /locus_tag="NIDE0032"
FT   CDS_pept        28390..30369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybhF"
FT                   /locus_tag="NIDE0032"
FT                   /product="ABC transport system, fused ATPase components"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11421269, 11988180, 15690043, 9640644, 9872322,
FT                   9873074; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0032"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39820"
FT                   /db_xref="GOA:D8P9B1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39820.1"
FT   gene            30390..31520
FT                   /locus_tag="NIDE0033"
FT   CDS_pept        30390..31520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0033"
FT                   /product="ABC transport system, permease component"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11421269, 11988180, 1303751, 9640644, 9872322,
FT                   9873074; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0033"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39821"
FT                   /db_xref="GOA:D8P9B2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39821.1"
FT   gene            31531..32685
FT                   /gene="yhhJ"
FT                   /locus_tag="NIDE0034"
FT   CDS_pept        31531..32685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yhhJ"
FT                   /locus_tag="NIDE0034"
FT                   /product="ABC transport system, permease component"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11421269, 11988180, 1303751, 9640644, 9872322,
FT                   9873074; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0034"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39822"
FT                   /db_xref="GOA:D8P9B3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39822.1"
FT   gene            33219..33350
FT                   /locus_tag="NIDE0035"
FT   CDS_pept        33219..33350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0035"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0035"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39823"
FT                   /db_xref="GOA:D8P9B4"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39823.1"
FT   gene            33372..33878
FT                   /locus_tag="NIDE0036"
FT   CDS_pept        33372..33878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0036"
FT                   /product="conserved membrane protein of unknown function,
FT                   DoxX family"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 15306018"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0036"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39824"
FT                   /db_xref="GOA:D8P9B5"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39824.1"
FT                   AFRTL"
FT   gene            33918..34205
FT                   /locus_tag="NIDE0037"
FT   CDS_pept        33918..34205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0037"
FT                   /product="protein of unknown function, putative Anti-sigma
FT                   factor antagonist"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0037"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39825"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39825.1"
FT   gene            34231..35136
FT                   /locus_tag="NIDE0038"
FT   CDS_pept        34231..35136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0038"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0038"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39826"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39826.1"
FT   gene            35263..35559
FT                   /locus_tag="NIDE0039"
FT   CDS_pept        35263..35559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0039"
FT                   /product="putative Antibiotic biosynthesis monooxygenase"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0039"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39827"
FT                   /db_xref="GOA:D8P9B8"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39827.1"
FT   gene            35590..36027
FT                   /locus_tag="NIDE0040"
FT   CDS_pept        35590..36027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0040"
FT                   /product="conserved exported protein of unknown function,
FT                   periplasmic protein CpxP"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0040"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39828"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9B9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39828.1"
FT   gene            36136..36474
FT                   /locus_tag="NIDE0041"
FT   CDS_pept        36136..36474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0041"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0041"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39829"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39829.1"
FT                   DTITVEVQ"
FT   gene            complement(36568..37344)
FT                   /gene="pgmB"
FT                   /locus_tag="NIDE0042"
FT   CDS_pept        complement(36568..37344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgmB"
FT                   /locus_tag="NIDE0042"
FT                   /product="Beta-phosphoglucomutase hydrolase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15005616, 15996095, 16784233, 7966317, 8071206,
FT                   9084169; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0042"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39830"
FT                   /db_xref="GOA:D8P9C1"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010976"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39830.1"
FT   gene            37445..39832
FT                   /locus_tag="NIDE0043"
FT   CDS_pept        37445..39832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0043"
FT                   /product="Glycoside hydrolase, family 65, putative
FT                   Kojibiose phosphorylase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 7624375, 8535779; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0043"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39831"
FT                   /db_xref="GOA:D8P9C2"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39831.1"
FT   gene            39882..40307
FT                   /gene="osmC"
FT                   /locus_tag="NIDE0044"
FT   CDS_pept        39882..40307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="osmC"
FT                   /locus_tag="NIDE0044"
FT                   /product="Peroxiredoxin"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 14627744, 15054099, 15103136, 15111059, 1715407, 8820643,
FT                   9573147, 9696771; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0044"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39832"
FT                   /db_xref="GOA:D8P9C3"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR019904"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39832.1"
FT   gene            40516..41214
FT                   /locus_tag="NIDE0045"
FT   CDS_pept        40516..41214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0045"
FT                   /product="putative Phosphoglycolate phosphatase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10572959, 13129953, 15996095,
FT                   16990279, 7966317; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0045"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39833"
FT                   /db_xref="GOA:D8P9C4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39833.1"
FT                   ECGVRPDPPA"
FT   gene            41221..41796
FT                   /gene="maa"
FT                   /locus_tag="NIDE0046"
FT   CDS_pept        41221..41796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maa"
FT                   /locus_tag="NIDE0046"
FT                   /product="Maltose O-acetyltransferase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1856235, 2615659, 8293817, 8801423; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0046"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39834"
FT                   /db_xref="GOA:D8P9C5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR024688"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39834.1"
FT   gene            41823..42428
FT                   /locus_tag="NIDE0047"
FT   CDS_pept        41823..42428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0047"
FT                   /product="Nitroreductase"
FT                   /function="5.7 : Nitrogen metabolism"
FT                   /EC_number="1.-.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11034992, 11491290, 11805110, 15684426, 8846223;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0047"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39835"
FT                   /db_xref="GOA:D8P9C6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39835.1"
FT   gene            complement(42439..43122)
FT                   /locus_tag="NIDE0048"
FT   CDS_pept        complement(42439..43122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0048"
FT                   /product="putative Methyltransferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0048"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39836"
FT                   /db_xref="GOA:D8P9C7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39836.1"
FT                   RIQWM"
FT   gene            43180..43962
FT                   /gene="fabG2"
FT                   /locus_tag="NIDE0049"
FT   CDS_pept        43180..43962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fabG2"
FT                   /locus_tag="NIDE0049"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /function="3.1 : Biosynthesis"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1889416, 7742302, 8759840; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0049"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39837"
FT                   /db_xref="GOA:D8P9C8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39837.1"
FT   gene            44182..44565
FT                   /locus_tag="NIDE0050"
FT   CDS_pept        44182..44565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0050"
FT                   /product="putative Endoribonuclease L-PSP, YjgF-like"
FT                   /function="9.1 : Degradation of RNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10400702, 10557275, 12515541,
FT                   14594850, 8530410; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0050"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39838"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9C9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39838.1"
FT   gene            44749..45426
FT                   /gene="alkA"
FT                   /locus_tag="NIDE0051"
FT   CDS_pept        44749..45426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkA"
FT                   /locus_tag="NIDE0051"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 6094528, 6389535, 7773744, 8706135, 8706136, 8921872,
FT                   9032058; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0051"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39839"
FT                   /db_xref="GOA:D8P9D0"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39839.1"
FT                   PNG"
FT   gene            45419..46294
FT                   /locus_tag="NIDE0052"
FT   CDS_pept        45419..46294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0052"
FT                   /product="Metallo-beta-lactamase superfamily hydrolase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 17196158, 7588620; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0052"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39840"
FT                   /db_xref="GOA:D8P9D1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39840.1"
FT                   LIEGRRQGRA"
FT   gene            46291..46968
FT                   /gene="yahD"
FT                   /locus_tag="NIDE0053"
FT   CDS_pept        46291..46968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yahD"
FT                   /locus_tag="NIDE0053"
FT                   /product="conserved protein of unknown function, contains
FT                   Ankyrin repeats"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12461176, 15063798,
FT                   8108379"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0053"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39841"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39841.1"
FT                   ARE"
FT   gene            complement(46996..47346)
FT                   /gene="yedX"
FT                   /locus_tag="NIDE0054"
FT   CDS_pept        complement(46996..47346)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yedX"
FT                   /locus_tag="NIDE0054"
FT                   /product="Transthyretin-like protein"
FT                   /function="2 : Purines, pyrimidines, nucleosides, and
FT                   nucleotides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12542701, 12553419, 16098976,
FT                   16462750, 16723258; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0054"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39842"
FT                   /db_xref="GOA:D8P9D3"
FT                   /db_xref="InterPro:IPR000895"
FT                   /db_xref="InterPro:IPR014306"
FT                   /db_xref="InterPro:IPR023416"
FT                   /db_xref="InterPro:IPR023418"
FT                   /db_xref="InterPro:IPR023419"
FT                   /db_xref="InterPro:IPR036817"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39842.1"
FT                   LSPFGYSTYRGS"
FT   gene            complement(47372..48286)
FT                   /gene="oxyR"
FT                   /locus_tag="NIDE0055"
FT   CDS_pept        complement(47372..48286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxyR"
FT                   /locus_tag="NIDE0055"
FT                   /product="Hydrogen peroxide-inducible genes activator"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11443091, 12015987, 12383513, 1864839, 2167922, 2471187,
FT                   2511419, 2551682, 3413113, 7604044, 9497290; Product type r
FT                   : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0055"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39843"
FT                   /db_xref="GOA:D8P9D4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39843.1"
FT   gene            48419..48625
FT                   /locus_tag="NIDE0056"
FT   CDS_pept        48419..48625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0056"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0056"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39844"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39844.1"
FT   gene            48673..49746
FT                   /gene="ccpA"
FT                   /locus_tag="NIDE0057"
FT   CDS_pept        48673..49746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccpA"
FT                   /locus_tag="NIDE0057"
FT                   /product="Cytochrome c551 peroxidase"
FT                   /function="6.5 : Electron transport"
FT                   /function="16.8 : Protect"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1657179, 17464064, 7781769, 8021188, 8163487, 8543038,
FT                   8591033; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0057"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39845"
FT                   /db_xref="GOA:D8P9D6"
FT                   /db_xref="InterPro:IPR004852"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR026259"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39845.1"
FT                   LNGEGWQHVAAPVEFPK"
FT   gene            49894..51519
FT                   /locus_tag="NIDE0058"
FT   CDS_pept        49894..51519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0058"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0058"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39846"
FT                   /db_xref="GOA:D8P9D7"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="InterPro:IPR039309"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39846.1"
FT   gene            51540..52490
FT                   /locus_tag="NIDE0059"
FT   CDS_pept        51540..52490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0059"
FT                   /product="conserved membrane protein of unknown function,
FT                   dedA family"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11803016"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0059"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39847"
FT                   /db_xref="GOA:D8P9D8"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR023695"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39847.1"
FT   gene            52561..53175
FT                   /locus_tag="NIDE0060"
FT   CDS_pept        52561..53175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0060"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0060"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39848"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9D9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39848.1"
FT   gene            complement(53246..53560)
FT                   /locus_tag="NIDE0061"
FT   CDS_pept        complement(53246..53560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0061"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0061"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39849"
FT                   /db_xref="InterPro:IPR025474"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39849.1"
FT                   "
FT   gene            complement(53608..53781)
FT                   /locus_tag="NIDE0062"
FT   CDS_pept        complement(53608..53781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0062"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0062"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39850"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39850.1"
FT                   GQEEASFHAYRA"
FT   gene            complement(54469..54810)
FT                   /gene="ynfA"
FT                   /locus_tag="NIDE0063"
FT   CDS_pept        complement(54469..54810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ynfA"
FT                   /locus_tag="NIDE0063"
FT                   /product="conserved membrane protein of unknown function,
FT                   UPF0060"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 16429150"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0063"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39851"
FT                   /db_xref="GOA:D8P9E2"
FT                   /db_xref="InterPro:IPR003844"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39851.1"
FT                   IALQPATGA"
FT   gene            complement(54807..55214)
FT                   /gene="merR"
FT                   /locus_tag="NIDE0064"
FT   CDS_pept        complement(54807..55214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merR"
FT                   /locus_tag="NIDE0064"
FT                   /product="Mercuric resistance operon regulatory protein"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10915804, 11136469, 11167016, 12446701, 12829265,
FT                   15773991, 2305262, 2492496, 2666393; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0064"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39852"
FT                   /db_xref="GOA:D8P9E3"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011794"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39852.1"
FT   gene            55257..55628
FT                   /gene="merT"
FT                   /locus_tag="NIDE0065"
FT   CDS_pept        55257..55628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merT"
FT                   /locus_tag="NIDE0065"
FT                   /product="Mercury ion transport protein"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9159519, 9167257, 9274008, 9479042; Product type
FT                   t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0065"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39853"
FT                   /db_xref="GOA:D8P9E4"
FT                   /db_xref="InterPro:IPR003457"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39853.1"
FT   gene            55641..55925
FT                   /gene="merP"
FT                   /locus_tag="NIDE0066"
FT   CDS_pept        55641..55925
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="merP"
FT                   /locus_tag="NIDE0066"
FT                   /product="Periplasmic mercury ion binding protein"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /function="15.5 : Detoxification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15123428, 1555597, 2666393, 9167257, 9188683,
FT                   9649312; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0066"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39854"
FT                   /db_xref="GOA:D8P9E5"
FT                   /db_xref="InterPro:IPR001802"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR011795"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39854.1"
FT   gene            55922..56143
FT                   /locus_tag="NIDE0067"
FT   CDS_pept        55922..56143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0067"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0067"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39855"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39855.1"
FT   gene            complement(56144..56620)
FT                   /locus_tag="NIDE0068"
FT   CDS_pept        complement(56144..56620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0068"
FT                   /product="conserved protein of unknown function (phage
FT                   related)"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type h : extrachromosomal
FT                   origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0068"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39856"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39856.1"
FT   gene            complement(56617..56988)
FT                   /locus_tag="NIDE0069"
FT   CDS_pept        complement(56617..56988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0069"
FT                   /product="conserved protein of unknown funktion
FT                   (phage-related)"
FT                   /function="17.2 : Prophage functions"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type h : extrachromosomal
FT                   origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0069"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39857"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39857.1"
FT   gene            complement(56988..58376)
FT                   /locus_tag="NIDE0070"
FT   CDS_pept        complement(56988..58376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0070"
FT                   /product="putative Site-specific recombinase, resolvase
FT                   family (phage related)"
FT                   /function="17.2 : Prophage functions"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 2896291, 3011407; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0070"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39858"
FT                   /db_xref="GOA:D8P9E9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9E9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39858.1"
FT                   EVEA"
FT   gene            complement(58373..58825)
FT                   /locus_tag="NIDE0071"
FT   CDS_pept        complement(58373..58825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0071"
FT                   /product="conserved protein of unknown function (phage
FT                   related)"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type h : extrachromosomal
FT                   origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0071"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39859"
FT                   /db_xref="InterPro:IPR021322"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39859.1"
FT   gene            complement(58825..59079)
FT                   /locus_tag="NIDE0072"
FT   CDS_pept        complement(58825..59079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0072"
FT                   /product="conserved protein of unknown function (putatively
FT                   phage related)"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0072"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39860"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39860.1"
FT   gene            59187..59465
FT                   /locus_tag="NIDE0075"
FT   CDS_pept        59187..59465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0075"
FT                   /product="putative Transcriptional regulator, Lambda
FT                   repressor-like"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0075"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39861"
FT                   /db_xref="GOA:D8P9F2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39861.1"
FT   gene            59466..60281
FT                   /locus_tag="NIDE0076"
FT   CDS_pept        59466..60281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0076"
FT                   /product="conserved protein of unknown function, contains
FT                   Peptidase M, zinc-binding site domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0076"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39862"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39862.1"
FT   gene            60379..61803
FT                   /locus_tag="NIDE0077"
FT   CDS_pept        60379..61803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0077"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0077"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39863"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39863.1"
FT                   KRVLEQLIRVGVLSEF"
FT   gene            61803..62747
FT                   /locus_tag="NIDE0078"
FT   CDS_pept        61803..62747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0078"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0078"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39864"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39864.1"
FT   gene            62833..63096
FT                   /locus_tag="NIDE0079"
FT   CDS_pept        62833..63096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0079"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0079"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39865"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39865.1"
FT   gene            63108..63590
FT                   /locus_tag="NIDE0080"
FT   CDS_pept        63108..63590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0080"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0080"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39866"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39866.1"
FT   gene            63587..64432
FT                   /locus_tag="NIDE0081"
FT   CDS_pept        63587..64432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0081"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0081"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39867"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39867.1"
FT                   "
FT   gene            64438..65082
FT                   /locus_tag="NIDE0082"
FT   CDS_pept        64438..65082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0082"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0082"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39868"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9F9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39868.1"
FT   gene            65093..65947
FT                   /locus_tag="NIDE0083"
FT   CDS_pept        65093..65947
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0083"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0083"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39869"
FT                   /db_xref="InterPro:IPR018874"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39869.1"
FT                   EVA"
FT   gene            65944..66444
FT                   /locus_tag="NIDE0084"
FT   CDS_pept        65944..66444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0084"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0084"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39870"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39870.1"
FT                   KKP"
FT   gene            66441..67178
FT                   /locus_tag="NIDE0085"
FT   CDS_pept        66441..67178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0085"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0085"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39871"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39871.1"
FT   gene            67175..67429
FT                   /locus_tag="NIDE0086"
FT   CDS_pept        67175..67429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0086"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0086"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39872"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39872.1"
FT   gene            67426..69717
FT                   /locus_tag="NIDE0087"
FT   CDS_pept        67426..69717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0087"
FT                   /product="putative DNA primase, P4 family (phage related)"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7636979; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0087"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39873"
FT                   /db_xref="InterPro:IPR006500"
FT                   /db_xref="InterPro:IPR014015"
FT                   /db_xref="InterPro:IPR014818"
FT                   /db_xref="InterPro:IPR034154"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39873.1"
FT                   HSNAYPYRDD"
FT   gene            69845..70309
FT                   /locus_tag="NIDE0089"
FT   CDS_pept        69845..70309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0089"
FT                   /product="putative Polynucleotidyl transferase (phage
FT                   related)"
FT                   /function="17.2 : Prophage functions"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15299518, 8696976; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0089"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39874"
FT                   /db_xref="GOA:D8P9G5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39874.1"
FT   gene            70507..70935
FT                   /locus_tag="NIDE0090"
FT   CDS_pept        70507..70935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0090"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0090"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39875"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39875.1"
FT   gene            70939..71133
FT                   /locus_tag="NIDE0091"
FT   CDS_pept        70939..71133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0091"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0091"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39876"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39876.1"
FT   gene            71254..72663
FT                   /locus_tag="NIDE0092"
FT   CDS_pept        71254..72663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0092"
FT                   /product="Site-specific DNA-methyltransferase N-4/N-6
FT                   (phage related)"
FT                   /function="8.2 : Restriction/modification"
FT                   /function="17.2 : Prophage functions"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2541254, 7607512, 7663118; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0092"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39877"
FT                   /db_xref="GOA:D8P9G8"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39877.1"
FT                   DDRLVTTEAAQ"
FT   gene            72660..73901
FT                   /locus_tag="NIDE0093"
FT   CDS_pept        72660..73901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0093"
FT                   /product="Site-specific DNA-methyltransferase N-4/N-6
FT                   (phage related)"
FT                   /function="8.2 : Restriction/modification"
FT                   /function="17.2 : Prophage functions"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2541254, 7607512, 7663118; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0093"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39878"
FT                   /db_xref="GOA:D8P9G9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR015840"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9G9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39878.1"
FT                   QAIREAADQEVCAS"
FT   gene            complement(73861..74085)
FT                   /locus_tag="NIDE0094"
FT   CDS_pept        complement(73861..74085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0094"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0094"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39879"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39879.1"
FT   gene            complement(74085..74450)
FT                   /locus_tag="NIDE0095"
FT   CDS_pept        complement(74085..74450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0095"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0095"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39880"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39880.1"
FT                   YLTGFVIHCDICDELAA"
FT   gene            complement(74548..75069)
FT                   /locus_tag="NIDE0097"
FT   CDS_pept        complement(74548..75069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0097"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0097"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39881"
FT                   /db_xref="InterPro:IPR021880"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39881.1"
FT                   QGGERIYRIA"
FT   gene            complement(75164..75370)
FT                   /locus_tag="NIDE0098"
FT   CDS_pept        complement(75164..75370)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0098"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0098"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39882"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39882.1"
FT   gene            75490..76026
FT                   /locus_tag="NIDE0099"
FT   CDS_pept        75490..76026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0099"
FT                   /product="conserved protein of unknown function (phage
FT                   related)"
FT                   /function="19 : Unclassified"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; Product type h : extrachromosomal
FT                   origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0099"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39883"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39883.1"
FT                   REHLQELGEMRPRVD"
FT   gene            76026..77984
FT                   /locus_tag="NIDE0100"
FT   CDS_pept        76026..77984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0100"
FT                   /product="Phage terminase, large subunit"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11866517, 2969839, 8468297; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0100"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39884"
FT                   /db_xref="InterPro:IPR008866"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39884.1"
FT                   VSGTTPRRRVIKSRWLS"
FT   gene            78003..78494
FT                   /locus_tag="NIDE0101"
FT   CDS_pept        78003..78494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0101"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0101"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39885"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39885.1"
FT                   "
FT   gene            78494..78886
FT                   /locus_tag="NIDE0102"
FT   CDS_pept        78494..78886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0102"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0102"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39886"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39886.1"
FT   gene            78886..79107
FT                   /locus_tag="NIDE0103"
FT   CDS_pept        78886..79107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0103"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0103"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39887"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39887.1"
FT   gene            79107..80594
FT                   /locus_tag="NIDE0104"
FT   CDS_pept        79107..80594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0104"
FT                   /product="Phage portal protein, lambda family"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8472949; Product type h : extrachromosomal
FT                   origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0104"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39888"
FT                   /db_xref="GOA:D8P9H9"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9H9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39888.1"
FT   gene            80605..81819
FT                   /locus_tag="NIDE0105"
FT   CDS_pept        80605..81819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0105"
FT                   /product="putative Phage minor capsid protein C"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7845208, 8439290, 8472949; Product
FT                   type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0105"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39889"
FT                   /db_xref="GOA:D8P9I0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39889.1"
FT                   AGQEK"
FT   gene            81821..82198
FT                   /locus_tag="NIDE0106"
FT   CDS_pept        81821..82198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0106"
FT                   /product="conserved protein of unknown function (phage
FT                   related)"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0106"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39890"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39890.1"
FT   gene            82201..83205
FT                   /locus_tag="NIDE0107"
FT   CDS_pept        82201..83205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0107"
FT                   /product="conserved protein of unknown function (phage
FT                   related)"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0107"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39891"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39891.1"
FT   gene            83205..83486
FT                   /locus_tag="NIDE0108"
FT   CDS_pept        83205..83486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0108"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0108"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39892"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39892.1"
FT   gene            83497..83922
FT                   /locus_tag="NIDE0109"
FT   CDS_pept        83497..83922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0109"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0109"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39893"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39893.1"
FT   gene            83927..84130
FT                   /locus_tag="NIDE0110"
FT   CDS_pept        83927..84130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0110"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0110"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39894"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39894.1"
FT   gene            84133..84885
FT                   /locus_tag="NIDE0111"
FT   CDS_pept        84133..84885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0111"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0111"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39895"
FT                   /db_xref="InterPro:IPR016893"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39895.1"
FT   gene            84885..85286
FT                   /locus_tag="NIDE0112"
FT   CDS_pept        84885..85286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0112"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0112"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39896"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39896.1"
FT   gene            85475..86116
FT                   /locus_tag="NIDE0113"
FT   CDS_pept        85475..86116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0113"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0113"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39897"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39897.1"
FT   gene            86116..88821
FT                   /locus_tag="NIDE0114"
FT   CDS_pept        86116..88821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0114"
FT                   /product="putative Phage tail length tape measure protein"
FT                   /function="17.2 : Prophage functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0114"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39898"
FT                   /db_xref="GOA:D8P9I9"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9I9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39898.1"
FT   gene            88841..89899
FT                   /locus_tag="NIDE0115"
FT   CDS_pept        88841..89899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0115"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0115"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39899"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39899.1"
FT                   AFNAAEFGVESA"
FT   gene            89896..91470
FT                   /locus_tag="NIDE0116"
FT   CDS_pept        89896..91470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0116"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0116"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39900"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39900.1"
FT                   RITYEPA"
FT   gene            91473..92261
FT                   /locus_tag="NIDE0117"
FT   CDS_pept        91473..92261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0117"
FT                   /product="conserved protein of unknown function (phage
FT                   related)"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0117"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39901"
FT                   /db_xref="InterPro:IPR018964"
FT                   /db_xref="InterPro:IPR019228"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39901.1"
FT   gene            92280..92507
FT                   /locus_tag="NIDE0118"
FT   CDS_pept        92280..92507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0118"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0118"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39902"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39902.1"
FT   gene            92710..94983
FT                   /locus_tag="NIDE0119"
FT   CDS_pept        92710..94983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0119"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0119"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39903"
FT                   /db_xref="InterPro:IPR032876"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39903.1"
FT                   WGGV"
FT   gene            94983..95579
FT                   /locus_tag="NIDE0120"
FT   CDS_pept        94983..95579
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0120"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0120"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39904"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39904.1"
FT   gene            95583..95933
FT                   /locus_tag="NIDE0121"
FT   CDS_pept        95583..95933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0121"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0121"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39905"
FT                   /db_xref="InterPro:IPR021251"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39905.1"
FT                   YKSTGWSAGIAI"
FT   gene            96000..96308
FT                   /locus_tag="NIDE0122"
FT   CDS_pept        96000..96308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0122"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0122"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39906"
FT                   /db_xref="GOA:D8P9J7"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39906.1"
FT   gene            96305..96532
FT                   /locus_tag="NIDE0123"
FT   CDS_pept        96305..96532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0123"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0123"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39907"
FT                   /db_xref="GOA:D8P9J8"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39907.1"
FT   gene            96529..97029
FT                   /locus_tag="NIDE0124"
FT   CDS_pept        96529..97029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0124"
FT                   /product="Phage lysozyme"
FT                   /function="17.2 : Prophage functions"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 2763468, 3586019, 7624375, 8535779; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0124"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39908"
FT                   /db_xref="GOA:D8P9J9"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9J9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39908.1"
FT                   EAS"
FT   gene            97026..97523
FT                   /locus_tag="NIDE0125"
FT   CDS_pept        97026..97523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0125"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0125"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39909"
FT                   /db_xref="GOA:D8P9K0"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39909.1"
FT                   TK"
FT   gene            complement(97573..98430)
FT                   /locus_tag="NIDE0126"
FT   CDS_pept        complement(97573..98430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0126"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0126"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39910"
FT                   /db_xref="GOA:D8P9K1"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39910.1"
FT                   KNGV"
FT   gene            complement(98456..99025)
FT                   /locus_tag="NIDE0127"
FT   CDS_pept        complement(98456..99025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0127"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0127"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39911"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39911.1"
FT   gene            complement(99212..101950)
FT                   /locus_tag="NIDE0128"
FT   CDS_pept        complement(99212..101950)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0128"
FT                   /product="putative DEAD/DEAH box helicase, SNF2 family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11545728, 11839499, 2546125, 7651832;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0128"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39912"
FT                   /db_xref="GOA:D8P9K3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39912.1"
FT   gene            complement(101955..104918)
FT                   /locus_tag="NIDE0129"
FT   CDS_pept        complement(101955..104918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0129"
FT                   /product="putative DNA methylase, containing Zn-ribbon"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0129"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39913"
FT                   /db_xref="GOA:D8P9K4"
FT                   /db_xref="InterPro:IPR009537"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39913.1"
FT   gene            complement(104922..105554)
FT                   /locus_tag="NIDE0130"
FT   CDS_pept        complement(104922..105554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0130"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0130"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39914"
FT                   /db_xref="InterPro:IPR024220"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39914.1"
FT   gene            complement(105559..108681)
FT                   /locus_tag="NIDE0131"
FT   CDS_pept        complement(105559..108681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0131"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 8412987, 8440408, 9759493"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0131"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39915"
FT                   /db_xref="InterPro:IPR007555"
FT                   /db_xref="InterPro:IPR026876"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39915.1"
FT   gene            complement(108678..108872)
FT                   /locus_tag="NIDE0132"
FT   CDS_pept        complement(108678..108872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0132"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11428897, 9714164, 9857196"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0132"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39916"
FT                   /db_xref="GOA:D8P9K7"
FT                   /db_xref="InterPro:IPR002145"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39916.1"
FT   gene            109581..109868
FT                   /locus_tag="NIDE0133"
FT   CDS_pept        109581..109868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0133"
FT                   /product="Prevent-host-death family protein"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 14659018; Product type cp : cell process"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0133"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39917"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39917.1"
FT   gene            109868..110209
FT                   /gene="parE"
FT                   /locus_tag="NIDE0134"
FT   CDS_pept        109868..110209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parE"
FT                   /locus_tag="NIDE0134"
FT                   /product="Plasmid stabilization system protein"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1459960, 14659018; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0134"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39918"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9K9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39918.1"
FT                   LLARRLLGA"
FT   gene            110519..110761
FT                   /locus_tag="NIDE0135"
FT   CDS_pept        110519..110761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0135"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0135"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39919"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39919.1"
FT   gene            110957..113179
FT                   /locus_tag="NIDE0136"
FT   CDS_pept        110957..113179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0136"
FT                   /product="putative Type I restriction endonuclease, R
FT                   subunit"
FT                   /function="8.2 : Restriction/modification"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10839821, 11545728, 11839499,
FT                   12595133, 12665693, 15121719, 15192705, 2546125, 8412658;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0136"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39920"
FT                   /db_xref="GOA:D8P9L1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39920.1"
FT   gene            113176..114345
FT                   /locus_tag="NIDE0137"
FT   CDS_pept        113176..114345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0137"
FT                   /product="protein of unknown function, putative Type I
FT                   restriction endonuclease, S subunit"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 6304321"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0137"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39921"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39921.1"
FT   gene            114342..115355
FT                   /locus_tag="NIDE0138"
FT   CDS_pept        114342..115355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0138"
FT                   /product="conserved protein of unknown function, DUF1016"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12655005, 15972856"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0138"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39922"
FT                   /db_xref="InterPro:IPR009362"
FT                   /db_xref="InterPro:IPR041527"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39922.1"
FT   gene            115358..117301
FT                   /gene="hsdM"
FT                   /locus_tag="NIDE0139"
FT   CDS_pept        115358..117301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hsdM"
FT                   /locus_tag="NIDE0139"
FT                   /product="Type I restriction endonuclease, M subunit
FT                   (modular protein)"
FT                   /function="8.2 : Restriction/modification"
FT                   /function="12.1 : DNA interactions"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1409708, 15882618, 3025838, 7607512, 7663118,
FT                   7971991, 8412658, 9440532; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0139"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39923"
FT                   /db_xref="GOA:D8P9L4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39923.1"
FT                   DLLAVDARAAYE"
FT   gene            117447..118010
FT                   /locus_tag="NIDE0140"
FT   CDS_pept        117447..118010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0140"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0140"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39924"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39924.1"
FT   gene            118178..118588
FT                   /locus_tag="NIDE0141"
FT   CDS_pept        118178..118588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0141"
FT                   /product="conserved exported protein of unknown function,
FT                   putative amicyanin"
FT                   /function="19 : Unclassified"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0141"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39925"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39925.1"
FT   gene            complement(118615..118914)
FT                   /locus_tag="NIDE0142"
FT   CDS_pept        complement(118615..118914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0142"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0142"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39926"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39926.1"
FT   gene            complement(118975..120771)
FT                   /locus_tag="NIDE0143"
FT   CDS_pept        complement(118975..120771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0143"
FT                   /product="Glycoside hydrolase, family 15"
FT                   /function="6.14 : Biosynthesis and degradation of
FT                   polysaccharides"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12614608, 14660574, 1633799, 7624375, 8535779;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0143"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39927"
FT                   /db_xref="GOA:D8P9L8"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39927.1"
FT   gene            120810..123041
FT                   /gene="otsA1"
FT                   /locus_tag="NIDE0144"
FT   CDS_pept        120810..123041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsA1"
FT                   /locus_tag="NIDE0144"
FT                   /product="Alpha,alpha-trehalose-phosphate synthase
FT                   (UDP-forming)"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12498887, 12626396, 12890033, 14570926, 3131312, 8045430,
FT                   9334165; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0144"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39928"
FT                   /db_xref="GOA:D8P9L9"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9L9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39928.1"
FT   gene            123050..123823
FT                   /gene="otsB"
FT                   /locus_tag="NIDE0145"
FT   CDS_pept        123050..123823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="otsB"
FT                   /locus_tag="NIDE0145"
FT                   /product="Trehalose phosphatase"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 16815921, 8045430; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0145"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39929"
FT                   /db_xref="GOA:D8P9M0"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39929.1"
FT   gene            complement(123867..124352)
FT                   /locus_tag="NIDE0146"
FT   CDS_pept        complement(123867..124352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0146"
FT                   /product="Appr-1-p processing enzyme family protein"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12842467, 15722447, 15902274; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0146"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39930"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39930.1"
FT   gene            124575..125408
FT                   /locus_tag="NIDE0147"
FT   CDS_pept        124575..125408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0147"
FT                   /product="putative Polyphosphate kinase 2"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /EC_number="2.7.4.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12482933, 12486232, 15520374,
FT                   15716459; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0147"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39931"
FT                   /db_xref="GOA:D8P9M2"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022300"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39931.1"
FT   gene            125545..125796
FT                   /locus_tag="NIDE0148"
FT   CDS_pept        125545..125796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0148"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0148"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39932"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39932.1"
FT   gene            125723..126604
FT                   /locus_tag="NIDE0149"
FT   CDS_pept        125723..126604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0149"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0149"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39933"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39933.1"
FT                   MKKQQVQPQGGQ"
FT   gene            126636..127349
FT                   /locus_tag="NIDE0150"
FT   CDS_pept        126636..127349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0150"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0150"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39934"
FT                   /db_xref="InterPro:IPR025524"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39934.1"
FT                   QSGDAMQEGRSPANR"
FT   gene            complement(127433..127603)
FT                   /locus_tag="NIDE0151"
FT   CDS_pept        complement(127433..127603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0151"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0151"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39935"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39935.1"
FT                   WNRAANPIYAP"
FT   gene            complement(128149..128367)
FT                   /locus_tag="NIDE0152"
FT   CDS_pept        complement(128149..128367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0152"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0152"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39936"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39936.1"
FT   gene            128490..129026
FT                   /locus_tag="NIDE0153"
FT   CDS_pept        128490..129026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0153"
FT                   /product="putative Mechanosensitive ion channel,
FT                   transmembrane region (fragment)"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10202137, 11275684, 12080120,
FT                   12446901, 12551944, 12626684, 15665866, 2436228, 7595939;
FT                   Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0153"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39937"
FT                   /db_xref="GOA:D8P9M8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9M8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39937.1"
FT                   NSVAAQQIVVKLRAA"
FT   gene            complement(129119..129652)
FT                   /pseudo
FT                   /locus_tag="NIDE0154"
FT   CDS_pept        complement(129119..129652)
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0154"
FT                   /product="putative Glycerophosphodiester phosphodiesterase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1851953, 2541415; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="PSEUDO:CBK39938.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            130095..130583
FT                   /locus_tag="NIDE0155"
FT   CDS_pept        130095..130583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0155"
FT                   /product="conserved protein of unknown function, containing
FT                   CBS domain pair"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10200156, 12403633,
FT                   12559919, 14722619, 15326606"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0155"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39939"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39939.1"
FT   gene            130670..131017
FT                   /gene="phhB"
FT                   /locus_tag="NIDE0156"
FT   CDS_pept        130670..131017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phhB"
FT                   /locus_tag="NIDE0156"
FT                   /product="4a-hydroxytetrahydrobiopterin dehydratase"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /function="9 : Transcription"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15182178, 7725101, 8108417, 8897596; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0156"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39940"
FT                   /db_xref="GOA:D8P9N1"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39940.1"
FT                   DREFEPFRAGA"
FT   gene            131129..131239
FT                   /locus_tag="NIDE0157"
FT   CDS_pept        131129..131239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0157"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0157"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39941"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39941.1"
FT   gene            131232..133097
FT                   /locus_tag="NIDE0158"
FT   CDS_pept        131232..133097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0158"
FT                   /product="putative Radical SAM protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11222759, 14704425; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0158"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39942"
FT                   /db_xref="GOA:D8P9N3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR023984"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39942.1"
FT   gene            complement(133135..133467)
FT                   /locus_tag="NIDE0159"
FT   CDS_pept        complement(133135..133467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0159"
FT                   /product="4-carboxymuconolactone decarboxylase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11799204, 11914371, 9495744; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0159"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39943"
FT                   /db_xref="GOA:D8P9N4"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR026445"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39943.1"
FT                   AEKLSM"
FT   gene            complement(133557..133826)
FT                   /locus_tag="NIDE0160"
FT   CDS_pept        complement(133557..133826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0160"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0160"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39944"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39944.1"
FT   gene            complement(133970..134791)
FT                   /gene="suhB"
FT                   /locus_tag="NIDE0161"
FT   CDS_pept        complement(133970..134791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="suhB"
FT                   /locus_tag="NIDE0161"
FT                   /product="Inositol-phosphate phosphatase"
FT                   /function="9 : Transcription"
FT                   /function="12.3 : Protein interactions"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10747806, 1660408, 7947723, 8002619; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0161"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39945"
FT                   /db_xref="GOA:D8P9N6"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39945.1"
FT   gene            134931..135551
FT                   /locus_tag="NIDE0162"
FT   CDS_pept        134931..135551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0162"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0162"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39946"
FT                   /db_xref="GOA:D8P9N7"
FT                   /db_xref="InterPro:IPR007759"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39946.1"
FT   gene            135586..135783
FT                   /locus_tag="NIDE0163"
FT   CDS_pept        135586..135783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0163"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0163"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39947"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39947.1"
FT   gene            complement(135793..136719)
FT                   /gene="lpxC"
FT                   /locus_tag="NIDE0164"
FT   CDS_pept        complement(135793..136719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxC"
FT                   /locus_tag="NIDE0164"
FT                   /product="UDP-3-O-acyl N-acetylglucosamine deacetylase"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="3.5.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10026271, 12819349, 15705580, 16420369, 16800620,
FT                   17296300, 8752330, 9068651; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0164"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39948"
FT                   /db_xref="GOA:D8P9N9"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9N9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39948.1"
FT   gene            complement(136956..137627)
FT                   /locus_tag="NIDE0165"
FT   CDS_pept        complement(136956..137627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0165"
FT                   /product="Transcriptional regulator, LuxR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10418137, 10966457, 11406410, 12533459,
FT                   14651641, 1482126, 16176121, 18076326, 8868347; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0165"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39949"
FT                   /db_xref="GOA:D8P9P0"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39949.1"
FT                   P"
FT   gene            complement(137614..138735)
FT                   /locus_tag="NIDE0166"
FT   CDS_pept        complement(137614..138735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0166"
FT                   /product="putative Histidine kinase with N-terminal
FT                   NAD-binding region"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10426948, 10500846, 11406410,
FT                   11489844, 11934609, 14651641, 8029829, 9989504; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0166"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39950"
FT                   /db_xref="GOA:D8P9P1"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39950.1"
FT   gene            complement(138844..139257)
FT                   /gene="nrdR"
FT                   /locus_tag="NIDE0167"
FT   CDS_pept        complement(138844..139257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="NIDE0167"
FT                   /product="Transcriptional regulator NrdR"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10939243, 15522084, 15949864, 16950922, 17229208,
FT                   17496099, 8052308; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0167"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39951"
FT                   /db_xref="GOA:D8P9P2"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39951.1"
FT   gene            complement(139324..140601)
FT                   /gene="glyA"
FT                   /locus_tag="NIDE0168"
FT   CDS_pept        complement(139324..140601)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glyA"
FT                   /locus_tag="NIDE0168"
FT                   /product="Serine hydroxymethyltransferase"
FT                   /function="1.5 : Serine family"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10656824, 2134182, 6190704, 6300791, 6325301; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0168"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39952"
FT                   /db_xref="GOA:D8P9P3"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39952.1"
FT   gene            complement(140656..141141)
FT                   /gene="rplI"
FT                   /locus_tag="NIDE0169"
FT   CDS_pept        complement(140656..141141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplI"
FT                   /locus_tag="NIDE0169"
FT                   /product="50S ribosomal protein L9"
FT                   /function="10 : Protein synthesis"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094780, 10756104, 12809609, 16272117, 1985969, 3298242,
FT                   8306963; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0169"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39953"
FT                   /db_xref="GOA:D8P9P4"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39953.1"
FT   gene            141440..142915
FT                   /locus_tag="NIDE0170"
FT   CDS_pept        141440..142915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0170"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0170"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39954"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39954.1"
FT   gene            143005..143091
FT                   /locus_tag="NIDEtRNA1"
FT   tRNA            143005..143091
FT                   /locus_tag="NIDEtRNA1"
FT                   /product="tRNA-Leu"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            143379..144821
FT                   /locus_tag="NIDE0171"
FT   CDS_pept        143379..144821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0171"
FT                   /product="putative Integrase"
FT                   /function="17.2 : Prophage functions"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15973401, 9082984, 9157243, 9288963;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0171"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39955"
FT                   /db_xref="GOA:D8P9P6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39955.1"
FT   gene            complement(144790..145134)
FT                   /locus_tag="NIDE0172"
FT   CDS_pept        complement(144790..145134)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0172"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0172"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39956"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39956.1"
FT                   LRKRGTRATP"
FT   gene            complement(145171..145410)
FT                   /locus_tag="NIDE0173"
FT   CDS_pept        complement(145171..145410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0173"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0173"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39957"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39957.1"
FT   gene            complement(145918..146010)
FT                   /locus_tag="NIDE0174"
FT   CDS_pept        complement(145918..146010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0174"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0174"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39958"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9P9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39958.1"
FT                   /translation="MVAPAGRARPSELGGYTYTYTYTYKVWLRL"
FT   gene            complement(146921..148942)
FT                   /locus_tag="NIDE0175"
FT   CDS_pept        complement(146921..148942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0175"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0175"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39959.1"
FT   gene            complement(149542..149820)
FT                   /locus_tag="NIDE0176"
FT   CDS_pept        complement(149542..149820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0176"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0176"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39960"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39960.1"
FT   gene            complement(150345..150677)
FT                   /locus_tag="NIDE0177"
FT   CDS_pept        complement(150345..150677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0177"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0177"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39961"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39961.1"
FT                   EITEDF"
FT   gene            complement(150743..151075)
FT                   /locus_tag="NIDE0178"
FT   CDS_pept        complement(150743..151075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0178"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0178"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39962"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39962.1"
FT                   PKRGRK"
FT   gene            complement(151313..151840)
FT                   /locus_tag="NIDE0179"
FT   CDS_pept        complement(151313..151840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0179"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10075917, 11327769"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0179"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39963"
FT                   /db_xref="InterPro:IPR004211"
FT                   /db_xref="InterPro:IPR038563"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39963.1"
FT                   GGFWVSSAPAPQ"
FT   gene            complement(151892..152305)
FT                   /locus_tag="NIDE0180"
FT   CDS_pept        complement(151892..152305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0180"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0180"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39964"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39964.1"
FT   gene            153211..153825
FT                   /gene="pin"
FT                   /locus_tag="NIDE0181"
FT   CDS_pept        153211..153825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pin"
FT                   /locus_tag="NIDE0181"
FT                   /product="DNA-invertase"
FT                   /function="17.2 : Prophage functions"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 2166334, 2550763, 2896291, 3011407, 3042382, 3399403,
FT                   6310572, 6315399, 8278807; Product type h :
FT                   extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0181"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39965"
FT                   /db_xref="GOA:D8P9Q6"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39965.1"
FT   gene            complement(153827..154060)
FT                   /locus_tag="NIDE0182"
FT   CDS_pept        complement(153827..154060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0182"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0182"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39966"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39966.1"
FT   gene            154163..154393
FT                   /locus_tag="NIDE0183"
FT   CDS_pept        154163..154393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0183"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0183"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39967"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39967.1"
FT   gene            complement(154442..154906)
FT                   /locus_tag="NIDE0184"
FT   CDS_pept        complement(154442..154906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0184"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0184"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39968"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Q9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39968.1"
FT   gene            154949..155182
FT                   /locus_tag="NIDE0185"
FT   CDS_pept        154949..155182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0185"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0185"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39969"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39969.1"
FT   gene            155464..156846
FT                   /gene="cyp"
FT                   /locus_tag="NIDE0186"
FT   CDS_pept        155464..156846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cyp"
FT                   /locus_tag="NIDE0186"
FT                   /product="Cytochrome P450"
FT                   /function="6.5 : Electron transport"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11178272, 16042601, 16510191, 17023115, 2037557,
FT                   2037602, 3304150, 3656428, 7678494, 8405421, 8637843;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0186"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39970"
FT                   /db_xref="GOA:D8P9R1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39970.1"
FT                   SA"
FT   gene            complement(156946..157494)
FT                   /locus_tag="NIDE0187"
FT   CDS_pept        complement(156946..157494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0187"
FT                   /product="protein of unknown function, similar to FliL"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10439416, 3519573"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0187"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39971"
FT                   /db_xref="GOA:D8P9R2"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39971.1"
FT   gene            complement(157825..158238)
FT                   /locus_tag="NIDE0189"
FT   CDS_pept        complement(157825..158238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0189"
FT                   /product="conserved protein of unknown function, DUF393"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 15236740"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0189"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39972"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39972.1"
FT   gene            complement(158257..159360)
FT                   /locus_tag="NIDE0190"
FT   CDS_pept        complement(158257..159360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0190"
FT                   /product="putative Regulatory protein, MerR family,
FT                   Cobalamin B12-binding"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10467146, 11731805, 12829265,
FT                   14985361, 2305262, 2492496, 7992050; Product type pr :
FT                   putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0190"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39973"
FT                   /db_xref="GOA:D8P9R4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39973.1"
FT   gene            159278..159610
FT                   /locus_tag="NIDE0191"
FT   CDS_pept        159278..159610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0191"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0191"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39974"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39974.1"
FT                   QGQVSV"
FT   gene            159667..160629
FT                   /locus_tag="NIDE0192"
FT   CDS_pept        159667..160629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0192"
FT                   /product="conserved exported protein of unknown function,
FT                   DUF323"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 14563551"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0192"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39975"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39975.1"
FT   gene            160694..161752
FT                   /locus_tag="NIDE0193"
FT   CDS_pept        160694..161752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0193"
FT                   /product="conserved exported protein of unknown function,
FT                   DUF323"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0193"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39976"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39976.1"
FT                   LRPLIEQSMKQR"
FT   gene            161805..162173
FT                   /locus_tag="NIDE0194"
FT   CDS_pept        161805..162173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0194"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0194"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39977"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39977.1"
FT                   EIKIHTAQAIAGSKEQKK"
FT   gene            162212..163000
FT                   /locus_tag="NIDE0195"
FT   CDS_pept        162212..163000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0195"
FT                   /product="conserved exported protein of unknown function,
FT                   DUF323"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0195"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39978"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9R9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39978.1"
FT   gene            163190..163321
FT                   /locus_tag="NIDE0196"
FT   CDS_pept        163190..163321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0196"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0196"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39979"
FT                   /db_xref="GOA:D8P9S0"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39979.1"
FT   gene            163350..163772
FT                   /locus_tag="NIDE0197"
FT   CDS_pept        163350..163772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0197"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0197"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39980"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39980.1"
FT   gene            163805..164743
FT                   /gene="yfcH"
FT                   /locus_tag="NIDE0198"
FT   CDS_pept        163805..164743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfcH"
FT                   /locus_tag="NIDE0198"
FT                   /product="conserved protein of unknown function,
FT                   NAD(P)-binding Rossmann-fold domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 9174344"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0198"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39981"
FT                   /db_xref="GOA:D8P9S2"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR010099"
FT                   /db_xref="InterPro:IPR013549"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39981.1"
FT   gene            164743..165201
FT                   /locus_tag="NIDE0199"
FT   CDS_pept        164743..165201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0199"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0199"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39982"
FT                   /db_xref="GOA:D8P9S3"
FT                   /db_xref="InterPro:IPR025423"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39982.1"
FT   gene            165224..165706
FT                   /locus_tag="NIDE0200"
FT   CDS_pept        165224..165706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0200"
FT                   /product="exported protein of unknown function, PDZ domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10331862, 10887205, 8674113, 9041651,
FT                   9204764, 9382826"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0200"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39983"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39983.1"
FT   gene            165714..166238
FT                   /locus_tag="NIDE0201"
FT   CDS_pept        165714..166238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0201"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0201"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39984"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39984.1"
FT                   WWRAFPDSWGR"
FT   gene            166287..166718
FT                   /locus_tag="NIDE0202"
FT   CDS_pept        166287..166718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0202"
FT                   /product="membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0202"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39985"
FT                   /db_xref="GOA:D8P9S6"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39985.1"
FT   gene            166715..168160
FT                   /gene="phr"
FT                   /locus_tag="NIDE0203"
FT   CDS_pept        166715..168160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phr"
FT                   /locus_tag="NIDE0203"
FT                   /product="Deoxyribodipyrimidine photolyase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="4.9 : Riboflavin, FMN, and FAD"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10871367, 11254140, 12535521, 12835419, 15576622,
FT                   15721603, 1840665, 7604260; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0203"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39986"
FT                   /db_xref="GOA:D8P9S7"
FT                   /db_xref="InterPro:IPR002081"
FT                   /db_xref="InterPro:IPR005101"
FT                   /db_xref="InterPro:IPR006050"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018394"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="InterPro:IPR036155"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39986.1"
FT   gene            168157..169110
FT                   /locus_tag="NIDE0204"
FT   CDS_pept        168157..169110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0204"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0204"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39987"
FT                   /db_xref="InterPro:IPR007553"
FT                   /db_xref="InterPro:IPR013560"
FT                   /db_xref="InterPro:IPR017087"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39987.1"
FT   gene            169327..169695
FT                   /locus_tag="NIDE0205"
FT   CDS_pept        169327..169695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0205"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0205"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39988"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9S9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39988.1"
FT                   SRYGKTNLQEYLESPVSM"
FT   gene            169735..170244
FT                   /locus_tag="NIDE0206"
FT   CDS_pept        169735..170244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0206"
FT                   /product="protein of unknown function, CbiX domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 11153269, 11215515, 12055304,
FT                   12686546, 12869542, 16042605, 16835730"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0206"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39989"
FT                   /db_xref="GOA:D8P9T0"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39989.1"
FT                   QVRRFS"
FT   gene            170310..170906
FT                   /locus_tag="NIDE0207"
FT   CDS_pept        170310..170906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0207"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0207"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39990"
FT                   /db_xref="GOA:D8P9T1"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39990.1"
FT   gene            170987..171403
FT                   /locus_tag="NIDE0208"
FT   CDS_pept        170987..171403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0208"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 15071504"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0208"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39991"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39991.1"
FT   gene            171407..172177
FT                   /locus_tag="NIDE0209"
FT   CDS_pept        171407..172177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0209"
FT                   /product="putative Glucose/ribitol dehydrogenase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1889416, 7742302; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0209"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39992"
FT                   /db_xref="GOA:D8P9T3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39992.1"
FT   gene            172174..173433
FT                   /locus_tag="NIDE0210"
FT   CDS_pept        172174..173433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0210"
FT                   /product="putative Flavin-containing amine oxidase"
FT                   /function="6.5 : Electron transport"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0210"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39993"
FT                   /db_xref="GOA:D8P9T4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39993.1"
FT   gene            173430..174215
FT                   /locus_tag="NIDE0211"
FT   CDS_pept        173430..174215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0211"
FT                   /product="conserved protein of unknown function, DUF1365"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0211"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39994"
FT                   /db_xref="InterPro:IPR010775"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39994.1"
FT   gene            174212..175519
FT                   /gene="cfa"
FT                   /locus_tag="NIDE0212"
FT   CDS_pept        174212..175519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cfa"
FT                   /locus_tag="NIDE0212"
FT                   /product="Cyclopropane-fatty-acyl-phospholipid synthase"
FT                   /function="3.1 : Biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11756461, 15606764, 16356931, 380648, 7592990, 7604045,
FT                   8917504, 9409147; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0212"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39995"
FT                   /db_xref="GOA:D8P9T6"
FT                   /db_xref="InterPro:IPR003333"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39995.1"
FT   gene            175516..176049
FT                   /locus_tag="NIDE0213"
FT   CDS_pept        175516..176049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0213"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0213"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39996"
FT                   /db_xref="GOA:D8P9T7"
FT                   /db_xref="InterPro:IPR021306"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39996.1"
FT                   WAAKRRSVGVSGEA"
FT   gene            complement(176087..179536)
FT                   /locus_tag="NIDE0214"
FT   CDS_pept        complement(176087..179536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0214"
FT                   /product="putative large exoprotein involved in heme
FT                   utilization or adhesion"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11703654, 16339899, 7519681; Product
FT                   type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0214"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39997"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39997.1"
FT   gene            complement(179533..182580)
FT                   /locus_tag="NIDE0216"
FT   CDS_pept        complement(179533..182580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0216"
FT                   /product="putative Filamentous haemagglutinin"
FT                   /function="16.4 : Excrete"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11703654, 15079085, 16339899, 2539596,
FT                   7519681; Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0216"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39998"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9T9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39998.1"
FT   gene            complement(182580..184163)
FT                   /locus_tag="NIDE0217"
FT   CDS_pept        complement(182580..184163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0217"
FT                   /product="putative Hemolysin activation/secretion protein"
FT                   /function="11.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7751272; Product type pf : putative
FT                   factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0217"
FT                   /db_xref="EnsemblGenomes-Tr:CBK39999"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK39999.1"
FT                   TMYLQAATRF"
FT   gene            184601..185176
FT                   /gene="pyrE"
FT                   /locus_tag="NIDE0218"
FT   CDS_pept        184601..185176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="NIDE0218"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10517335, 11751055, 6207018, 7516791, 8620002; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0218"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40000"
FT                   /db_xref="GOA:D8P9U1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40000.1"
FT   gene            complement(185178..185417)
FT                   /locus_tag="NIDE0219"
FT   CDS_pept        complement(185178..185417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0219"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0219"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40001"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40001.1"
FT   gene            185549..185974
FT                   /locus_tag="NIDE0220"
FT   CDS_pept        185549..185974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0220"
FT                   /product="Rhodanese-like sulphurtransferase"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10788330, 11709175, 6948991, 8702871, 9733650;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0220"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40002"
FT                   /db_xref="GOA:D8P9U3"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40002.1"
FT   gene            complement(185986..186912)
FT                   /locus_tag="NIDE0221"
FT   CDS_pept        complement(185986..186912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0221"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0221"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40003"
FT                   /db_xref="InterPro:IPR018711"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40003.1"
FT   gene            complement(187044..188681)
FT                   /locus_tag="NIDE0222"
FT   CDS_pept        complement(187044..188681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0222"
FT                   /product="putative Hybrid histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10418137, 10966457, 11406410, 1482126,
FT                   16176121, 16622408, 18076326, 8029829, 8868347; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0222"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40004"
FT                   /db_xref="GOA:D8P9U5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40004.1"
FT   gene            complement(188719..189180)
FT                   /locus_tag="NIDE0223"
FT   CDS_pept        complement(188719..189180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0223"
FT                   /product="Signal transduction response regulator, receiver
FT                   domain"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10418137, 10966457, 11406410, 1482126, 16176121,
FT                   18076326, 7908398, 8868347, 9278513; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0223"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40005"
FT                   /db_xref="GOA:D8P9U6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40005.1"
FT   gene            complement(189177..190676)
FT                   /locus_tag="NIDE0224"
FT   CDS_pept        complement(189177..190676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0224"
FT                   /product="putative Sensor histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10418137, 10966457, 11406410, 1482126,
FT                   16176121, 16622408, 18076326, 8029829, 8868347; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0224"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40006"
FT                   /db_xref="GOA:D8P9U7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40006.1"
FT   gene            complement(190827..192323)
FT                   /gene="nuoN"
FT                   /locus_tag="NIDE0225"
FT   CDS_pept        complement(190827..192323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoN"
FT                   /locus_tag="NIDE0225"
FT                   /product="NADH-quinone oxidoreductase, membrane subunit N"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 17157874, 1903537, 7690854, 8366049, 8566820,
FT                   9030257, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0225"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40007"
FT                   /db_xref="GOA:D8P9U8"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR010096"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40007.1"
FT   gene            complement(192320..193975)
FT                   /gene="nuoM2"
FT                   /locus_tag="NIDE0226"
FT   CDS_pept        complement(192320..193975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM2"
FT                   /locus_tag="NIDE0226"
FT                   /product="NADH-quinone oxidoreductase, membrane subunit M"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12923180, 17157874, 17360196, 7690854, 7846157, 8366049,
FT                   9030257, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0226"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40008"
FT                   /db_xref="GOA:D8P9U9"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9U9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40008.1"
FT   gene            complement(193980..195539)
FT                   /gene="nuoM1"
FT                   /locus_tag="NIDE0227"
FT   CDS_pept        complement(193980..195539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoM1"
FT                   /locus_tag="NIDE0227"
FT                   /product="NADH-quinone oxidoreductase, membrane subunit M"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 12923180, 17157874, 17360196, 7690854, 8366049,
FT                   9030257, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0227"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40009"
FT                   /db_xref="GOA:D8P9V0"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003918"
FT                   /db_xref="InterPro:IPR010227"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40009.1"
FT                   AK"
FT   gene            complement(195564..197567)
FT                   /gene="nuoL"
FT                   /locus_tag="NIDE0228"
FT   CDS_pept        complement(195564..197567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoL"
FT                   /locus_tag="NIDE0228"
FT                   /product="NADH-quinone oxidoreductase, membrane subunit L"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 17157874, 7690854, 8366049, 8566820, 9030257,
FT                   9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0228"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40010"
FT                   /db_xref="GOA:D8P9V1"
FT                   /db_xref="InterPro:IPR001516"
FT                   /db_xref="InterPro:IPR001750"
FT                   /db_xref="InterPro:IPR003945"
FT                   /db_xref="InterPro:IPR018393"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40010.1"
FT   gene            complement(197569..197871)
FT                   /gene="nuoK"
FT                   /locus_tag="NIDE0229"
FT   CDS_pept        complement(197569..197871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoK"
FT                   /locus_tag="NIDE0229"
FT                   /product="NADH-quinone oxidoreductase, membrane subunit K"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 1463844, 17157874, 7690854, 8366049, 8566820,
FT                   9030257, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0229"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40011"
FT                   /db_xref="GOA:D8P9V2"
FT                   /db_xref="InterPro:IPR001133"
FT                   /db_xref="InterPro:IPR039428"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40011.1"
FT   gene            complement(197868..198392)
FT                   /gene="nuoJ"
FT                   /locus_tag="NIDE0230"
FT   CDS_pept        complement(197868..198392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoJ"
FT                   /locus_tag="NIDE0230"
FT                   /product="NADH-quinone oxidoreductase, membrane subunit J"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 12923180, 17157874, 17360196, 7690854, 8366049,
FT                   9030257, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0230"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40012"
FT                   /db_xref="GOA:D8P9V3"
FT                   /db_xref="InterPro:IPR001457"
FT                   /db_xref="InterPro:IPR042106"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40012.1"
FT                   TPKSIETRRDS"
FT   gene            complement(198402..199010)
FT                   /gene="nuoI"
FT                   /locus_tag="NIDE0231"
FT   CDS_pept        complement(198402..199010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoI"
FT                   /locus_tag="NIDE0231"
FT                   /product="NADH-quinone oxidoreductase, subunit I (modular
FT                   protein)"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 12923180, 17157874, 17360196, 7690854, 8366049,
FT                   9030257, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0231"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40013"
FT                   /db_xref="GOA:D8P9V4"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40013.1"
FT   gene            complement(199034..201742)
FT                   /locus_tag="NIDE0232"
FT   CDS_pept        complement(199034..201742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0232"
FT                   /product="putative NADH-quinone oxidoreductase, subunit G"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12730198, 17157874, 7690854, 8366049,
FT                   9030257, 9593861; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0232"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40014"
FT                   /db_xref="GOA:D8P9V5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40014.1"
FT   gene            complement(201823..203070)
FT                   /gene="nuoD"
FT                   /locus_tag="NIDE0233"
FT   CDS_pept        complement(201823..203070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoD"
FT                   /locus_tag="NIDE0233"
FT                   /product="NADH-quinone oxidoreductase, subunit D"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 1637825, 17157874, 7690854, 8366049, 9030257,
FT                   9219542, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0233"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40015"
FT                   /db_xref="GOA:D8P9V6"
FT                   /db_xref="InterPro:IPR001135"
FT                   /db_xref="InterPro:IPR022885"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="InterPro:IPR038290"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40015.1"
FT                   VTIFGTYDIVMGECDR"
FT   gene            complement(203099..203596)
FT                   /gene="nuoC"
FT                   /locus_tag="NIDE0234"
FT   CDS_pept        complement(203099..203596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoC"
FT                   /locus_tag="NIDE0234"
FT                   /product="NADH-quinone oxidoreductase, subunit C"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 1637825, 17157874, 7690854, 8366049, 9030257,
FT                   9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0234"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40016"
FT                   /db_xref="GOA:D8P9V7"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR010218"
FT                   /db_xref="InterPro:IPR020396"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40016.1"
FT                   TR"
FT   gene            complement(203615..204142)
FT                   /gene="nuoB"
FT                   /locus_tag="NIDE0235"
FT   CDS_pept        complement(203615..204142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoB"
FT                   /locus_tag="NIDE0235"
FT                   /product="NADH-quinone oxidoreductase, subunit B"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 1637825, 17157874, 7690854, 8366049, 9020134,
FT                   9030257, 9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0235"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40017"
FT                   /db_xref="GOA:D8P9V8"
FT                   /db_xref="InterPro:IPR006137"
FT                   /db_xref="InterPro:IPR006138"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40017.1"
FT                   AQPKEVKDALKV"
FT   gene            complement(204133..204516)
FT                   /gene="nuoA"
FT                   /locus_tag="NIDE0236"
FT   CDS_pept        complement(204133..204516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nuoA"
FT                   /locus_tag="NIDE0236"
FT                   /product="NADH-quinone oxidoreductase, membrane subunit A"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12730198, 1637825, 17157874, 7690854, 8366049, 9030257,
FT                   9593861; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0236"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40018"
FT                   /db_xref="GOA:D8P9V9"
FT                   /db_xref="InterPro:IPR000440"
FT                   /db_xref="InterPro:IPR023043"
FT                   /db_xref="InterPro:IPR038430"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9V9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40018.1"
FT   gene            205101..206642
FT                   /locus_tag="NIDE0237"
FT   CDS_pept        205101..206642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0237"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 14763978, 16475801, 2202726"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0237"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40019"
FT                   /db_xref="GOA:D8P9W0"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40019.1"
FT   gene            206954..209179
FT                   /locus_tag="NIDE0238"
FT   CDS_pept        206954..209179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0238"
FT                   /product="putative Primosomal protein N'"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12878029, 14515321, 15252043,
FT                   15323559, 16188886, 1662369, 2162049, 2162050, 8366072;
FT                   Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0238"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40020"
FT                   /db_xref="GOA:D8P9W1"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40020.1"
FT   gene            complement(209186..209623)
FT                   /locus_tag="NIDE0239"
FT   CDS_pept        complement(209186..209623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0239"
FT                   /product="membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0239"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40021"
FT                   /db_xref="GOA:D8P9W2"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40021.1"
FT   gene            complement(209749..210120)
FT                   /locus_tag="NIDE0240"
FT   CDS_pept        complement(209749..210120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0240"
FT                   /product="Signal transduction response regulator, receiver
FT                   domain"
FT                   /function="13.1 : Two-component systems"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10418137, 10966457, 10997904, 11406410, 1482126,
FT                   16176121, 18076326, 8868347, 9068642, 9521117; Product type
FT                   r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0240"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40022"
FT                   /db_xref="GOA:D8P9W3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40022.1"
FT   gene            complement(210228..211826)
FT                   /locus_tag="NIDE0241"
FT   CDS_pept        complement(210228..211826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0241"
FT                   /product="putative Sensor histidine kinase"
FT                   /function="12.4 : Small molecule interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10418137, 10966457, 11406410, 1482126,
FT                   15009198, 16176121, 18076326, 8868347, 9301332, 9382818;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0241"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40023"
FT                   /db_xref="GOA:D8P9W4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40023.1"
FT                   LTEAKEFLAEHDKER"
FT   gene            complement(212256..212339)
FT                   /locus_tag="NIDEtRNA46"
FT   tRNA            complement(212256..212339)
FT                   /locus_tag="NIDEtRNA46"
FT                   /product="tRNA-Leu"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            212563..213258
FT                   /locus_tag="NIDE0243"
FT   CDS_pept        212563..213258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0243"
FT                   /product="putative Haloacid dehalogenase superfamily
FT                   hydrolase, subfamily IB, PSPase-like"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11169108, 11342136; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0243"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40024"
FT                   /db_xref="GOA:D8P9W5"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40024.1"
FT                   NGWPVTTWK"
FT   gene            213310..213948
FT                   /locus_tag="NIDE0244"
FT   CDS_pept        213310..213948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0244"
FT                   /product="putative Radical-activating enzyme, radical SAM
FT                   superfamily"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11222759, 14633981, 14704425; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0244"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40025"
FT                   /db_xref="GOA:D8P9W6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024924"
FT                   /db_xref="InterPro:IPR027621"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40025.1"
FT   gene            214030..215550
FT                   /gene="pepA"
FT                   /locus_tag="NIDE0245"
FT   CDS_pept        214030..215550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pepA"
FT                   /locus_tag="NIDE0245"
FT                   /product="Leucyl aminopeptidase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="9 : Transcription"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10449417, 10970742, 15049810, 2395881, 7616563, 7616564,
FT                   7674922, 8057849, 8416891, 8605888, 8736540; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0245"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40026"
FT                   /db_xref="GOA:D8P9W7"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40026.1"
FT   gene            215622..216773
FT                   /gene="nagZ"
FT                   /locus_tag="NIDE0246"
FT   CDS_pept        215622..216773
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagZ"
FT                   /locus_tag="NIDE0246"
FT                   /product="Beta-N-acetylglucosaminidase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /function="16.13 : Shape"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10940025, 10978324, 12754233, 1377, 8969206; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0246"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40027"
FT                   /db_xref="GOA:D8P9W8"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40027.1"
FT   gene            216995..217381
FT                   /locus_tag="NIDE0247"
FT   CDS_pept        216995..217381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0247"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0247"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40028"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9W9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40028.1"
FT   gene            217378..217902
FT                   /locus_tag="NIDE0248"
FT   CDS_pept        217378..217902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0248"
FT                   /product="conserved membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0248"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40029"
FT                   /db_xref="GOA:D8P9X0"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40029.1"
FT                   MRPTRERSATT"
FT   gene            217995..218456
FT                   /locus_tag="NIDE0249"
FT   CDS_pept        217995..218456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0249"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0249"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40030"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40030.1"
FT   gene            complement(218493..219983)
FT                   /gene="yeeF"
FT                   /locus_tag="NIDE0250"
FT   CDS_pept        complement(218493..219983)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yeeF"
FT                   /locus_tag="NIDE0250"
FT                   /product="Amino acid permease"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 16621821, 2687114, 3146645, 8382989; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0250"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40031"
FT                   /db_xref="GOA:D8P9X2"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40031.1"
FT   gene            complement(220002..220778)
FT                   /locus_tag="NIDE0251"
FT   CDS_pept        complement(220002..220778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0251"
FT                   /product="putative Gamma-glutamyl-gamma-aminobutyrate
FT                   hydrolase"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="2.4 : Pyrimidine ribonucleotide biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11517925, 11953431, 15590624; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0251"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40032"
FT                   /db_xref="GOA:D8P9X3"
FT                   /db_xref="InterPro:IPR011697"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40032.1"
FT   gene            complement(220780..221253)
FT                   /locus_tag="NIDE0252"
FT   CDS_pept        complement(220780..221253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0252"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0252"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40033"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40033.1"
FT   gene            complement(221386..221844)
FT                   /locus_tag="NIDE0253"
FT   CDS_pept        complement(221386..221844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0253"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0253"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40034"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40034.1"
FT   gene            221891..223156
FT                   /locus_tag="NIDE0254"
FT   CDS_pept        221891..223156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0254"
FT                   /product="Peptidase M24"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15005612, 16229471, 2659585, 5880695, 7674922,
FT                   8471602; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0254"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40035"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40035.1"
FT   gene            223303..224157
FT                   /locus_tag="NIDE0255"
FT   CDS_pept        223303..224157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0255"
FT                   /product="Twin arginine-targeting protein translocase,
FT                   TatA/E family (modular protein)"
FT                   /function="11.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10652088, 9546395, 9649434; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0255"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40036"
FT                   /db_xref="GOA:D8P9X7"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40036.1"
FT                   KSV"
FT   gene            224349..225194
FT                   /locus_tag="NIDE0256"
FT   CDS_pept        224349..225194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0256"
FT                   /product="protein of unknown function, HEAT repeat protein"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0256"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40037"
FT                   /db_xref="GOA:D8P9X8"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40037.1"
FT                   "
FT   gene            complement(225148..225666)
FT                   /locus_tag="NIDE0257"
FT   CDS_pept        complement(225148..225666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0257"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0257"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40038"
FT                   /db_xref="GOA:D8P9X9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9X9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40038.1"
FT                   SLNRTRATA"
FT   gene            complement(225731..226255)
FT                   /locus_tag="NIDE0258"
FT   CDS_pept        complement(225731..226255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0258"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0258"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40039"
FT                   /db_xref="GOA:D8P9Y0"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40039.1"
FT                   SVKGIPSDEPK"
FT   gene            226256..226477
FT                   /locus_tag="NIDE0259"
FT   CDS_pept        226256..226477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0259"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0259"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40040"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40040.1"
FT   gene            complement(226474..227730)
FT                   /gene="clpX"
FT                   /locus_tag="NIDE0260"
FT   CDS_pept        complement(226474..227730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpX"
FT                   /locus_tag="NIDE0260"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpX"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10322004, 12667450, 12937164, 14525985, 7743994, 8226769,
FT                   8226770, 8973311; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0260"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40041"
FT                   /db_xref="GOA:D8P9Y2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004487"
FT                   /db_xref="InterPro:IPR010603"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038366"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40041.1"
FT   gene            complement(227757..228392)
FT                   /gene="clpP"
FT                   /locus_tag="NIDE0261"
FT   CDS_pept        complement(227757..228392)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="clpP"
FT                   /locus_tag="NIDE0261"
FT                   /product="ATP-dependent Clp protease, proteolytic subunit
FT                   clpP"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 16899079, 2197275, 2211522, 8012595, 8831780, 9383193,
FT                   9390554, 9643546; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0261"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40042"
FT                   /db_xref="GOA:D8P9Y3"
FT                   /db_xref="InterPro:IPR001907"
FT                   /db_xref="InterPro:IPR018215"
FT                   /db_xref="InterPro:IPR023562"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033135"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40042.1"
FT   gene            complement(228519..229844)
FT                   /gene="tig"
FT                   /locus_tag="NIDE0262"
FT   CDS_pept        complement(228519..229844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tig"
FT                   /locus_tag="NIDE0262"
FT                   /product="Trigger factor (TF)"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12452438, 12603737, 12756233, 15148364, 2211496,
FT                   8521806, 9063446; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0262"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40043"
FT                   /db_xref="GOA:D8P9Y4"
FT                   /db_xref="InterPro:IPR005215"
FT                   /db_xref="InterPro:IPR008880"
FT                   /db_xref="InterPro:IPR008881"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="InterPro:IPR036611"
FT                   /db_xref="InterPro:IPR037041"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40043.1"
FT   gene            complement(229905..229987)
FT                   /locus_tag="NIDEtRNA45"
FT   tRNA            complement(229905..229987)
FT                   /locus_tag="NIDEtRNA45"
FT                   /product="tRNA-Leu"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            230316..231401
FT                   /locus_tag="NIDE0263"
FT   CDS_pept        230316..231401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0263"
FT                   /product="exported protein of unknown function, contains
FT                   PBS lyase HEAT-like repeats"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10708746, 16819590, 8132596, 9023176,
FT                   9882677"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0263"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40044"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40044.1"
FT   gene            231807..233009
FT                   /locus_tag="NIDE0264"
FT   CDS_pept        231807..233009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0264"
FT                   /product="putative Leu/Ile/Val-binding protein,
FT                   periplasmic-binding component of ABC transport system"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.1 : Amino acids, peptides and amines"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 15850393, 2195019, 2649682, 3891753,
FT                   4077929, 8011339; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0264"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40045"
FT                   /db_xref="GOA:D8P9Y6"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40045.1"
FT                   L"
FT   gene            complement(233074..234579)
FT                   /locus_tag="NIDE0265"
FT   CDS_pept        complement(233074..234579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0265"
FT                   /product="putative Outer membrane protein, OmpA/MotB
FT                   family"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10515919, 1538702, 17052729, 2202726;
FT                   Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0265"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40046"
FT                   /db_xref="GOA:D8P9Y7"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40046.1"
FT   gene            complement(234827..236029)
FT                   /locus_tag="NIDE0266"
FT   CDS_pept        complement(234827..236029)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0266"
FT                   /product="putative Outer membrane protein, OmpA/MotB
FT                   family"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10515919, 1538702, 17052729, 2202726;
FT                   Product type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0266"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40047"
FT                   /db_xref="GOA:D8P9Y8"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40047.1"
FT                   H"
FT   gene            complement(236105..236533)
FT                   /gene="mscL"
FT                   /locus_tag="NIDE0267"
FT   CDS_pept        complement(236105..236533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscL"
FT                   /locus_tag="NIDE0267"
FT                   /product="Large-conductance mechanosensitive channel"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10202137, 7511799, 8890153, 9632260, 9856938; Product
FT                   type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0267"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40048"
FT                   /db_xref="GOA:D8P9Y9"
FT                   /db_xref="InterPro:IPR001185"
FT                   /db_xref="InterPro:IPR019823"
FT                   /db_xref="InterPro:IPR036019"
FT                   /db_xref="InterPro:IPR037673"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Y9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40048.1"
FT   gene            complement(236583..237692)
FT                   /locus_tag="NIDE0268"
FT   CDS_pept        complement(236583..237692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0268"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0268"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40049"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40049.1"
FT   gene            complement(237793..237963)
FT                   /locus_tag="NIDE0269"
FT   CDS_pept        complement(237793..237963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0269"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0269"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40050"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40050.1"
FT                   QPRDGFLEPEC"
FT   gene            complement(238023..238568)
FT                   /locus_tag="NIDE0270"
FT   CDS_pept        complement(238023..238568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0270"
FT                   /product="protein of unknown function, putative
FT                   transcriptional regulator"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0270"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40051"
FT                   /db_xref="GOA:D8P9Z2"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40051.1"
FT                   TSADSESTKETRKLTNVK"
FT   gene            complement(238607..240403)
FT                   /locus_tag="NIDE0271"
FT   CDS_pept        complement(238607..240403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0271"
FT                   /product="Sigma-54 dependent response regulator"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11123690, 11183780, 11544185, 12618438,
FT                   14561776, 1534752, 2041769, 2694934, 8407777, 9738943;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0271"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40052"
FT                   /db_xref="GOA:D8P9Z3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40052.1"
FT   gene            complement(240393..240929)
FT                   /locus_tag="NIDE0273"
FT   CDS_pept        complement(240393..240929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0273"
FT                   /product="conserved protein of unknown function, small
FT                   GTP-binding protein"
FT                   /function="18 : Unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10712923, 11099382,
FT                   12163169, 12384139, 12728271, 17143896"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0273"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40053"
FT                   /db_xref="GOA:D8P9Z4"
FT                   /db_xref="InterPro:IPR001806"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40053.1"
FT                   GTPPETPPAGTTDGV"
FT   gene            complement(240942..242672)
FT                   /locus_tag="NIDE0274"
FT   CDS_pept        complement(240942..242672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0274"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0274"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40054"
FT                   /db_xref="GOA:D8P9Z5"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40054.1"
FT                   "
FT   gene            complement(242789..243406)
FT                   /locus_tag="NIDE0275"
FT   CDS_pept        complement(242789..243406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0275"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0275"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40055"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40055.1"
FT   gene            complement(243543..244343)
FT                   /gene="mscS"
FT                   /locus_tag="NIDE0276"
FT   CDS_pept        complement(243543..244343)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mscS"
FT                   /locus_tag="NIDE0276"
FT                   /product="Small-conductance mechanosensitive channel"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10202137, 12080120, 12446901, 12551944, 15665866,
FT                   2436228, 7595939; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0276"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40056"
FT                   /db_xref="GOA:D8P9Z7"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40056.1"
FT   gene            complement(244362..246470)
FT                   /locus_tag="NIDE0277"
FT   CDS_pept        complement(244362..246470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0277"
FT                   /product="protein of unknown function; AsmA family"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 7476172, 8866482"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0277"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40057"
FT                   /db_xref="GOA:D8P9Z8"
FT                   /db_xref="InterPro:IPR007844"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40057.1"
FT                   LLKGLFGR"
FT   gene            246688..246777
FT                   /locus_tag="NIDEtRNA2"
FT   tRNA            246688..246777
FT                   /locus_tag="NIDEtRNA2"
FT                   /product="tRNA-Ser"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            247214..249091
FT                   /gene="dnaX"
FT                   /locus_tag="NIDE0278"
FT   CDS_pept        247214..249091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="NIDE0278"
FT                   /product="DNA polymerase III, gamma and tau subunits"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11463787, 1575709, 2124672, 2181440, 2186364, 2187190,
FT                   3534795, 7538662, 7961443, 8598050, 9209069, 9300054;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0278"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40058"
FT                   /db_xref="GOA:D8P9Z9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8P9Z9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40058.1"
FT   gene            249088..249411
FT                   /gene="ybaB"
FT                   /locus_tag="NIDE0279"
FT   CDS_pept        249088..249411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybaB"
FT                   /locus_tag="NIDE0279"
FT                   /product="conserved protein of unknown function, UPF0133"
FT                   /function="19 : Unclassified"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0279"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40059"
FT                   /db_xref="GOA:D8PA00"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA00"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40059.1"
FT                   GLF"
FT   gene            249448..250050
FT                   /gene="recR"
FT                   /locus_tag="NIDE0280"
FT   CDS_pept        249448..250050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="NIDE0280"
FT                   /product="Recombination protein recR"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11056289, 11459953, 14625283, 15116069, 1698765, 2674903,
FT                   7862088, 8483906, 9108043, 9363943; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0280"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40060"
FT                   /db_xref="GOA:D8PA01"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA01"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40060.1"
FT   gene            250192..250608
FT                   /locus_tag="NIDE0281"
FT   CDS_pept        250192..250608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0281"
FT                   /product="putative RNA polymerase-binding protein DksA"
FT                   /function="10.4 : Translation factors"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="12 : Regulatory functions"
FT                   /function="9.3 : Transcription factors"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10529348, 12665246, 15294157,
FT                   15355225, 15718139, 15899978, 15948952, 15963892, 17210253;
FT                   Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0281"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40061"
FT                   /db_xref="GOA:D8PA02"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA02"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40061.1"
FT   gene            complement(250676..251821)
FT                   /locus_tag="NIDE0282"
FT   CDS_pept        complement(250676..251821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0282"
FT                   /product="protein of unknown function, TPR-like"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0282"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40062"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA03"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40062.1"
FT   gene            complement(251972..252301)
FT                   /locus_tag="NIDE0283"
FT   CDS_pept        complement(251972..252301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0283"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0283"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40063"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA04"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40063.1"
FT                   DSQRR"
FT   gene            252751..253143
FT                   /locus_tag="NIDE0284"
FT   CDS_pept        252751..253143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0284"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0284"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40064"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA05"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40064.1"
FT   gene            253127..253546
FT                   /locus_tag="NIDE0285"
FT   CDS_pept        253127..253546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0285"
FT                   /product="conserved protein of unknown function, DUF132"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0285"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40065"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002850"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA06"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40065.1"
FT   gene            complement(253836..254396)
FT                   /locus_tag="NIDE0286"
FT   CDS_pept        complement(253836..254396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0286"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0286"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40066"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA07"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40066.1"
FT   gene            254512..254745
FT                   /locus_tag="NIDE0287"
FT   CDS_pept        254512..254745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0287"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0287"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40067"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA08"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40067.1"
FT   gene            complement(254908..255258)
FT                   /locus_tag="NIDE0288"
FT   CDS_pept        complement(254908..255258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0288"
FT                   /product="conserved protein of unknown function, contains
FT                   Fis-type HTH domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0288"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40068"
FT                   /db_xref="InterPro:IPR019650"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA09"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40068.1"
FT                   LLASLASSALGL"
FT   gene            complement(255396..255974)
FT                   /locus_tag="NIDE0289"
FT   CDS_pept        complement(255396..255974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0289"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0289"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40069"
FT                   /db_xref="GOA:D8PA10"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA10"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40069.1"
FT   gene            256551..257123
FT                   /locus_tag="NIDE0290"
FT   CDS_pept        256551..257123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0290"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0290"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40070"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA11"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40070.1"
FT   gene            256931..257326
FT                   /pseudo
FT                   /locus_tag="NIDE0291"
FT   CDS_pept        256931..257326
FT                   /pseudo
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0291"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="PSEUDO:CBK40071.1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT   gene            257327..257557
FT                   /locus_tag="NIDE0292"
FT   CDS_pept        257327..257557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0292"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0292"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40072"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA13"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40072.1"
FT   gene            257588..257914
FT                   /locus_tag="NIDE0293"
FT   CDS_pept        257588..257914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0293"
FT                   /product="putative DNA-binding domain protein, Excisionase
FT                   family (modular protein)"
FT                   /function="18 : Unknown function"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0293"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40073"
FT                   /db_xref="GOA:D8PA14"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA14"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40073.1"
FT                   DGAR"
FT   gene            257901..259022
FT                   /gene="int"
FT                   /locus_tag="NIDE0294"
FT   CDS_pept        257901..259022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="int"
FT                   /locus_tag="NIDE0294"
FT                   /product="Phage integrase"
FT                   /function="17.2 : Prophage functions"
FT                   /function="8.2 : Restriction/modification"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12887904, 2183007, 2553674, 9082984, 9311978;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0294"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40074"
FT                   /db_xref="GOA:D8PA15"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA15"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40074.1"
FT   gene            complement(258979..259053)
FT                   /locus_tag="NIDEtRNA44"
FT   tRNA            complement(258979..259053)
FT                   /locus_tag="NIDEtRNA44"
FT                   /product="tRNA-Val"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            259249..260565
FT                   /gene="trmFO"
FT                   /locus_tag="NIDE0295"
FT   CDS_pept        259249..260565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmFO"
FT                   /locus_tag="NIDE0295"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme gid"
FT                   /function="10 : Protein synthesis"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11544186, 11703671, 16027442, 9603884; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0295"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40075"
FT                   /db_xref="GOA:D8PA16"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004417"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA16"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40075.1"
FT   gene            260538..261491
FT                   /gene="xerC"
FT                   /locus_tag="NIDE0296"
FT   CDS_pept        260538..261491
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="xerC"
FT                   /locus_tag="NIDE0296"
FT                   /product="Tyrosine recombinase xerC"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10027974, 10523315, 1931824, 2254268, 7729430, 7744017,
FT                   7838714, 8168483, 8402918; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0296"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40076"
FT                   /db_xref="GOA:D8PA17"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA17"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40076.1"
FT   gene            261488..262024
FT                   /gene="hslV"
FT                   /locus_tag="NIDE0297"
FT   CDS_pept        261488..262024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslV"
FT                   /locus_tag="NIDE0297"
FT                   /product="Heat shock protein HslUV, peptidase component"
FT                   /function="11 : Protein fate"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number="3.4.25.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10693812, 11106733, 11685516, 11717526, 8244018, 9177170,
FT                   9257689, 9288941; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0297"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40077"
FT                   /db_xref="GOA:D8PA18"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA18"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40077.1"
FT                   DIYTNQQIVIESLSR"
FT   gene            262037..263440
FT                   /gene="hslU"
FT                   /locus_tag="NIDE0298"
FT   CDS_pept        262037..263440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hslU"
FT                   /locus_tag="NIDE0298"
FT                   /product="Heat shock protein HslVU, ATPase subunit"
FT                   /function="11 : Protein fate"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10693812, 11106733, 8244018, 8867465, 9288941, 9722513;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0298"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40078"
FT                   /db_xref="GOA:D8PA19"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA19"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40078.1"
FT                   DQDLSRYIL"
FT   gene            263467..264363
FT                   /gene="argB"
FT                   /locus_tag="NIDE0299"
FT   CDS_pept        263467..264363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="NIDE0299"
FT                   /product="Acetylglutamate kinase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10393305, 12005432, 12875848, 14623187, 15342584,
FT                   16376937, 8581175; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0299"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40079"
FT                   /db_xref="GOA:D8PA20"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA20"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40079.1"
FT                   ILLEIFTHKGIGTEIVA"
FT   gene            264588..265286
FT                   /locus_tag="NIDE0300"
FT   CDS_pept        264588..265286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0300"
FT                   /product="protein of unknown function, putative
FT                   SAM-dependent methyltransferase"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0300"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40080"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA21"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40080.1"
FT                   GDPVCLMRLG"
FT   gene            complement(265304..265843)
FT                   /gene="yrdA"
FT                   /locus_tag="NIDE0301"
FT   CDS_pept        complement(265304..265843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yrdA"
FT                   /locus_tag="NIDE0301"
FT                   /product="putative Transferase, hexapeptide repeat protein"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10924115, 1427014, 16223443, 7481807,
FT                   8293817; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0301"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40081"
FT                   /db_xref="GOA:D8PA22"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA22"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40081.1"
FT                   RQYLSGPDKPRPGFWV"
FT   gene            265928..267382
FT                   /gene="yliG"
FT                   /locus_tag="NIDE0302"
FT   CDS_pept        265928..267382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yliG"
FT                   /locus_tag="NIDE0302"
FT                   /product="putative tRNA modifying enzyme, MiaB-like"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10572129, 11313137, 11882645; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0302"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40082"
FT                   /db_xref="GOA:D8PA23"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA23"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40082.1"
FT   gene            complement(267426..268904)
FT                   /gene="degP"
FT                   /locus_tag="NIDE0303"
FT   CDS_pept        complement(267426..268904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="degP"
FT                   /locus_tag="NIDE0303"
FT                   /product="Serine protease Do"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11919638, 12408815, 12878036, 15137941, 2025286, 2180903,
FT                   3057437, 7845208, 8439290, 8576051, 9204764; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0303"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40083"
FT                   /db_xref="GOA:D8PA24"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA24"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40083.1"
FT   gene            complement(269019..270422)
FT                   /gene="cztS"
FT                   /locus_tag="NIDE0304"
FT   CDS_pept        complement(269019..270422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cztS"
FT                   /locus_tag="NIDE0304"
FT                   /product="Heavy metal sensor histidine kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="12.3 : Protein interactions"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11004187, 11399769, 8449873, 9044283; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0304"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40084"
FT                   /db_xref="GOA:D8PA25"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA25"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40084.1"
FT                   VLPLAPPTA"
FT   gene            complement(270422..271093)
FT                   /gene="cztR"
FT                   /locus_tag="NIDE0305"
FT   CDS_pept        complement(270422..271093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cztR"
FT                   /locus_tag="NIDE0305"
FT                   /product="Heavy metal response regulator"
FT                   /function="13.1 : Two-component systems"
FT                   /function="9 : Transcription"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11004187, 11283292, 11399769, 12829274, 8078459,
FT                   8449873; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0305"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40085"
FT                   /db_xref="GOA:D8PA26"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA26"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40085.1"
FT                   D"
FT   gene            complement(271162..272304)
FT                   /locus_tag="NIDE0306"
FT   CDS_pept        complement(271162..272304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0306"
FT                   /product="putative Peptidase, family M48"
FT                   /function="11 : Protein fate"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7674922, 9015299; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0306"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40086"
FT                   /db_xref="GOA:D8PA27"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA27"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40086.1"
FT   gene            complement(272310..273320)
FT                   /locus_tag="NIDE0307"
FT   CDS_pept        complement(272310..273320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0307"
FT                   /product="conserved membrane protein of unknown function,
FT                   DUF898"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0307"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40087"
FT                   /db_xref="GOA:D8PA28"
FT                   /db_xref="InterPro:IPR010295"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA28"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40087.1"
FT   gene            complement(273582..274631)
FT                   /locus_tag="NIDE0308"
FT   CDS_pept        complement(273582..274631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0308"
FT                   /product="protein of unknown function, contains Ankyrin and
FT                   Tetratricopeptide repeats"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 12461176, 14659697, 7667876, 8108379,
FT                   9482716"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0308"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40088"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA29"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40088.1"
FT                   CTFGHRAAC"
FT   gene            274704..274904
FT                   /locus_tag="NIDE0309"
FT   CDS_pept        274704..274904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0309"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0309"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40089"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA30"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40089.1"
FT   gene            complement(275073..276728)
FT                   /gene="sdhA"
FT                   /locus_tag="NIDE0310"
FT   CDS_pept        complement(275073..276728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="NIDE0310"
FT                   /product="Succinate dehydrogenase/fumarate reductase,
FT                   flavoprotein subunit"
FT                   /function="6.12 : TCA cycle"
FT                   /function="6.7 : Fermentation"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11850430, 1856194, 2668268, 6383359, 8224887; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0310"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40090"
FT                   /db_xref="GOA:D8PA31"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA31"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40090.1"
FT   gene            276934..279819
FT                   /gene="gcvP"
FT                   /locus_tag="NIDE0312"
FT   CDS_pept        276934..279819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvP"
FT                   /locus_tag="NIDE0312"
FT                   /product="Glycine dehydrogenase, glycine cleavage system P
FT                   protein"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1802033, 8181752, 8219277, 8375392, 8830251; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0312"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40091"
FT                   /db_xref="GOA:D8PA32"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA32"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40091.1"
FT   gene            279827..280465
FT                   /locus_tag="NIDE0313"
FT   CDS_pept        279827..280465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0313"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0313"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40092"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA33"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40092.1"
FT   gene            280498..281484
FT                   /gene="rih"
FT                   /locus_tag="NIDE0314"
FT   CDS_pept        280498..281484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rih"
FT                   /locus_tag="NIDE0314"
FT                   /product="Inosine-uridine preferring nucleoside hydrolase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11027694, 8634237, 8634238; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0314"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40093"
FT                   /db_xref="GOA:D8PA34"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA34"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40093.1"
FT   gene            281481..282407
FT                   /gene="rbsK"
FT                   /locus_tag="NIDE0315"
FT   CDS_pept        281481..282407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rbsK"
FT                   /locus_tag="NIDE0315"
FT                   /product="Ribokinase"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10438599, 3011794, 7921236, 9385653, 9519409; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0315"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40094"
FT                   /db_xref="GOA:D8PA35"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA35"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40094.1"
FT   gene            complement(282450..283091)
FT                   /locus_tag="NIDE0316"
FT   CDS_pept        complement(282450..283091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0316"
FT                   /product="exported protein of unknown function, TPR-like"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0316"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA36"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40095.1"
FT   gene            complement(283190..283735)
FT                   /gene="mug"
FT                   /locus_tag="NIDE0317"
FT   CDS_pept        complement(283190..283735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mug"
FT                   /locus_tag="NIDE0317"
FT                   /product="G:T/U mismatch-specific DNA glycosylase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10339434, 10521502, 10581234, 11555290, 12184783,
FT                   12531390, 12668677, 8878487, 9489705; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0317"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40096"
FT                   /db_xref="GOA:D8PA37"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR015637"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA37"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40096.1"
FT                   EAFRTLTPWAKSGLKSRP"
FT   gene            283975..284199
FT                   /locus_tag="NIDE0318"
FT   CDS_pept        283975..284199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0318"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0318"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40097"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA38"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40097.1"
FT   gene            complement(284276..284794)
FT                   /gene="nudF"
FT                   /locus_tag="NIDE0319"
FT   CDS_pept        complement(284276..284794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nudF"
FT                   /locus_tag="NIDE0319"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /function="2.6 : Sugar-nucleotide biosynthesis and
FT                   conversions"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /function="16.8 : Protect"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10542272, 11323725, 11416161, 12135348, 1328155,
FT                   16378245, 16766526, 8170394, 8233837, 8810257; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0319"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40098"
FT                   /db_xref="GOA:D8PA39"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA39"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40098.1"
FT                   VYIRQERYR"
FT   gene            complement(284798..285907)
FT                   /gene="gcvT"
FT                   /locus_tag="NIDE0320"
FT   CDS_pept        complement(284798..285907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="NIDE0320"
FT                   /product="Aminomethyltransferase, glycine cleavage system T
FT                   protein"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10364177, 1802033, 8181752, 8219277, 8375392, 9047339;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0320"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40099"
FT                   /db_xref="GOA:D8PA40"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA40"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40099.1"
FT   gene            complement(285962..286333)
FT                   /gene="fbp"
FT                   /locus_tag="NIDE0321"
FT   CDS_pept        complement(285962..286333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fbp"
FT                   /locus_tag="NIDE0321"
FT                   /product="Peptidyl-prolyl cis-trans isomerase"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1371354, 14672666, 1696687, 2186809, 8404888; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0321"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40100"
FT                   /db_xref="GOA:D8PA41"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA41"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40100.1"
FT   gene            complement(286465..287691)
FT                   /locus_tag="NIDE0322"
FT   CDS_pept        complement(286465..287691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0322"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0322"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40101"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA42"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40101.1"
FT                   RSDTQASKH"
FT   gene            complement(287739..287966)
FT                   /locus_tag="NIDE0323"
FT   CDS_pept        complement(287739..287966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0323"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0323"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40102"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA43"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40102.1"
FT   gene            complement(288239..289504)
FT                   /gene="dmpA"
FT                   /locus_tag="NIDE0324"
FT   CDS_pept        complement(288239..289504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dmpA"
FT                   /locus_tag="NIDE0324"
FT                   /product="Peptidase S58"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.11.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10089474, 10379365, 10673442, 15955066,
FT                   16109932, 17064315, 7845208, 8439290; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0324"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40103"
FT                   /db_xref="GOA:D8PA44"
FT                   /db_xref="InterPro:IPR005321"
FT                   /db_xref="InterPro:IPR016117"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA44"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40103.1"
FT   gene            complement(289549..290946)
FT                   /locus_tag="NIDE0325"
FT   CDS_pept        complement(289549..290946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0325"
FT                   /product="putative RNA-metabolising metallo-beta-lactamase"
FT                   /function="9.4 : RNA processing"
FT                   /function="9.1 : Degradation of RNA"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12177301, 16518398, 7588620; Product
FT                   type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0325"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40104"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR011108"
FT                   /db_xref="InterPro:IPR022712"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA45"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40104.1"
FT                   KDSIYEI"
FT   gene            complement(290943..291809)
FT                   /locus_tag="NIDE0326"
FT   CDS_pept        complement(290943..291809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0326"
FT                   /product="conserved protein of unknown function CHP00730"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0326"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40105"
FT                   /db_xref="GOA:D8PA46"
FT                   /db_xref="InterPro:IPR005269"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA46"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40105.1"
FT                   HGGPSAR"
FT   gene            complement(291867..292289)
FT                   /locus_tag="NIDE0327"
FT   CDS_pept        complement(291867..292289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0327"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0327"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40106"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA47"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40106.1"
FT   gene            complement(292294..292674)
FT                   /locus_tag="NIDE0328"
FT   CDS_pept        complement(292294..292674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0328"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0328"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40107"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA48"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40107.1"
FT   gene            complement(292710..293228)
FT                   /locus_tag="NIDE0329"
FT   CDS_pept        complement(292710..293228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0329"
FT                   /product="N-acetyltransferase, GNAT family"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10940244, 12801725, 15123251, 15468321,
FT                   15581578, 16210326, 9175471, 9727486; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0329"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40108"
FT                   /db_xref="GOA:D8PA49"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA49"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40108.1"
FT                   RPHSVGTKA"
FT   gene            complement(293225..293851)
FT                   /locus_tag="NIDE0330"
FT   CDS_pept        complement(293225..293851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0330"
FT                   /product="conserved membrane protein of unknown function
FT                   DUF502"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0330"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40109"
FT                   /db_xref="GOA:D8PA50"
FT                   /db_xref="InterPro:IPR007462"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA50"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40109.1"
FT   gene            293892..294290
FT                   /locus_tag="NIDE0331"
FT   CDS_pept        293892..294290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0331"
FT                   /product="conserved protein of unknown function, DUF343
FT                   (modular protein)"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0331"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40110"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA51"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40110.1"
FT   gene            complement(294800..295039)
FT                   /locus_tag="NIDE0332"
FT   CDS_pept        complement(294800..295039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0332"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0332"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40111"
FT                   /db_xref="GOA:D8PA52"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA52"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40111.1"
FT   gene            complement(295097..295465)
FT                   /locus_tag="NIDE0333"
FT   CDS_pept        complement(295097..295465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0333"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0333"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40112"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA53"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40112.1"
FT                   YLSSLITATEIESAKTSV"
FT   gene            complement(295550..295879)
FT                   /locus_tag="NIDE0334"
FT   CDS_pept        complement(295550..295879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0334"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0334"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40113"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA54"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40113.1"
FT                   SLLFT"
FT   gene            296163..296237
FT                   /locus_tag="NIDEtRNA3"
FT   tRNA            296163..296237
FT                   /locus_tag="NIDEtRNA3"
FT                   /product="tRNA-Gly"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(296244..297284)
FT                   /locus_tag="NIDE0335"
FT   CDS_pept        complement(296244..297284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0335"
FT                   /product="putative Phage integrase"
FT                   /function="17.2 : Prophage functions"
FT                   /function="8.2 : Restriction/modification"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12887904, 15973401, 2553674, 3491212,
FT                   9082984, 9288963, 9311978; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0335"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40114"
FT                   /db_xref="GOA:D8PA55"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA55"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40114.1"
FT                   ECCASA"
FT   gene            complement(297304..297615)
FT                   /locus_tag="NIDE0336"
FT   CDS_pept        complement(297304..297615)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0336"
FT                   /product="putative DNA-binding domain protein, Excisionase
FT                   family (modular protein)"
FT                   /function="17 : Mobile and extrachromosomal element
FT                   functions"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type h : extrachromosomal origin"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0336"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40115"
FT                   /db_xref="GOA:D8PA56"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA56"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40115.1"
FT   gene            complement(297658..298665)
FT                   /locus_tag="NIDE0337"
FT   CDS_pept        complement(297658..298665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0337"
FT                   /product="protein of unknown function, putative Replication
FT                   initiation factor"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 2270231"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0337"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40116"
FT                   /db_xref="GOA:D8PA57"
FT                   /db_xref="InterPro:IPR003491"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA57"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40116.1"
FT   gene            298845..299129
FT                   /locus_tag="NIDE0338"
FT   CDS_pept        298845..299129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0338"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0338"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40117"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA58"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40117.1"
FT   gene            299200..300063
FT                   /locus_tag="NIDE0339"
FT   CDS_pept        299200..300063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0339"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0339"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40118"
FT                   /db_xref="GOA:D8PA59"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA59"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40118.1"
FT                   PFSGGQ"
FT   gene            300126..300419
FT                   /locus_tag="NIDE0340"
FT   CDS_pept        300126..300419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0340"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0340"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40119"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA60"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40119.1"
FT   gene            complement(300576..300677)
FT                   /locus_tag="NIDE0341"
FT   CDS_pept        complement(300576..300677)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0341"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0341"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40120"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA61"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40120.1"
FT   gene            complement(300878..303082)
FT                   /locus_tag="NIDE0342"
FT   CDS_pept        complement(300878..303082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0342"
FT                   /product="conserved membrane protein of unknown function,
FT                   Transglutaminase-like"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10452618, 12366374,
FT                   9791169"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0342"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40121"
FT                   /db_xref="GOA:D8PA62"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR021878"
FT                   /db_xref="InterPro:IPR025403"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA62"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40121.1"
FT   gene            complement(303054..304196)
FT                   /locus_tag="NIDE0343"
FT   CDS_pept        complement(303054..304196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0343"
FT                   /product="conserved protein of unknown function, DUF58"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0343"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40122"
FT                   /db_xref="GOA:D8PA63"
FT                   /db_xref="InterPro:IPR002881"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA63"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40122.1"
FT   gene            complement(304272..305276)
FT                   /locus_tag="NIDE0344"
FT   CDS_pept        complement(304272..305276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0344"
FT                   /product="ATPase, AAA family; putative Methanol
FT                   dehydrogenase regulatory protein MoxR"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1657871, 2504152, 7646486, 8997703, 9927482;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0344"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40123"
FT                   /db_xref="GOA:D8PA64"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011703"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041628"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA64"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40123.1"
FT   gene            complement(305372..306700)
FT                   /locus_tag="NIDE0345"
FT   CDS_pept        complement(305372..306700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0345"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0345"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40124"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA65"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40124.1"
FT   gene            306840..307856
FT                   /locus_tag="NIDE0346"
FT   CDS_pept        306840..307856
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0346"
FT                   /product="exported protein of unknown function, DUF399"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0346"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40125"
FT                   /db_xref="InterPro:IPR007314"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA66"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40125.1"
FT   gene            308071..308937
FT                   /locus_tag="NIDE0347"
FT   CDS_pept        308071..308937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0347"
FT                   /product="protein of unknown function, contains SWIM-type
FT                   Zinc finger domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10529348, 11179890, 12151216,
FT                   12665246, 15718139, 15963892, 17210253"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0347"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40126"
FT                   /db_xref="GOA:D8PA67"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA67"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40126.1"
FT                   LKSLGKA"
FT   gene            309076..309252
FT                   /locus_tag="NIDE0348"
FT   CDS_pept        309076..309252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0348"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0348"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40127"
FT                   /db_xref="GOA:D8PA68"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA68"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40127.1"
FT                   LGFGVYDTFFKKS"
FT   gene            complement(309314..310117)
FT                   /gene="tesA"
FT                   /locus_tag="NIDE0349"
FT   CDS_pept        complement(309314..310117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesA"
FT                   /locus_tag="NIDE0349"
FT                   /product="TAP complex multifunctional esterase (modular
FT                   protein)"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number=""
FT                   /EC_number="3.1.2.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10423542, 12842470, 15697222, 16515533,
FT                   17604237, 1864840, 7610479; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0349"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40128"
FT                   /db_xref="GOA:D8PA69"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA69"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40128.1"
FT   gene            310176..310880
FT                   /gene="ybbA"
FT                   /locus_tag="NIDE0350"
FT   CDS_pept        310176..310880
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ybbA"
FT                   /locus_tag="NIDE0350"
FT                   /product="Uncharacterized ABC-type transport system, ATPase
FT                   component"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10783239, 11421269, 11844772, 11988180, 2126155,
FT                   2229036, 3762694, 8098033, 9640644, 9872322, 9873074;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0350"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40129"
FT                   /db_xref="GOA:D8PA70"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA70"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40129.1"
FT                   ASLHQRMPDLEP"
FT   gene            310877..313549
FT                   /locus_tag="NIDE0351"
FT   CDS_pept        310877..313549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0351"
FT                   /product="putative Uncharacterized ABC-type transport
FT                   system, permease component YbbP"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0351"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40130"
FT                   /db_xref="GOA:D8PA71"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA71"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40130.1"
FT   gene            complement(313580..316096)
FT                   /locus_tag="NIDE0352"
FT   CDS_pept        complement(313580..316096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0352"
FT                   /product="putative Peptidase M1, membrane alanine
FT                   aminopeptidase"
FT                   /function="11 : Protein fate"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7674922; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0352"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40131"
FT                   /db_xref="GOA:D8PA72"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR024571"
FT                   /db_xref="InterPro:IPR034016"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA72"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40131.1"
FT   gene            complement(316354..317070)
FT                   /gene="rpiA"
FT                   /locus_tag="NIDE0353"
FT   CDS_pept        complement(316354..317070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="NIDE0353"
FT                   /product="Ribose-5-phosphate isomerase A"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12057201, 12211039, 12517338, 13679361, 8366047; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0353"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40132"
FT                   /db_xref="GOA:D8PA73"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA73"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40132.1"
FT                   IVGHAQGADVTLAAES"
FT   gene            complement(317067..318152)
FT                   /gene="glk"
FT                   /locus_tag="NIDE0354"
FT   CDS_pept        complement(317067..318152)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glk"
FT                   /locus_tag="NIDE0354"
FT                   /product="Glucokinase"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15466045, 16233797, 9023215, 9620975; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0354"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40133"
FT                   /db_xref="GOA:D8PA74"
FT                   /db_xref="InterPro:IPR003836"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA74"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40133.1"
FT   gene            complement(318170..318931)
FT                   /gene="pgl"
FT                   /locus_tag="NIDE0355"
FT   CDS_pept        complement(318170..318931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pgl"
FT                   /locus_tag="NIDE0355"
FT                   /product="6-phosphogluconolactonase"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /function="6.6 : Entner-Doudoroff"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 15766779, 9020051; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0355"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40134"
FT                   /db_xref="GOA:D8PA75"
FT                   /db_xref="InterPro:IPR005900"
FT                   /db_xref="InterPro:IPR006148"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR039104"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA75"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40134.1"
FT   gene            complement(318933..320636)
FT                   /locus_tag="NIDE0356"
FT   CDS_pept        complement(318933..320636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0356"
FT                   /product="putative Glucose-6-phosphate isomerase (modular
FT                   protein)"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1593646, 2549364; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0356"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40135"
FT                   /db_xref="GOA:D8PA76"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA76"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40135.1"
FT   gene            complement(320813..321961)
FT                   /locus_tag="NIDE0357"
FT   CDS_pept        complement(320813..321961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0357"
FT                   /product="exported protein of unknown function, contains
FT                   TonB box"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 2439491, 2644220, 2687240, 3015941"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0357"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40136"
FT                   /db_xref="GOA:D8PA77"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA77"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40136.1"
FT   gene            322036..322206
FT                   /locus_tag="NIDE0358"
FT   CDS_pept        322036..322206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0358"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0358"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40137"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA78"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40137.1"
FT                   SWTDYLSRTIS"
FT   gene            322775..323143
FT                   /locus_tag="NIDE0359"
FT   CDS_pept        322775..323143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0359"
FT                   /product="putative Ribonuclease P, protein component"
FT                   /function="9.4 : RNA processing"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10623511, 12799461, 1374553, 1689306,
FT                   1700778, 9563955, 9628904; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0359"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40138"
FT                   /db_xref="GOA:D8PA79"
FT                   /db_xref="InterPro:IPR000100"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA79"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40138.1"
FT                   WRGTLQRQRLARFGEPSL"
FT   gene            323396..325138
FT                   /gene="oxaA"
FT                   /locus_tag="NIDE0360"
FT   CDS_pept        323396..325138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oxaA"
FT                   /locus_tag="NIDE0360"
FT                   /product="Inner-membrane protein insertion factor OxaA"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="11.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10675323, 10949305, 11821429, 12068816, 12452432,
FT                   12724529, 12950181, 14506280, 14528263, 15802250, 9804807;
FT                   Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0360"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40139"
FT                   /db_xref="GOA:D8PA80"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR019998"
FT                   /db_xref="InterPro:IPR028053"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="InterPro:IPR038210"
FT                   /db_xref="InterPro:IPR038221"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA80"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40139.1"
FT                   SPSE"
FT   gene            325160..326590
FT                   /gene="trmE"
FT                   /locus_tag="NIDE0361"
FT   CDS_pept        325160..326590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmE"
FT                   /locus_tag="NIDE0361"
FT                   /product="tRNA modification GTPase"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /function="15.5 : Detoxification"
FT                   /function="9.4 : RNA processing"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10601028, 11092873, 11489118, 11532950, 11544186,
FT                   17062623, 17143896, 1917835; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0361"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40140"
FT                   /db_xref="GOA:D8PA81"
FT                   /db_xref="InterPro:IPR004520"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR018948"
FT                   /db_xref="InterPro:IPR025867"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR027368"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031168"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA81"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40140.1"
FT                   ITTDEILERIFAEFCIGK"
FT   gene            326604..328478
FT                   /gene="gidA"
FT                   /locus_tag="NIDE0362"
FT   CDS_pept        326604..328478
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidA"
FT                   /locus_tag="NIDE0362"
FT                   /product="tRNA uridine 5-carboxymethylaminomethyl
FT                   modification enzyme GidA"
FT                   /function="15.1 : Cell division"
FT                   /function="10 : Protein synthesis"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11544186, 11703671, 17062623; Product type cp : cell
FT                   process"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0362"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40141"
FT                   /db_xref="GOA:D8PA82"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA82"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40141.1"
FT   gene            328584..329240
FT                   /gene="gidB"
FT                   /locus_tag="NIDE0363"
FT   CDS_pept        328584..329240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gidB"
FT                   /locus_tag="NIDE0363"
FT                   /product="Methyltransferase GidB"
FT                   /function="15.1 : Cell division"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.1.-.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12001236; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0363"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40142"
FT                   /db_xref="GOA:D8PA83"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA83"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40142.1"
FT   gene            329305..330081
FT                   /gene="parA"
FT                   /locus_tag="NIDE0364"
FT   CDS_pept        329305..330081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parA"
FT                   /locus_tag="NIDE0364"
FT                   /product="Chromosomal partitioning ATPase ParA"
FT                   /function="15.1 : Cell division"
FT                   /function="16.9 : Replicate"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1836760, 3903163, 9054507; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0364"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40143"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA84"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40143.1"
FT   gene            330059..330910
FT                   /gene="parB"
FT                   /locus_tag="NIDE0365"
FT   CDS_pept        330059..330910
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="parB"
FT                   /locus_tag="NIDE0365"
FT                   /product="Chromosomal partitioning protein ParB"
FT                   /function="15.1 : Cell division"
FT                   /function="16.9 : Replicate"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 8071208, 9054507; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0365"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40144"
FT                   /db_xref="GOA:D8PA85"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA85"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40144.1"
FT                   DS"
FT   gene            331058..331546
FT                   /locus_tag="NIDE0366"
FT   CDS_pept        331058..331546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0366"
FT                   /product="conserved protein of unknown function, DUF583"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0366"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40145"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA86"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40145.1"
FT   gene            331676..332131
FT                   /locus_tag="NIDE0367"
FT   CDS_pept        331676..332131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0367"
FT                   /product="conserved protein of unknown function, DUF583"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0367"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40146"
FT                   /db_xref="InterPro:IPR007607"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA87"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40146.1"
FT   gene            332163..333245
FT                   /gene="trmU"
FT                   /locus_tag="NIDE0368"
FT   CDS_pept        332163..333245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmU"
FT                   /locus_tag="NIDE0368"
FT                   /product="tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase"
FT                   /function="10 : Protein synthesis"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /function="9.4 : RNA processing"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12549933, 16387657, 3298234, 9811540; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0368"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40147"
FT                   /db_xref="GOA:D8PA88"
FT                   /db_xref="InterPro:IPR004506"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023382"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA88"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40147.1"
FT   gene            333495..334034
FT                   /locus_tag="NIDE0369"
FT   CDS_pept        333495..334034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0369"
FT                   /product="putative ATP synthase F1, delta subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1832989, 2861810, 6272190, 6278247,
FT                   6301339, 9164460, 9440534; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0369"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40148"
FT                   /db_xref="GOA:D8PA89"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA89"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40148.1"
FT                   TVRGRLSAMQRVLTKE"
FT   gene            334037..335554
FT                   /gene="atpA"
FT                   /locus_tag="NIDE0370"
FT   CDS_pept        334037..335554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpA"
FT                   /locus_tag="NIDE0370"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10902917, 2903146, 6272228, 6278247, 6301339, 8125291;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0370"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40149"
FT                   /db_xref="GOA:D8PA90"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA90"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40149.1"
FT   gene            335619..336506
FT                   /gene="atpG"
FT                   /locus_tag="NIDE0371"
FT   CDS_pept        335619..336506
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpG"
FT                   /locus_tag="NIDE0371"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10570135, 2138624, 2894854, 6272217, 6301339, 7961438,
FT                   9045833; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0371"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40150"
FT                   /db_xref="GOA:D8PA91"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA91"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40150.1"
FT                   KELMDIVGGAEALK"
FT   gene            336574..338016
FT                   /gene="atpD"
FT                   /locus_tag="NIDE0372"
FT   CDS_pept        336574..338016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpD"
FT                   /locus_tag="NIDE0372"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1832155, 2889623, 6272217, 6301339, 8065448; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0372"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40151"
FT                   /db_xref="GOA:D8PA92"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA92"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40151.1"
FT   gene            338132..338554
FT                   /gene="atpC"
FT                   /locus_tag="NIDE0373"
FT   CDS_pept        338132..338554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpC"
FT                   /locus_tag="NIDE0373"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /function="6.4 : ATP-proton motive force interconversion"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10735863, 10958801, 7958772, 7961438, 9045833, 9331422,
FT                   9756905; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0373"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40152"
FT                   /db_xref="GOA:D8PA93"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA93"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40152.1"
FT   gene            338623..339507
FT                   /locus_tag="NIDE0374"
FT   CDS_pept        338623..339507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0374"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0374"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40153"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA94"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40153.1"
FT                   RLKRREIRSIPTP"
FT   gene            complement(339642..340238)
FT                   /locus_tag="NIDE0375"
FT   CDS_pept        complement(339642..340238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0375"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0375"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40154"
FT                   /db_xref="InterPro:IPR021796"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA95"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40154.1"
FT   gene            340765..341727
FT                   /gene="rluD1"
FT                   /locus_tag="NIDE0376"
FT   CDS_pept        340765..341727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD1"
FT                   /locus_tag="NIDE0376"
FT                   /product="23S rRNA pseudouridine synthase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number=""
FT                   /EC_number="5.4.99.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11087118, 11453071, 14501142, 14659742, 14730022,
FT                   15078091, 9660827, 9814761; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0376"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40155"
FT                   /db_xref="GOA:D8PA96"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA96"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40155.1"
FT   gene            complement(341710..342195)
FT                   /locus_tag="NIDE0377"
FT   CDS_pept        complement(341710..342195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0377"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0377"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40156"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA97"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40156.1"
FT   gene            342576..343541
FT                   /gene="rluD2"
FT                   /locus_tag="NIDE0379"
FT   CDS_pept        342576..343541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rluD2"
FT                   /locus_tag="NIDE0379"
FT                   /product="23S rRNA pseudouridine synthase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number=""
FT                   /EC_number="5.4.99.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11087118, 11453071, 14501142, 14659742, 14730022,
FT                   9814761; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0379"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40157"
FT                   /db_xref="GOA:D8PA98"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA98"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40157.1"
FT   gene            343822..344244
FT                   /locus_tag="NIDE0380"
FT   CDS_pept        343822..344244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0380"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0380"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40158"
FT                   /db_xref="UniProtKB/TrEMBL:D8PA99"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40158.1"
FT   gene            complement(344303..344482)
FT                   /locus_tag="NIDE0381"
FT   CDS_pept        complement(344303..344482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0381"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0381"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40159"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40159.1"
FT                   VTAGANAAGPKMGH"
FT   gene            344546..344989
FT                   /locus_tag="NIDE0382"
FT   CDS_pept        344546..344989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0382"
FT                   /product="N-acetyltransferase, GCN5-related"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10322433, 10940244, 12801725, 15123251,
FT                   15581578, 1644165, 8090199, 9175471, 9727486; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0382"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40160"
FT                   /db_xref="GOA:D8PAA1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40160.1"
FT   gene            complement(345096..345917)
FT                   /gene="mntC"
FT                   /locus_tag="NIDE0383"
FT   CDS_pept        complement(345096..345917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntC"
FT                   /locus_tag="NIDE0383"
FT                   /product="Manganese transport system, permease component"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11421269, 11988180, 1303751, 9640644, 9680209,
FT                   9872322, 9873074; Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0383"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40161"
FT                   /db_xref="GOA:D8PAA2"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40161.1"
FT   gene            complement(346196..346975)
FT                   /gene="mntB"
FT                   /locus_tag="NIDE0384"
FT   CDS_pept        complement(346196..346975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mntB"
FT                   /locus_tag="NIDE0384"
FT                   /product="Manganese transport system, ATPase component"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10760146, 11421269, 11988180, 16326809, 2229036,
FT                   3301821, 3762694, 9640644, 9680209, 9872322, 9873074;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0384"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40162"
FT                   /db_xref="GOA:D8PAA3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40162.1"
FT   gene            complement(347036..347962)
FT                   /locus_tag="NIDE0385"
FT   CDS_pept        complement(347036..347962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0385"
FT                   /product="putative Manganese transport system, periplasmic
FT                   binding component"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11914363, 14583199, 7596287, 9379902,
FT                   9765793, 9862808; Product type lp : lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0385"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40163"
FT                   /db_xref="GOA:D8PAA4"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40163.1"
FT   gene            348124..349308
FT                   /gene="anmK"
FT                   /locus_tag="NIDE0386"
FT   CDS_pept        348124..349308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="anmK"
FT                   /locus_tag="NIDE0386"
FT                   /product="Anhydro-N-acetylmuramic acid kinase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /function="5.1 : Amino sugars"
FT                   /EC_number="2.7.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15901686, 16452451; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0386"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40164"
FT                   /db_xref="GOA:D8PAA5"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40164.1"
FT   gene            349324..349842
FT                   /locus_tag="NIDE0387"
FT   CDS_pept        349324..349842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0387"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0387"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40165"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40165.1"
FT                   TVLDLADPE"
FT   gene            complement(349893..350414)
FT                   /locus_tag="NIDE0388"
FT   CDS_pept        complement(349893..350414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0388"
FT                   /product="exported protein of unknown function, TPR domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0388"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40166"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR014162"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40166.1"
FT                   KDEPVAAEPS"
FT   gene            350742..351575
FT                   /locus_tag="NIDE0389"
FT   CDS_pept        350742..351575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0389"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0389"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40167"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR039448"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40167.1"
FT   gene            complement(351655..352587)
FT                   /locus_tag="NIDE0390"
FT   CDS_pept        complement(351655..352587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0390"
FT                   /product="putative Signal transduction response regulator,
FT                   receiver and diguanylate cyclase domain (fragment)"
FT                   /function="12.4 : Small molecule interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10966457, 11119645, 11682196,
FT                   11934609, 12622822, 15063857, 15075296, 15306016, 15569936,
FT                   15716451, 7592388; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0390"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40168"
FT                   /db_xref="GOA:D8PAA9"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAA9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40168.1"
FT   gene            352682..352849
FT                   /locus_tag="NIDE0391"
FT   CDS_pept        352682..352849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0391"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0391"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40169"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40169.1"
FT                   RFKQERTSSR"
FT   gene            353221..353994
FT                   /gene="slt"
FT                   /locus_tag="NIDE0393"
FT   CDS_pept        353221..353994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="slt"
FT                   /locus_tag="NIDE0393"
FT                   /product="Lytic murein transglycosylase (modular protein)"
FT                   /function="15.1 : Cell division"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /EC_number="3.2.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10452894, 14625683, 1938883, 2184239, 8107871,
FT                   8203016; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0393"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40170"
FT                   /db_xref="GOA:D8PAB1"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40170.1"
FT   gene            complement(354114..354785)
FT                   /locus_tag="NIDE0394"
FT   CDS_pept        complement(354114..354785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0394"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0394"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40171"
FT                   /db_xref="InterPro:IPR025847"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40171.1"
FT                   Q"
FT   gene            complement(355143..355219)
FT                   /locus_tag="NIDEtRNA43"
FT   tRNA            complement(355143..355219)
FT                   /locus_tag="NIDEtRNA43"
FT                   /product="tRNA-Met"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            355307..356257
FT                   /gene="fmt"
FT                   /locus_tag="NIDE0395"
FT   CDS_pept        355307..356257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fmt"
FT                   /locus_tag="NIDE0395"
FT                   /product="Methionyl-tRNA formyltransferase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10499278, 10694387, 14729668, 8432722, 8887566, 9843487;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0395"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40172"
FT                   /db_xref="GOA:D8PAB3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40172.1"
FT   gene            356381..357730
FT                   /gene="rsmB"
FT                   /locus_tag="NIDE0396"
FT   CDS_pept        356381..357730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="NIDE0396"
FT                   /product="Ribosomal RNA small subunit methyltransferase B"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /function="10 : Protein synthesis"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10026269, 10194318, 10899996, 14656444; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0396"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40173"
FT                   /db_xref="GOA:D8PAB4"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40173.1"
FT   gene            357730..358434
FT                   /gene="rpe"
FT                   /locus_tag="NIDE0397"
FT   CDS_pept        357730..358434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="NIDE0397"
FT                   /product="D-ribulose-5-phosphate 3-epimerase"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /function="6.11 : Sugars"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1429456, 8572885, 8616224, 9194706, 9733539, 9890975;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0397"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40174"
FT                   /db_xref="GOA:D8PAB5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40174.1"
FT                   AARTARVATAHR"
FT   gene            358462..360006
FT                   /gene="pheS"
FT                   /locus_tag="NIDE0398"
FT   CDS_pept        358462..360006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="NIDE0398"
FT                   /product="Phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /function="10 : Protein synthesis"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10575359, 1451792, 14607984, 1508711, 1915899, 1942071,
FT                   2127701, 6317865, 7664121, 8089840; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0398"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40175"
FT                   /db_xref="GOA:D8PAB6"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR022917"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40175.1"
FT   gene            360019..361737
FT                   /gene="pheT"
FT                   /locus_tag="NIDE0399"
FT   CDS_pept        360019..361737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="NIDE0399"
FT                   /product="Phenylalanyl-tRNA synthetase, beta subunit"
FT                   /function="10 : Protein synthesis"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10966471, 14607984, 15526031, 1915899, 2127701,
FT                   2991205; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0399"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40176"
FT                   /db_xref="GOA:D8PAB7"
FT                   /db_xref="InterPro:IPR004531"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40176.1"
FT   gene            complement(361797..362165)
FT                   /gene="rplT"
FT                   /locus_tag="NIDE0400"
FT   CDS_pept        complement(361797..362165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="NIDE0400"
FT                   /product="50S ribosomal protein L20"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /function="12 : Regulatory functions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094780, 12809609, 16272117, 17439971, 3158742, 6317865,
FT                   8628231, 8955899, 9256461; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0400"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40177"
FT                   /db_xref="GOA:D8PAB8"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40177.1"
FT                   GFEKLVGVAKQQLATAAS"
FT   gene            complement(362211..362408)
FT                   /gene="rpmI"
FT                   /locus_tag="NIDE0401"
FT   CDS_pept        complement(362211..362408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="NIDE0401"
FT                   /product="50S ribosomal protein L35"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10094780, 16272117, 3298224, 3542048, 7559446, 7766160,
FT                   9491077; Product type s : structure"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0401"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40178"
FT                   /db_xref="GOA:D8PAB9"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAB9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40178.1"
FT   gene            complement(362442..362948)
FT                   /gene="infC"
FT                   /locus_tag="NIDE0402"
FT   CDS_pept        complement(362442..362948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="infC"
FT                   /locus_tag="NIDE0402"
FT                   /product="Translation initiation factor IF-3"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11500382, 1457399, 16199751, 16724118, 2954162, 6325158,
FT                   6353409, 8858588, 9370368; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0402"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40179"
FT                   /db_xref="GOA:D8PAC0"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40179.1"
FT                   ILAPK"
FT   gene            complement(362952..364907)
FT                   /gene="thrS"
FT                   /locus_tag="NIDE0403"
FT   CDS_pept        complement(362952..364907)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="NIDE0403"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /function="10.1 : tRNA aminoacylation"
FT                   /function="12 : Regulatory functions"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10319817, 10881191, 3086882, 6353409, 8031907; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0403"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40180"
FT                   /db_xref="GOA:D8PAC1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40180.1"
FT                   DANHTLRQTATHSQTR"
FT   gene            complement(364994..365068)
FT                   /locus_tag="NIDEtRNA42"
FT   tRNA            complement(364994..365068)
FT                   /locus_tag="NIDEtRNA42"
FT                   /product="tRNA-Val"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            complement(365202..365474)
FT                   /gene="hupA"
FT                   /locus_tag="NIDE0404"
FT   CDS_pept        complement(365202..365474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hupA"
FT                   /locus_tag="NIDE0404"
FT                   /product="Transcriptional dual regulator HU-alpha"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12372591, 12853489, 17097674, 3047111, 3118156, 6540370,
FT                   6987059, 9218807; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0404"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40181"
FT                   /db_xref="GOA:D8PAC2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40181.1"
FT   gene            complement(365571..366161)
FT                   /locus_tag="NIDE0405"
FT   CDS_pept        complement(365571..366161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0405"
FT                   /product="protein of unknown function, putative
FT                   transcriptional regulator"
FT                   /function="19 : Unclassified"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 11123690, 11183780, 11532124,
FT                   1619650, 1986310, 9738943"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0405"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40182"
FT                   /db_xref="GOA:D8PAC3"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40182.1"
FT   gene            366501..366953
FT                   /locus_tag="NIDE0406"
FT   CDS_pept        366501..366953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0406"
FT                   /product="putative HTH-type transcriptional regulator, rrf2
FT                   family"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11742080, 15458412, 16428390,
FT                   16677314, 9148780; Product type pr : putative regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0406"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40183"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40183.1"
FT   gene            366960..369503
FT                   /locus_tag="NIDE0407"
FT   CDS_pept        366960..369503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0407"
FT                   /product="putative Sulfite reductase, contains SirA-like
FT                   domain (modular protein)"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="6.5 : Electron transport"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10830496, 10984484, 11080457,
FT                   16387657, 7569952, 9315848, 9555915; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0407"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40184"
FT                   /db_xref="GOA:D8PAC5"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007842"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40184.1"
FT   gene            369509..370231
FT                   /gene="cysH"
FT                   /locus_tag="NIDE0408"
FT   CDS_pept        369509..370231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="NIDE0408"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10075658, 12682041, 2005873, 2250719, 7588765, 8917600,
FT                   9006060, 9261082; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0408"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40185"
FT                   /db_xref="GOA:D8PAC6"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40185.1"
FT                   PRSGRWKNFGKTECGLHK"
FT   gene            370273..371340
FT                   /gene="trpD"
FT                   /locus_tag="NIDE0409"
FT   CDS_pept        370273..371340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="NIDE0409"
FT                   /product="Anthranilate phosphoribosyltransferase"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10361288, 10369778, 12123839, 2110100, 2404959,
FT                   2679363, 4886289, 6283099; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0409"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40186"
FT                   /db_xref="GOA:D8PAC7"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40186.1"
FT                   AGSSAGHAPKVGISA"
FT   gene            371358..372155
FT                   /gene="cysD"
FT                   /locus_tag="NIDE0410"
FT   CDS_pept        371358..372155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysD"
FT                   /locus_tag="NIDE0410"
FT                   /product="Sulfate adenylyltransferase, subunit 2"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10464198, 1316900, 1730615, 2185135, 2828368, 8117661,
FT                   9611812, 9773278; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0410"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40187"
FT                   /db_xref="GOA:D8PAC8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR011784"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40187.1"
FT   gene            372202..374082
FT                   /gene="cysNC"
FT                   /locus_tag="NIDE0411"
FT   CDS_pept        372202..374082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cysNC"
FT                   /locus_tag="NIDE0411"
FT                   /product="Sulfate adenylyltransferase, subunit 1, and
FT                   adenylylsulfate kinase (bifunctional enzyme)"
FT                   /function="5.5 : Sulfur metabolism"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 12676676, 1316900, 2828368, 8755625, 8850086,
FT                   9421916, 9611812; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0411"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40188"
FT                   /db_xref="GOA:D8PAC9"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR011779"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAC9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40188.1"
FT   gene            374162..375082
FT                   /gene="mrp"
FT                   /locus_tag="NIDE0412"
FT   CDS_pept        374162..375082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mrp"
FT                   /locus_tag="NIDE0412"
FT                   /product="putative ATPase, Mrp homolog"
FT                   /function="5 : Central intermediary metabolism"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1675209, 8824612, 8978086, 9813262;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0412"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40189"
FT                   /db_xref="GOA:D8PAD0"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40189.1"
FT   gene            375109..375864
FT                   /locus_tag="NIDE0413"
FT   CDS_pept        375109..375864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0413"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0413"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40190"
FT                   /db_xref="GOA:D8PAD1"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40190.1"
FT   gene            375999..376718
FT                   /locus_tag="NIDE0414"
FT   CDS_pept        375999..376718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0414"
FT                   /product="membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0414"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40191"
FT                   /db_xref="GOA:D8PAD2"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40191.1"
FT                   WASLVVVIGLQLLIYSE"
FT   gene            376860..377615
FT                   /locus_tag="NIDE0415"
FT   CDS_pept        376860..377615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0415"
FT                   /product="conserved protein of unknown function UPF0082,
FT                   DUF28"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 12060744"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0415"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40192"
FT                   /db_xref="GOA:D8PAD3"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40192.1"
FT   gene            377697..378305
FT                   /gene="ruvA"
FT                   /locus_tag="NIDE0416"
FT   CDS_pept        377697..378305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="NIDE0416"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10585965, 10890893, 12408833, 14616075, 1608954, 2842314,
FT                   7045590, 8041610, 8433990, 8832889, 9442895, 9628481;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0416"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40193"
FT                   /db_xref="GOA:D8PAD4"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40193.1"
FT   gene            378309..378815
FT                   /locus_tag="NIDE0417"
FT   CDS_pept        378309..378815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0417"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0417"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40194"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40194.1"
FT                   SPEAR"
FT   gene            378846..379883
FT                   /gene="ruvB"
FT                   /locus_tag="NIDE0418"
FT   CDS_pept        378846..379883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvB"
FT                   /locus_tag="NIDE0418"
FT                   /product="Holliday junction ATP-dependent DNA helicase
FT                   RuvB"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number="3.6.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10585965, 11171970, 11478862, 12408833, 12423347,
FT                   14616075, 1608954, 7045590, 8041610, 8433990, 9442895;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0418"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40195"
FT                   /db_xref="GOA:D8PAD6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40195.1"
FT                   SVTTP"
FT   gene            380023..381099
FT                   /gene="pheA"
FT                   /locus_tag="NIDE0419"
FT   CDS_pept        380023..381099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheA"
FT                   /locus_tag="NIDE0419"
FT                   /product="P-protein, bifunctional chorismate
FT                   mutase/prephenate dehydratase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10493788, 10769128, 11450855, 15753077, 1919506, 3037264,
FT                   9497350, 9642265, 9843375; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0419"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40196"
FT                   /db_xref="GOA:D8PAD7"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR010957"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40196.1"
FT                   VKSRCLFMKILGSYPAYS"
FT   gene            381116..382201
FT                   /gene="hisC"
FT                   /locus_tag="NIDE0420"
FT   CDS_pept        381116..382201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="NIDE0420"
FT                   /product="Histidinol-phosphate aminotransferase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.6 : Histidine family"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11294630, 11518529, 12686152, 15007066, 2999081,
FT                   7883715; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0420"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40197"
FT                   /db_xref="GOA:D8PAD8"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40197.1"
FT   gene            382220..383233
FT                   /gene="aroF"
FT                   /locus_tag="NIDE0421"
FT   CDS_pept        382220..383233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="NIDE0421"
FT                   /product="3-deoxy-7-phosphoheptulonate synthase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10425687, 12743122, 15019786, 15276836, 8760910;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0421"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40198"
FT                   /db_xref="GOA:D8PAD9"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAD9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40198.1"
FT   gene            383293..384189
FT                   /gene="tyrA"
FT                   /locus_tag="NIDE0422"
FT   CDS_pept        383293..384189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrA"
FT                   /locus_tag="NIDE0422"
FT                   /product="Prephenate dehydrogenase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 9843375; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0422"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40199"
FT                   /db_xref="GOA:D8PAE0"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40199.1"
FT                   KAKHEREQLTPRAPGKS"
FT   gene            384196..385524
FT                   /gene="aroA"
FT                   /locus_tag="NIDE0423"
FT   CDS_pept        384196..385524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="NIDE0423"
FT                   /product="3-phosphoshikimate-1-carboxyvinyltransferase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10601870, 11607190, 15736934, 1899181, 1939260, 3121621,
FT                   4942558, 8026753; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0423"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40200"
FT                   /db_xref="GOA:D8PAE1"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40200.1"
FT   gene            385537..386235
FT                   /gene="cmk"
FT                   /locus_tag="NIDE0424"
FT   CDS_pept        385537..386235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="NIDE0424"
FT                   /product="Cytidylate kinase"
FT                   /function="2.2 : Nucleotide and nucleoside
FT                   interconversions"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11827479, 14573872, 7836281, 8190075, 9126287, 9862805;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0424"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40201"
FT                   /db_xref="GOA:D8PAE2"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40201.1"
FT                   HMLAVITARL"
FT   gene            386232..386927
FT                   /locus_tag="NIDE0425"
FT   CDS_pept        386232..386927
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0425"
FT                   /product="putative Acyltransferase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.3.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 8748025; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0425"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40202"
FT                   /db_xref="GOA:D8PAE3"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40202.1"
FT                   PAAKSCNAE"
FT   gene            386985..388700
FT                   /gene="rpsA"
FT                   /locus_tag="NIDE0426"
FT   CDS_pept        386985..388700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="NIDE0426"
FT                   /product="30S ribosomal protein S1"
FT                   /function="10.2 : Ribosomal proteins: synthesis and
FT                   modification"
FT                   /function="10.4 : Translation factors"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11004188, 11297922, 11593008, 12068815, 2011495, 7041110,
FT                   7534475, 9008164, 9677288, 9716382; Product type s :
FT                   structure"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0426"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40203"
FT                   /db_xref="GOA:D8PAE4"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40203.1"
FT   gene            388716..389615
FT                   /locus_tag="NIDE0427"
FT   CDS_pept        388716..389615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0427"
FT                   /product="Peptidase S49, putative signal peptide peptidase
FT                   SppA"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10455123, 3522590, 7845208, 8439290; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0427"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40204"
FT                   /db_xref="GOA:D8PAE5"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40204.1"
FT                   FPKLELNTGVKLKYLMAF"
FT   gene            389689..389967
FT                   /gene="ihfB"
FT                   /locus_tag="NIDE0428"
FT   CDS_pept        389689..389967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ihfB"
FT                   /locus_tag="NIDE0428"
FT                   /product="Integration host factor, beta subunit"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /function="8.4 : Chromosome-associated proteins"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12842466, 17097674, 1902464, 2886490, 2972385, 3118156,
FT                   7651128, 7715442, 8156991, 8230206, 8407826, 8980235;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0428"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40205"
FT                   /db_xref="GOA:D8PAE6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40205.1"
FT   gene            390059..390976
FT                   /locus_tag="NIDE0429"
FT   CDS_pept        390059..390976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0429"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0429"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40206"
FT                   /db_xref="GOA:D8PAE7"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40206.1"
FT   gene            complement(391248..391568)
FT                   /locus_tag="NIDE0430"
FT   CDS_pept        complement(391248..391568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0430"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0430"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40207"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40207.1"
FT                   AH"
FT   gene            391809..393008
FT                   /locus_tag="NIDE0431"
FT   CDS_pept        391809..393008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0431"
FT                   /product="exported protein of unknown function, contains
FT                   FG-GAP repeats"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 12297042, 12361595, 14689578"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0431"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40208"
FT                   /db_xref="InterPro:IPR028994"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAE9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40208.1"
FT                   "
FT   gene            393176..393349
FT                   /locus_tag="NIDE0432"
FT   CDS_pept        393176..393349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0432"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0432"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40209"
FT                   /db_xref="GOA:D8PAF0"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40209.1"
FT                   AGCLALILNRLR"
FT   gene            393387..393617
FT                   /locus_tag="NIDE0433"
FT   CDS_pept        393387..393617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0433"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0433"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40210"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40210.1"
FT   gene            393663..394592
FT                   /locus_tag="NIDE0434"
FT   CDS_pept        393663..394592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0434"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /function="16.13 : Shape"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10383966, 10419503, 12627955, 1741619,
FT                   3279397, 7845208, 8439290, 8955390; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0434"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40211"
FT                   /db_xref="GOA:D8PAF2"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40211.1"
FT   gene            complement(394746..395276)
FT                   /locus_tag="NIDE0435"
FT   CDS_pept        complement(394746..395276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0435"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0435"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40212"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40212.1"
FT                   LGKDVNVEFSLPH"
FT   gene            complement(395442..396389)
FT                   /locus_tag="NIDE0436"
FT   CDS_pept        complement(395442..396389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0436"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11301006, 12706716, 3413113, 8257110, 9309218,
FT                   9497290; Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0436"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40213"
FT                   /db_xref="GOA:D8PAF4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40213.1"
FT   gene            396569..397048
FT                   /locus_tag="NIDE0437"
FT   CDS_pept        396569..397048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0437"
FT                   /product="Hemoglobin-like protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10500158, 10636862, 10903511, 15598493,
FT                   16600051, 17540514, 8932316; Product type c : carrier"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0437"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40214"
FT                   /db_xref="GOA:D8PAF5"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR016339"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40214.1"
FT   gene            complement(397109..397402)
FT                   /locus_tag="NIDE0438"
FT   CDS_pept        complement(397109..397402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0438"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0438"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40215"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40215.1"
FT   gene            complement(397440..397826)
FT                   /locus_tag="NIDE0439"
FT   CDS_pept        complement(397440..397826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0439"
FT                   /product="membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0439"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40216"
FT                   /db_xref="GOA:D8PAF7"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40216.1"
FT   gene            complement(397851..399110)
FT                   /gene="gdhA"
FT                   /locus_tag="NIDE0440"
FT   CDS_pept        complement(397851..399110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhA"
FT                   /locus_tag="NIDE0440"
FT                   /product="Glutamate dehydrogenase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12052548, 9135121, 9680336, 9829940; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0440"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40217"
FT                   /db_xref="GOA:D8PAF8"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40217.1"
FT   gene            complement(399107..399934)
FT                   /gene="lipB"
FT                   /locus_tag="NIDE0441"
FT   CDS_pept        complement(399107..399934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="NIDE0441"
FT                   /product="Lipoyltransferase"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="4.4 : Lipoate"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12591875, 15642479, 16342964, 8002607, 8444795; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0441"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40218"
FT                   /db_xref="GOA:D8PAF9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAF9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40218.1"
FT   gene            complement(399938..401014)
FT                   /locus_tag="NIDE0442"
FT   CDS_pept        complement(399938..401014)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0442"
FT                   /product="Trypsin-like serine peptidase, S1C"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /function="12.3 : Protein interactions"
FT                   /EC_number="3.4.21.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11919638, 12408815, 15137941, 2180903, 3057437,
FT                   7845208, 8439290, 8576051; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0442"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40219"
FT                   /db_xref="GOA:D8PAG0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40219.1"
FT                   GKAGTGTITVSRPGPARP"
FT   gene            complement(401142..402401)
FT                   /gene="rpoD"
FT                   /locus_tag="NIDE0443"
FT   CDS_pept        complement(401142..402401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpoD"
FT                   /locus_tag="NIDE0443"
FT                   /product="RNA polymerase sigma-70 factor"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10188247, 11931761, 12000971, 12016307, 1597408,
FT                   3052291, 7746156, 7961408; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0443"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40220"
FT                   /db_xref="GOA:D8PAG1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40220.1"
FT   gene            402697..403575
FT                   /gene="trmI"
FT                   /locus_tag="NIDE0444"
FT   CDS_pept        402697..403575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmI"
FT                   /locus_tag="NIDE0444"
FT                   /product="tRNA (adenine-N(1)-)-methyltransferase"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12682365; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0444"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40221"
FT                   /db_xref="GOA:D8PAG2"
FT                   /db_xref="InterPro:IPR014816"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40221.1"
FT                   DEAHEGEDAQA"
FT   gene            403572..404333
FT                   /locus_tag="NIDE0445"
FT   CDS_pept        403572..404333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0445"
FT                   /product="Short-chain dehydrogenase"
FT                   /function="5 : Central intermediary metabolism"
FT                   /EC_number="1.1.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1889416, 7742302, 9241368; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0445"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40222"
FT                   /db_xref="GOA:D8PAG3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40222.1"
FT   gene            404381..405235
FT                   /gene="aroE"
FT                   /locus_tag="NIDE0446"
FT   CDS_pept        404381..405235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="NIDE0446"
FT                   /product="Shikimate 5-dehydrogenase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10739937, 12624088, 12637497, 12837789, 12906831,
FT                   15012217, 15596430, 16828913; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0446"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40223"
FT                   /db_xref="GOA:D8PAG4"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40223.1"
FT                   RFG"
FT   gene            405290..405820
FT                   /gene="aroK"
FT                   /locus_tag="NIDE0447"
FT   CDS_pept        405290..405820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroK"
FT                   /locus_tag="NIDE0447"
FT                   /product="Shikimate kinase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.1 : Aromatic amino acid family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11369852, 12001235, 1309529, 15299895, 2537963, 3026317,
FT                   7612934, 7703851, 7883721; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0447"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40224"
FT                   /db_xref="GOA:D8PAG5"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40224.1"
FT                   SRILQLISHESTV"
FT   gene            405908..405984
FT                   /locus_tag="NIDEtRNA4"
FT   tRNA            405908..405984
FT                   /locus_tag="NIDEtRNA4"
FT                   /product="tRNA-Arg"
FT                   /function="10 : Protein synthesis"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; Product
FT                   type n : RNA"
FT                   /inference="profile:tRNAscan:1.23"
FT   gene            406217..406477
FT                   /gene="relB1"
FT                   /locus_tag="NIDE0449"
FT   CDS_pept        406217..406477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relB1"
FT                   /locus_tag="NIDE0449"
FT                   /product="RelB antitoxin"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /function="9 : Transcription"
FT                   /function="12.2 : RNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11274135, 11717402, 12123459, 12526800, 12787364,
FT                   9767574, 9917385; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0449"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40225"
FT                   /db_xref="GOA:D8PAG6"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40225.1"
FT   gene            406481..406750
FT                   /gene="relE1"
FT                   /locus_tag="NIDE0450"
FT   CDS_pept        406481..406750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relE1"
FT                   /locus_tag="NIDE0450"
FT                   /product="RelE toxin"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11274135, 11717402, 12123459, 12526800, 12787364,
FT                   14659018, 15864262, 16257530, 17263853, 9767574, 9829958,
FT                   9917385, 19210620; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0450"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40226"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40226.1"
FT   gene            407319..407747
FT                   /locus_tag="NIDE0452"
FT   CDS_pept        407319..407747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0452"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0452"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40227"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40227.1"
FT   gene            408072..408734
FT                   /locus_tag="NIDE0453"
FT   CDS_pept        408072..408734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0453"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0453"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40228"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAG9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40228.1"
FT   gene            408664..408918
FT                   /locus_tag="NIDE0454"
FT   CDS_pept        408664..408918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0454"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0454"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40229"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40229.1"
FT   gene            409183..409596
FT                   /locus_tag="NIDE0455"
FT   CDS_pept        409183..409596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0455"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0455"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40230"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40230.1"
FT   gene            complement(409684..409863)
FT                   /locus_tag="NIDE0456"
FT   CDS_pept        complement(409684..409863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0456"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0456"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40231"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40231.1"
FT                   HYLNAAESGEHRNL"
FT   gene            410102..410356
FT                   /gene="relB2"
FT                   /locus_tag="NIDE0457"
FT   CDS_pept        410102..410356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relB2"
FT                   /locus_tag="NIDE0457"
FT                   /product="RelB antitoxin"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /function="9 : Transcription"
FT                   /function="12.2 : RNA interactions"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11274135, 11717402, 12123459, 12526800, 12787364,
FT                   9767574, 9917385; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0457"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40232"
FT                   /db_xref="GOA:D8PAH3"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40232.1"
FT   gene            410359..410628
FT                   /gene="relE2"
FT                   /locus_tag="NIDE0458"
FT   CDS_pept        410359..410628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="relE2"
FT                   /locus_tag="NIDE0458"
FT                   /product="RelE toxin"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11274135, 11717402, 12123459, 12526800, 12787364,
FT                   14659018, 15864262, 16257530, 17263853, 9767574, 9829958,
FT                   9917385, 19210620; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0458"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40233"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40233.1"
FT   gene            410782..411000
FT                   /locus_tag="NIDE0459"
FT   CDS_pept        410782..411000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0459"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0459"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40234"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40234.1"
FT   gene            411177..411887
FT                   /locus_tag="NIDE0460"
FT   CDS_pept        411177..411887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0460"
FT                   /product="exported protein of unknown function, OmpA
FT                   family"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10515919, 11173492, 16475801,
FT                   17052729, 2202726"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0460"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40235"
FT                   /db_xref="GOA:D8PAH6"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR039001"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40235.1"
FT                   CHQQNRRGHMLLRK"
FT   gene            412210..412374
FT                   /locus_tag="NIDE0461"
FT   CDS_pept        412210..412374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0461"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0461"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40236"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40236.1"
FT                   IEDIEEEDE"
FT   gene            412498..413889
FT                   /locus_tag="NIDE0462"
FT   CDS_pept        412498..413889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0462"
FT                   /product="conserved protein of unknown function"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0462"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40237"
FT                   /db_xref="GOA:D8PAH8"
FT                   /db_xref="InterPro:IPR021830"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40237.1"
FT                   DPAGH"
FT   gene            complement(413961..414323)
FT                   /locus_tag="NIDE0463"
FT   CDS_pept        complement(413961..414323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0463"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0463"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40238"
FT                   /db_xref="GOA:D8PAH9"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAH9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40238.1"
FT                   ESAMEANTNGRELTAA"
FT   gene            414678..414953
FT                   /locus_tag="NIDE0464"
FT   CDS_pept        414678..414953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0464"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0464"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40239"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40239.1"
FT   gene            414970..415278
FT                   /locus_tag="NIDE0465"
FT   CDS_pept        414970..415278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0465"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0465"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40240"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40240.1"
FT   gene            415358..415678
FT                   /locus_tag="NIDE0466"
FT   CDS_pept        415358..415678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0466"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0466"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40241"
FT                   /db_xref="GOA:D8PAI2"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40241.1"
FT                   NN"
FT   gene            complement(415712..416584)
FT                   /locus_tag="NIDE0467"
FT   CDS_pept        complement(415712..416584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0467"
FT                   /product="exported protein of unknown function, containing
FT                   C-terminal TonB domain"
FT                   /function="19 : Unclassified"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0467"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40242"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40242.1"
FT                   HVEISGIPR"
FT   gene            416809..418338
FT                   /gene="zwf1"
FT                   /locus_tag="NIDE0468"
FT   CDS_pept        416809..418338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="zwf1"
FT                   /locus_tag="NIDE0468"
FT                   /product="Glucose-6-phosphate 1-dehydrogenase"
FT                   /function="6.6 : Entner-Doudoroff"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11320304, 14661115, 1704005, 2254282, 8566707, 9485426,
FT                   9537370; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0468"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40243"
FT                   /db_xref="GOA:D8PAI4"
FT                   /db_xref="InterPro:IPR001282"
FT                   /db_xref="InterPro:IPR019796"
FT                   /db_xref="InterPro:IPR022674"
FT                   /db_xref="InterPro:IPR022675"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40243.1"
FT   gene            418371..418916
FT                   /gene="msrA"
FT                   /locus_tag="NIDE0469"
FT   CDS_pept        418371..418916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="msrA"
FT                   /locus_tag="NIDE0469"
FT                   /product="Methionine sulfoxide reductase A"
FT                   /function="11.2 : Protein modification and repair"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10841552, 10964927, 11063566, 11080639, 11677230,
FT                   12604343, 12837786, 1386361, 7836279, 8755589; Product type
FT                   e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0469"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40244"
FT                   /db_xref="GOA:D8PAI5"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40244.1"
FT                   VGPKVAKFRQRYASLLKA"
FT   gene            complement(418941..419378)
FT                   /locus_tag="NIDE0470"
FT   CDS_pept        complement(418941..419378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0470"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0470"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40245"
FT                   /db_xref="GOA:D8PAI6"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40245.1"
FT   gene            complement(420152..421015)
FT                   /gene="ydaO"
FT                   /locus_tag="NIDE0471"
FT   CDS_pept        complement(420152..421015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ydaO"
FT                   /locus_tag="NIDE0471"
FT                   /product="putative PP-loop ATPase, YdaO-related"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12012333, 7731953; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0471"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40246"
FT                   /db_xref="GOA:D8PAI7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40246.1"
FT                   AEDDLL"
FT   gene            421106..421573
FT                   /locus_tag="NIDE0472"
FT   CDS_pept        421106..421573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0472"
FT                   /product="putative Low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /function="11.2 : Protein modification and repair"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11090276, 12657060, 12678841,
FT                   15995210, 16452434, 8052313, 9571056, 9646865, 9818190;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0472"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40247"
FT                   /db_xref="GOA:D8PAI8"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40247.1"
FT   gene            421757..422818
FT                   /locus_tag="NIDE0473"
FT   CDS_pept        421757..422818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0473"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0473"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40248"
FT                   /db_xref="InterPro:IPR031321"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAI9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40248.1"
FT                   MNYLHSGRHKVAL"
FT   gene            422815..423837
FT                   /gene="ddlA"
FT                   /locus_tag="NIDE0474"
FT   CDS_pept        422815..423837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ddlA"
FT                   /locus_tag="NIDE0474"
FT                   /product="D-alanine-D-alanine ligase"
FT                   /function="14.2 : Biosynthesis and degradation of murein
FT                   sacculus and peptidoglycan"
FT                   /function="15.1 : Cell division"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11699883, 12499203, 1554356, 1993184, 2841972, 7939684,
FT                   8125347, 8662022, 9054558; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0474"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40249"
FT                   /db_xref="GOA:D8PAJ0"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40249.1"
FT                   "
FT   gene            423911..424078
FT                   /locus_tag="NIDE0475"
FT   CDS_pept        423911..424078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0475"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0475"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40250"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40250.1"
FT                   ALLRPCWKPV"
FT   gene            complement(424281..424823)
FT                   /locus_tag="NIDE0476"
FT   CDS_pept        complement(424281..424823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0476"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0476"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40251"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40251.1"
FT                   PDDNTSVALLFGIRWGP"
FT   gene            424979..425473
FT                   /locus_tag="NIDE0477"
FT   CDS_pept        424979..425473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0477"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0477"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40252"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40252.1"
FT                   V"
FT   gene            complement(425648..426253)
FT                   /gene="gpmA"
FT                   /locus_tag="NIDE0478"
FT   CDS_pept        complement(425648..426253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmA"
FT                   /locus_tag="NIDE0478"
FT                   /product="2,3-bisphosphoglycerate-dependent
FT                   phosphoglycerate mutase"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10437801, 11038361, 11884145; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0478"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40253"
FT                   /db_xref="GOA:D8PAJ4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40253.1"
FT   gene            426490..427266
FT                   /locus_tag="NIDE0479"
FT   CDS_pept        426490..427266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0479"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0479"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40254"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40254.1"
FT   gene            427332..427559
FT                   /locus_tag="NIDE0480"
FT   CDS_pept        427332..427559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0480"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0480"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40255"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40255.1"
FT   gene            427611..427799
FT                   /locus_tag="NIDE0481"
FT   CDS_pept        427611..427799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0481"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0481"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40256"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40256.1"
FT                   SAFQFVKDPLSFISRLR"
FT   gene            complement(427862..428506)
FT                   /locus_tag="NIDE0482"
FT   CDS_pept        complement(427862..428506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0482"
FT                   /product="membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0482"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40257"
FT                   /db_xref="GOA:D8PAJ8"
FT                   /db_xref="InterPro:IPR024399"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40257.1"
FT   gene            428679..429887
FT                   /gene="argD"
FT                   /locus_tag="NIDE0483"
FT   CDS_pept        428679..429887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argD"
FT                   /locus_tag="NIDE0483"
FT                   /product="Acetylornithine aminotransferase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.2 : Aspartate family"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10074354, 2199330, 7929012, 8473852, 9370352, 9696779;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0483"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40258"
FT                   /db_xref="GOA:D8PAJ9"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAJ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40258.1"
FT                   SHH"
FT   gene            429904..430884
FT                   /gene="argF"
FT                   /locus_tag="NIDE0484"
FT   CDS_pept        429904..430884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argF"
FT                   /locus_tag="NIDE0484"
FT                   /product="Ornithine carbamoyltransferase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11893735, 1406593, 2121620, 6379651, 7868583, 9253409,
FT                   9275160, 9288930, 9346304, 9370352, 9501170; Product type e
FT                   : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0484"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40259"
FT                   /db_xref="GOA:D8PAK0"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40259.1"
FT   gene            430900..432117
FT                   /gene="argG"
FT                   /locus_tag="NIDE0485"
FT   CDS_pept        430900..432117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argG"
FT                   /locus_tag="NIDE0485"
FT                   /product="Argininosuccinate synthase"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10666579, 11738042, 11809762, 11844799, 12684518,
FT                   2123815; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0485"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40260"
FT                   /db_xref="GOA:D8PAK1"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40260.1"
FT                   KKRSTR"
FT   gene            432117..433571
FT                   /gene="argH"
FT                   /locus_tag="NIDE0486"
FT   CDS_pept        432117..433571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="NIDE0486"
FT                   /product="Argininosuccinate lyase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /function="1.3 : Glutamate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 11683360, 15502303, 2851495, 3282546, 353508, 4365537,
FT                   770426; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0486"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40261"
FT                   /db_xref="GOA:D8PAK2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40261.1"
FT   gene            433568..433870
FT                   /locus_tag="NIDE0487"
FT   CDS_pept        433568..433870
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0487"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0487"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40262"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40262.1"
FT   gene            433973..435235
FT                   /gene="lysA"
FT                   /locus_tag="NIDE0488"
FT   CDS_pept        433973..435235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="NIDE0488"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /function="1.2 : Aspartate family"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12637582, 14343156, 2836698, 3143046, 6350601, 8181483,
FT                   8226683, 8440471; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0488"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40263"
FT                   /db_xref="GOA:D8PAK4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40263.1"
FT   gene            435272..436144
FT                   /gene="dapA"
FT                   /locus_tag="NIDE0489"
FT   CDS_pept        435272..436144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="NIDE0489"
FT                   /product="Dihydrodipicolinate synthase"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 1463470, 15066435, 16041077, 16185069, 7853400, 8478336,
FT                   8993314; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0489"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40264"
FT                   /db_xref="GOA:D8PAK5"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40264.1"
FT                   HAMKEAGLV"
FT   gene            436174..436977
FT                   /gene="dapB"
FT                   /locus_tag="NIDE0490"
FT   CDS_pept        436174..436977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="NIDE0490"
FT                   /product="Dihydrodipicolinate reductase"
FT                   /function="1.2 : Aspartate family"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12962488, 6094578, 7893645, 8873595, 8993314, 9098082,
FT                   9398235; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0490"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40265"
FT                   /db_xref="GOA:D8PAK6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40265.1"
FT   gene            437670..437930
FT                   /locus_tag="NIDE0491"
FT   CDS_pept        437670..437930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0491"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0491"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40266"
FT                   /db_xref="GOA:D8PAK7"
FT                   /db_xref="InterPro:IPR007029"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40266.1"
FT   gene            complement(437927..438229)
FT                   /locus_tag="NIDE0492"
FT   CDS_pept        complement(437927..438229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0492"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0492"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40267"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40267.1"
FT   gene            438427..439074
FT                   /gene="talC"
FT                   /locus_tag="NIDE0493"
FT   CDS_pept        438427..439074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="talC"
FT                   /locus_tag="NIDE0493"
FT                   /product="Transaldolase, putative Fructose-6-phosphate
FT                   aldolase"
FT                   /function="6.9 : Pentose phosphate pathway"
FT                   /EC_number=""
FT                   /EC_number="4.1.2.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11120740, 7773398, 8616240; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0493"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40268"
FT                   /db_xref="GOA:D8PAK9"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAK9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40268.1"
FT   gene            complement(439088..439786)
FT                   /locus_tag="NIDE0494"
FT   CDS_pept        complement(439088..439786)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0494"
FT                   /product="putative Uracil-DNA glycosylase"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /EC_number="3.2.2.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10339434, 14556741, 16041069, 9489705;
FT                   Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0494"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40269"
FT                   /db_xref="GOA:D8PAL0"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40269.1"
FT                   QKLAAAPLSD"
FT   gene            439930..440961
FT                   /locus_tag="NIDE0495"
FT   CDS_pept        439930..440961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0495"
FT                   /product="exported protein of unknown function, contains
FT                   Transglycosylase SLT domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10452894, 14625683, 8203016"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0495"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40270"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40270.1"
FT                   KLP"
FT   gene            440967..442307
FT                   /gene="ttuD"
FT                   /locus_tag="NIDE0496"
FT   CDS_pept        440967..442307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ttuD"
FT                   /locus_tag="NIDE0496"
FT                   /product="putative Hydroxypyruvate reductase"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1657886, 16865707, 2114287, 7592429,
FT                   8055948, 8120891; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0496"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40271"
FT                   /db_xref="GOA:D8PAL2"
FT                   /db_xref="InterPro:IPR007835"
FT                   /db_xref="InterPro:IPR025286"
FT                   /db_xref="InterPro:IPR037035"
FT                   /db_xref="InterPro:IPR038614"
FT                   /db_xref="InterPro:IPR039760"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40271.1"
FT   gene            442323..444953
FT                   /locus_tag="NIDE0497"
FT   CDS_pept        442323..444953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0497"
FT                   /product="putative Phosphoenolpyruvate synthase"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.8 : Glycolysis/gluconeogenesis"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10995759, 11468288, 12083528, 1310524,
FT                   7686067, 8610096; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0497"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40272"
FT                   /db_xref="GOA:D8PAL3"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40272.1"
FT                   SRLVS"
FT   gene            445050..446465
FT                   /locus_tag="NIDE0498"
FT   CDS_pept        445050..446465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0498"
FT                   /product="putative DNA recombination protein RmuC"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10886369, 15972856; Product type cp :
FT                   cell process"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0498"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40273"
FT                   /db_xref="GOA:D8PAL4"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40273.1"
FT                   GVACAAESRGTLE"
FT   gene            446462..446890
FT                   /locus_tag="NIDE0499"
FT   CDS_pept        446462..446890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0499"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0499"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40274"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023292"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40274.1"
FT   gene            446892..447401
FT                   /locus_tag="NIDE0500"
FT   CDS_pept        446892..447401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0500"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0500"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40275"
FT                   /db_xref="GOA:D8PAL6"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40275.1"
FT                   PPRVSA"
FT   gene            complement(447487..448344)
FT                   /gene="panC"
FT                   /locus_tag="NIDE0501"
FT   CDS_pept        complement(447487..448344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="panC"
FT                   /locus_tag="NIDE0501"
FT                   /product="Pantoate--beta-alanine ligase"
FT                   /function="4.7 : Pantothenate and coenzyme A"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10223988, 11377204, 12717031, 16460002, 374975, 8837478;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0501"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40276"
FT                   /db_xref="GOA:D8PAL7"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40276.1"
FT                   RRKP"
FT   gene            complement(448341..448904)
FT                   /gene="folK"
FT                   /locus_tag="NIDE0502"
FT   CDS_pept        complement(448341..448904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="folK"
FT                   /locus_tag="NIDE0502"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   diphosphokinase"
FT                   /function="4.2 : Folic acid"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10080886, 10378268, 1313386, 1325970, 14769023, 15016362,
FT                   15018613, 1657875, 2123867; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0502"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40277"
FT                   /db_xref="GOA:D8PAL8"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40277.1"
FT   gene            complement(448992..450167)
FT                   /gene="yfdZ"
FT                   /locus_tag="NIDE0503"
FT   CDS_pept        complement(448992..450167)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="yfdZ"
FT                   /locus_tag="NIDE0503"
FT                   /product="Aminotransferase, probable Transaminase MtnE"
FT                   /function="6 : Energy metabolism"
FT                   /function="6.2 : Amino acids and amines"
FT                   /EC_number="2.6.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10029535, 15103638, 1954227, 1990006, 2155199,
FT                   3137225, 8907187, 12022921, 15102328; Product type e :
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0503"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40278"
FT                   /db_xref="GOA:D8PAL9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019881"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAL9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40278.1"
FT   gene            450317..451612
FT                   /locus_tag="NIDE0504"
FT   CDS_pept        450317..451612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0504"
FT                   /product="Acyltransferase, family 3"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="2.3.1.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1629172, 1787800; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0504"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40279"
FT                   /db_xref="GOA:D8PAM0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40279.1"
FT   gene            451781..452140
FT                   /locus_tag="NIDE0505"
FT   CDS_pept        451781..452140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0505"
FT                   /product="conserved protein of unknown function, DUF1499"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0505"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40280"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40280.1"
FT                   RRRMEEIRVVVEGRL"
FT   gene            452231..452854
FT                   /locus_tag="NIDE0506"
FT   CDS_pept        452231..452854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0506"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0506"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40281"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40281.1"
FT   gene            453233..454090
FT                   /locus_tag="NIDE0507"
FT   CDS_pept        453233..454090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0507"
FT                   /product="ABC-2 type transporter, permease component,
FT                   putative LPS export system"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11421269, 11988180, 1303751, 1659649, 7533882,
FT                   7565096, 8626291, 9640644, 9872322, 9873074; Product type t
FT                   : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0507"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40282"
FT                   /db_xref="GOA:D8PAM3"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40282.1"
FT                   ADVI"
FT   gene            454091..455392
FT                   /locus_tag="NIDE0508"
FT   CDS_pept        454091..455392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0508"
FT                   /product="ABC-type transport system, ATPase component,
FT                   putative LPS export system"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="14.3 : Biosynthesis and degradation of surface
FT                   polysaccharides and lipopolysaccharides"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11421269, 11470432, 11988180, 2229036, 3762694,
FT                   7565096, 8626291, 8752339, 9640644, 9872322, 9873074;
FT                   Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0508"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40283"
FT                   /db_xref="GOA:D8PAM4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40283.1"
FT   gene            455544..455747
FT                   /locus_tag="NIDE0509"
FT   CDS_pept        455544..455747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0509"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0509"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40284"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40284.1"
FT   gene            456006..456872
FT                   /locus_tag="NIDE0510"
FT   CDS_pept        456006..456872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0510"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0510"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40285"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40285.1"
FT                   PTHQASR"
FT   gene            complement(456894..457580)
FT                   /gene="pmtA"
FT                   /locus_tag="NIDE0511"
FT   CDS_pept        complement(456894..457580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pmtA"
FT                   /locus_tag="NIDE0511"
FT                   /product="Phosphatidylethanolamine N-methyltransferase"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 8340421, 9045837; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0511"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40286"
FT                   /db_xref="GOA:D8PAM7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40286.1"
FT                   RHGHHS"
FT   gene            457835..458455
FT                   /locus_tag="NIDE0512"
FT   CDS_pept        457835..458455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0512"
FT                   /product="membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0512"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40287"
FT                   /db_xref="GOA:D8PAM8"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40287.1"
FT   gene            complement(458452..458808)
FT                   /locus_tag="NIDE0513"
FT   CDS_pept        complement(458452..458808)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0513"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0513"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40288"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAM9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40288.1"
FT                   PEFDHLLKLYRPTS"
FT   gene            458919..459410
FT                   /locus_tag="NIDE0514"
FT   CDS_pept        458919..459410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0514"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0514"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40289"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40289.1"
FT                   "
FT   gene            complement(459427..460035)
FT                   /locus_tag="NIDE0515"
FT   CDS_pept        complement(459427..460035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0515"
FT                   /product="putative Alpha-ribazole phosphatase cobC"
FT                   /function="4.3 : Heme, porphyrin, and cobalamin"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 17209023, 7929373; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0515"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40290"
FT                   /db_xref="GOA:D8PAN1"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40290.1"
FT   gene            complement(460054..461085)
FT                   /locus_tag="NIDE0516"
FT   CDS_pept        complement(460054..461085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0516"
FT                   /product="BNR repeat protein (fragment)"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11266614, 12374200,
FT                   8591030"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0516"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40291"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR031778"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40291.1"
FT                   PAP"
FT   gene            complement(461168..462304)
FT                   /locus_tag="NIDE0517"
FT   CDS_pept        complement(461168..462304)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0517"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0517"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40292"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40292.1"
FT   gene            462487..463176
FT                   /locus_tag="NIDE0518"
FT   CDS_pept        462487..463176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0518"
FT                   /product="putative Peptidase S16, lon-like"
FT                   /function="11.4 : Degradation of proteins, peptides, and
FT                   glycopeptides"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7845208, 8439290; Product type pe :
FT                   putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0518"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40293"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40293.1"
FT                   RGAGGWG"
FT   gene            463176..464147
FT                   /gene="drrA"
FT                   /locus_tag="NIDE0519"
FT   CDS_pept        463176..464147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="drrA"
FT                   /locus_tag="NIDE0519"
FT                   /product="Daunorubicin resistance ABC transporter,
FT                   ATP-binding protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /EC_number="3.6.3.-"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 1924314, 9640644, 9872322; Product type t :
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0519"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40294"
FT                   /db_xref="GOA:D8PAN5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40294.1"
FT   gene            464177..464956
FT                   /locus_tag="NIDE0520"
FT   CDS_pept        464177..464956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0520"
FT                   /product="putative Daunorubicin resistance ABC transporter,
FT                   membrane protein"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 1924314; Product type pt : putative
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0520"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40295"
FT                   /db_xref="GOA:D8PAN6"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40295.1"
FT   gene            464983..465843
FT                   /locus_tag="NIDE0521"
FT   CDS_pept        464983..465843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0521"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0521"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40296"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40296.1"
FT                   REEGL"
FT   gene            complement(466026..466784)
FT                   /locus_tag="NIDE0522"
FT   CDS_pept        complement(466026..466784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0522"
FT                   /product="putative Ribonuclease Z"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /function="9.1 : Degradation of RNA"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10625642, 12029081, 15699034,
FT                   15764599, 16634630, 7588620; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0522"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40297"
FT                   /db_xref="GOA:D8PAN8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40297.1"
FT   gene            complement(466781..467239)
FT                   /locus_tag="NIDE0523"
FT   CDS_pept        complement(466781..467239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0523"
FT                   /product="Transcriptional regulator, MarR family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10498949, 11473263, 12088660, 9194707; Product
FT                   type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0523"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40298"
FT                   /db_xref="GOA:D8PAN9"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAN9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40298.1"
FT   gene            467341..467973
FT                   /locus_tag="NIDE0524"
FT   CDS_pept        467341..467973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0524"
FT                   /product="protein of unknown function, contains HEAT-like
FT                   repeat"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 16819590, 8132596, 9882677"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0524"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40299"
FT                   /db_xref="GOA:D8PAP0"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40299.1"
FT   gene            complement(468011..468844)
FT                   /locus_tag="NIDE0525"
FT   CDS_pept        complement(468011..468844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0525"
FT                   /product="putative Metallophosphoesterase"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /EC_number="3.1.-.-"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0525"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40300"
FT                   /db_xref="GOA:D8PAP1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40300.1"
FT   gene            complement(468841..469452)
FT                   /locus_tag="NIDE0526"
FT   CDS_pept        complement(468841..469452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0526"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0526"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40301"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40301.1"
FT   gene            469627..470679
FT                   /gene="truD"
FT                   /locus_tag="NIDE0527"
FT   CDS_pept        469627..470679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="truD"
FT                   /locus_tag="NIDE0527"
FT                   /product="tRNA pseudouridine synthase D"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /EC_number="5.4.99.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 12756329, 14999002, 15039583, 15135053, 15208439; Product
FT                   type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0527"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40302"
FT                   /db_xref="GOA:D8PAP3"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40302.1"
FT                   VLREVVKKSD"
FT   gene            470787..472031
FT                   /locus_tag="NIDE0528"
FT   CDS_pept        470787..472031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0528"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0528"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40303"
FT                   /db_xref="InterPro:IPR005239"
FT                   /db_xref="InterPro:IPR007545"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40303.1"
FT                   ASFLTELARELGWRP"
FT   gene            472028..472828
FT                   /locus_tag="NIDE0529"
FT   CDS_pept        472028..472828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0529"
FT                   /product="putative Dimethylargininase"
FT                   /function="1 : Amino acid biosynthesis"
FT                   /EC_number=""
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10493931, 11473257, 16698551, 9537995,
FT                   9874257; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0529"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40304"
FT                   /db_xref="GOA:D8PAP5"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40304.1"
FT   gene            complement(473097..473456)
FT                   /locus_tag="NIDE0530"
FT   CDS_pept        complement(473097..473456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0530"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0530"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40305"
FT                   /db_xref="GOA:D8PAP6"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40305.1"
FT                   AIAGLYLSFLFREKR"
FT   gene            473638..474663
FT                   /gene="gpsA"
FT                   /locus_tag="NIDE0531"
FT   CDS_pept        473638..474663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="NIDE0531"
FT                   /product="Glycerol-3-phosphate dehydrogenase [NAD(P)+]"
FT                   /function="3 : Fatty acid and phospholipid metabolism"
FT                   /function="3.1 : Biosynthesis"
FT                   /function="5.3 : Phosphorus compounds"
FT                   /function="6 : Energy metabolism"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10801498, 6773774, 7592341; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0531"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40306"
FT                   /db_xref="GOA:D8PAP7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40306.1"
FT                   S"
FT   gene            474660..475412
FT                   /locus_tag="NIDE0532"
FT   CDS_pept        474660..475412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0532"
FT                   /product="conserved protein of unknown function, putative
FT                   NCAIR mutase"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10074353, 10574791"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0532"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40307"
FT                   /db_xref="GOA:D8PAP8"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40307.1"
FT   gene            complement(475465..476037)
FT                   /locus_tag="NIDE0533"
FT   CDS_pept        complement(475465..476037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0533"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0533"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40308"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAP9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40308.1"
FT   gene            476207..477415
FT                   /locus_tag="NIDE0534"
FT   CDS_pept        476207..477415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0534"
FT                   /product="conserved protein of unknown function, UPF0272"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0534"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40309"
FT                   /db_xref="GOA:D8PAQ0"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40309.1"
FT                   GSR"
FT   gene            477474..478487
FT                   /locus_tag="NIDE0535"
FT   CDS_pept        477474..478487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0535"
FT                   /product="Ca2+/Na+ antiporter"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="7.4 : Cations and iron carrying compounds"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type t : transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0535"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40310"
FT                   /db_xref="GOA:D8PAQ1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40310.1"
FT   gene            478477..479520
FT                   /gene="pdxA"
FT                   /locus_tag="NIDE0536"
FT   CDS_pept        478477..479520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pdxA"
FT                   /locus_tag="NIDE0536"
FT                   /product="4-hydroxythreonine-4-phosphate dehydrogenase"
FT                   /function="4.8 : Pyridoxine"
FT                   /EC_number=""
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10225425, 12896974, 15026039; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0536"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40311"
FT                   /db_xref="GOA:D8PAQ2"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="InterPro:IPR037510"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40311.1"
FT                   PVTKTSR"
FT   gene            479541..479861
FT                   /locus_tag="NIDE0537"
FT   CDS_pept        479541..479861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0537"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0537"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40312"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40312.1"
FT                   AG"
FT   gene            479878..480681
FT                   /gene="ksgA"
FT                   /locus_tag="NIDE0538"
FT   CDS_pept        479878..480681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ksgA"
FT                   /locus_tag="NIDE0538"
FT                   /product="Dimethyladenosine transferase"
FT                   /function="9.4 : RNA processing"
FT                   /function="10.3 : tRNA and rRNA base modification"
FT                   /function="15.8 : Toxin production and resistance"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 15136037, 3122846, 3905517; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0538"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40313"
FT                   /db_xref="GOA:D8PAQ4"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40313.1"
FT   gene            480844..483216
FT                   /gene="ftsK"
FT                   /locus_tag="NIDE0539"
FT   CDS_pept        480844..483216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsK"
FT                   /locus_tag="NIDE0539"
FT                   /product="DNA translocase FtsK"
FT                   /function="15.1 : Cell division"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 10672183, 11062134, 11433368, 11778051, 7592387,
FT                   8160014; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0539"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40314"
FT                   /db_xref="GOA:D8PAQ5"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40314.1"
FT   gene            483213..483935
FT                   /locus_tag="NIDE0540"
FT   CDS_pept        483213..483935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0540"
FT                   /product="putative Outer membrane lipoprotein carrier
FT                   protein LolA"
FT                   /function="7 : Transport and binding proteins"
FT                   /function="11.3 : Protein folding and stabilization"
FT                   /function="11.1 : Protein and peptide secretion and
FT                   trafficking"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12032293, 12839983, 9829994, 9849875;
FT                   Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0540"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40315"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40315.1"
FT                   FKAPADVEIVRAPVLSRP"
FT   gene            484150..484911
FT                   /locus_tag="NIDE0541"
FT   CDS_pept        484150..484911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0541"
FT                   /product="putative 2-oxoglutarate-Fe(II) oxygenase
FT                   superfamily"
FT                   /function="18 : Unknown function"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11276424; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0541"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40316"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40316.1"
FT   gene            complement(485006..487738)
FT                   /locus_tag="NIDE0542"
FT   CDS_pept        complement(485006..487738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0542"
FT                   /product="protein of unknown function, putative Histidine
FT                   kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0542"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40317"
FT                   /db_xref="GOA:D8PAQ8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40317.1"
FT   gene            complement(487981..490296)
FT                   /locus_tag="NIDE0543"
FT   CDS_pept        complement(487981..490296)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0543"
FT                   /product="protein of unknown function, putative Histidine
FT                   kinase"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0543"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40318"
FT                   /db_xref="GOA:D8PAQ9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAQ9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40318.1"
FT                   GTQFYFTLPLDNAPASTP"
FT   gene            complement(490296..491273)
FT                   /locus_tag="NIDE0544"
FT   CDS_pept        complement(490296..491273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0544"
FT                   /product="conserved exported protein of unknown function,
FT                   DUF534"
FT                   /function="19 : Unclassified"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0544"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40319"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40319.1"
FT   gene            complement(491321..494443)
FT                   /locus_tag="NIDE0545"
FT   CDS_pept        complement(491321..494443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0545"
FT                   /product="protein of unknown function, S-box protein"
FT                   /function="12.4 : Small molecule interactions"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 12377121, 15009198, 9301332"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0545"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40320"
FT                   /db_xref="GOA:D8PAR1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40320.1"
FT   gene            complement(494511..496511)
FT                   /locus_tag="NIDE0546"
FT   CDS_pept        complement(494511..496511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0546"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12957833, 15111112, 15993072, 2644220;
FT                   Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0546"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40321"
FT                   /db_xref="GOA:D8PAR2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40321.1"
FT   gene            complement(496555..498504)
FT                   /locus_tag="NIDE0547"
FT   CDS_pept        complement(496555..498504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0547"
FT                   /product="putative TonB-dependent receptor"
FT                   /function="7 : Transport and binding proteins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 12948487, 12957833, 14499604,
FT                   15993072; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0547"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40322"
FT                   /db_xref="GOA:D8PAR3"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40322.1"
FT                   TLGSRVMGWVTLRF"
FT   gene            complement(498862..499143)
FT                   /locus_tag="NIDE0548"
FT   CDS_pept        complement(498862..499143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0548"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 1943695"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0548"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40323"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40323.1"
FT   gene            complement(499628..500359)
FT                   /locus_tag="NIDE0549"
FT   CDS_pept        complement(499628..500359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0549"
FT                   /product="protein of unknown function, DUF928"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0549"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40324"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40324.1"
FT   gene            complement(500399..501079)
FT                   /locus_tag="NIDE0550"
FT   CDS_pept        complement(500399..501079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0550"
FT                   /product="protein of unknown function, DUF928"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0550"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40325"
FT                   /db_xref="InterPro:IPR010328"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40325.1"
FT                   AGRR"
FT   gene            complement(501213..503525)
FT                   /locus_tag="NIDE0551"
FT   CDS_pept        complement(501213..503525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0551"
FT                   /product="conserved protein of unknown function,
FT                   Tetratricopeptide repeat protein"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 10786835, 14659697,
FT                   1882418, 7667876, 9482716"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0551"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40326"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40326.1"
FT                   YEHPAYWSAFLLLNNWL"
FT   gene            complement(503556..505316)
FT                   /locus_tag="NIDE0552"
FT   CDS_pept        complement(503556..505316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0552"
FT                   /product="putative Surface antigen (D15)"
FT                   /function="14.1 : Surface structures"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 7737523, 8757848, 9284140; Product
FT                   type pm : putative membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0552"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40327"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40327.1"
FT                   IHLQFVVQAL"
FT   gene            complement(505355..508447)
FT                   /locus_tag="NIDE0553"
FT   CDS_pept        complement(505355..508447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0553"
FT                   /product="conserved protein of unknown function,
FT                   filamentous haemagglutinin family"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 11703654, 15079085,
FT                   16339899, 7519681"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0553"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40328"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAR9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40328.1"
FT   gene            complement(508569..508745)
FT                   /locus_tag="NIDE0554"
FT   CDS_pept        complement(508569..508745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0554"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0554"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40329"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40329.1"
FT                   ALKEISKNHSSST"
FT   gene            complement(509406..510794)
FT                   /locus_tag="NIDE0556"
FT   CDS_pept        complement(509406..510794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0556"
FT                   /product="putative long-chain fatty acid outer membrane
FT                   transporter"
FT                   /function="7.6 : Porins"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 10671442, 10845710, 15178802,
FT                   16079137, 1987139; Product type pt : putative transporter"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0556"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40330"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40330.1"
FT                   RFNY"
FT   gene            complement(510799..513648)
FT                   /locus_tag="NIDE0557"
FT   CDS_pept        complement(510799..513648)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0557"
FT                   /product="protein of unknown function, putative Histidine
FT                   kinase"
FT                   /function="19 : Unclassified"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0557"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40331"
FT                   /db_xref="GOA:D8PAS2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40331.1"
FT   gene            complement(513641..515419)
FT                   /locus_tag="NIDE0558"
FT   CDS_pept        complement(513641..515419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0558"
FT                   /product="conserved exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0558"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40332"
FT                   /db_xref="GOA:D8PAS3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40332.1"
FT                   LDRLVMTNAPICRDLE"
FT   gene            515418..515720
FT                   /locus_tag="NIDE0559"
FT   CDS_pept        515418..515720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0559"
FT                   /product="protein of unknown function"
FT                   /note="Evidence 6 : Doubtful CDS"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0559"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40333"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40333.1"
FT   gene            complement(515767..516282)
FT                   /locus_tag="NIDE0560"
FT   CDS_pept        complement(515767..516282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0560"
FT                   /product="membrane protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0560"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40334"
FT                   /db_xref="GOA:D8PAS5"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40334.1"
FT                   AAMKHLHQ"
FT   gene            complement(516351..517754)
FT                   /locus_tag="NIDE0561"
FT   CDS_pept        complement(516351..517754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0561"
FT                   /product="radical SAM superfamily protein, putative
FT                   Coenzyme PQQ synthesis protein E"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /function="4.5 : Menaquinone and ubiquinone"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11111029, 11222759, 2536663, 7665488,
FT                   8982003; Product type pe : putative enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0561"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40335"
FT                   /db_xref="GOA:D8PAS6"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40335.1"
FT                   FNFDMRGKD"
FT   gene            complement(517754..519865)
FT                   /locus_tag="NIDE0562"
FT   CDS_pept        complement(517754..519865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0562"
FT                   /product="putative Universal stress protein UspA (modular
FT                   protein)"
FT                   /function="15.10 : Adaptations to atypical conditions"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11738040, 8152377, 9405142, 9860944;
FT                   Product type pf : putative factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0562"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40336"
FT                   /db_xref="GOA:D8PAS7"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR013580"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="InterPro:IPR042298"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40336.1"
FT                   SSSKTGANR"
FT   gene            complement(520031..521686)
FT                   /locus_tag="NIDE0563"
FT   CDS_pept        complement(520031..521686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0563"
FT                   /product="Radical SAM superfamily protein"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 3 : Function proposed based on presence of
FT                   conserved amino acid motif, structural feature or limited
FT                   homology; PubMedId : 11222759; Product type pe : putative
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0563"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40337"
FT                   /db_xref="GOA:D8PAS8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40337.1"
FT   gene            complement(521782..522558)
FT                   /gene="ubiE"
FT                   /locus_tag="NIDE0564"
FT   CDS_pept        complement(521782..522558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ubiE"
FT                   /locus_tag="NIDE0564"
FT                   /product="Ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /function="4 : Biosynthesis of cofactors, prosthetic
FT                   groups, and carriers"
FT                   /function="4.5 : Menaquinone and ubiquinone"
FT                   /function="6.1 : Aerobic"
FT                   /function="6.3 : Anaerobic"
FT                   /EC_number="2.1.1.-"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10960098, 1444716, 2121900, 4323297, 9045837, 9139683,
FT                   9325429; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0564"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40338"
FT                   /db_xref="GOA:D8PAS9"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAS9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40338.1"
FT   gene            complement(522655..523434)
FT                   /locus_tag="NIDE0565"
FT   CDS_pept        complement(522655..523434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0565"
FT                   /product="conserved protein of unknown function,
FT                   metallo-beta-lactamase superfamily"
FT                   /function="19 : Unclassified"
FT                   /function="18.1 : Enzymes of unknown specificity"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function; PubMedId : 7588620"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0565"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40339"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40339.1"
FT   gene            complement(523424..524215)
FT                   /locus_tag="NIDE0566"
FT   CDS_pept        complement(523424..524215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0566"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0566"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40340"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40340.1"
FT   gene            524210..524410
FT                   /locus_tag="NIDE0567"
FT   CDS_pept        524210..524410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0567"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0567"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40341"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40341.1"
FT   gene            524421..526928
FT                   /gene="uvrA"
FT                   /locus_tag="NIDE0568"
FT   CDS_pept        524421..526928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="NIDE0568"
FT                   /product="Excinuclease ABC, subunit A"
FT                   /function="8 : DNA metabolism"
FT                   /function="8.1 : DNA replication, recombination, and
FT                   repair"
FT                   /note="Evidence 2a : Function of homologous gene
FT                   experimentally demonstrated in an other organism; PubMedId
FT                   : 10503543, 1826851, 2550431, 3007478, 6310514, 8921840,
FT                   8955293, 9370272; Product type e : enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0568"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40342"
FT                   /db_xref="GOA:D8PAT3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40342.1"
FT   gene            526952..527119
FT                   /locus_tag="NIDE0569"
FT   CDS_pept        526952..527119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0569"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0569"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40343"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40343.1"
FT                   FRRLHPSHPR"
FT   gene            527258..528007
FT                   /locus_tag="NIDE0570"
FT   CDS_pept        527258..528007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0570"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0570"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40344"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40344.1"
FT   gene            528069..528398
FT                   /locus_tag="NIDE0571"
FT   CDS_pept        528069..528398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0571"
FT                   /product="conserved membrane protein of unknown function,
FT                   DUF486"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0571"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40345"
FT                   /db_xref="GOA:D8PAT6"
FT                   /db_xref="InterPro:IPR007437"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40345.1"
FT                   VFKEW"
FT   gene            complement(528478..528696)
FT                   /locus_tag="NIDE0572"
FT   CDS_pept        complement(528478..528696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0572"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0572"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40346"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT7"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40346.1"
FT   gene            528734..529099
FT                   /locus_tag="NIDE0573"
FT   CDS_pept        528734..529099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0573"
FT                   /product="protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0573"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40347"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT8"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40347.1"
FT                   KMVSALNRELVAASLLP"
FT   gene            529124..529216
FT                   /locus_tag="NIDE0574"
FT   CDS_pept        529124..529216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0574"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0574"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40348"
FT                   /db_xref="GOA:D8PAT9"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAT9"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40348.1"
FT                   /translation="MGTMGKGFILWLLGVPASLLVLLWFLGILK"
FT   gene            complement(529357..530271)
FT                   /locus_tag="NIDE0575"
FT   CDS_pept        complement(529357..530271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0575"
FT                   /product="exported protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0575"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40349"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAU0"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40349.1"
FT   gene            530437..532932
FT                   /locus_tag="NIDE0577"
FT   CDS_pept        530437..532932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0577"
FT                   /product="conserved protein of unknown function"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 4 : Homologs of previously reported genes
FT                   of unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0577"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40350"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAU1"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40350.1"
FT   gene            533043..537041
FT                   /locus_tag="NIDE0578"
FT   CDS_pept        533043..537041
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0578"
FT                   /product="protein of unknown function, putative Sensor
FT                   histidine kinase"
FT                   /function="19 : Unclassified"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences; PubMedId : 10966457, 18076326"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0578"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40351"
FT                   /db_xref="GOA:D8PAU2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAU2"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40351.1"
FT   gene            537034..537672
FT                   /locus_tag="NIDE0579"
FT   CDS_pept        537034..537672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0579"
FT                   /product="Transcriptional regulator, LuxR family"
FT                   /function="9 : Transcription"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11022030, 12193630, 12533459; Product type r :
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0579"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40352"
FT                   /db_xref="GOA:D8PAU3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAU3"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40352.1"
FT   gene            537831..538511
FT                   /locus_tag="NIDE0580"
FT   CDS_pept        537831..538511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0580"
FT                   /product="Transcriptional regulator, LuxR family"
FT                   /function="12.1 : DNA interactions"
FT                   /function="13.1 : Two-component systems"
FT                   /function="9 : Transcription"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   Product type r : regulator"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0580"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40353"
FT                   /db_xref="GOA:D8PAU4"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAU4"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40353.1"
FT                   EDCA"
FT   gene            538530..538913
FT                   /locus_tag="NIDE0581"
FT   CDS_pept        538530..538913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0581"
FT                   /product="Response regulator, CheY-like"
FT                   /function="13.1 : Two-component systems"
FT                   /note="Evidence 2b : Function of strongly homologous gene;
FT                   PubMedId : 11489844, 11934609; Product type f : factor"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0581"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40354"
FT                   /db_xref="GOA:D8PAU5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAU5"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40354.1"
FT   gene            complement(539018..542980)
FT                   /locus_tag="NIDE0582"
FT   CDS_pept        complement(539018..542980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0582"
FT                   /product="membrane protein of unknown function, contains
FT                   GNAT domain"
FT                   /function="19 : Unclassified"
FT                   /note="Evidence 5 : No homology to any previously reported
FT                   sequences"
FT                   /db_xref="EnsemblGenomes-Gn:NIDE0582"
FT                   /db_xref="EnsemblGenomes-Tr:CBK40355"
FT                   /db_xref="GOA:D8PAU6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D8PAU6"
FT                   /inference="ab initio prediction:AMIGene:2.0"
FT                   /protein_id="CBK40355.1"
FT   gene            complement(543249..543806)
FT                   /locus_tag="NIDE0583"
FT   CDS_pept        complement(543249..543806)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="NIDE0583"
FT                   /product="conserved membrane protein of unknown function,
FT                   UPF0114"