(data stored in SCRATCH3701 zone)

EMBL: FP929140

ID   FP929140; SV 1; circular; genomic DNA; STD; PRO; 4587455 BP.
XX
AC   FP929140;
XX
PR   Project:PRJEA46849;
XX
DT   29-JUL-2010 (Rel. 105, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 3)
XX
DE   gamma proteobacterium HdN1 complete genome
XX
KW   complete genome.
XX
OS   gamma proteobacterium HdN1
OC   Bacteria; Proteobacteria; Gammaproteobacteria.
XX
RN   [1]
RP   1-4587455
RA   Widdel F., Rabus R., Grundmann O., Werner I., Schreiber F., Ehrenreich P.,
RA   Behrends A., Wilkes H., Kube M., Reinhardt R., Zedelius J.;
RT   "Alkane degradation by a new type of denitrifying bacterium with possible
RT   involvement of the electron acceptor in substrate activation";
RL   Environ. Microbiol. 0:0(2010).
XX
RN   [2]
RP   1-4587455
RA   Kube M., Beck R., Reinhardt R.;
RT   ;
RL   Submitted (30-MAR-2010) to the INSDC.
RL   Max Planck Institute for Molecular Genetics, proScience Ihnestrasse 63,
RL   D-14195 Berlin, Germany.
XX
DR   MD5; 33d53d9a2eb71eb276a139b1e54483ce.
DR   BioSample; SAMEA2272402.
DR   EnsemblGenomes-Gn; EBG00000238115.
DR   EnsemblGenomes-Gn; EBG00000238117.
DR   EnsemblGenomes-Gn; EBG00000238121.
DR   EnsemblGenomes-Gn; EBG00000238122.
DR   EnsemblGenomes-Gn; EBG00000238125.
DR   EnsemblGenomes-Gn; EBG00000238128.
DR   EnsemblGenomes-Gn; EBG00000238131.
DR   EnsemblGenomes-Gn; EBG00000238136.
DR   EnsemblGenomes-Gn; EBG00000238138.
DR   EnsemblGenomes-Gn; EBG00000238146.
DR   EnsemblGenomes-Gn; EBG00000238149.
DR   EnsemblGenomes-Gn; EBG00000238157.
DR   EnsemblGenomes-Gn; EBG00000238160.
DR   EnsemblGenomes-Gn; EBG00000238167.
DR   EnsemblGenomes-Gn; EBG00000238168.
DR   EnsemblGenomes-Gn; EBG00000238172.
DR   EnsemblGenomes-Gn; EBG00000238177.
DR   EnsemblGenomes-Gn; EBG00000238179.
DR   EnsemblGenomes-Gn; EBG00000238180.
DR   EnsemblGenomes-Gn; EBG00000238185.
DR   EnsemblGenomes-Gn; EBG00000238191.
DR   EnsemblGenomes-Gn; EBG00000238195.
DR   EnsemblGenomes-Gn; EBG00000238197.
DR   EnsemblGenomes-Gn; EBG00000238198.
DR   EnsemblGenomes-Gn; EBG00000238199.
DR   EnsemblGenomes-Gn; EBG00000238202.
DR   EnsemblGenomes-Gn; EBG00000238210.
DR   EnsemblGenomes-Gn; EBG00000238215.
DR   EnsemblGenomes-Gn; EBG00000238216.
DR   EnsemblGenomes-Gn; EBG00000238217.
DR   EnsemblGenomes-Gn; EBG00000238219.
DR   EnsemblGenomes-Gn; EBG00000238221.
DR   EnsemblGenomes-Gn; EBG00000238225.
DR   EnsemblGenomes-Gn; EBG00000238226.
DR   EnsemblGenomes-Gn; EBG00000238231.
DR   EnsemblGenomes-Gn; EBG00000238233.
DR   EnsemblGenomes-Gn; EBG00000238236.
DR   EnsemblGenomes-Gn; EBG00000238237.
DR   EnsemblGenomes-Gn; EBG00000238238.
DR   EnsemblGenomes-Gn; EBG00000238240.
DR   EnsemblGenomes-Gn; EBG00000238244.
DR   EnsemblGenomes-Gn; EBG00000238246.
DR   EnsemblGenomes-Gn; EBG00000238247.
DR   EnsemblGenomes-Gn; EBG00000238249.
DR   EnsemblGenomes-Gn; EBG00000238251.
DR   EnsemblGenomes-Gn; EBG00000238253.
DR   EnsemblGenomes-Gn; EBG00000238259.
DR   EnsemblGenomes-Gn; EBG00000238262.
DR   EnsemblGenomes-Gn; EBG00000238263.
DR   EnsemblGenomes-Gn; EBG00000238264.
DR   EnsemblGenomes-Gn; EBG00000238266.
DR   EnsemblGenomes-Gn; EBG00000238269.
DR   EnsemblGenomes-Gn; EBG00000238270.
DR   EnsemblGenomes-Gn; EBG00000238271.
DR   EnsemblGenomes-Gn; EBG00000238272.
DR   EnsemblGenomes-Gn; EBG00000238273.
DR   EnsemblGenomes-Gn; EBG00001043301.
DR   EnsemblGenomes-Gn; EBG00001043302.
DR   EnsemblGenomes-Gn; EBG00001043303.
DR   EnsemblGenomes-Gn; EBG00001043304.
DR   EnsemblGenomes-Gn; EBG00001043305.
DR   EnsemblGenomes-Gn; EBG00001043306.
DR   EnsemblGenomes-Gn; EBG00001043307.
DR   EnsemblGenomes-Gn; EBG00001043308.
DR   EnsemblGenomes-Gn; EBG00001043309.
DR   EnsemblGenomes-Gn; EBG00001043310.
DR   EnsemblGenomes-Gn; EBG00001043311.
DR   EnsemblGenomes-Gn; EBG00001043312.
DR   EnsemblGenomes-Gn; EBG00001043313.
DR   EnsemblGenomes-Gn; EBG00001043314.
DR   EnsemblGenomes-Gn; EBG00001043315.
DR   EnsemblGenomes-Gn; EBG00001043316.
DR   EnsemblGenomes-Gn; EBG00001043317.
DR   EnsemblGenomes-Gn; EBG00001043318.
DR   EnsemblGenomes-Gn; EBG00001043319.
DR   EnsemblGenomes-Gn; EBG00001043320.
DR   EnsemblGenomes-Gn; EBG00001043321.
DR   EnsemblGenomes-Gn; EBG00001043322.
DR   EnsemblGenomes-Gn; EBG00001043323.
DR   EnsemblGenomes-Gn; EBG00001043324.
DR   EnsemblGenomes-Gn; EBG00001043325.
DR   EnsemblGenomes-Gn; EBG00001043326.
DR   EnsemblGenomes-Gn; EBG00001043327.
DR   EnsemblGenomes-Gn; EBG00001043328.
DR   EnsemblGenomes-Gn; EBG00001043329.
DR   EnsemblGenomes-Gn; EBG00001043330.
DR   EnsemblGenomes-Gn; EBG00001043331.
DR   EnsemblGenomes-Gn; EBG00001043332.
DR   EnsemblGenomes-Gn; EBG00001043333.
DR   EnsemblGenomes-Gn; EBG00001043334.
DR   EnsemblGenomes-Gn; EBG00001043335.
DR   EnsemblGenomes-Gn; EBG00001043336.
DR   EnsemblGenomes-Gn; EBG00001043337.
DR   EnsemblGenomes-Gn; EBG00001043338.
DR   EnsemblGenomes-Gn; EBG00001043339.
DR   EnsemblGenomes-Gn; EBG00001043340.
DR   EnsemblGenomes-Gn; EBG00001043341.
DR   EnsemblGenomes-Gn; EBG00001043342.
DR   EnsemblGenomes-Gn; EBG00001043343.
DR   EnsemblGenomes-Gn; EBG00001043344.
DR   EnsemblGenomes-Gn; EBG00001043345.
DR   EnsemblGenomes-Gn; EBG00001043346.
DR   EnsemblGenomes-Gn; EBG00001043347.
DR   EnsemblGenomes-Gn; EBG00001043348.
DR   EnsemblGenomes-Gn; EBG00001043349.
DR   EnsemblGenomes-Gn; EBG00001043350.
DR   EnsemblGenomes-Gn; EBG00001043351.
DR   EnsemblGenomes-Gn; EBG00001043352.
DR   EnsemblGenomes-Gn; EBG00001043353.
DR   EnsemblGenomes-Gn; EBG00001043354.
DR   EnsemblGenomes-Gn; EBG00001043355.
DR   EnsemblGenomes-Gn; EBG00001043356.
DR   EnsemblGenomes-Gn; EBG00001043357.
DR   EnsemblGenomes-Gn; EBG00001043358.
DR   EnsemblGenomes-Gn; EBG00001043359.
DR   EnsemblGenomes-Gn; EBG00001043360.
DR   EnsemblGenomes-Gn; EBG00001043361.
DR   EnsemblGenomes-Gn; EBG00001043362.
DR   EnsemblGenomes-Gn; EBG00001043363.
DR   EnsemblGenomes-Gn; EBG00001043364.
DR   EnsemblGenomes-Gn; EBG00001043365.
DR   EnsemblGenomes-Gn; HDN1F_01930.
DR   EnsemblGenomes-Gn; HDN1F_04940.
DR   EnsemblGenomes-Gn; HDN1F_04950.
DR   EnsemblGenomes-Gn; HDN1F_05990.
DR   EnsemblGenomes-Gn; HDN1F_06000.
DR   EnsemblGenomes-Gn; HDN1F_06140.
DR   EnsemblGenomes-Gn; HDN1F_07170.
DR   EnsemblGenomes-Gn; HDN1F_07420.
DR   EnsemblGenomes-Gn; HDN1F_08380.
DR   EnsemblGenomes-Gn; HDN1F_08390.
DR   EnsemblGenomes-Gn; HDN1F_11490.
DR   EnsemblGenomes-Gn; HDN1F_11610.
DR   EnsemblGenomes-Gn; HDN1F_11620.
DR   EnsemblGenomes-Gn; HDN1F_11740.
DR   EnsemblGenomes-Gn; HDN1F_15180.
DR   EnsemblGenomes-Gn; HDN1F_17140.
DR   EnsemblGenomes-Gn; HDN1F_17170.
DR   EnsemblGenomes-Gn; HDN1F_17310.
DR   EnsemblGenomes-Gn; HDN1F_17890.
DR   EnsemblGenomes-Gn; HDN1F_17990.
DR   EnsemblGenomes-Gn; HDN1F_18320.
DR   EnsemblGenomes-Gn; HDN1F_18330.
DR   EnsemblGenomes-Gn; HDN1F_22130.
DR   EnsemblGenomes-Gn; HDN1F_23170.
DR   EnsemblGenomes-Gn; HDN1F_29870.
DR   EnsemblGenomes-Gn; HDN1F_29880.
DR   EnsemblGenomes-Gn; HDN1F_30490.
DR   EnsemblGenomes-Gn; HDN1F_30930.
DR   EnsemblGenomes-Gn; HDN1F_31180.
DR   EnsemblGenomes-Gn; HDN1F_31240.
DR   EnsemblGenomes-Gn; HDN1F_31330.
DR   EnsemblGenomes-Gn; HDN1F_31340.
DR   EnsemblGenomes-Gn; HDN1F_32700.
DR   EnsemblGenomes-Gn; HDN1F_32710.
DR   EnsemblGenomes-Gn; HDN1F_33510.
DR   EnsemblGenomes-Gn; HDN1F_34910.
DR   EnsemblGenomes-Gn; HDN1F_34920.
DR   EnsemblGenomes-Gn; HDN1F_35190.
DR   EnsemblGenomes-Gn; HDN1F_35990.
DR   EnsemblGenomes-Gn; HDN1F_36000.
DR   EnsemblGenomes-Gn; HDN1F_36540.
DR   EnsemblGenomes-Gn; HDN1F_36590.
DR   EnsemblGenomes-Gn; HDN1F_36600.
DR   EnsemblGenomes-Gn; HDN1F_36630.
DR   EnsemblGenomes-Gn; HDN1F_36640.
DR   EnsemblGenomes-Tr; EBG00000238115-1.
DR   EnsemblGenomes-Tr; EBG00000238117-1.
DR   EnsemblGenomes-Tr; EBG00000238121-1.
DR   EnsemblGenomes-Tr; EBG00000238122-1.
DR   EnsemblGenomes-Tr; EBG00000238125-1.
DR   EnsemblGenomes-Tr; EBG00000238128-1.
DR   EnsemblGenomes-Tr; EBG00000238131-1.
DR   EnsemblGenomes-Tr; EBG00000238136-1.
DR   EnsemblGenomes-Tr; EBG00000238138-1.
DR   EnsemblGenomes-Tr; EBG00000238146-1.
DR   EnsemblGenomes-Tr; EBG00000238149-1.
DR   EnsemblGenomes-Tr; EBG00000238157-1.
DR   EnsemblGenomes-Tr; EBG00000238160-1.
DR   EnsemblGenomes-Tr; EBG00000238167-1.
DR   EnsemblGenomes-Tr; EBG00000238168-1.
DR   EnsemblGenomes-Tr; EBG00000238172-1.
DR   EnsemblGenomes-Tr; EBG00000238177-1.
DR   EnsemblGenomes-Tr; EBG00000238179-1.
DR   EnsemblGenomes-Tr; EBG00000238180-1.
DR   EnsemblGenomes-Tr; EBG00000238185-1.
DR   EnsemblGenomes-Tr; EBG00000238191-1.
DR   EnsemblGenomes-Tr; EBG00000238195-1.
DR   EnsemblGenomes-Tr; EBG00000238197-1.
DR   EnsemblGenomes-Tr; EBG00000238198-1.
DR   EnsemblGenomes-Tr; EBG00000238199-1.
DR   EnsemblGenomes-Tr; EBG00000238202-1.
DR   EnsemblGenomes-Tr; EBG00000238210-1.
DR   EnsemblGenomes-Tr; EBG00000238215-1.
DR   EnsemblGenomes-Tr; EBG00000238216-1.
DR   EnsemblGenomes-Tr; EBG00000238217-1.
DR   EnsemblGenomes-Tr; EBG00000238219-1.
DR   EnsemblGenomes-Tr; EBG00000238221-1.
DR   EnsemblGenomes-Tr; EBG00000238225-1.
DR   EnsemblGenomes-Tr; EBG00000238226-1.
DR   EnsemblGenomes-Tr; EBG00000238231-1.
DR   EnsemblGenomes-Tr; EBG00000238233-1.
DR   EnsemblGenomes-Tr; EBG00000238236-1.
DR   EnsemblGenomes-Tr; EBG00000238237-1.
DR   EnsemblGenomes-Tr; EBG00000238238-1.
DR   EnsemblGenomes-Tr; EBG00000238240-1.
DR   EnsemblGenomes-Tr; EBG00000238244-1.
DR   EnsemblGenomes-Tr; EBG00000238246-1.
DR   EnsemblGenomes-Tr; EBG00000238247-1.
DR   EnsemblGenomes-Tr; EBG00000238249-1.
DR   EnsemblGenomes-Tr; EBG00000238251-1.
DR   EnsemblGenomes-Tr; EBG00000238253-1.
DR   EnsemblGenomes-Tr; EBG00000238259-1.
DR   EnsemblGenomes-Tr; EBG00000238262-1.
DR   EnsemblGenomes-Tr; EBG00000238263-1.
DR   EnsemblGenomes-Tr; EBG00000238264-1.
DR   EnsemblGenomes-Tr; EBG00000238266-1.
DR   EnsemblGenomes-Tr; EBG00000238269-1.
DR   EnsemblGenomes-Tr; EBG00000238270-1.
DR   EnsemblGenomes-Tr; EBG00000238271-1.
DR   EnsemblGenomes-Tr; EBG00000238272-1.
DR   EnsemblGenomes-Tr; EBG00000238273-1.
DR   EnsemblGenomes-Tr; EBT00001646287.
DR   EnsemblGenomes-Tr; EBT00001646288.
DR   EnsemblGenomes-Tr; EBT00001646289.
DR   EnsemblGenomes-Tr; EBT00001646290.
DR   EnsemblGenomes-Tr; EBT00001646291.
DR   EnsemblGenomes-Tr; EBT00001646292.
DR   EnsemblGenomes-Tr; EBT00001646293.
DR   EnsemblGenomes-Tr; EBT00001646294.
DR   EnsemblGenomes-Tr; EBT00001646295.
DR   EnsemblGenomes-Tr; EBT00001646296.
DR   EnsemblGenomes-Tr; EBT00001646297.
DR   EnsemblGenomes-Tr; EBT00001646298.
DR   EnsemblGenomes-Tr; EBT00001646299.
DR   EnsemblGenomes-Tr; EBT00001646300.
DR   EnsemblGenomes-Tr; EBT00001646301.
DR   EnsemblGenomes-Tr; EBT00001646302.
DR   EnsemblGenomes-Tr; EBT00001646303.
DR   EnsemblGenomes-Tr; EBT00001646304.
DR   EnsemblGenomes-Tr; EBT00001646305.
DR   EnsemblGenomes-Tr; EBT00001646306.
DR   EnsemblGenomes-Tr; EBT00001646307.
DR   EnsemblGenomes-Tr; EBT00001646308.
DR   EnsemblGenomes-Tr; EBT00001646309.
DR   EnsemblGenomes-Tr; EBT00001646310.
DR   EnsemblGenomes-Tr; EBT00001646311.
DR   EnsemblGenomes-Tr; EBT00001646312.
DR   EnsemblGenomes-Tr; EBT00001646313.
DR   EnsemblGenomes-Tr; EBT00001646314.
DR   EnsemblGenomes-Tr; EBT00001646315.
DR   EnsemblGenomes-Tr; EBT00001646316.
DR   EnsemblGenomes-Tr; EBT00001646317.
DR   EnsemblGenomes-Tr; EBT00001646318.
DR   EnsemblGenomes-Tr; EBT00001646319.
DR   EnsemblGenomes-Tr; EBT00001646320.
DR   EnsemblGenomes-Tr; EBT00001646321.
DR   EnsemblGenomes-Tr; EBT00001646322.
DR   EnsemblGenomes-Tr; EBT00001646323.
DR   EnsemblGenomes-Tr; EBT00001646324.
DR   EnsemblGenomes-Tr; EBT00001646325.
DR   EnsemblGenomes-Tr; EBT00001646326.
DR   EnsemblGenomes-Tr; EBT00001646327.
DR   EnsemblGenomes-Tr; EBT00001646328.
DR   EnsemblGenomes-Tr; EBT00001646329.
DR   EnsemblGenomes-Tr; EBT00001646330.
DR   EnsemblGenomes-Tr; EBT00001646331.
DR   EnsemblGenomes-Tr; EBT00001646332.
DR   EnsemblGenomes-Tr; EBT00001646333.
DR   EnsemblGenomes-Tr; EBT00001646334.
DR   EnsemblGenomes-Tr; EBT00001646335.
DR   EnsemblGenomes-Tr; EBT00001646336.
DR   EnsemblGenomes-Tr; EBT00001646337.
DR   EnsemblGenomes-Tr; EBT00001646338.
DR   EnsemblGenomes-Tr; EBT00001646339.
DR   EnsemblGenomes-Tr; EBT00001646340.
DR   EnsemblGenomes-Tr; EBT00001646341.
DR   EnsemblGenomes-Tr; EBT00001646342.
DR   EnsemblGenomes-Tr; EBT00001646343.
DR   EnsemblGenomes-Tr; EBT00001646344.
DR   EnsemblGenomes-Tr; EBT00001646345.
DR   EnsemblGenomes-Tr; EBT00001646346.
DR   EnsemblGenomes-Tr; EBT00001646347.
DR   EnsemblGenomes-Tr; EBT00001646348.
DR   EnsemblGenomes-Tr; EBT00001646349.
DR   EnsemblGenomes-Tr; EBT00001646350.
DR   EnsemblGenomes-Tr; EBT00001646351.
DR   EnsemblGenomes-Tr; HDN1F_01930.
DR   EnsemblGenomes-Tr; HDN1F_04940.
DR   EnsemblGenomes-Tr; HDN1F_04950.
DR   EnsemblGenomes-Tr; HDN1F_05990.
DR   EnsemblGenomes-Tr; HDN1F_06000.
DR   EnsemblGenomes-Tr; HDN1F_06140.
DR   EnsemblGenomes-Tr; HDN1F_07170.
DR   EnsemblGenomes-Tr; HDN1F_07420.
DR   EnsemblGenomes-Tr; HDN1F_08380.
DR   EnsemblGenomes-Tr; HDN1F_08390.
DR   EnsemblGenomes-Tr; HDN1F_11490.
DR   EnsemblGenomes-Tr; HDN1F_11610.
DR   EnsemblGenomes-Tr; HDN1F_11620.
DR   EnsemblGenomes-Tr; HDN1F_11740.
DR   EnsemblGenomes-Tr; HDN1F_15180.
DR   EnsemblGenomes-Tr; HDN1F_17140.
DR   EnsemblGenomes-Tr; HDN1F_17170.
DR   EnsemblGenomes-Tr; HDN1F_17310.
DR   EnsemblGenomes-Tr; HDN1F_17890.
DR   EnsemblGenomes-Tr; HDN1F_17990.
DR   EnsemblGenomes-Tr; HDN1F_18320.
DR   EnsemblGenomes-Tr; HDN1F_18330.
DR   EnsemblGenomes-Tr; HDN1F_22130.
DR   EnsemblGenomes-Tr; HDN1F_23170.
DR   EnsemblGenomes-Tr; HDN1F_29870.
DR   EnsemblGenomes-Tr; HDN1F_29880.
DR   EnsemblGenomes-Tr; HDN1F_30490.
DR   EnsemblGenomes-Tr; HDN1F_30930.
DR   EnsemblGenomes-Tr; HDN1F_31180.
DR   EnsemblGenomes-Tr; HDN1F_31240.
DR   EnsemblGenomes-Tr; HDN1F_31330.
DR   EnsemblGenomes-Tr; HDN1F_31340.
DR   EnsemblGenomes-Tr; HDN1F_32700.
DR   EnsemblGenomes-Tr; HDN1F_32710.
DR   EnsemblGenomes-Tr; HDN1F_33510.
DR   EnsemblGenomes-Tr; HDN1F_34910.
DR   EnsemblGenomes-Tr; HDN1F_34920.
DR   EnsemblGenomes-Tr; HDN1F_35190.
DR   EnsemblGenomes-Tr; HDN1F_35990.
DR   EnsemblGenomes-Tr; HDN1F_36000.
DR   EnsemblGenomes-Tr; HDN1F_36540.
DR   EnsemblGenomes-Tr; HDN1F_36590.
DR   EnsemblGenomes-Tr; HDN1F_36600.
DR   EnsemblGenomes-Tr; HDN1F_36630.
DR   EnsemblGenomes-Tr; HDN1F_36640.
DR   EuropePMC; PMC3151549; 21837252.
DR   EuropePMC; PMC3189936; 22016774.
DR   EuropePMC; PMC5088012; 27767006.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02001; group-II-D1D4-3.
DR   RFAM; RF02012; group-II-D1D4-7.
DR   SILVA-LSU; FP929140.
DR   SILVA-SSU; FP929140.
XX
CC   This project was carried out by
CC   *Max Planck Institute for Marine Microbiology, Bremen, Germany;
CC   *ICBM, General and Molecular Microbiology, Oldenburg, Germany;
CC   *GeoForschungsZentrum, Potsdam, Germany;
CC   *Max Planck Institute for Molecular Genetics, Berlin, Germany;
CC   -------------- Genome Center
CC        Center: Max Planck Institute for Molecular Genetics
CC        Center code: MPIMG
CC   -------------- Summary Statistics
CC        Sequencing vector: pUC19; 100% of reads
CC        Chemistry: Dye-terminator Big Dye; 100% of reads
CC        Assembly program: Phrap; version 0.990329
CC   --------------
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4587455
FT                   /organism="gamma proteobacterium HdN1"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:83406"
FT   CDS_pept        361..1794
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="HDN1F_00010"
FT                   /product="Chromosomal replication initiator protein"
FT                   /note="silverDB:HdN1F1"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43584"
FT                   /db_xref="GOA:E1VFE1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE1"
FT                   /protein_id="CBL43584.1"
FT                   /translation="MGNALWQGCLAKMQSELPAQQFNMWIRPLQAELDQGTLKLLAPNR
FT                   FVLDWVNEKFLSRIGELVAEASQGEQCPAVVVAIGSRQTGAVSRSTTISARVEAPKPAA
FT                   AAPGNDWAGSQISSAPQVAANVHREPDLGGTVKHRTNLNGASTFNNFVEGKSNQLARAA
FT                   AIQVAENPGQAYNPLFLYGGVGLGKTHLMHAVGNFMVEKKPNAKVVFLTSEQFVADMVK
FT                   ALQLNAINEFKRFYRSVDALLIDDIQFFAGKERSQEEFFHTFNALLEGGRQMIFTCDRF
FT                   PKEINGVEERLKSRFGWGLTVAVEPPELETRVAILKKKAEQASIELPDDAAFFVAQRVR
FT                   SNVRDLEGALKRITANQQFTGKPITVEFAKESLKDLLALQEKQISIDNIQKVVAEYFKI
FT                   KMSDLNSKRRSRSVARPRQIAMALAKELTQHSLPEIGEAFGGRDHTTVLHACRKVKELA
FT                   ATAPDIREDFSNLLRSLTT"
FT   CDS_pept        1857..2960
FT                   /transl_table=11
FT                   /gene="dnaN"
FT                   /locus_tag="HDN1F_00020"
FT                   /product="DNA polymerase sliding clamp subunit (PcnA
FT                   homolog)"
FT                   /note="silverDB:HdN1F2"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43585"
FT                   /db_xref="GOA:E1VFE2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE2"
FT                   /protein_id="CBL43585.1"
FT                   /translation="MKFKVIREGILKPLQQLAGLVERRQTKPILANILLVLDGNALTLT
FT                   GTDTEVELRARIQLGEEYPFGRATLPAKKLLDICKSLPEGAELLIEADDQKALLRSGRS
FT                   KFSLVALPPDDFPDLEDGQFEVQFSIQQRYLRELIEKTGFAMAQQDVRFYLNGMLLEVS
FT                   ENNLRAVATDGHRLALGDRDILWQGAGIRQAVVPRKGILEIPKLFGSDDGELLISLSGN
FT                   HLRAETADLRFTSKLLDAKYPEYGRVLPKPGERYIVADRDALRQCLLRVGILSNEKFRG
FT                   VRLTFQCGVLVARASNPEQEEAEESVVVDYNGADTEIAFNIGYLLDVLGVVKSESVSIS
FT                   LADANNTALIRETVDDKTLYVVMPMRI"
FT   CDS_pept        2964..4145
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="HDN1F_00030"
FT                   /product="Recombinational DNA repair ATPase"
FT                   /note="silverDB:HdN1F3"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43586"
FT                   /db_xref="GOA:E1VFE3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE3"
FT                   /protein_id="CBL43586.1"
FT                   /translation="MAIVKLEISDFRNLKAVEIAPAQGLNWVVGPNGSGKTSLLEALHL
FT                   LATGKSFRANNLRSCIRGGAKTCRVVCLKNAAAYPDVIQRLGVERDLSGGVRAVLDQLE
FT                   VTKLSGLANQIAVCTLLPDSINLLIGDPSLRREFLGWSMFHVEHNSDYLQVLRDYRFSL
FT                   QQRNALLRRLNGSELPLSGNEAIRSKELDGWDRQLGKFALKLDERRSHFMTLFRERYFS
FT                   LISKEQLNLRSSSYSSNEVHFELLRGWPDGVSLEDALAEARMRDIERGFTGSGPHRADI
FT                   RISYAGKPVRDYFSRGQLKHLISICVLVQADLIRSSRGKDGLVFIFDDAFAELDENHAS
FT                   SVLAALRSISVQTFVTTSDAAVANRHVDAIQDRMFHVEHGDVQMSVSIPKENY"
FT   CDS_pept        4147..6570
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="HDN1F_00040"
FT                   /product="DNA gyrase (topoisomerase II) B subunit"
FT                   /note="silverDB:HdN1F4"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43587"
FT                   /db_xref="GOA:E1VFE4"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE4"
FT                   /protein_id="CBL43587.1"
FT                   /translation="MSQEEDTKGYDSSSIKVLRGLDAVRKRPGMYIGDTDDGTGLHHMV
FT                   FEVVDNSIDEALAGFCKEITVTIHQDETITVCDDGRGIPVDIHPEEGVSAAEVIMTVLH
FT                   AGGKFDDNTYKVSGGLHGVGVSVVNALSEELVLTIRRKGKVWQQIYRHGVPQEPLAPIG
FT                   ESSTTGTQVHFKPSSETFSNIEFSHEILARRLRELSFLNSGVKILLKDERTDATDVFCY
FT                   EGGLEQFVKFLNLNKTPLNKVFYFSSEKDGVSVEVALQWNDGYQENVRCYTNNIPQRDG
FT                   GTHLAGFRSAMTRAINQYLDQEGITKKHKISASGDDAREGLVAIVSVKVGDPKFSSQTK
FT                   DKLVSSEVKPAVETLMFEKLSEYLAEQPNEAKIVCQKIIDAARAREAARKAREMTRRKG
FT                   ALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKQGRNRKTQAILPLKGKILNVEK
FT                   ARFDKMLSSAEVGTLITALGCGIGREEYDPDKTRYHNIIIMTDADVDGSHIRTLLLTFF
FT                   FRQMPELIERGYIYIAQPPLYKIKKGKQEQYLKDDEALSHYLTAAAIDDASLNPGGDLA
FT                   PILGTELAALLEEYKRATNRVARLSRLYPGLLLNELIYRPALDTDDLNSVDVVRNWCSG
FT                   IETHLNAICPPSEHYEVSAVEVPEKGIFVPKIILTAHGVPHHYTLGRDFFISNDYRMFT
FT                   TLGAKVRNLIQEGAFVKKGEKVKTVSSFPEVVEWLMDESRRGHQIQRYKGLGEMNPEQL
FT                   WETTMDPEMRRMLRVTVEDAIAADQIFTTLMGDAVEPRRDFIETNALNVANLDI"
FT   CDS_pept        complement(6661..7374)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00050"
FT                   /product="Phospholipid/glycerol acyltransferase"
FT                   /note="silverDB:HdN1F5"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43588"
FT                   /db_xref="GOA:E1VFE5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE5"
FT                   /protein_id="CBL43588.1"
FT                   /translation="MATARSILFLAGLVAAAIIHGLVTTLVAIFLNSEQRYRVAATLPL
FT                   FIKWWLHITCGISYRVIGEENIIAAPAVIVSNHQSAWETFMIQRLFNPLCPVLKKELTN
FT                   IPFFGWAVRLVDPIAIDRHRKQNALKQLLSEGCVRLNQKKYVMIFPEGTRVAPGEVVPH
FT                   FSGGSLLAVKAGVPIIPIVHNSGYFWPAHHIKKTPGVITLKIGAPIDTQSKSPKALTAE
FT                   IEAWMRREFEQLPKS"
FT   CDS_pept        complement(7588..9663)
FT                   /transl_table=11
FT                   /gene="glyS"
FT                   /locus_tag="HDN1F_00060"
FT                   /product="Glycyl-tRNA synthetase beta chain"
FT                   /note="silverDB:HdN1F6"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43589"
FT                   /db_xref="GOA:E1VFE6"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE6"
FT                   /protein_id="CBL43589.1"
FT                   /translation="MGNNVIECNDLLIELGTEELPPKALSRLMESFAHSIREYLGAQGL
FT                   AFESVRPLASPRRLAVIVSALAGQQADQTVEKKGPTLVAAYDREGNPSKAAIGFARSCG
FT                   VEFDALESIKTDKGEWLFHRSSHKGRALDEIVGPMIKSALDQLPIPKRMHWGSRRALFV
FT                   RPAHWLVVLYGNRVLPCEALGLTAGRTSYGHRFHAPDAITIESPSSYEAQLQHAYVVAD
FT                   FFARRTQIAESAHRIANEMGATLSIAAELLDEVTGLVEWPIPLVGNFDPEFLSVPQEAL
FT                   ISTMESNQKYFPLFDNTGKLLNRFITIANIESTHPDRVIAGNERVVRPRLSDARFFFET
FT                   DQKQRLEDHAELQQKVVFEKQLGSVDEKSVRNSALAREIAQVIGGEPGLAKRAGRLAKA
FT                   DLASNMVGEFPELQGVMGEYYALGQGEPKDVATAIREHYLPRYSGDAMPATLTGSAVAL
FT                   ADKVDSLIGILGIGKIPSGDKDPYALRRAAIGVLRIVVENRFGISLSMLAEASISLYSS
FT                   RLTNPNVKQDFLEFIRARIPGYFAEQGIASDTVRAVLAVSSDAPSDIMERAIGVTEFRT
FT                   YPEAAALAAANKRVRNILEKRTDNGSQAVDGALLKESAEVELFHRLAETREKLTTLRGN
FT                   YSAQLKTLAELRTPVDNFFEKVLVNAESPEVRTNRLNLLANLQELFLGIADIAELQ"
FT   CDS_pept        complement(9683..10636)
FT                   /transl_table=11
FT                   /gene="glyQ"
FT                   /locus_tag="HDN1F_00070"
FT                   /product="Glycyl-tRNA synthetase alpha-chain"
FT                   /note="silverDB:HdN1F7"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43590"
FT                   /db_xref="GOA:E1VFE7"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE7"
FT                   /protein_id="CBL43590.1"
FT                   /translation="MTQHKHDTRTFQGLILALQSYWASKGCVIIQPLDLEVGAGTFHPA
FT                   TFLRAIGPETWSAAYVQPSRRPTDGRYGENPNRLQHYYQFQVVLKPSPDDIQALYLESL
FT                   ETLGIDPRVHDIRFVEDNWESPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECFPVTG
FT                   EITYGLERVAMYLQGVDSVYDLVWAEGPFGKVTYGDVFLQNEIEMSKFNFECANVEMLL
FT                   SQFDFYEKECNKLIDTKLPLPAYEYVLKCSHTFNLLDARRAISVTERQRYILRVRTMAR
FT                   AVAEAYFEARRQLGFPLAVEDIKAEVLQKLAKNTEA"
FT   CDS_pept        11167..12219
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00080"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F8"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43591"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE8"
FT                   /protein_id="CBL43591.1"
FT                   /translation="MSEIPNNNKDVTVMFRSRSLLGLSVLCVAFLTSGCSNMVRNMAGS
FT                   GMVSFGNNYITPWFMASEDTDVMCAMGEGMAAMTFPLEPATDVMVPMLTLASGMCADER
FT                   SKEEELRYIRAMRKNDTETAQDARTMQKRWAEVAARRQYFGYQATVRHFGEPGDKCPDF
FT                   DDRNDEMSYLFGLLGGLQAFQTDLANGGTVGVPMDTMPKVFKGLECVKSDEFWGMPEAV
FT                   MAAATIMKSNIGGDKENLAAGVATLKKASAFGESQGVRMVQLMEATVYTSLGDEEKTKA
FT                   VIREHVASKKKIPPNPELKLLDEMATRGIKLISDKMWTQATGQRTPFNALGTFWDDKSE
FT                   STGLDIDDLL"
FT   CDS_pept        12273..13298
FT                   /transl_table=11
FT                   /gene="adeT"
FT                   /locus_tag="HDN1F_00090"
FT                   /product="RND type efflux pump involved in aminoglycoside
FT                   resistance"
FT                   /note="silverDB:HdN1F10"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43592"
FT                   /db_xref="GOA:E1VFE9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFE9"
FT                   /protein_id="CBL43592.1"
FT                   /translation="MKIKTVKSWLAKSIAALIAGGALAAHAAEPTPITMCAFTFMGEGG
FT                   PEHQALLDYQTAALSWGVKLTLKPYINEKIVAEELKSGVCDIANMSSVQARNFNKFTGT
FT                   LDAPASMPTYKHLQMIMGTISKPNAAKYMRNGDYEVIGIQPAGQVYLFMNDRSIQGLSD
FT                   MAGKKIGILDTMPEMRELVTGLGMTPVSSTMTNMFQKFNNGATDITGGPAIVYDLMELH
FT                   KGIGTKGGILSVPLIQSNNQFVARWSKLPEGFAQKSREFFVNNFDKNLAVIRTAEDKIP
FT                   KNLWVSLPDSRMGEYDLQTRNIRLKFRSQNIYDAKMLTLMRKVRCQLDATLGECTAADA
FT                   E"
FT   CDS_pept        13316..15388
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00100"
FT                   /product="Putative integral membrane protein"
FT                   /note="silverDB:HdN1F11"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43593"
FT                   /db_xref="GOA:E1VFF0"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF0"
FT                   /protein_id="CBL43593.1"
FT                   /translation="MTELSAEAKRANVALFSEKIPVLVILTVLVFLIFARTGESIHGQM
FT                   TKLGEYFWDDYFSLRAEPKRPTCDLQMDITARLNQLEAQASQSSDDFDDLLDSGFDREA
FT                   ARTSLENQHRVCQQQYQALEQYEARVTIWVKLFRGLEHQFSQASIFATAQQAAILLVLL
FT                   FFAAGIATHKRHHIAFRPMIWSLDFKVSTTTQFLANASLAISAWLYRSATYNSSIAVND
FT                   PFMVNGLMIGTTVLAVISLYQLFNIPKRAIPGGKVGHALLSIPLYTYVMLIFAVVVFFQ
FT                   QQHPAGLSIYFSAYFDNAGTYLDVGLYLWCGMLLKQTQIGERVFSIFTPWKLPPELLAT
FT                   VAILVMAIPTAYTGASSIIILAAGTVVYRELRKVGTRRQLALAVTAMSGSSGVVLAPCL
FT                   IVIIISILNKQVTTDALFHWGARVFLLTVVVFFIYAMIIKREPLRLAPFSKAWRPSLAN
FT                   MRPLIPYIIVFFLVSLVYSIFLEAHLDQFSAPIMLPVILFAIIVFERYFAKATPIYHDP
FT                   ERSDSVGGALTRAMSDASEHIGALLFLMATFIIMTSLGGKVVSATFITEIENKWLLMTC
FT                   LMFMFVAVGMFMESIAAIGLISLAMAPFAYQAGVNPVHFWMTCLVALELGYLTPPMNLS
FT                   HLFTRQIVGETECGKAAEEGDTFFYRHERLILPIMVMGTVLLIVTFGPVIAGLYS"
FT   CDS_pept        15589..16299
FT                   /transl_table=11
FT                   /gene="AHS1"
FT                   /locus_tag="HDN1F_00110"
FT                   /product="putative allophanate hydrolase subunit 1"
FT                   /note="silverDB:HdN1F12"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43594"
FT                   /db_xref="GOA:E1VFF1"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF1"
FT                   /protein_id="CBL43594.1"
FT                   /translation="MREYTSSTVAPKVIPLGDSAFLLYFNAQCASTAESMVLGYQKALK
FT                   VAAPAWLIELVPAPDTLYLQYDPYLLHQRGGAYAEWLAWLTALPYQPLQLEMRRSHTLP
FT                   ICYAPEFGIDLEFIATVLKLSVSEIVHLHCGASYRVQMIGFAPGFPYLTGLPAALQMPR
FT                   RATPRTRLPAGSVAVADQRCGIYPAALPGGWHVLGRTPTTLFDPNQSELCLLSMGDTVR
FT                   FVEIDLPTFKALAK"
FT   CDS_pept        16296..17480
FT                   /transl_table=11
FT                   /gene="AHS2"
FT                   /locus_tag="HDN1F_00120"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="silverDB:HdN1F13"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43595"
FT                   /db_xref="GOA:E1VFF2"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF2"
FT                   /protein_id="CBL43595.1"
FT                   /translation="MITIIHPGLLTTVQGPPRHNVQAYGVSPGGAQDLQAFRIGNWLVG
FT                   NEDDCPALEITLIGPTLRFEYAALISITGALCKITRKSQAHRYSSSTLTPWSPVLVDAG
FT                   DILIFGDMPRGFRTYLCVRGGIHVAPVLRGFGTDLKNGFGGHQGRALQKGDVISLNVST
FT                   APVHSANPEPQRATYRRVPPRFGRDAGSWSVSLWHPWYPNLGDSVLWLPYDSVAPNFKG
FT                   PAASQRQNNIPSCAQDLVNPLDQPCKVLPASDRQGLRITPIVPLPCRKVEPACSPDTSQ
FT                   TQSHVARAAPWESNSTGVCFGLIQLPPDGNPVVLLADHQASGGYPILGVVASVSRSHLS
FT                   QLRPGDKVTFRRITLAAAQKALIAQEESLRYLRLQLTHKLASLGLRDNDYFANS"
FT   CDS_pept        17467..18186
FT                   /transl_table=11
FT                   /gene="lamB"
FT                   /locus_tag="HDN1F_00130"
FT                   /product="putative homolog of lactam utilization protein B"
FT                   /note="silverDB:HdN1F14"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43596"
FT                   /db_xref="GOA:E1VFF3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF3"
FT                   /protein_id="CBL43596.1"
FT                   /translation="MQTLELNADVGEGGRYDERLMPLIQRANIACGGHAGDNASITNSL
FT                   RLTARYGVAAGAHPSYPDRDGFGRIETHATPDQIEAACLQQLRHFKALADFESVPVVHV
FT                   KPHGALYHRLMKDGAAANAFMRAVTITYGRIMIIGQPNTALEDSAALLGCPYSREMFAD
FT                   RRYEADGTLTPRTHADALITDINESIFQVRTLNSTGYVYARTGEKIALQADTVCVHGDH
FT                   DVALSLVEHLRNLVCKS"
FT   CDS_pept        complement(18236..18700)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00140"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F15"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43597"
FT                   /db_xref="GOA:E1VFF4"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF4"
FT                   /protein_id="CBL43597.1"
FT                   /translation="MTKHLLIVAHTPSENTRRMLAAMIDGAQDPAIEGVATRAVAPLKA
FT                   TADDVLSADAIILGTPENLGYMSGALKDFFDRIYYPCLELTQGRPYALCVRAGSDGTGT
FT                   RRGVETIVTGLRWRAAREPLICRGDFREEFVEQARELGMYMAAGLDAGIL"
FT   rRNA            19179..20701
FT                   /gene="16S rRNA"
FT   tRNA            20793..20869
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /note="tRNAscan-SE-score 92.90"
FT   tRNA            20884..20959
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /note="tRNAscan-SE-score 90.68"
FT   rRNA            21310..24198
FT                   /gene="23S rRNA"
FT   rRNA            24344..24458
FT                   /gene="5S rRNA"
FT   CDS_pept        24543..25343
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00150"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F16"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43598"
FT                   /db_xref="GOA:E1VFF5"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF5"
FT                   /protein_id="CBL43598.1"
FT                   /translation="MARRKCHKIQRLLPSAVSISSFARRGLSMFAGKKYRALKLYAVLK
FT                   VIAFTAVVCSTPAFSGDVVYTGVHADGSRWFSDTLPAAGVPYTTRQKPAITEPTVSDLA
FT                   TNELASSKATTKPVAAKLDTPDKEPSARASAKAHNEKPQVARSAIAEAKAEPKIVLHKP
FT                   QPKPKSQPKPVAQNPVPAVGSNAKTAIVQQKPRQRRASSVRRERIYVSTLSEREVRRCE
FT                   RYDVGLRKISARLRESHSARAGVRLHARKRDLEDLRNTECRNRR"
FT   CDS_pept        complement(25473..26390)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00160"
FT                   /product="putative epimerase"
FT                   /note="silverDB:HdN1F17"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43599"
FT                   /db_xref="GOA:E1VFF6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF6"
FT                   /protein_id="CBL43599.1"
FT                   /translation="MKLKGKTIAVTGASGMIGVYICRSLLAAGASVIGVVRNPAKADFL
FT                   AKEGVTFRKADLNDPAALTAAFQGCDAVVANAALYIVQKSMGAWDAHEKANLDGTRNVM
FT                   EAAQSAGVKRIVQISTFGIYRWSVLRTLTEESPQLNGAKRQGGAYRATKQTSEALAWNL
FT                   AQQLKLDLTTLRPTAVYGARDNNCLRPIYQLLRAPLLPMPSIRFPVVYAGDVADAVTGA
FT                   LANDVSIGQAYNVGGADIQVAELIKAIGERVPKKRRIFALPLPIGIRIDNAKAARDLGF
FT                   RNRPFAEGIQQVLKEDQLPRYLAG"
FT   CDS_pept        complement(26448..27239)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00170"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F18"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43600"
FT                   /db_xref="GOA:E1VFF7"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF7"
FT                   /protein_id="CBL43600.1"
FT                   /translation="MIAIRNPAPKKDLNKGTNSLASSYTFIWGAGLSGAFLVVLGIAAH
FT                   STAIQAINHTIAHLAFSLRTQGLDPLAISLGILGEYQPMILWATLIFIALLVQKNPRAA
FT                   SQWIAFTLLGQVILSSAKHLFQVARPHLVTTPPTSFAYPSGHTAMMLIFIGLLTSLLWP
FT                   TVAKPYRYALFLFAWLVITSAAFARLYLGVHWLSDIIGGICVGLLILCLHQIAQLRWPS
FT                   PKIKAIPVGLACLAALLINTLLFVLPEFPIWRGRYLPLGID"
FT   CDS_pept        complement(27284..28987)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00180"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F19"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43601"
FT                   /db_xref="GOA:E1VFF8"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF8"
FT                   /protein_id="CBL43601.1"
FT                   /translation="MTATSELESTGTQILVRLYNEISHLIDGNHVERSEVRNQGGRYCA
FT                   AHITYKVEWTFTPQVSEQRLYGNKATSIHFGYKRSAYDAETTHRCQLSRTHHPLRTPFI
FT                   NQILSAGGSSLSNANTSHEIWNFGQHSVHQQCNTCGGDGHVRCPSCYGSGRQSCSYCFG
FT                   SGHTTQTRWVTDHRGNGHHETYQQACYHCGCTGRVNCGHCSGSGTEQCASCRGNGFFTD
FT                   ITTVSVHATPSVQINVHSQLSAKQLLGYLTQQNTATITRHLAFSILKTQNTMDETWQIQ
FT                   YEVHTTAVELDFSLRSKTYLAAAIGPSALTYLRPPVFDDIFTEELTDLQKIEITKKTKL
FT                   SARRARTFFSTYSGQPVLDKAMQLVANLEREGFTSPSDAVNAACQGYISQASANALGKC
FT                   MKSLLDKISPPNSFWSWMLVTSIPATVLTLGAQNWLERNPISGFWSLAGVGILVVALAF
FT                   ASVLLVSPIAVTVSAATSAYRRRSVPPEYRQKPRNWQPFGRFVRITLLFGLLGAASGSL
FT                   SHHGYLPRMNNQPMQSIEQTLRLHKLPYYNQASAWMHFNGFFQPQSPTPH"
FT   CDS_pept        29042..29812
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00190"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F20"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43602"
FT                   /db_xref="GOA:E1VFF9"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFF9"
FT                   /protein_id="CBL43602.1"
FT                   /translation="MLIQKLVAYAFYPTVWVIVALVLALVLFCWGRVRGAALSVFLGLV
FT                   VLVFASMPLVAVGLWKSLEGRYPILVPSEQPKADVIVVLGGGIALPEPPQVVPDLNDAA
FT                   DRVWYAAELYHAGKAPWVVVSGGQVFPRSGLESEAEYHRKLLERMGVPAEAILVESASR
FT                   DTAGNAMLTAALMRERKFQKALLVTSAAHMPRAVLLFEHAGVDVVPASCDVHGVDMDVP
FT                   LILKLLPVAWAFQDTERALHEWLAFVYYRYFAAN"
FT   CDS_pept        29851..30870
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00200"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F22"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43603"
FT                   /db_xref="GOA:E1VFG0"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG0"
FT                   /protein_id="CBL43603.1"
FT                   /translation="MVVFFAMGSVFTAAHKRAFWLILLAMAFGLFFQAPVDSGGRWLNA
FT                   VWNYGHVVLFAGWAYVLGNFRADGGGSGRIRPSWWGALFWVVVLVVLGGLIEWLQALTG
FT                   RDGEWGDVFADCAGSVFGLSISRYGRALIGSGRARFGRYALACVVLGASGWQVFVQSVD
FT                   GVVRLATFPVLYSPNALFAVAGRLDLHNLHVMRVNQKSVAAVYENNGLHDRAEDAQLLK
FT                   VEFLPGRYSTLAIDTLRPDWRGYDTLVWRWYSVEGGLVLRCRAHDVAHEFGGFESKDRF
FT                   GGRYRLTQGWTEIEIPLESIQRAPAKRLMDLSNMRSVACFTSHLGSPKVAYLSAVFLR"
FT   CDS_pept        complement(30945..31745)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00210"
FT                   /product="Putative dehydrogenase"
FT                   /note="silverDB:HdN1F24"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43604"
FT                   /db_xref="GOA:E1VFG1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG1"
FT                   /protein_id="CBL43604.1"
FT                   /translation="MSSSATVKTALITGASAGIGKSFATLYAKNGFDLVIVARRKDALQ
FT                   TLADALKKEHGVMVHVIPLDLANPSAPEELTNTLDAKGIDIHTLINNAGYALSHSTLNT
FT                   ELVDVKAFMQVLMSTPVELCHRLAPSMIAAGEGHIINISSIAAFMPPIKGDIYCAAKSF
FT                   LLNFSLGLAAELKPAGVHCTALCPGFTFSEFHDVMGTRKAVSKLPRFMWMDADEVALQG
FT                   YQAVSQGKDIHIPGRVNQGASQLVSMLPPQIRQFFAGRQSILEY"
FT   CDS_pept        32054..32335
FT                   /transl_table=11
FT                   /gene="higB1"
FT                   /locus_tag="HDN1F_00220"
FT                   /product="Plasmid maintenance system killer"
FT                   /note="silverDB:HdN1F25"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43605"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG2"
FT                   /protein_id="CBL43605.1"
FT                   /translation="MITGFRHKGLEAFYRTGTTKGIQAAHAAKLGRILGALDVAAGPED
FT                   LNFPAYRLHPLKGELKGFWSMTVNGNWRVIFRFAGAADVELVDYLDYH"
FT   CDS_pept        32351..32647
FT                   /transl_table=11
FT                   /gene="vapI"
FT                   /locus_tag="HDN1F_00230"
FT                   /product="VapI-like plasmid maintenance system antidote
FT                   protein"
FT                   /note="silverDB:HdN1F26"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43606"
FT                   /db_xref="GOA:E1VFG3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG3"
FT                   /protein_id="CBL43606.1"
FT                   /translation="MMKNPPHPGELLREDVIVELGLSVTETAERLGMSRVAFSRVLNCK
FT                   AAVSPDLAIRLERAGVSTARAWLAMQANYDLAQAMKRPQPPVRRLFAATASPA"
FT   CDS_pept        32958..33764
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00240"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F28"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43607"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG4"
FT                   /protein_id="CBL43607.1"
FT                   /translation="MNAPFLILRWPIMKFSKLDLISKESSGAVNAASNFNHDVAHASIE
FT                   MLRACLQERMPRAVLQIGAGSLESTLAVCEALDLDAGAMLTLVEPAIYSDASCRTVLDA
FT                   LQHHGYDSSVEVVANFADQALPDFFFQEQGYDLAVLNPSGDADQNFITLYYLGKLLPKN
FT                   ALLMVYRAEDESIRPWLRRLVVENRYRVLPKEVRAQELPFLEKILRDRYQRLPARLRSV
FT                   VEDRVRSEVILPDHQLGLVGSFVVLEKLDGASAEAVDVEQMIAELV"
FT   CDS_pept        complement(33827..35134)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00250"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F29"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43608"
FT                   /db_xref="GOA:E1VFG5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG5"
FT                   /protein_id="CBL43608.1"
FT                   /translation="MSQTATLPPEVPMATERATAIPTQPHSSSPSDTETSALDTQREHT
FT                   PSPSESLNTDKPSLDNASTTLRERNERFGRDINSRIDLLETHIGQTTSLVERSQTFVRN
FT                   ALDELRERMTQALHEIEKRITQQQNENEASRQKLEQSQTALKKDLTDLTDEHNATIAQV
FT                   EAVAEQAYSAHQRINQQHRYTQTQIVQLGIAATAGIGLCLLLIGYFVYNPVAAPEEIKG
FT                   KLQILSADAQLQKNQTTQIGNQLAQMEAQQTSTDATLTGLQSEVGGLKSNETVLLDRHQ
FT                   GQQNEISKLRSEINRLEQNLTQLQRTTTQQRAVAQRTTATASNTISTRPPAAQIPALLF
FT                   RDGHWLNSRPSQHYVIQLASSGSRANLTQFAGSHAAILRTQPLTLTTSRRNAQTWHHLY
FT                   YGDYPNELSARTALSHLPASLRQNQPWVRQIASLAR"
FT   CDS_pept        35303..36307
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00260"
FT                   /product="Aminoglycoside phosphotransferase"
FT                   /note="silverDB:HdN1F30"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43609"
FT                   /db_xref="GOA:E1VFG6"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR032882"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG6"
FT                   /protein_id="CBL43609.1"
FT                   /translation="MSDELEEYARLSPEDVILAVESVGFLSDARILALNSYENRVYQVG
FT                   IEESDPMVAKFYRPSRWTDAQILEEHAFVAALVDAEIPVVAPWVKAGSGADGAGSLHHY
FT                   QGYRFALFPRKGGQAPEPGDLDQLYRIGMLLGRMHAVGRKQEFSVRPRLSLERYLETPI
FT                   AAVCRDGFLPATLCDRYRKITDTLRIKLNALPWEAVQWIRTHGDCHAGNVLWTRDDGPW
FT                   LVDFDDCQSAPAVQDLWMMLTSSRLEQELQLAELLEGYSTFCEFDRREIALIEGLRSLR
FT                   MVHYAGWLASRWHDPAFPRHFPWFNTQQYWQQHLAELELQCLQLDEEPLRCLG"
FT   CDS_pept        complement(36354..37310)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00270"
FT                   /product="Predicted regulatory protein, MerR family"
FT                   /note="silverDB:HdN1F31"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43610"
FT                   /db_xref="GOA:E1VFG7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG7"
FT                   /protein_id="CBL43610.1"
FT                   /translation="MNSTPNQPSQNQSAPSKNAHSENTQSNSTQSSSTQSSSAPSNLAD
FT                   LLETLQQDASSNEGEKNPPQEFTIDQLAQAAQTTVRNIRAYQDRGLLHPPRRRGRVGIY
FT                   SEMHLARLRIISQLIERGYSLASIGDLITVWETDRPLGDVLGLEVAITTAWNKEAPIDI
FT                   GFAQLLNDFQGVITQDDIQQIIALGYVAVHGNEIHILKPRIYNAAKELVAAGIPISDLI
FT                   KHVSLVRADIERLAERFVDMALYHLIDKKYATDGLPDGEGAANLAKLIRRTPALADMIV
FT                   DTEIERLLDMTINNALVQRLERVLKAQSQARKPTQPD"
FT   CDS_pept        37490..38431
FT                   /transl_table=11
FT                   /gene="argC"
FT                   /locus_tag="HDN1F_00280"
FT                   /product="Acetylglutamate semialdehyde dehydrogenase"
FT                   /note="silverDB:HdN1F32"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43611"
FT                   /db_xref="GOA:E1VFG8"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR010136"
FT                   /db_xref="InterPro:IPR023013"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG8"
FT                   /protein_id="CBL43611.1"
FT                   /translation="MGIPSIFVDGEHGTTGLQIVERLASRKDVQLLSIPHEQRHSAPLR
FT                   KEFLNRADVVILCLPDEAAREAVSWIENPAVKVIDASTAHRVHPDWVFGFPEMARGQRE
FT                   RIVASSRVANPGCYSTGAIALLRPLIESGALAAESAVNILGVSGYTGGGKALIGAHEGS
FT                   DPEPFAFYALGLAHKHVPEVLQNAGLRVKPVFLPSVGHFPTGMLVSIPLHASQLSVGAE
FT                   RIAQIFADWYAGERFIQVAPLNDQAHLVRGAFLRADSLSGTNNLEIFVYASTSGEELVV
FT                   MARLDNLGKGASGAAVQNLNLLLGLPEARGLE"
FT   CDS_pept        complement(38458..38778)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00290"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F33"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43612"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFG9"
FT                   /protein_id="CBL43612.1"
FT                   /translation="MNEEVSIDDLEEPSDTDLTAESAATSDDLTNDEVIPAARKLPDYN
FT                   HHGGVGDSEEAMQEGANLTVSAKNAERAALEEAMQRFLAGGGKIQTVPPDASARAKAAP
FT                   SQ"
FT   CDS_pept        complement(39066..42707)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00300"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F35"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43613"
FT                   /db_xref="GOA:E1VFH0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH0"
FT                   /protein_id="CBL43613.1"
FT                   /translation="MHVQSLQTLARHKRTSVFLAFLLFALFSATVAGMLGVLTAPSSAA
FT                   LPWFEFLHRAGAACLGASLLLASQPFLNIELRGTLRWFALACLAYGSASTLDTLSQGRL
FT                   TQTLIEPYNLLHLLTGLLITAGIAHWGWPQLDRLTRRTVVLDTATLLAATLTISFLWHS
FT                   PLAEQISPNHIISDLVYPLTLALPVVFGLVLTLTLRTRIHWSYVAVFFGCSALAILHAN
FT                   AWLQILTHNLFTQQMSRIGESAALLLIAGAASKLQLNASYAPQTTRLYSKILRGIPTII
FT                   VVFTCIGAMQTLLAHNSSPEASNIVIAGTALTLLFAMTRQSDILNEHNRLLYTEKALRE
FT                   EELHYQALLESSTDGILVWLDGRIVDCNHTAPQLFGISRNELIGKSVYELSPELQASGE
FT                   LSEEQAQKLFVRGANAQKLSFEWRHTRGDGTAFDAEITLRQLGSNKQRFISVTRDISER
FT                   KNAEREIRHQTQLLQATLDATPGIFMVINPDGQLIEYNAQFLADLEYTSEEAKHLRISD
FT                   FCSPEDCSKVAKTIEQILTDSNSSEANTNTLEIRLTTKHGQTFPVLLSTSRAISNSEKH
FT                   IVAIAVDISVRKLLENELQEFQTELVHSNNSLRLLNLLSSRLNAISDISEIAWETIEVL
FT                   RILGKSDIGMFYLANTDENMLDLLAYNGELQDTEIEPYRQTRLQNTLSGLAIQSGNVLH
FT                   LSEVLPKAQEFPLLSLLLKEHQIGDGVLIPLHLHQRVIGTIALFFHTPRQQQLQDDTLE
FT                   AIGKTVSLAITNARHLRELEHQANHDNLTHLPNRQVLHERFASALNANPSPRRMALMLL
FT                   DLNRFKEINDTMGHHAGDLLLQQTSRRLARIAETYHVLACRLGGDEFTLLMPTYENQQE
FT                   VLTLAENVANTLRHPLLINGQNVQICASIGVALYPDHGHDSHTLLRAADTAMYRAKRQG
FT                   ADIVLYQAQDQYSPEQLSIATALNQAIEGRELVLHYQPKIALNSKTITGMEALVRWQHP
FT                   TLGFLYPESFVPVAEQGEAIHKLTYRILDMALAQQKEWKRLGYRISVAVNLSTRSLANE
FT                   RILEMLSELLDKHGAVSGDLEVEITEAALMQDPDFSAKLLHDIADMGVALSIDNFGIGF
FT                   SSLSHLRHLPISTLKIDRKFVQKMLDNDLDALMVRSTIGLAHNLNMTVIAGGVEDDQTC
FT                   TKLELMGCDVVQGHFLTQPRTWPDLCHWLDESYLELAKAPHSPSQLH"
FT   CDS_pept        42996..45416
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00310"
FT                   /product="Fatty acid cis/trans isomerase"
FT                   /note="silverDB:HdN1F37"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43614"
FT                   /db_xref="GOA:E1VFH1"
FT                   /db_xref="InterPro:IPR010706"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH1"
FT                   /protein_id="CBL43614.1"
FT                   /translation="MRVSNHRRRLIPLLVVSFVVVVVGFAVFVVSSGPLAAKDLVVQAQ
FT                   TAHPLVERIVSPTTASRVEREAAVFYDQQVRPILDQRCVVCHACYDAPCQLNLSSPEGI
FT                   DRGANKQLVYEGTRLRPADPTRLGLDAQTTLQWRNKGFYSVLDVDLPARESAPLLRLLR
FT                   LKQKHPLPQGDLLAPEFTLGLDRQQSCPAPSEVDRFEQEHPSWGMPYGLPGLAASEFAV
FT                   LTRWLEDGAMMSVPAPLSVALAQQVTRWERFLNGDSLKQQLASRYIYEHLFLAHLYFDE
FT                   VRGPAASRSFFKLVRSRTPPGQPLSIIATRQPFDDPGVERVYYRFQRDDTSIVSKTHMP
FT                   YVLNGAQMEWMKSLFLVPNYTVVKLPAYDAESISNPFLSFRDLPVESRYRFMLEQAQFT
FT                   VMGFIKGPVCRGQVALNVIDDHFWVVFVSPKEENSHTLERFLLEQGKNMGIPNAEERGI
FT                   GGTAKAWVAYSLKQREYLAARSKMLNNFFSTNHKISMDMIWDGDGHNPNAALTIFRHFD
FT                   SSTVEQGLLGQAPKTAWVISYPLLERIHYLLVAGFDVYGNLGHQLNTRLYMDFLRMEGE
FT                   VNFLAFLPREDRDALRKFWYRDTRFEVNDFVFKPALHFDRDTGIVFQSSQPKLEFYEML
FT                   KDWLAPVLNHRHDLDLRKLPYNQGYALARINHVAGKRASLFPELSMLLVEGEGHEDQVF
FT                   TLIRNSGHSNITSLLNENGQRLPEEDYLTLLKGVVGSYPGAFLRVKEGELNRFVNALEQ
FT                   VDSEAAYAAFLGRYGVRRTASDFWVVSDRFHALYFLENPVEAGLLDFNRLENR"
FT   CDS_pept        complement(45353..47371)
FT                   /transl_table=11
FT                   /gene="topB"
FT                   /locus_tag="HDN1F_00320"
FT                   /product="DNA topoisomerase III"
FT                   /EC_number="5.99.1.2"
FT                   /note="silverDB:HdN1F38"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43615"
FT                   /db_xref="GOA:E1VFH2"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH2"
FT                   /protein_id="CBL43615.1"
FT                   /translation="MKLYIAEKPSLARAIAEALPRPHNRQDSCIQLGNGDCVTWCIGHL
FT                   LEQAEPDAYDAAYKKWQIAHLPILPEQWQLQPKASTRKQLSALRTLIQSADQLVHAGDP
FT                   DREGQLLVDEVIHYFKVPAAKRRNMQRLLISDLNPTAVARALTQMRSNQEFTALSTSAL
FT                   ARSRADWLYGINMTRAYTLQGQSAGYQGVLSVGRVQTPVLGLVVRRDQVIANFISVPYY
FT                   EVLAHLLTPAPSETAPSLADPAHPTDSARFTARWQPSEACKPWQDDEGRVLNRALAENV
FT                   ARRITDQPAHVESVEKIPRKLSPPLPYSLSTLQIDAGRRYGMSAQQVLDGCQQLYERHR
FT                   LITYPRSDSRHLPEDHFAQSNDVLRAIASFGEPLQSACRHANPTLRSKAWDNAKVDAHH
FT                   AIIPTEKPPQTQSLSDVERKLYEQIARQYVAQFYPAHRYLETQLALRIAGGLFTASARQ
FT                   VQEIGWKTLYARETGHAEDTDALTEIPPLNPGDILHCERGELQEKQTRPPAHFTDASLL
FT                   SAMTGVSRFVKDPEIRKILKETDGLGTEATRAGIIELLLKRGFVQREGKTLRATPTGTA
FT                   LIEALPESATLPDMTAQWESALEAICQQKIDYHAFIQPLIETLRTLIEQSTQTSPRSFS
FT                   GLNAPKHTQRTKRKQPAQRFSKRLKSKSPASTGFSKK"
FT   CDS_pept        47476..48003
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00330"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F40"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43616"
FT                   /db_xref="GOA:E1VFH3"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH3"
FT                   /protein_id="CBL43616.1"
FT                   /translation="MTTQTPSQKTVAPRDAAIEHYLSQLCLKGIVATIVLIIIGMATEV
FT                   QNHVDLEIVTVWGGSVGALVAFLVSATALRNKAASRENGALWGILAMLTAIYPLLLAPY
FT                   FGLYVGAGVLLVHDLTGGNYLTGLVRVITCVCSYYVFRDALRLILATRHFALQSPRLEA
FT                   VIAELAYESRHQ"
FT   CDS_pept        48464..49525
FT                   /transl_table=11
FT                   /gene="oprF"
FT                   /locus_tag="HDN1F_00340"
FT                   /product="outer membrane porin f precursor"
FT                   /note="silverDB:HdN1F42"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43617"
FT                   /db_xref="GOA:E1VFH4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH4"
FT                   /protein_id="CBL43617.1"
FT                   /translation="MRNLKIKSLALGVAAAALVGGVAHADQILINPGVAWYMNDADRGL
FT                   KNREAYVLGLEYIYADRFGVEVSGSFSQPKWKAANRGLGEDPDHIAYDANLLYYFGKSG
FT                   DRLRPYAAFGVGDGRWEFDNTDWVETDVNLGGGVRYELAKNVSLRADARVVHGTDESTF
FT                   DGRALLGVSYAFNVGPDRTKKAAAPVAEPAPVVEEPRDSDGDGVLDSADRCPNTRAGAK
FT                   VDANGCELVKTVMESIRLNVQFATGSSAVAPRYHAEVQKIADFMKKYPDLTVTIEGHTD
FT                   NTGGAALNERLSSARANSVREELVNRFGVAANRVTSVGYGPSRPVASNATAAGRQENRR
FT                   VVAVLEKEVSAGQ"
FT   CDS_pept        49858..51129
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00350"
FT                   /product="predicted beta-lactamase protein"
FT                   /note="silverDB:HdN1F43"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43618"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH5"
FT                   /protein_id="CBL43618.1"
FT                   /translation="MIQGFVHPEFSPIADELARMIPADGRSGAAISVYHQGECVVDLWG
FT                   GCRDRAGNPWERDTLALSFSTTKGVESTLLHVLADQGLIDYNQPVKHYWPEFCQGGKSA
FT                   ITVAHLLTHQAGLYDIRSLIDDASRMTDWEYMAHHLAAAAPCHAPGSTHGYHGLTYGWL
FT                   LGELIQRVTGQSFAQVLKEQLADPLQLDGLYVGLPEEEFGRRAMLRSFPRSSQPKPTLE
FT                   SRRPMGPIRQFQSGVQRTLLKHASRWVTIDGFAMLKGLVPHGIARLSFNDDQVVSACIP
FT                   SANGMFTARSLARMYAMMANGGELDGVRLMSPQRVALISQVRSRRFDKVVPLPMHWRLG
FT                   YHRVFTTGPRTPNAFGHFGFQGSGAWCDPSRQLSLGFTVNSTAGSTPFGDARIAKLSAR
FT                   AIEAVERMQGVRVLQRAGAIPYAS"
FT   CDS_pept        complement(51164..51838)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00360"
FT                   /product="Putative heavy metal response regulator
FT                   precursor"
FT                   /note="silverDB:HdN1F44"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43619"
FT                   /db_xref="GOA:E1VFH6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR006291"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH6"
FT                   /protein_id="CBL43619.1"
FT                   /translation="MKILLVEDEPKTGDYLKQGLCEAGFPTDWVQDGISGSHQALHETY
FT                   DLIILDVMLPGRSGWEVLQDIRSAGKDMPVLFLTARDEVNDRVRGLEAGADDYLVKPFA
FT                   FAELLARIRTLLRRERSREPDVLNVADLELDLRTRRATRSHQRIELTAREFALLALLMR
FT                   RRGEILPRALIASQVWDMNFESDTNVVEVAVRRLRAKIDDPFEPRLIHTVRGMGYTLEE
FT                   KR"
FT   CDS_pept        complement(51894..53174)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00370"
FT                   /product="putative membrane protein involved in aromatic
FT                   hydrocarbon degradation"
FT                   /note="silverDB:HdN1F45"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43620"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH7"
FT                   /protein_id="CBL43620.1"
FT                   /translation="MPQVSRILPKTLVLALGVSTAPFALATNGYLPHGYGVAAKGAAGA
FT                   GIALAQDTLSAASNPALLLSLGNRIDFGLDVFSPRRGSSITGNAFGPDQRVNGNDDDDF
FT                   LIPEFGYTQQLNPDLAFGLTVNANGGMNTGYERNPYARFGATGPAGIDLAQMFLTPALA
FT                   FRFAEGQSLGVGLNLAYQHFKAYGIDTFGQFSSDPLHVSNKGYDSSSGVGARIGWHGEF
FT                   TEQLSAGASWQSKTRMSEFHSYKGLFANAGDFDVPEHYTLGLAFKPIPALALLADYQRI
FT                   NYSDIPAVGNSVSSLFAGKPLGSHNGPGFGWKDVNVKKFGAVYTVSPTLTLRAGYSDMN
FT                   QPIPASETFFNILAPGVMEKHYTLGASFALTNHASFSTYVAHAPKVSIQGNNSIPPGMP
FT                   NQGGMGGGNANLHMYQNAIGFAFQQTL"
FT   CDS_pept        53528..54772
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00380"
FT                   /product="putative outer membrane protein"
FT                   /note="silverDB:HdN1F46"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43621"
FT                   /db_xref="GOA:E1VFH8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH8"
FT                   /protein_id="CBL43621.1"
FT                   /translation="MRWGGAKISLQQVALALWVLASPVLAADEPAQRWEALLGAAQKLA
FT                   TETVRIAGDEKVQAARAREAARWLPQAPELSVSHRTDQWLSDLGGREWEVELAAPLWQR
FT                   GQRSTLQKLSSDGLRLLEAEKARLEWSLAQKLNEAVWLVREQGAKLQAAQARFAVAEKL
FT                   SADVQRRVAAGDLAETDGLLAQGERLAALAEQEDARVALQGARAQLGLLVGSSNVELPR
FT                   TDFRSVDREAPHFSYENHPRWQEAHARFAIARLEFENTRFGGEPVKAGISWTQSKDTSD
FT                   EVAQRMVGVSVSIPLGGQSRQALSRAEANTAMVSQEVELARLRAALTATFEQAIRARSS
FT                   AARQAEQIAEQLALSERTVALSKRAFEVGELDLPAWLRLQQSASEIALQSELKSISLSR
FT                   YEFDLRLAQGQIPWR"
FT   CDS_pept        54778..56244
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00390"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F48"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43622"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFH9"
FT                   /protein_id="CBL43622.1"
FT                   /translation="MEQNNLRRFAWLTVIAVIAGAGFFWMPQIALAHGDEDHGEAAPQM
FT                   AQGPLLPRFSASSDALEVVGVLRGKEVDLFVDNAKTNAPVSGLSIEISADEFSVRATEV
FT                   AAGEYRAELSWLGKPDHYPLIFVVDGEMEGDAFSDLLEATLDSVDMPALITPAMTKPAS
FT                   MRLADGQVAMYKATQHLLGIRTLPARFEDTRRAIALNGKVIADPTASGVVQTIQAGRIG
FT                   APEAGFPVLGQRVKAGEVLAWLEPAISSLERANQEAALAELDAQLKLAHSRSARLESLR
FT                   GSVPNKEIEAAKVEVHGLEQRRRALAASVGQREVLRAPMDGVIGTANVVVGQVVNAGDT
FT                   LFTLLQPNRLWVESLAYDASPLQKSAAARSEGVTFSLAEISRGAVLQDQAVPILYRILP
FT                   PVPAIPVGQPVTVLAESQTQVNGVIVPSEALMRNGQGEWIVWLHDAAERFRPMLVQWEA
FT                   LDGARSLVRKGLHEGDRVVIRGAASLSQVR"
FT   CDS_pept        56253..59363
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00400"
FT                   /product="Heavy metal efflux pump CzcA precursor"
FT                   /note="silverDB:HdN1F49"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43623"
FT                   /db_xref="GOA:E1VFI0"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI0"
FT                   /protein_id="CBL43623.1"
FT                   /translation="MFRQIVRISLQQRGIVLALALLLMIYGGITLSKMPVDVFPDLNRP
FT                   TVTVMTEAPGMAPEEIEQRITFPLETALNGMPGVSRVRSVSGIGLAVVYVEFEWGTDLF
FT                   RNRQQVAERLTLVNEQMPKGVVPQLGPVSSIMGEVLLVAIASEGASPMDLRAFADWTLR
FT                   PQLLTIPGIAQVIPMGGEIRQYRITPDLIRMQALNVSLEELELALAKLGDNSSGGFLDH
FT                   MGREYLIRNLARTTKLEDMRNLVIGHEDTHPVLLRQVAEVDFAAANKRGDAGFNGKPAV
FT                   ILSVQKQPDGDTTALTQKVEHVLAEMASRLPEGVGKPAVLFRQANFIEASIDNVETALR
FT                   DGAIMVAVVLLLFLLNVRTTVISLVAIPLSVLTSALVFHWMGLTINTMTLGGLAIAIGE
FT                   LVDDAVVGVENTMRRLRQEPSANLVRTLEIVLDASVEVRSAIVYATLIIVLVFIPLFAL
FT                   PGMEGRLFVPLGIAYIVSILASMLVSMTVTPVLSYYLLPATIKKSLAAGKVEGDSPLVR
FT                   VLKRADRHVLTASFQHPRYVLACAALSVVAAAALVPSFPRAFLPAFNEGTLTIGVLLHP
FT                   GTSLSESNRIGSLAEALILEVPEVSQVGRRTGRAELDEHAEGVHSSEIEVDLKPSERSR
FT                   DEIMADIRQRLTVLPASVSIGQPISHRLDHLLSGVRAQIALKIYGDDLDTLRGLADGLQ
FT                   QKMARIPGLVDLQVEKQVLIPQQQVHLDYSRAASLGVTPGAIVQALETLVAGATLGEVM
FT                   DGQQRFEIVLRVADADRTLQGLSRLLIETPNGRVPLSQVADIEDAVGPNQISRDNGQRR
FT                   IVISANSDGRDLAALVEEIRELLDQTSLPPRYSFSLEGQFQAQEEATRVIAGLALISLA
FT                   LIWLVLYSRYKSTRLALMIMGNIPMALVGSVVALKITGNALSVASLIGFITLAGISTRN
FT                   GILKISHYIHLARFEGETFGKEMVIRGSLERLVPVLMTALVAAFALLPLLFEASAPGKE
FT                   ILYPVAVVIFGGLISSTLLDTVVTPVMFYLWGEKPLLACLQDQDSNH"
FT   CDS_pept        59375..59845
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00410"
FT                   /product="Hypothetical protein precursor"
FT                   /note="silverDB:HdN1F50"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43624"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI1"
FT                   /protein_id="CBL43624.1"
FT                   /translation="MKSSRLFAMVAGVSVSALLSAGLAYAHSNEYLATITGPHGGMVRM
FT                   VGPSHFELVVTPAALQVYVTDHGDNARSVEGATGSVMMLSGKSKQQIELQPKGGNLMEG
FT                   AGSFSADQTFKAVVKIHLAGQQVGQVMFDSSAKVSLQEGAAMSGADHHHGSH"
FT   CDS_pept        59855..61243
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00420"
FT                   /product="Heavy metal sensor kinase"
FT                   /note="silverDB:HdN1F51"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43625"
FT                   /db_xref="GOA:E1VFI8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR006290"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI8"
FT                   /protein_id="CBL43625.1"
FT                   /translation="MNTSITSRISLLFSTLAVLVLLAMGYVINASVEHHFEVQDRMALE
FT                   GKLALLQHLLAEPSLDVASNLSLHERIDDALVGHHELVLRLEATNGTLVFESSHAPPNA
FT                   FLEGVFEPYSEGAFQLHDLSLEHHRFRAVMVLISAPVSGENYRVFLAIDRSIHDTFLEN
FT                   FHQQLIAVGALGLALICLFGWLATRHGLRPLTSMAQVAEGISAQKIQARLPMRHLPAEL
FT                   HSLGNSFNEMLDRLEAALARLNDFSSDIAHELRTPITNLMTQVQVSLSRDRSAEEYREV
FT                   LYSSMEEYERLAAMISDMLFLAKSDNDQIVPRQEALDLRREVDALFEFYEPLASERGLQ
FT                   LACTGEAKLWGGRLMLQRAIGNLLSNAVRYAYADSVIEVLLRQAGASVSIELSNQGDTI
FT                   PPETLSQLFSRFYRADAARHRSDEGAGLGLAITRSIVLAHRGSITVRSEQGVTRFEILL
FT                   PSGG"
FT   CDS_pept        61279..61785
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00430"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F52"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43626"
FT                   /db_xref="GOA:E1VFI2"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI2"
FT                   /protein_id="CBL43626.1"
FT                   /translation="MQGEVSGIVERMFTHQGLGIRVMTAADYCLLAAGVFFMTGLLTGV
FT                   WKYRKMMTSVDTLAPVYVDIAHRASLMYSFAAILMREFVPYSPLGETATSWAVGIPLLF
FT                   FGSAIITYITHGFLQDTENQLARPHVLGSGHLPGFLVQGYMVALIVGEIGGFAVLFWGF
FT                   LKAVL"
FT   CDS_pept        61807..62220
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00440"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F53"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43627"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI3"
FT                   /protein_id="CBL43627.1"
FT                   /translation="MALEIKTLPEHLPWDARSTLFANGNHTFVGLDWPEGVSAAYQTRL
FT                   LWRPALAPTLTLERDYAQDGDFERYRSAYRRQLAAHPEYWQPLLGNLGALTLWTVQRDL
FT                   AHSHVSLLADWLEDEYAEQEPPSSPVCYRDLPP"
FT   CDS_pept        complement(62236..62742)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00450"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F54"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43628"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI4"
FT                   /protein_id="CBL43628.1"
FT                   /translation="MGRITNWIIGIAKSLIKESDVEVLVKSVTDTLKERPNFVPQLVSH
FT                   MDTKLIAKLANDVLRSNPEFVAGIVKGLDFHEIGRVVNGALRENPDLVPNLISTLSTDL
FT                   IADAVNRSVHKHPEFSADLVGRLDPAFVANVVNLVLDRNLEFASTMVDRIDRAKLESWR
FT                   SKLIH"
FT   CDS_pept        63227..64534
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00460"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /note="silverDB:HdN1F55"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43629"
FT                   /db_xref="GOA:E1VFI5"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012806"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI5"
FT                   /protein_id="CBL43629.1"
FT                   /translation="MSTAIPYRNSNGRVAIVDAVRTPFARIATAYRDLNAIDLGVLVVK
FT                   ELIERNQLNAEDVQQLVFGMTVMIPEAPFIAREIALQAGYPKMDAYSITRACATSFQTT
FT                   ASLADNILAGYTDIGIAGGTDSTSSVRIPLSSKLSSTLRDVNFAKTTQDKLKLLAQLKP
FT                   KDVLPQRPSITEYSVGETMGESCEKMVKKWGVTRAEQDDLAHASHSNAARAWAEGRMDK
FT                   QVMEVHLPDGKTFREDNLIRRNSERGSYDKLKPVYDTTSGKGSVTAGNSSPLTDGAGAL
FT                   LLMSEARAHALGYKPLGYIRSYAFAARTPRDDLLMGPVLAAPMALERAGITLADLTLVD
FT                   MHEAFAGQVACNLRGLNDAEYLKQNLGREMPTGEIDRSILNVNGGSVAYGHPFGATGAR
FT                   VIMQILYELQRRGGGLGLTTACAAGGIGAAMVLESA"
FT   CDS_pept        complement(64623..64964)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00470"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F57"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43630"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI6"
FT                   /protein_id="CBL43630.1"
FT                   /translation="MLGGFSMQRRWLITLAIAGSALLLTANSGAAEIYTFGKRGDGSRF
FT                   VRQVDRPIERRTEAEANNAKPAGQTPARSSLSRPNGASTGRVPPPLPRELLPPPIPNAQ
FT                   ALQLLDQPI"
FT   CDS_pept        complement(65125..66774)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00480"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F58"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43631"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFI7"
FT                   /protein_id="CBL43631.1"
FT                   /translation="MERNHHPPLIQALLQAERHSDSIEQMELIETHISWVLLAGDFAYK
FT                   IKKPLKLEFLDFSTLALRKHYCEEELRLNQRQTHGLYLGLCAITGSPLQPKLEEHNAQA
FT                   QAFEYAVKMRRFKQSDLLDQRLAHGALEQDEITLISRTLHTFHQAIHAAEKNSNFGTPT
FT                   CIRRYSEENIAEILPALGASSEDQTDRSELLAYQSWLDRQHKMLSPLFSSRKETGFVRE
FT                   CHGDLHLGNILLEGSVVQLFDCIEFNPELRWIDVISELAFLAMDLDHHQRPDLAHWLIN
FT                   DYLERSGDYAGAQLLPYYLAYRAMVRAKVAWLQRNQKLALSKSKIANDVHLNSLRQSAS
FT                   HYLHKAWQYAFTRKPCLLITHGFSGSGKTTHTHALVKRLGAIRLRSDVERKRIFADLVK
FT                   ENNAEKSSTEGTHTSTQLYAPSVTRATYAYLQEQAAALLNAGFPVIVDATHLQRWQRNG
FT                   FREVAQALEAPFTILHFNAPTPVLESRIRERQRQGTDASDATIEVLRQQIRHYEPLQDD
FT                   ELSSVFEFDTEKSQPSDPHYSAVWDGLLSRLA"
FT   CDS_pept        66934..68193
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00490"
FT                   /product="SMF protein"
FT                   /note="silverDB:HdN1F59"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43632"
FT                   /db_xref="GOA:E1VFP0"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP0"
FT                   /protein_id="CBL43632.1"
FT                   /translation="MPARIAPTPDLPLRLALQRAPLLGPATFRDLRAAFGAPEDWHRVS
FT                   DNALRSVVSRHQWPVLANLLASSAGDQPGVARDLAWLAEDRHYVVCIDDAAYPVLLRQV
FT                   RDAPPLLFVHGELASLRMPQLAVVGTRHPTRAGLKDCASFSKHLVGRGLAITSGLALGV
FT                   DGAAHFAALDAGGVTLAVLAHGMHQIYPARHRVLASRIAETGALISEFPVGVEAQPEYF
FT                   PRRNRIISGMSLGVLVVEAAIRSGSLITAREAMEQGREVFAIPGSIHSPLARGCHHLIR
FT                   QGAKLVETGEDIVEDLGPLLSMVLPGLSAFVRETASALEASEGKLRRAKELAAEPETED
FT                   LFTTAEAHTPKGLQATTKPSENHDTPEGRILALLYAEPHSVDDLVERTELGTAEINATL
FT                   MMLELEGRIVQMSGVYQAIA"
FT   CDS_pept        complement(68198..70945)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00500"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="silverDB:HdN1F60"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43633"
FT                   /db_xref="GOA:E1VFP1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP1"
FT                   /protein_id="CBL43633.1"
FT                   /translation="MANASLRLQPQDFSHIDRSMALSFGLLITSLMLVALVAASGYLRT
FT                   AMDREQSRLATLTTEVLADALSRVSFAGKYQARLLIEKLQKDEDDIAYIRLIDTHGVII
FT                   ASSTSSENGLPASNQELEHIKPLLSESTTIRVRKLSIANLGIVREIGVMYYGGFNNQTQ
FT                   GVLLVGISESSIEKSLYHGLLYTAFLLFFLAFIGIIVTLRMSRHFAAPTRELAKEIAYE
FT                   RTRLESIVDAIHCGTWEWDTSSDQFILDERWAEIIGYRLDEMAPITSKTPLKLAHPDDA
FT                   PMITARLRAHLCGETERFHTESRARHKDGHWVWVEDSGRVTERDALGAPLKFMGARQDI
FT                   SARKQAQEDLRRESERFIALAKVSDTGVWEWDAKAQYLWCSHEYFSMLGLSPANFDLTG
FT                   KPNLENTWATLLHPGDKDQATEAFARYLAGEKTSLYENTFRMRNAQGGWVWILSKGRTL
FT                   RDANGRFTDKTLGTHINITSLIEAQQSLEENQERLKRISDNLPDCALYQIDCGKHGETR
FT                   HFRYLSEGIERIHQVSVKDVLADSSILYKQALPEYQQIVADKEALCIQQMKEFRIEISS
FT                   IMPDGSQRWFMVISSPKRLSDGHIIFDGIEIDITERKRQEQQIRELNATLELRVEKRTT
FT                   ELQNALTTLQRTQNELIQNEKLASLGALVAGIAHELNTPIGNAVMLASALNQNQNNFRQ
FT                   KIESGLTRTALSEFVSEVAESSAIIERNLERAAELIRSFKQLAVDQTSYQRREFSLKGL
FT                   THEIALALHPSLRKTTIQLIDQVPEDLHLDSFPGPLGQVLINLINNALVHAFEGKAPNG
FT                   RSDEGGASNRISLNAELIRSGWMRLNVSDNGIGISPENMRKIFDPFFTTKLGHGGSGLG
FT                   LHITYNLVTGILGGKVEVQSDVGKGSCFILDLPLVAPALEQKPE"
FT   CDS_pept        complement(70945..72003)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00510"
FT                   /product="D-ribose periplasmic binding protein precursor"
FT                   /note="silverDB:HdN1F61"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43634"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP2"
FT                   /protein_id="CBL43634.1"
FT                   /translation="MRFFTPLLLLALLSLNAYAQTDAQAKTPWSIGVLYWSNTIAGQIA
FT                   MRKGLEEEAEKINREAKSTGKRPIVLTSKIAGDGPQGIENQIQQMVQLVATKPDAIIVQ
FT                   PTDNAALAGPLIAANRAGIPVIAYDQYISEGTLASFITSNNDQAGRLGGEYLASLFPDE
FT                   KPMQLVLVEYPSVSSTVERLNGFLDALQERGQAYRILASFQAVQPEEGARAAHAILKQF
FT                   PDKGSIDAIFTVNDGGGLSVVDILAAAGRTEIVVATVDGDPASVANIKAKRLTRIDSAQ
FT                   FCGPLGATAMRTTYQVLLGKKVSPQILIPSFPITTQTLTRYPGWAGPIPAAFQKPWPSR
FT                   TPLWQNRLVEAP"
FT   CDS_pept        complement(72011..74197)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00520"
FT                   /product="GGDEF"
FT                   /note="silverDB:HdN1F62"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43635"
FT                   /db_xref="GOA:E1VFP3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR021800"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP3"
FT                   /protein_id="CBL43635.1"
FT                   /translation="MENDGDMLHFVEEQEQPAHNLAPCWQILLVDDEPDVHTATKLALK
FT                   NLTIEGRPLRFSHAYSAAEARAMLADYGNFAVAIIDVVMETDRAGLELVRYIRETLNNQ
FT                   ALRLILRTGQPGYAPELSTIAEYDINDYRTKTELTQARLFTSLTIAIRSFEQIHQLEAN
FT                   RQGLEQILAAAGELSKPIGLQKFATGIATQICALLKVDAECLVCAAMHEPEHSPYVLAA
FT                   AGKYSKWIGLPLENLPDASVKALLEKSLTSRQHLYEQGACLYFRGADDQALAAYVQTAQ
FT                   PLELLERRLLEVFCSNISGAFENLQLYLTISELAYNDSLVGLPNRNALISALENDPVQG
FT                   QCLALLDIDSFSDINSILDDRFGDEVLKAVAARLRTSFSEATFVARLSSDLFALYGSAT
FT                   QVHPKSIAKIFAEPFLIFGQEALRLSATSGLVLLTGSDALGVELLKNAGAALKQAKRHA
FT                   RGKAIYFKEAQSAAARDRIKMLNDLRNAVSAHTLELYYQPFVRLKDRAVIGAECLLRWK
FT                   ATNGKFISPDTFIPIAERSGLMVPIGDWVTKTALRWRKRLEGKFADDFKVAINVSHVQF
FT                   SEPNFVAKMLAALDEAGVPGHHVEIELTESIAIENLELLQARIEMLRTANIHLSMDDFG
FT                   TGYSSLNVLQHMHLDRLKIDRSFVSGDASDDFNMVRTILAMAGHLNLNTIAEGIETQAQ
FT                   LDLLVKEGCDDGQGYFFSKPLPEAEFALWLANFR"
FT   CDS_pept        complement(74219..76345)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00530"
FT                   /product="PAS/GGDEF domain protein"
FT                   /note="silverDB:HdN1F63"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43636"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP4"
FT                   /protein_id="CBL43636.1"
FT                   /translation="MHNGHDTIQATTPLSFRQLPEQLDRLPACVYIKDPLGRYVAANQT
FT                   MCDLLQQPLTAIIGRRDEDYFDLDRAPGVTEHDRQVLIDGLAWVGEEKCWHKQQQEFRS
FT                   FLSLKLPWRDTLGQVVGLIGVSIDASNRAPHSAALEQNRLLDLFLNHIDAHIFQKDANG
FT                   RFLYANRPVVRLYGRTEAEILGHTDLELLPEEIARALMATDQEILQSGQPRACQEAIRG
FT                   ADGVLRHFWSSKLPLLNPGQPPTLVGVATDISELLELQERLHRQQTTDELTGLANRSLF
FT                   ESRLQQALTAEDTTWAVILLDLDDFKYINSAHGQATGDTLLRQVALRLEQCPAAQQLRN
FT                   TIARFGANRYALLLEIPNADSGAQVAQMASCLTQTLALPLQIGEQLFHLTASIGVSLYP
FT                   LDSQAQQQLLSHAEAALYQAKALGRNQVCFYSPELGQRVQERAHLEHALRAAIVEPDQA
FT                   FELHYQPKIQLLSGQAVGVEALLRWPRPEGMVSPLQFIPLAEQLGLINALGGWAITTAC
FT                   RQLAAWRGTSLDGLKIAVNLSAHQLRDDKLVSFIADQLQRYGVPAKSLELEVTESLMMD
FT                   NPERAIAYLHQLRALGVSLAIDDFGTGFSSFSYLKQLPVDCLKLDKAFITNIAKDAREA
FT                   DLCAGLIMLAKRMGLTVVAEGVEEEAQLELLRQMDCELIQGYFYSKPLSIRPLEDYLRG
FT                   RTALQNPQGAPKLN"
FT   CDS_pept        complement(76365..77993)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00540"
FT                   /product="PAS:GGDEF domain protein"
FT                   /note="silverDB:HdN1F64"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43637"
FT                   /db_xref="GOA:E1VFP5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP5"
FT                   /protein_id="CBL43637.1"
FT                   /translation="MARPMTGRLEKLGNSKSSVGKVILIMVLFIMINLLLLGMLYLQGN
FT                   VLDGARAYVRGEGLWAKAQKDMVLHFTHYSYTHDPKNYQAAIDAYDVILGDRQGRLAML
FT                   ASPPDRALARAGLERGLNDPKDTPTMVQFLITFQNEAHIHESATIWAHADTRVEELVQT
FT                   GSAIRKAIENGAPESVIVAHRAHLRELDEELRTLEYQFSKLMADGARFVRNVTWYASIG
FT                   ILLMVMAISLLISRQIILSIARSEQQMRLAATVFAASNDGVLIMDQNLKILSANTALCR
FT                   ITGYTEAELTSHSAKILQSVFASELPLQEMEIALQNTGHWQTDVVERRQDGSLVPLQFS
FT                   INSVYGADNVSHYVAIVSDISRRKAQEAQLRHIAHHDALTGLPNRILFNDRMEQIFKRA
FT                   HRQHNKFAVIYLDLDNFKPVNDNFGHDTGDQLLQAVATRITEHVRGTDTVTRLGGDEFV
FT                   ILLEDIVDQEMAEEIAEKISTEIRKPFQANGHTVQVSASLGIALYPDHGDTARDLLHYA
FT                   DLGMYRRKMLHHGRSPEAVSEQRHH"
FT   CDS_pept        complement(78069..79013)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00550"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F65"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43638"
FT                   /db_xref="InterPro:IPR025538"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP6"
FT                   /protein_id="CBL43638.1"
FT                   /translation="MRVRPLCIFLLLALPLPSWANSSTGSVNTGGVQYLKSKSIQMYSE
FT                   DLYISKKVIKVDYQFKNLTSGEITETILFPLPRVPNYSLMDFPYTPNLIKSFKIYANGE
FT                   RIIPKVHVRAFKESQGDGAPAMDITDALKSCGFSDKDLQGPWIDVDTRKINKQTLRDCK
FT                   NPIAQQLINESTDPEEVLWESQIIYRWDQTFKANSLTRIQHEYQPLLGGDIGVPDEDWH
FT                   RRRYCTDRSFIAAVKKTRNEQLQIENLGYILKTGANWAKPIQNFTLTIERDPNELISLC
FT                   WDGKIKKINPTQFQAVETNFVPTQDVEILFVHE"
FT   CDS_pept        complement(79156..79386)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00560"
FT                   /product="conserved hypothetical protein CHP02443"
FT                   /note="silverDB:HdN1F66"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43639"
FT                   /db_xref="InterPro:IPR012658"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP7"
FT                   /protein_id="CBL43639.1"
FT                   /translation="MMRRFIAGAVCPKCQARDKIYLAKENDEDVAYCVACDYRSVRPRN
FT                   DEPLVHPDDEVDALRKEAETGVVKFVPGARH"
FT   CDS_pept        complement(79455..81611)
FT                   /transl_table=11
FT                   /gene="prlC"
FT                   /locus_tag="HDN1F_00570"
FT                   /product="Oligopeptidase A"
FT                   /EC_number="3.4.24.70"
FT                   /note="silverDB:HdN1F67"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43640"
FT                   /db_xref="GOA:E1VFP8"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP8"
FT                   /protein_id="CBL43640.1"
FT                   /translation="MADNPLYRSSEETNTGLPPFRAILPEHVIPALDQVLAENRAALKA
FT                   LLADPANHCPDQPVQQILKPLEALDDRLTRLWSPVGHLNAVMNNDDLRTAYNACLPKLS
FT                   EYSAELGQNSDLCNIFKHIRASAQWESLNTTERRVVENALRDFHLSGVDLRADQQGRYK
FT                   EIRKRLSELSSKYAENVLDCGQAFYHHTTDPAELAGLPESQRQAAKQAALEKGKEGWWL
FT                   TLDAPVYIAVLTYADRQALREKFYHAYSTRASDQSPNIVQDRASTDPQTAHPWDNAPLM
FT                   REILALRHELAQLLGYPNYAEYSLATKMASSAREVLEFLHDLAERSRTAGEKEFAALQG
FT                   FARENYGCETLNAWDVAYYSEKLKEQRYAVSQEALRPWFPLPKVLDGLFQVTHKLFGVR
FT                   FETNDQIERWHEDVLYFDVYNSHKKIAGFYLDAYTRSGKRSGAWMDDCRVRRLRSDGSL
FT                   QLPVAYLTCNFNRPVGEAPALLTHNEVTTLFHEFGHGLHHMLTRIDAAPVSGINGVAWD
FT                   AVELPSQFMENWCWEGEALRLISGFYNAASEVSSATSQTVPQAGDPLPQELLDKMLAAR
FT                   HFQSAMFMLRQLEFATFDMRLHAQYTENTDIHAVLEQVRQEIAVVPTPAFNRFECGFSH
FT                   IFAGGYAAGYYSYKWAEVLSADAFSRFEEDGIFNSETGRAFRTAILENGGALDAMALFV
FT                   QFRGRKPSIDALLRHSGLLEKDAA"
FT   CDS_pept        complement(81749..82570)
FT                   /transl_table=11
FT                   /gene="aroE"
FT                   /locus_tag="HDN1F_00580"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="silverDB:HdN1F68"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43641"
FT                   /db_xref="GOA:E1VFP9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFP9"
FT                   /protein_id="CBL43641.1"
FT                   /translation="MVDRYAVLGNPVKHSKSPAIHRFFALQTDQDIAYTAIQVPLDGFN
FT                   AAVTKFCEEGGRGFNVTVPFKQQAFERMDECSERAALAGAVNTVVVRKDGTLYGDNTDG
FT                   VGLVRDILNNHEGRLIDKRILLLGAGGAVRGVLGFLLQQKPLEIVIANRTVEKAEELAT
FT                   HFSPYGRVSGCAYSQLGTKPFDWIINGTSASLQGDLPPLHDGLVSRDTWCYDMMYGKET
FT                   TVFNQWAEQRGAARAIDGLGMLVEQAAEAFRIWRDVLPLTAPVTMELRSSM"
FT   CDS_pept        complement(82573..83577)
FT                   /transl_table=11
FT                   /gene="hemF"
FT                   /locus_tag="HDN1F_00590"
FT                   /product="Oxygen-dependent coproporphyrinogen III oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="silverDB:HdN1F69"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43642"
FT                   /db_xref="GOA:E1VFQ0"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ0"
FT                   /protein_id="CBL43642.1"
FT                   /translation="MDKNTSDTARSDTTSALSNPAPAQPIAHAPLEQVKNWLLGLQARI
FT                   CSGLEAEESRGCFIEDRWDRDAGGGGCSRVLEGGEVFEKAGVNFSHVYGESLPASATAH
FT                   RPELAGRSFNAMGVSLVIHPRNPFVPTSHANVRYFVAEKPGAEPVWWFGGGFDLTPYYP
FT                   FEEDCVHWHKTAKAACDPFGAGVYAQYKKWCDEYFFLKHRNETRGVGGLFFDDLNQWDF
FT                   ETSFAFMRSVGDHFLPAYQPIVAARKNTHYTDAQREFQLYRRGRYVEFNLVYDRGTLFG
FT                   LQTGGRVESILMSLPSQVSWKYNWHPEPGTQEARLYEDFLKPKDWLQLSQDSK"
FT   CDS_pept        complement(83672..84253)
FT                   /transl_table=11
FT                   /gene="sua5"
FT                   /locus_tag="HDN1F_00600"
FT                   /product="putative translation factor (SUA5)"
FT                   /note="silverDB:HdN1F70"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43643"
FT                   /db_xref="GOA:E1VFQ1"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ1"
FT                   /protein_id="CBL43643.1"
FT                   /translation="MPDTTSRLPQAVKILHEGGVIACPTEAVWGLSCDPFNPMAVQRIL
FT                   DLKQRDPSKGLLLVAANEQAIAPLLAHLAPVLLERLRAHWPGPFTFLIPDPQNWVPPYV
FT                   KGNHPHVAVRISAHPLVHRLCEAFGGPLVSTSANQQGAPPARSETDLRNWLNTLENTAD
FT                   RPHILPGSTGGQTNPTRIIDLMSGETVRPD"
FT   CDS_pept        complement(84246..84752)
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="HDN1F_00610"
FT                   /product="Phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="silverDB:HdN1F72"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43644"
FT                   /db_xref="GOA:E1VFQ2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ2"
FT                   /protein_id="CBL43644.1"
FT                   /translation="MSTPFVAILMGSDSDLPKVEVAAETLKKLGVRVEMKVTSAHRTPA
FT                   ATHAYVTDADQRGCAVFICAAGMAAHLAGAVSALTVKPVIGIPIDAGPLDGMDALLSTV
FT                   MMPAGIPVATVAIGKAGAKNAGYLAAQIIAVGDAALAQRLRDDREENARAVQAKDAALQ
FT                   ARLNA"
FT   CDS_pept        85117..86217
FT                   /transl_table=11
FT                   /gene="adeT"
FT                   /locus_tag="HDN1F_00620"
FT                   /product="RND type efflux pump involved in aminoglycoside
FT                   resistance"
FT                   /note="silverDB:HdN1F74"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43645"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ3"
FT                   /protein_id="CBL43645.1"
FT                   /translation="MTRSTASANISPIETAHATSTKSRAKSLLRRAALSTLLCAGMMAA
FT                   PLQATHAAELVKRTFCVFDIIGKSGPIYNAMQEYRLAAMGWGVDLELKPFTDERITVEE
FT                   FKSGQCDAVGVTGLRGRTFNAFTGTIDSIGAIPDYDTLRVVLQKLASPQLAPLMKSGEY
FT                   EVVGIGPAGAVYLMVNDRSIKTVSDLSGKRIAVLDFDKSQGVMVESIGASPVTATIATF
FT                   GSMFNNGAVDVIAAPAVAFGPLELHKGVGSKGAIVDFAMVQLTVQVLTRHDRFPEGFGQ
FT                   KSREYILAQFDKTMAEIGKATQNIDSKMWMKIPEKDIPGYTEMARQTRLRLRDEGFYDP
FT                   KMLKFLSRVRCELKPGLSECTAPDRE"
FT   CDS_pept        86340..87272
FT                   /transl_table=11
FT                   /gene="hmgL"
FT                   /locus_tag="HDN1F_00630"
FT                   /product="Hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="silverDB:HdN1F76"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43646"
FT                   /db_xref="GOA:E1VFQ4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ4"
FT                   /protein_id="CBL43646.1"
FT                   /translation="MGERVFITEVGLRDGLQNQPVPVSTQDKLRLANALIAAGVRRLEA
FT                   VSFVHPKIVPQMADAVEVLAGLPKVDALNVTALVPNMKGYERAREQGLKRVAVVVSTTD
FT                   TFNLRNLNMTTAQTMEASLSVIRQARQDGLSARAYISGALACPYDGPTPVDVVHRMAEQ
FT                   LINGGADEISVADTIGAGNPRQIKDILRPLVAQYGAEAFNLHLHDTRGMALAMAWAGIE
FT                   CGVRKFDSSVGGLGGCPFAPGASGNVATEDLVYMLEASGFDSGISLEGLREAVAIAEQA
FT                   TQKTLGGRILTWMRSQDALKAAKAQPCAS"
FT   CDS_pept        complement(87281..88249)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00640"
FT                   /product="Zinc-containing alcohol dehydrogenase"
FT                   /note="silverDB:HdN1F77"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43647"
FT                   /db_xref="GOA:E1VFQ5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ5"
FT                   /protein_id="CBL43647.1"
FT                   /translation="MKAIVQDAQQNLSWGDVPTPLPKAGEVAISVKATAVNRADLMQRK
FT                   GLYPPPLGASEIMGLECAGTISAVGPGVTGWQVGESVCALLTGGGYAETVVCPAGHVLP
FT                   LPSGYSFAQGAAIVEVYATAWLNIFLEGAAKLGERVLIHAGASGVGTAAIQLCKALGNP
FT                   CFVTVGSQPKLDFCLKLGASAGCLRQDNHFEERVRDWSQGAGVDVILDCVGADYLDANL
FT                   RSLNTDGRLVLIGIMGGRTASIDLGRMLIKRLKVWGSTLRSRDNQSKTALIRSLREQVW
FT                   PRFEKGELRSIIHAEYPIQEVERAFADIASNANIGKIVLTV"
FT   CDS_pept        88566..89810
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00650"
FT                   /product="Predicted permease PerM family"
FT                   /note="silverDB:HdN1F79"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43648"
FT                   /db_xref="GOA:E1VFQ6"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ6"
FT                   /protein_id="CBL43648.1"
FT                   /translation="MYYRERLERRTFLLLLLIVSFSFMWLLKPFFGAIFWAVAIALIFS
FT                   PVQRRLNQRWPSRNSGNAMLTLLLCVVVLVLPMLFVVGSLVSEGAGLYQRINAGQFDPA
FT                   HYLARLREAFPMVEELFRRANIDMQSLQEKLAELGMAGSKLLAGQVVALGQNTFSVVLN
FT                   AVLALYVGFFFLRDGEQLTVQLIRALPLGDARERLLLDRFAGVMRATIKGTLVVALVQG
FT                   ALGGLAFAALGISGALLWGGVMVIASLIPAVGAALIWAPVAVYSLATGDWVSGVVLIVV
FT                   GVGVIGMVDNLLRPILVGRDTQMPDYLVLLSTLGGLALFGMNGLIIGPIIAALFIAFWE
FT                   IFMREFNAPDATAPEATAPEAIAPEAIAPEAIAPEAIAPVLAAKDSVDEQENTVPLDSD
FT                   QRQGMGVADKPSRAD"
FT   CDS_pept        complement(89821..90261)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00660"
FT                   /product="CBS domain protein"
FT                   /note="silverDB:HdN1F80"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43649"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ7"
FT                   /protein_id="CBL43649.1"
FT                   /translation="MKNVRDILRSKPSAYVYSVRPDSKVLDAIKLMSEKGVGALLVTEN
FT                   DKVVGVISERDYARKVVLMARSSHQAEVREIMTADVISVDPTQSMESCMELMTEKRIRH
FT                   LPVIENDELIGMISIGDLVKNIISDQKFMIEQLQQYIRGETA"
FT   CDS_pept        90493..92106
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00670"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /note="silverDB:HdN1F83"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43650"
FT                   /db_xref="GOA:E1VFQ8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ8"
FT                   /protein_id="CBL43650.1"
FT                   /translation="MVVQQRLRVVLMAQIVIPSIALAYLWMVHDASRVANSALVALYCV
FT                   TFAAMLGMMVYFWRTFNSLLGAPVEDLLLQLEKMKEGDLTQCSLARSTRLRGSLSHRFG
FT                   ALCQEWAQTLFSVTTAADMAGVRGAGLRESLDETRKGMREVNETIGQLTVSVNEMAASI
FT                   REVAQNTELARSDAGAVDKIAQRSLLVVDGTISAIHGMAASMQQSTDAINQLAEESYRI
FT                   GEIVDVIGAISQQTNLLALNAAIEAARAGEAGRGFAVVADEVRSLATRTHDSTTNIRAI
FT                   IENLQRGTQLAVTEIQRSSVASADMVAHADEVRVALHEIAEGVGRISLTNTQVATATEE
FT                   QSAVATTLGNNMSRVTDIVSATAERARKDRIRALDSELSIEDVILLMNTFKTGVKVSKP
FT                   TDAHTIVDWSDLYSVEIGLPDKQHQQLFVLMNQAYGLMLEESCATQIQPVLTELLKVAT
FT                   THFREEEALMEKADYPELARHREIHNRLLKDATALAGAYQASKQEADLLKLILFLKNWL
FT                   IGHIFKVDKRYTECMKAAGF"
FT   CDS_pept        92226..93869
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00680"
FT                   /product="CheY-like response regulator receiver"
FT                   /note="silverDB:HdN1F85"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43651"
FT                   /db_xref="GOA:E1VFQ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFQ9"
FT                   /protein_id="CBL43651.1"
FT                   /translation="MDLIPYHKKSVLVIEDLAEMRASMKSMLGNMGVQSIESVNSGEEA
FT                   MNKLRVNHYDIVLSDYELGRGKDGQQILEECRAANLIKAQTIFVLVTAAQTVEMVMGAL
FT                   EFEPDGYITKPVTLDILRTRLNKIIRTKDVYAEINRAIDNKDVTGALEACNRLAVERPR
FT                   FALASYRIKGKVLLDVGRLQEARDIFETVLGIKRVAWAVLGMAKVLYRQGELEESRKLL
FT                   EGLANSNAKFVEALDWLAKVLEAQGKYNAAQKVLETAVANSAKSVQRQQALARLAELNN
FT                   DYPVMYRACRKAVGLGKNSFFNNPQMYIALAKSLQPKIVGGSLREQKLCITEAFSLLEM
FT                   ARTQFDLDGVSVLKASLVEAQTLFNSGKKTEGSLAYRAAQVQVDANPDLSLDDKLDILI
FT                   VRLSFDDEATLKAYGDELLAQIKGDRRLENKYYSILENHLSEQPEERLALMKRRGEELM
FT                   GRSNWEDAVDLYLRASELKNADTDVRIGAIKATIGLFASGHPDSARIATIDSLLSQLAN
FT                   LPESDARFPVVQRLQREWVEVTAVELAAQS"
FT   CDS_pept        93853..94566
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00690"
FT                   /product="Sensor histidine kinase"
FT                   /note="silverDB:HdN1F86"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43652"
FT                   /db_xref="GOA:E1VFR0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR0"
FT                   /protein_id="CBL43652.1"
FT                   /translation="MPHNPDQHRADLLFAASIHELKNRFGLLLVNLEALLPQLTLAPEQ
FT                   QGAVASIRHDAQYIGDELVRLLTVFKAAGGQLRANIDQYALEDLLEEVVARHATTARAT
FT                   GCMIGFECDSELVGFLDEGIIRVVLDTCIYNAVKAGAHQITLRAVESQDGLRIDVDDDG
FT                   PGFPEEMRLRYNASIDCGSLAPARSVNPAENTTGLGLYFANSLLAQICEQEACGRLLLG
FT                   VSPEGGAQASLLIPQ"
FT   CDS_pept        complement(94590..96290)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00700"
FT                   /product="ktn nad-binding domain involved with k+
FT                   transport"
FT                   /note="silverDB:HdN1F87"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43653"
FT                   /db_xref="GOA:E1VFR1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR013099"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR1"
FT                   /protein_id="CBL43653.1"
FT                   /translation="MNYAIFLLLRRVRLPVILVILSHAIAVLGLTLIPSVDVNGQPAPP
FT                   MDFFHAFYFITYTATTIGYTEPASGFSDGQRLWITGCIYLLVISWSFVLVTLVALFQDK
FT                   GLQNALVANRFARRLKHLNEPFYLVCGYGETGSLICDTLDHLRQRFVVLEKDELRVQEL
FT                   ELVEYRTEPIALAVDVRLPDKLLQGGLCHPRCRGILAVTNSEAANLAIVMAARLLNPTT
FT                   PVLARARSAAIVANMTSFGADHIINPFERFAEYLSLAAIAPEQFRLVELLTGIPDGPLP
FT                   EPHRPPKGHWIVCGFGVFGQAIVRNLRATDVTMTIVDPNGPTPEQEIIRGHGTDAFTLD
FT                   AAGVREAAGIVAGSDDDVSNLAIAVTARELNPDIFVVTRQNRAANNALFEAFEGDFCMV
FT                   PSQIVAQECLAILTTPMLARFLNSVRKQDEAWCARLAASLNAVCPNRIPDIWGIHLNAQ
FT                   GAIAAHRHLMLNGGIKLGTLLMSNQDHNKPLPIVPLRLERSGTPILLPGPEFDLVAGDH
FT                   LLVAGPHGIRNHLELTLQNNNVLGYVLSGKASGGWLWKWLSHNHKEKEE"
FT   CDS_pept        complement(96308..96691)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00710"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F88"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43654"
FT                   /db_xref="GOA:E1VFR2"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR2"
FT                   /protein_id="CBL43654.1"
FT                   /translation="MNFEKVVFGFFIVLAATLNFGFFIGDIDRPELHNVYELFAAIVVN
FT                   LIATALKFGDRTQIGATHLSASLVADLQLIAAAITWGVALYVTKEGMTPHVTASVVSLS
FT                   GGALLANIVSVIILTTETIMLRR"
FT   CDS_pept        96746..97402
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00720"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F89"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43655"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR3"
FT                   /protein_id="CBL43655.1"
FT                   /translation="MYCSSVNGFPAGVILSQAGIQCCGKCTCFRRRDERKVNIAGVRAT
FT                   RNLYSPLSHWERVLIMSEEKQISVTLEQQSDYRFLASYDDGAPALITDEPAPLGQGQGP
FT                   SPVQLLTTAVGNCLTDSLLFALRKFKQEAEPLRTQVTAKVGRNEKGRMRVLEIEAHIRL
FT                   GTALMHLSNAERVLGQFEGFCTVTQSVAQGLPIKLSVFDSTGALLHYSDSSEDGE"
FT   CDS_pept        complement(97452..97886)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00730"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F90"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43656"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR4"
FT                   /protein_id="CBL43656.1"
FT                   /translation="MKFALHLLIAAATSLASGALWAAEIAIIANPKANFDSITISQVRQ
FT                   LFMAKSRTLPDEQNAVTFMQVEESPARVAFDRIVLQRSPRDSRAYWAQLIFTGRGQPPS
FT                   SLPDDASVKEQVALYRNALGYILRESVDDSVKVVLVLPYH"
FT   CDS_pept        complement(97913..99286)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00740"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F91"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43657"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR5"
FT                   /protein_id="CBL43657.1"
FT                   /translation="MHCSALRRMHILTITFERIGSLSTAASGMAWLARSSLATSLALGF
FT                   VAPNAFAEGVRWNGYLNVVGGALQKEPASARQDRRPPSYANYSTDFVMDNETSAGMQAM
FT                   YAIDAKTAVTLQLQANSSQDHYETELRWLYATWIPTEHSSFRIGRIGAPIYLYSDSLNV
FT                   GYSYHWIRPPRDVHDYDLPLTGVDYIYQSVYGNSEWSAELAYGSDEQFVAATHGELTMR
FT                   NVLGAVFTYSYDSWLTLRAAIFQAEISLASEVLSSDNLIDRGFDYAVRSGQLDAASAQA
FT                   LKEQLAPSMAPMIDQALQVEDKRWHYRDLAAKIDRERWFAIAEWSTFRTDTYMFGNVTA
FT                   WYASAGWRQNQFTWHATYSRYRQDIKAAVLDDYYAVLPESPTPSQIAEFYGRQIRAKPP
FT                   AATASHWRTVTIGMGIDITSGTVVKFELLRFTRDPTVREETGAIGSNMLFRTALNVAF"
FT   CDS_pept        99427..99942
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00750"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F92"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43658"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR6"
FT                   /protein_id="CBL43658.1"
FT                   /translation="MATEVSACVELDLPRSEAWQKLADLSLAHHYVPGVVDTRITTSTL
FT                   QGVGVSRNVYRKRGEYLEETVTEWVPEHGFTLRLHKGERDAPLRGAWFRYRLDDAPAGK
FT                   TRLTTTMGYIPPFGVLGQWLDGAFLRRIIQRAIGDVAVCLKHFYETGETPTSEQRKSLR
FT                   SALNPLVS"
FT   CDS_pept        100079..100519
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00760"
FT                   /product="Thioesterase family protein"
FT                   /note="silverDB:HdN1F94"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43659"
FT                   /db_xref="GOA:E1VFR7"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR7"
FT                   /protein_id="CBL43659.1"
FT                   /translation="MTDLPHASPNPAKPSLEELQAFLLREFPQSRATVEALGPMTATLR
FT                   LRVTDADLRPGGTVSGPSMMGVADAALYIAILGEIGIVPLAVTTNLTINFLRKPRANCD
FT                   LLGKCRMIKIGRTQAVGEVSLYSDGDDQNPVAHVVGTYAIPR"
FT   CDS_pept        complement(100526..101011)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00770"
FT                   /product="Transglycosylase SLT domain protein"
FT                   /note="silverDB:HdN1F95"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43660"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR8"
FT                   /protein_id="CBL43660.1"
FT                   /translation="MTKIIPFLLLFAGWIGTAQAFDEACFRAAAERYSVPQPLLYAIAR
FT                   VESNFNQSAVNRNTNGSTDYGIMQINSRWFTQLETEFGIPREQVIRDACINIHVGAWIL
FT                   ATNFATRGKKWDSVGAYNAGFSSDRRNIRSNYVAKVKRFYDYYNSAAAQTPAIVATR"
FT   CDS_pept        101209..105015
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00780"
FT                   /product="probable non-ribosomal peptide synthetase
FT                   protein"
FT                   /note="silverDB:HdN1F98"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43661"
FT                   /db_xref="GOA:E1VFR9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFR9"
FT                   /protein_id="CBL43661.1"
FT                   /translation="MVLLAAALVCDFSPFRFASAPFMSVSPQSSTVICSHRLSFVQQRR
FT                   WFMEQLQSPSGVSNAAVGVRIYGALDCQQLVAHLNTAVAAQAIFRSRYVLGGDDAPEAQ
FT                   VLAESGFQLREEDFSQQYVQSNADKLLERRLQQEQQVKFDLAQPPLLTGVLLKLAENEH
FT                   LLVLVAHPIVADPHSLGRFVAAWLKRFVVQIDQGKDAGGVDEARTRDYGHYADWQQQQW
FT                   RDSAWVTALREVSDTLHGAHRALELPWDHRRATAPARTVYSLALPVSPNVLARLAGTGE
FT                   RHGLRLDAMLCGLYALLLARLSSQTGFCLGMPVNSCPQEWQDVGCGPFENLLPLRAQLA
FT                   FDETLLQWLLDMQAHLDFMLARRMLPIEKVQEALAAPAAGGQLPWLRVAFACQQQPSSY
FT                   PVCNSLRFEPICLRSERSLFDLQLTVLTGDKPHFVWQFNRDLLEKGTIEQWHRYLLTLL
FT                   ESASTGMEASAGSVALLDRAQQQQLLKQLSGGDIKIAREQSLYGRIALLARQVPRHTAI
FT                   IQGERFVRYQSLVQQAEGWAAALRDLGVKRGARVVMPMPRSAEAFVALLAVWRAGGCAV
FT                   PVPQRYSEEQARTLLLQVQPVVVLFHAGSPVSEHMKCWRGAASGVCEFTSLMGLANDGR
FT                   LREEPAPAQDGFAVMLTKGSTDPRHVPVFIPITHGALLALFHSLTQRMQLRANAQWLAM
FT                   AEFYQDISLVEALMPLLSGACLVVAEPNDLETVDQWAVLIQQRSVTCMIAPPERFHELL
FT                   QHHALPAESYLFSRNHSLKPDWLQEFLHAGATVVNLFGTPESGIINALQIVRDLRGGVM
FT                   EEGVSLGAPLQNTHLRILDEQMAQVMPGGIGDLLVGGDVVSPGYWQRDELVRERFVQVG
FT                   GDCYFRTGFRARLASDGQVFLVEATREEIEPPQALPHPSLEQAVLRCWQFMLERDEIDP
FT                   EQPFAELGGSSLVALRLVAHVNRYFGATLPLAMLLQAATVRAQAWCLQGAGVSVEPLSL
FT                   QTLHAGSAGSMPWVLLFDEYGSVASWKAQYAQILATKDSHSAAGVHGQHGSVYDQVLMS
FT                   TPVFALHCNRYEGAKSLAELGGECIAALPEGRFVLAGAGFGGALAAAIAMQIPERISRL
FT                   ELLDAPPKWDEPLAAEAKSEHEEQLALFHRQLWRDGVCGVFAMPVRAWLPAQGLLALGA
FT                   ASGWELSAKSLDVVRVEGGRDSLLSRWFAQMYEESAAAREWTAGENAGQGEVEQGLESA
FT                   NGPELAASRTSLPQDAQGSQTSEKPQTPQTSQIPQIQETGAYA"
FT   CDS_pept        105105..109943
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00790"
FT                   /product="probable non-ribosomal peptide synthetase"
FT                   /note="silverDB:HdN1F101"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43662"
FT                   /db_xref="GOA:E1VFS0"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS0"
FT                   /protein_id="CBL43662.1"
FT                   /translation="MQASSGGGVQENDIAALRGLLQALGLTTNTHGAAVGDEFANKLQG
FT                   IPALLIPDTQAYGKMLRLPVSGCDLGVLRHKAGAWLSSFLGVGATLFALLSARYQSRGL
FT                   WLEELSAGIGQCGVADDVPLAWFSLSSMQGYLPQDGSLREAVHQVSGSLMVAALSAGDS
FT                   LDLALSLPDAHEGDFLTWHYCEALLDEGFVRQLHEDYVALLQQASALITPVLSAIDLPL
FT                   AARKADDAEFAEVVEEVITVAPTNETSGAVRRDASALWRTVQAVIDLHVKPEDIRTESA
FT                   PVASPVIAESAVTSAARAVEHGSEAAVLALREDTLSPQQWLIALDERIHGVGVRNTVIA
FT                   ACMQLGLEAGSGLGGKASRTDPERAQRALQALMQRHALLRTSFVWCDEIPSAESVLPME
FT                   SLDAAKASAIAWPRLHENPAVPWRVSVLSVAGEGAHADLHASAKKWLANGASVALPMFG
FT                   EGLPWRAELATVSNGDERLAVWRMCFNAAIADQHTAERWLAEWQALYAGEVLSPVATQY
FT                   ADYVGDLWKKAALSSLMPSTEADVFWKETLQRVRPVRWPLATSSIGGALSSTIEAELVQ
FT                   RVRVAATAWQVSMESVFLAAYAALLQRYIGGDSFAIGVEFANRQGAARQSLLGPLSNRL
FT                   PFVAQMSAGRPSVRHRVEQVDSQWQDMALYQDTPALALLPMLSALRGGAVASAENGANA
FT                   TPLMFGFAYRELPGTAALPLVARGLQLMPMDARQARFGIELRVHCGEWQATEVSLAFQA
FT                   GFLDSVLAEHWFEQYLHLLSGMVNSADSDLALLSVQSLPDQQEVFDRFNREARSLPTFL
FT                   PHFSLWWQRQCYGVPNNVAVVGVEGRISYIELDAITNQLARYLQAKGVGVGDRVGLLLP
FT                   RDPMLLASVLALFKLGAAWIPLHSSWSVELQQQVLAHGEASCVLHDSERSPWQGELPAI
FT                   EVSYSDDVWQKCSDVPFDEVDDAGLLACILYPTENTALAQGVALSHRNISALVAWGSRL
FT                   FEHRGALKSALAKELNEEGALFDVFVTLGCGGTVVMIEDLLSKQARERPTTTTAKLLAL
FT                   VNHLTVTPTLASELLRRQWLPGTLRSIALLGEQAPPALCDALRAIPGVEQVWTFHACLE
FT                   NSGIGFVGTGARSSLGVPVDGTQCVILNERAQLTAWGVVGDLYIGGASLCSGYWKEPLQ
FT                   GRFTRNPLTYFPTLGSTLFHTGYRACWFADGRIELVGFSADKDAQDRRQVECLRLEQKM
FT                   AEVLSEVQGVYTATTNACTVFVCGTHPARHYQQLLQRSLPQLNGVAVKVLAEWPRDRLQ
FT                   RIDRATLLQLLESSSANDDEIAVSASESAESAASRVHSGHSNTLERQMLHFWQEWLGAG
FT                   VTGVDCEFANAGGDSMLALRMVVALAQRYALKEIPPVALLFQHSTPARLALWLDSSLRG
FT                   EEHRERLWLPLQARTTSSSVLCFRTGDTSVAEAIWQPFAEALPEHLGAWHLCSRQEVAT
FT                   GCIPSDLALLTQEHLTQKNGVHENAGPNGVLVDHALLAKRYVDAMEQECLPVPSAIVGH
FT                   QEGALLATAVAAELRSRGWAWLPLVLLDGCPSPVDVPTVQSSALHLLNAEAELPLREGW
FT                   PERLQGNVQWRISQDSGANAVFRQAARWLEECC"
FT   CDS_pept        complement(109947..112709)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00800"
FT                   /product="predicted histidine kinase"
FT                   /note="silverDB:HdN1F103"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43663"
FT                   /db_xref="GOA:E1VFS1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025293"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS1"
FT                   /protein_id="CBL43663.1"
FT                   /translation="MIPSLRVLPHRFAKPLFRNRFVANLILSSLFLALFASFHATTSST
FT                   AYAAPQASEQSLRIALTFNFFRYITWPNEQSLPVFRIGVLTNDARFFEEIQRSAPLLQI
FT                   RNKGFQVVRVTSTQNLASQGLQMLYLDTQNSAQLDAIAPLLRGRGTLLVSNGSSDARSV
FT                   MINLVRTPENTLRFEINRSNLIYEKLSVDRKIILLGGTELDVAKLFRQTEDTLQKTKMQ
FT                   LAEQEQKYGELLTEIAKTRRELSTTHSQVEQQKSLLQTQTKQLLQQQTQITGQEKQLDD
FT                   QGKQLVAQQAKFTEVNATIARSEHELQRKIEELQQQAERLKSAEARLAETKQELASSAE
FT                   ALAESRQQFVINQQQVEQSIATIEALRVEINNAKSELKSQLAELGRQTIVIDYLRYWLI
FT                   AIAFASLAMLGLAFALFRSNRARKRNAEELQAANQALLAIHTQLANEKQEAERKNEAKS
FT                   RFLANVSHEIRTPMNVVLGYSDLLQQTPGLGSDSRRALQVINRSGEHLLTLINDILDVS
FT                   RIEAGTIQLVEQDFCLQTLLMDLEVMFSERCQHQNTQLSIKAEPDTHPDLRGDRGKLLQ
FT                   ILINLVGNAVKFTEQGQILLTVNTQPMGADQFELNIIVKDTGCGIAPEDYDKVFSLYQQ
FT                   TESGQRLGKGTGLGLAISREFARRMGGDLVFESEIEKGTTFYLRIPFRAGQQVASEIGA
FT                   APHPVALEAGQTQRRILIVDDNENNRELLHKILLPFDFCLNEASNGQSAVQICQDWHPD
FT                   LILMDIRMPEMDGHQAIREIRKIHSRDQLPIIVLTAGTLAGDVEKSTQEGANDYLSKPF
FT                   KADDVLSRIGKQLNLRYIYANHPWRGSRHVPPDDKASLRNAFAQLPESLQQLLRKDIEL
FT                   GHATGLLQHLETVDHAAPELVAALRALAQDFDYPQLLEITAPHQSTPTQ"
FT   CDS_pept        complement(112699..114501)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00810"
FT                   /product="predicted response regulator receiver"
FT                   /note="silverDB:HdN1F104"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43664"
FT                   /db_xref="GOA:E1VFS2"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS2"
FT                   /protein_id="CBL43664.1"
FT                   /translation="MPTSKILMVDDEPANLKILHEMLAGDHYDLSVAANGARALEIAKI
FT                   ILPDLILLDVRLPDMDGFEVCRQLKADSATQAIPVVFVTGSLESVSTGFAVGGVDYLTK
FT                   PVRREELQARVKTHLQISGLLREIADKNRGLELAQEQLEQRVNERTQELREANERLQRE
FT                   ISERRFAEERIQYLARHDYLTHLLTRTAFEETLTSLLSRIADEKAQHVLLYMDLDQFKL
FT                   VNDTSGHMAGDELLCQVAELLRRHLRAHDIAARLGGDDFAIILYNATPESGKATAEEII
FT                   KAIGNLAFQHDGARHSVGASIGLVSITHEASGVASLLSMADTACYAAKEDGRNRVHVYD
FT                   DNLKQMQSRQAEMQLTPRIFSALENNQFALHRQVIIPLSNGSAPHYEILIRMIGENNSI
FT                   ISPADFLGAAERFGVTPQIDRWVIERVFRHFAHHPELIEQMGGCSINLSGLTLSIPRFE
FT                   LFIEGLLKTYAVPAHKICFEITETSAVTNLHRTLEFMHAIRKLGCSFALDDFGRGVSSY
FT                   YYLKNLPVDYLKIDGAFVRSMQHDTVDYAMVKSINDVGHAMGKKTIAEYVENGHIEHQL
FT                   RALGVDFAQGYHLGRPELFIPHDT"
FT   CDS_pept        114875..115549
FT                   /transl_table=11
FT                   /gene="ytfE"
FT                   /locus_tag="HDN1F_00820"
FT                   /product="Regulator of cell morphogenesis and NO signaling
FT                   (RCMNS)"
FT                   /note="silverDB:HdN1F106"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43665"
FT                   /db_xref="GOA:E1VFS3"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR019903"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS3"
FT                   /protein_id="CBL43665.1"
FT                   /translation="MELLDQTVGWIARNVPGSTRIFHEHQLDFCCGGNQPLRVALQNCN
FT                   LAPMPIVEALTSLQDVDVQEKDWRDSPKKELVAFIQTTYHTRHREQLQELIRMASRVEQ
FT                   VHGRREGCPNGLAVHLHGMLEDLDDHMRKEEEILFPMLERGFSVQQVAAPISVMREAHV
FT                   EHGDALHKLYALTNGITPPKGACNTWRALYAGLRQFSDELVEHIHLENNILFAENAVSE
FT                   GA"
FT   CDS_pept        complement(115561..115833)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00830"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F108"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43666"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS4"
FT                   /protein_id="CBL43666.1"
FT                   /translation="MKSAKKQIQPPLWASAFVLGLSLSTTCSATQQSTVLTPETQAAQW
FT                   EATTSVASIKTADEKKASHTALDSATYALLAAGLIGLGLARRKHA"
FT   CDS_pept        complement(116348..118324)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00840"
FT                   /product="predicted histidine kinase"
FT                   /note="silverDB:HdN1F112"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43667"
FT                   /db_xref="GOA:E1VFS5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS5"
FT                   /protein_id="CBL43667.1"
FT                   /translation="MSLSPANQVRWQILVLAVIGSIGFCVYVSAVFVIALNNEKRLTEI
FT                   VEIKQPLIEQLRRSEIACEQFRALLTNAISLEDLFMVEDAEAQTRIIASGLQAASQSDI
FT                   ANRTDSEALLTEFKAYWKDAIQIAHTLVEHPEKLYELQKQIESSTAKQAELNAQLSGIL
FT                   DRSLKNYRTELEQVGAAMQTTRHLGIFLGLLVILLMLGLAIAISSRAKNAITRSDRARD
FT                   EFLSTLSHELRTPMNGILGSLGLLRETSLSPEQQQLSGAANAAAAEMLLAVVDLLAFSD
FT                   FLNGRIQINKGPFSISQLLDEIIPRARDECAIKQISLQVTNDANPSRFAAQDADHDFTL
FT                   IGDQLHTAHVLRHILSNAIKFTEHGSIRVQLGLEDISATAASGAGLLWITVRDQGGGVP
FT                   EHLVNEIFQPFHQADAGFARKHGGMGIGLSICKTIIEALAGNIVFQNHAEGGAEVTIRI
FT                   PIEYQRSPRIHPSSTKEPTSTKQPPTIKGSADTGSAVSTAHPHQHEPDDTLKLHILVVE
FT                   DNKVNQMVINGYLKKMGCSVEVANNGQEGVDRLGDTTTNRPSFDLILMDCQMPVMDGFE
FT                   ATRRIRALPNPALAALPIIAVTANAMEGDRERCLQAGMNDYLSKPIDLPVLRSMICKTV
FT                   HNHHHTPQQGAHGTASLAQIAAR"
FT   CDS_pept        118642..119046
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00850"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F113"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43668"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS6"
FT                   /protein_id="CBL43668.1"
FT                   /translation="MWVLFPYESVRADIAVIVHPSNPVKSMDEEDLRRIYMGRMRLFPG
FT                   TSLGVEAVDLPEENPRFVEFYQSLTHLAPARLRRQRASFLFSGKGRLPRVVESEAEVLR
FT                   FVTESPAAIGYLDKSQVNGAVRVVAVVKEE"
FT   CDS_pept        119054..120367
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00860"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F114"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43669"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS7"
FT                   /protein_id="CBL43669.1"
FT                   /translation="MYIRLFAQSETNSAIKRKPRVSAAWRWWAFLLGTAFFGVPAAVSA
FT                   KVQWDFSGFASYGVGRLSDSSLELMNYSGGHWSSRSDSIVALQAIAQVGDRWSVTGQVV
FT                   GKAFSYDGKSAWTPRLDWLFVSYEATPDLRLRVGRLRAPLFLFSESLEVGYSYPWVRPP
FT                   LNMYANLLEPFSNINGMDVSLQKPIGDVENEFRMFAGTEKGKYRARKVSLDQSVGFSVQ
FT                   SKWRALTLRYSYDWFRVSIDDPSFVLPRTLYANYAERLNAPIFLEIADTLRLDNKVFQY
FT                   HSFGAQWEHGAWMVIAEQFSTQGPDRQFSFENDGRYVSLTWQIGNFMPYVTWSDYRSQV
FT                   QRSINGRIRHSFEAVPAGSEPLLDFLRNATIAGMDDVSVYQRSRALGMRWDFIDNADVK
FT                   LEFEYFTGMKSTGQMLFDDSKLEPDHVLATTIVFDVVF"
FT   CDS_pept        120384..121262
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00870"
FT                   /product="predicted extracellular solute-binding protein"
FT                   /note="silverDB:HdN1F116"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43670"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS8"
FT                   /protein_id="CBL43670.1"
FT                   /translation="MRFSEYCVLKIECAIRNWRIEWPLRLFVMVLGALGCFGGVHAEAG
FT                   SAVDAVAACRAGGVVISGGDTYPPLSWRRGDHLVGASVDMVTEILAGFGIHAKADEGGP
FT                   WKRVLLRARDGEVDILLGVRKAREYEHFLVYLEPPITPSVQGVFMLKGHEFSYKDWSDL
FT                   EGKSGSITLGTTFDKKFDAFAKSHLELQPVRRIEQNFFKLEKRRVDYMLAPSQPTQLYL
FT                   KRFGYQDKIVAAQEPLMILEEYIAISKKSPCIQLKDEISRAMRAWIESDRFDEAMEAAF
FT                   LNWFKVEGGEK"
FT   CDS_pept        complement(121304..123991)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00880"
FT                   /product="predicted histidine kinase"
FT                   /note="silverDB:HdN1F117"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43671"
FT                   /db_xref="GOA:E1VFS9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFS9"
FT                   /protein_id="CBL43671.1"
FT                   /translation="MYVPISLLHPRDGAFIRANRTQFSLPPPLNPARLKTTSSLRPKAC
FT                   CTGMNTTSDAHSSSNTDASNPAKDGASKPHATQSLASRLLRSILSIYFLIAVALTITQL
FT                   MYGFFDEQKRLDMEITHTSKIFEPIFAQALWNVDTEQTYSNMEGALANENLLGIQIKDE
FT                   HGSAIASLGAVLGDSKNQLCKHIDSIHLNPGKCSPLFTQLKPYEYPVFFNDNVRGAQLV
FT                   GSIVFYSSTDIAIKRSLSMFAITLANAVIKTLCLWAIAWFILQKLVARPLGLVARALDQ
FT                   LNPDEQTSARDTNDVNSPDPHAAECNEPHCNGCDSLDESYSQRQDELGVMVRSYFHLKD
FT                   ALLRKNAELSAYHSELEQKVEERTRKLEKANQAKSEFLANMSHEIRTPMNGVLGMTELL
FT                   LGTELNTRQQQYTRTIHNSALSLLGIINDILDYSKIEAGKLELESVPFNLEILVDDCTA
FT                   IFSLKCAQKPIQLTSRIAPGTPIDLVGDPTRLRQILINLTGNAFKFTEKGEICIGIEFL
FT                   EDHSKQVRLKFSIRDSGIGLSEEQIGKLFQSFSQADTSTTRKYGGTGLGLAICKQLAEL
FT                   MEGEIGVDSRLGHGATFWFTAWLGVEASPKADPSRKILEASMNGKRLLLVGPADHWREI
FT                   VAERAQAWNMDVSVAENIQQAAGLLASAQEAEKPISALLLGDPANALEQARTLAGHSAY
FT                   ARQKMILTHPANLPPTSPWLREQPLGRYLLLERPTPLQELRNLLGRASGADISTSEALS
FT                   KEQLTLPDLSHLRILVAEDNKVNQMVIEGLLKKLHANTTTVENGQLAVDACSTASPPFD
FT                   LVLMDCEMPQLDGWSASRQIRDRHTLRSNGAPVVIIALSAHAMNVEKEKAQEAGMNDYL
FT                   SKPISLSRLVEAFERHELHLRDDT"
FT   CDS_pept        124059..125999
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00890"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F118"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43672"
FT                   /db_xref="GOA:E1VFT0"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT0"
FT                   /protein_id="CBL43672.1"
FT                   /translation="MYTPDYRQRQMRRFRRILRRYFGRISTSMLNEVLSACEWMELEGG
FT                   ELLFGQGDPGDAAYFLIAGRLRAIRFHPDGSFRPLGEIRPGEIVGEEAVLAEDRRGAMV
FT                   RATRDSVVVRLPTRELRAWFLQYPQLLLKTAQLIIARSRQNTGMRYVEHVCNLALLPLS
FT                   VGVDVASFREAFAQALEQLGRVLIISARDVDQALGEQGIAQVGRGDTARYRQLSAWLDS
FT                   LENRFDHVVYLADPADDAWTQRCLRQADRIVLLGDAQQSPRVAAFEPSLMAQAAARGQT
FT                   EVLLAIQHPASTVMPENTRSWLADRPWVSEVVHVRQACSRHLQRLARIATGKAVGLVLG
FT                   SGGARGLAAVGILQALEEAGVPVDRVGGTSIGAIMAATVALDLPAGDAVELARQSFSQN
FT                   PTHMKDLSPLPILAIYRGKRLNGLLQTTFPEQLHIEDLWINFFCITSNMASNGEVVHTR
FT                   GPVWKALRASASLPGIFPVVRLEDGLHVDGAFLNALPVDVMAARGVHTILAADFSSMPS
FT                   PALRQATGEVEVAEEPSRLRDYLREHLLGQQGHTYPVPNLLSGLIQSSLMASSQRSLRA
FT                   RAEADVLFAPDLQRFELLGWHCFDDLVAIGYKHAQKVLADQSRGGSEPSVMRSLRALSS
FT                   TRSPSPFQEDR"
FT   CDS_pept        126135..127136
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00900"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F119"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43673"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT1"
FT                   /protein_id="CBL43673.1"
FT                   /translation="MSRGDRGIMNFNKSFTLEQLAAYLANPDTQRPFARYREELLEPEP
FT                   AFTTEEAARLIEIVRMDIPQYSKFSVGKLLVDLSWASSHLEGNTYTQLDTQVLIEYGKI
FT                   NKDKPAEDAAMILNHKKAIEYMVSNVALSEKNVRMIHKALSDNSMAPESRHFLEQDKCG
FT                   MIRSYTPSGLYIAGSSYMPPQAEDRSFGYIDKEFGKLIASAGALPDAVNKSFFVMTRIP
FT                   YLQAFYDANKRTSRISCNIPLIEDGLSPLSFVDFEKRRYLEGMIAFYELGDERLAKNAY
FT                   LDAYLASAFRYLPFGEDAKFALSAERDKHLAAARRYVVAGVREAEPVWLRIK"
FT   CDS_pept        complement(128206..128919)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00910"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F121"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43674"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT2"
FT                   /protein_id="CBL43674.1"
FT                   /translation="MTEAVAAKKKAQSTPTAAQVADYLRKHPEFFDQQEQLLADLQLPP
FT                   AHGTAAISLSDRQVRIMRERNTELRNRLSQLVAVARDNERLFEQIRRLGLALLEADSLD
FT                   AVVSTIQNSMCRDFHMDHAHLFLYDAAIQNRSTPLVHAFVTTLSQAQAQETVGSRLQDN
FT                   QVSCGAFRNTELALLFPQQEMQQGSAALIPLHYQHPLGVLAIGSNDPSHFSPSMDRLFV
FT                   SWMGDAIARRLATFL"
FT   CDS_pept        complement(128916..129920)
FT                   /transl_table=11
FT                   /gene="dapF1"
FT                   /locus_tag="HDN1F_00920"
FT                   /product="Diaminopimelate epimerase"
FT                   /note="silverDB:HdN1F123"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43675"
FT                   /db_xref="GOA:E1VFT3"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT3"
FT                   /protein_id="CBL43675.1"
FT                   /translation="MKRKPNARRRKRTRAPRATYTRNTTGRLQFTKMYASGEDFLVIDL
FT                   VSQYYRIEAQQIQRLAHPQLGIVFGALLMVLPPATPDADFRFRLFTANGEEIGRAQEAT
FT                   HPAHLLEMLGAARCVAQFVRQRQLTNKHQLLIETPLGELTVQIGEFEEACIDFLPPAWA
FT                   NTFTKSQSFNLVTPSHSTPVTLIHTPAGETGTHSHALLMADNMDRKALQAIASALENHT
FT                   LFPKQATIMFMQVENRKRVHLRFFRARTESTFLTEDAGAAGALEVGGRDTDAFIAAAVG
FT                   LRQQLIDHPVQVLLHAPTPGFSAHTLGIHWQGDNQVMRLGGTATTVFEGSIAL"
FT   CDS_pept        complement(129917..131185)
FT                   /transl_table=11
FT                   /gene="lysA"
FT                   /locus_tag="HDN1F_00930"
FT                   /product="Diaminopimelate decarboxylase (DAP
FT                   decarboxylase)"
FT                   /EC_number="4.1.1.20"
FT                   /note="silverDB:HdN1F124"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43676"
FT                   /db_xref="GOA:E1VFT4"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT4"
FT                   /protein_id="CBL43676.1"
FT                   /translation="MSSAFHYQNHELHAEQVNLTQLAEQVGTPAYVYSRSAIEQQWLAF
FT                   DRAFGAHPHLVCFAVKANSNIAVLNLLARLGAGFDIVSEGELERVLRAGGDPKKVVFSG
FT                   VGKQPAEMARALTVGVRCFNVESESELHTLNQVAATLGVKAPVSLRVNPDVDAQTHPYI
FT                   STGLKENKFGIDIDRALQVYRDASELPHINIVGVDCHIGSQLTQLAPFLDALDRVLVLV
FT                   DALKAEGIALRHLDLGGGLGVCYRNEQPPSPSDYVQALLTRLGQHPEFGKQGIEIILEP
FT                   GRAIVANAGVLLTRIMGLKETPARKFAIIDGAMNDLIRPALYGAWQEIVAVKERQDSPE
FT                   ATYDIVGPVCETGDFLGKERALRIQQGDLLAVKSAGAYGFVMSSNYNTRNRAAEVIVDK
FT                   EQFHIVRARESYDYQLQLESLVP"
FT   CDS_pept        complement(131528..134425)
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="HDN1F_00940"
FT                   /product="Adenylate cyclase"
FT                   /EC_number="4.6.1.1"
FT                   /note="silverDB:HdN1F126"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43677"
FT                   /db_xref="GOA:E1VFT5"
FT                   /db_xref="InterPro:IPR000274"
FT                   /db_xref="InterPro:IPR024685"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT5"
FT                   /protein_id="CBL43677.1"
FT                   /translation="MSEHQIIAPQIKEGIDRKQLKTLKGRFLAVNAERLRRTLEGLSPK
FT                   RQQFLHALPLLLHVNHASLPGYITPKTPVGVRHFVPEKHHLLAARNIARAFTYNGSKLN
FT                   EPDLLGIFLMGSTGTIAQSEKSDLDFWICHRSDLPPKALQELQDKLTAISRWASGIGLE
FT                   AHFFLMDAERFKRGERGDLSGEDCGSTQHYLLLDEFYRSSLLIAGCAPLWWMVPAYEEK
FT                   FYDAYASEMLQKRFLEATDFIDFGGISDFPAGEFVGAGLWQLYKGIDSPYKSVLKIILT
FT                   EVYASEHPNVECLSVGFKKALYHGETLLDHVDPYVMMYRKIERYLESRQEFRRLELVRH
FT                   CFYFKVGESLSRDASGKPTGWRFQLMERLATQWHWDTAYIKALDNRKRWRVVRVQQERQ
FT                   ELVHELNYSYRLLSSFARQGAIESSIRQQDMQVLGRRLHAAFERTSGKVEQVNPGMAHD
FT                   LREDALSLHYIYDAENPSLDHYWVVQRGYVKARDIQNTQEPLRKSRSLIELLAWCIFNR
FT                   LLDESTHISADCEGSDLTETELKRLTQHFFQQFPTGAPVAQESAFSEAARPSAYLLFIN
FT                   VGLDPLRELTRRGIHRLSNQTDALSYSAMRHNLVLTVDQVLFNSWGEVLCSRYDGETAL
FT                   LDCLQEFLRRSLPGNPLPEVQIRCECPTRPTAIVARVEELFADLSLHFCQSERAATTRY
FT                   LLEMEQQYFLLRLKDGVPLLKRAQSREELLERLAEPHPRYSPIVPDRRALNRDPLREVL
FT                   LASAPNCIQVFYQRRDDWVVIYVLDENGCLFHTTRPWNKEGSVLAHFQHFFESVYLRRQ
FT                   AISQRLPDALMVPRYYELITTGETTRREARPTPSASPLRPWHNVQAFAEHGNHEGLSFT
FT                   IRCDGADFSELEHGARLYERVAEFITQRRHNQARYPCYITDLDLMPLANNTPLQPSTCD
FT                   YLRHKELLEQAINRALYPQGPASEPQPPQHEPQAR"
FT   CDS_pept        134618..135844
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00950"
FT                   /product="probable diguanylate phosphodiesterase"
FT                   /note="silverDB:HdN1F127"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43678"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="InterPro:IPR014408"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT6"
FT                   /protein_id="CBL43678.1"
FT                   /translation="MNIFLARQPIFDRNLCAVGYELLYRAGAENSAAGMPEGSAATMQV
FT                   LVNAFSEIGLENITSGLPALVNITQSMLSQGLLPKGLQKLLIPEVLEDVLVNSNVTQEV
FT                   KNLLALGYRVALDDFVYATQWNPLIPLASFIKLDVRALTPAGVEEQLALLNSVADVSGK
FT                   LLAEKVETHEEYELYRNMGFDFFQGYFLCKPQIMSGRSIPASYLVILSLLAELANDDYD
FT                   VRRVEQLICQDPRLSYKLLRVVNSASFGFARSIKNIGETVIVLGAYELRRWAGMLALSN
FT                   VDSKPNELVVTAIVRAKMCELLAARLNYGEPSTCFTAGLLSLLDALLDQPMQALVEKIP
FT                   LSSDLESALLERSGKIGRLLSVVEAYEAGRWQDPSSNTLSNPFTADILLESYMGALQWS
FT                   ETLKAALFH"
FT   CDS_pept        complement(135841..137241)
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="HDN1F_00960"
FT                   /product="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="silverDB:HdN1F128"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43679"
FT                   /db_xref="GOA:E1VFT7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT7"
FT                   /protein_id="CBL43679.1"
FT                   /translation="MSTSQKDKPWGGRFSEATDAFVEAFTASVQFDQKMAMQDINGSIA
FT                   HATMLARTGILTDDERENILLGLEQIRNEIQSGSFDWSIKLEDVHMNIEARLTERIGIA
FT                   GKKLHTGRSRNDQVATDIRLYLRDAIDAICAEITRLQHGLLELASREADTIMPGFTHLQ
FT                   TAQPVTFGHHMLAWFENLSRDYERYIDARKRVNRMPLGAAALAGTTYPIDRNITRELLG
FT                   FEALCENSLDAVSDRDFAIEFTAASSILMTHLSRFSEELVLWTSAQFNFIDLPDRFCTG
FT                   SSIMPQKKNPDVPELVRGKSGRVNGHLIALLTLMKSQPLAYNKDNQEDKEPLFDTVDTV
FT                   RNCLRAYADMIPAIEVKREVMREAAKRGFSTATDLADYLVKRGVAFRDSHEIVGKAVRY
FT                   GVENRKDLAEMSLEELRQFSDQINNDVFEVLTLEGSVNARNHIGGTAPVQVRAAIARAQ
FT                   NRLAKRLD"
FT   CDS_pept        137277..138407
FT                   /transl_table=11
FT                   /gene="fimS"
FT                   /locus_tag="HDN1F_00970"
FT                   /product="Sensor histidine kinase"
FT                   /note="silverDB:HdN1F131"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43680"
FT                   /db_xref="GOA:E1VFT8"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT8"
FT                   /protein_id="CBL43680.1"
FT                   /translation="MKGKKVYHRGARTELSRSAHAAEIGDAEGFFLPNPCQNEALLLIV
FT                   LAAELFALLITLIKSGMIGFDWGQLALISVLVQAISLSSAFVLCRLRPWLLRLPSRRAV
FT                   AIAFAVVPTLTWLLDGLAMMLLHAPNRDSLALWWSDEVLRDVAVSILLTGMVFRYFYLQ
FT                   AQLAARQQAELRHQLQALQSRIQPHFLFNSMNSIASLITIDPVAAEQAVEDLSALFRAS
FT                   LSEVGNQVPLSTELDLCRRYLRIEQLRFGKRLRVHWALNLASEDVLIPLLTLQPLLENA
FT                   IVHGIAPLQNGGEIQIECIQQRGLLEIKVVNPNPAANSEAGTPEEGANEGGNQMALANI
FT                   RSRLSVLYGSRAKLAAYAEKGRYICHLSYPVSARRG"
FT   CDS_pept        complement(138408..139274)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00980"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F132"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43681"
FT                   /db_xref="GOA:E1VFT9"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFT9"
FT                   /protein_id="CBL43681.1"
FT                   /translation="MSDTAIITCALTGVLTNPQQHPVPVTAEEMATAARQAYDAGASIM
FT                   HVHFRCQVPGKGHLPSFEPEVAALVSDAIREKCPGVIINMTTGVPFRDQSGPISCLRAI
FT                   KPEMAACNAGSLNYLKAKADGTWAWPPMLFSNPVDKVSELVEVMKETGTLPEFECFDVG
FT                   IVRSVNMYVDVGIVKNPEYNFVMGVASGMPADPELLPLLLKYMRPGHGWQVTAIGREDV
FT                   WPLHQKAAELGGHLRTGLEDTFYMPDGSKASDNGQLIEALAKCAERAGRKVATPAEARK
FT                   ILHLKPA"
FT   CDS_pept        139586..140365
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_00990"
FT                   /product="LytR family response regulator receiver"
FT                   /note="silverDB:HdN1F133"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_00990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43682"
FT                   /db_xref="GOA:E1VFU0"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU0"
FT                   /protein_id="CBL43682.1"
FT                   /translation="MRILICDDEPLARERLKRLLAEIPEANYVGEAENGIDLLEKAARL
FT                   RPDVVISDIRMPVMDGLEAAEQLAKLPEAPALIFCTAYDAYAIRAFQVNAVGYLLKPVR
FT                   QQDLAQALAQAQRLTRAQLQSLRESAAATVTATASGAMAAPSDTRSARKYIHARTHRGL
FT                   ELIRVDEIRCFVADQKYVTLFHGEGSVLIDETLKDLESEFAERFQRIHRNCLIQMDYLE
FT                   SLEQVGGQIYAQLRGLNMPLLVSRRLLPVLRKTLKNH"
FT   CDS_pept        140470..141405
FT                   /transl_table=11
FT                   /gene="hemC"
FT                   /locus_tag="HDN1F_01000"
FT                   /product="Porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="silverDB:HdN1F134"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43683"
FT                   /db_xref="GOA:E1VFU1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU1"
FT                   /protein_id="CBL43683.1"
FT                   /translation="MSNHRIRIATRESALALWQAEHVRACLLAAHPGLDVEIIGMTTKG
FT                   DKILDTPLAKIGGKGLFVKELEVAMLEGIADIAVHSMKDVPVDFPEGLGLSVILEREDP
FT                   RDAFVSNQYDTLDQLPLGARVGTCSLRRQTQLRARRPDIEILELRGNVNSRLAKLDAGQ
FT                   FDAILLAAAGLKRLGFHERIRATLDPAASLPAVGQGAIGIECRTDDARTLALLAPLNHP
FT                   DTHTCVSAERAMNHRLQGGCQVPIAGYAELHGDQLYMRGLVGEPDGSRILRAEIRGARA
FT                   DAAALGAALADDLLAQGAKEILARLYQSGH"
FT   CDS_pept        141538..142365
FT                   /transl_table=11
FT                   /gene="hemD"
FT                   /locus_tag="HDN1F_01010"
FT                   /product="Uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="silverDB:HdN1F137"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43684"
FT                   /db_xref="GOA:E1VFU2"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU2"
FT                   /protein_id="CBL43684.1"
FT                   /translation="MSSDPLNGLQVLVTRPQPHGERLAARVQAAGGEAFVYPVIDIVPR
FT                   ELTPTEQNCIAELDRYSGVISVSVAASELGVEACEARWPQWPLDQTWYTVGPASGKPLE
FT                   GRGLNLHIAVAGSSSETLLALPEFQADHVAGQRFLILRGKGGRELLANTLRERGAQVDF
FT                   VELYTRPPAANDPACLQRFLTSSAPRVALITNGESLQQLLLQAGEGRERLLQCPVIVVS
FT                   GRLADYAMQQGFTEVHTASGAHDDALLASLCSFADAAQISPQHPSQPHFSSKT"
FT   CDS_pept        142446..143705
FT                   /transl_table=11
FT                   /gene="nirE"
FT                   /locus_tag="HDN1F_01020"
FT                   /product="Putative uroporphyrin-III C-methyltransferase,
FT                   initiates heme D1 synthesis"
FT                   /note="silverDB:HdN1F138"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43685"
FT                   /db_xref="GOA:E1VFU3"
FT                   /db_xref="InterPro:IPR007470"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU3"
FT                   /protein_id="CBL43685.1"
FT                   /translation="MKAAPAAKPLPTPKPAPAVKPAPAPKPARSGGGGFTTTLAALSFL
FT                   LAGGAIGGVGFLWWQQQQENPVVHNAIDALEAGVADVNNGLTSARQQFTQATASQKQLQ
FT                   EQVAKLGGERDMLQQHLDNIEQRIVRVLEGSSRVDWMLSEAAQLVNVAERRLSLLGDVN
FT                   GGLALLESAEKIVAAMDEPMARPFRQALLNDIQALRGAQGEVIDTEGLLLRINSTKRLV
FT                   EALEPPRPNFKIDRVETPESVAPGTSGIELAWHKIGTFMGSLVDFQRHKQPIVGIAVDP
FT                   QTRFVMQQGLLLLLDQAQLSVLRGDSSTYGLALKEVADRVERYTQSDSKTGKHLLAELK
FT                   LLAEQPVKQRVPEISESLLAMHAFRDAWNQQRPAREAAARRVEAAAPSDAQQPNAQQPE
FT                   ASTGNQTGTSALDAAQRRLP"
FT   CDS_pept        143720..144970
FT                   /transl_table=11
FT                   /gene="hemY"
FT                   /locus_tag="HDN1F_01030"
FT                   /product="porphyrin biosynthesis protein"
FT                   /note="silverDB:HdN1F140"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43686"
FT                   /db_xref="GOA:E1VFU4"
FT                   /db_xref="InterPro:IPR005254"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU4"
FT                   /protein_id="CBL43686.1"
FT                   /translation="MLTLRTSTLIFFAVAVVLVSMFCAKLARNPGYVLLSYRYYTLETS
FT                   MLVGFLSIVLLVVLSIVGYRLTVWLFDSNWRRRMANRKTMRGLIAYAEGNWPQAEKLLS
FT                   RSAGNNDAPLINFLAAAEAAHQQGKTEKRDDYLLQAHETIPGVEQSVGLAKARFQILSE
FT                   QWESALATLRMLKQNPKSPGYPFVLKLLAQTYNELADWPALRDLLPELQKQQVLEAAEF
FT                   DVLTQRCLEGQLAAAVRGTTEEGARLNLRGVWDTVPKKMRYNADLILGYAQRLAEAGAS
FT                   KEAEEVVASFLRKNWDERLVRLYGTIQSPDPAKQLQHAEGWAKEHPMDAALLLALGRLS
FT                   LLNQQWEQAHRYFESSLNARKSAEACGELGRLLASLGQHDRSNEYFQQGLAMLAQRLPV
FT                   LPQPKAAAATAEETVSG"
FT   CDS_pept        complement(145103..146362)
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="HDN1F_01040"
FT                   /product="Transcription termination factor Rho"
FT                   /note="silverDB:HdN1F142"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43687"
FT                   /db_xref="GOA:E1VFU5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU5"
FT                   /protein_id="CBL43687.1"
FT                   /translation="MNLTELKQKPVADLVHMAEEMGLENIARTRKQDIIFAILKRHAKG
FT                   GEDIYGDGVLEILQDGFGFLRSSEGSYLAGPDDIYVSPSQVRRFNLRTGDTISGKIRPP
FT                   KEGERYFALLKVNDINYDVPASTKNKVLFENLTPLFPQQRLKAELGNGSTEDITARVID
FT                   LVAPFGKGQRGLIIAPPKAGKTMMLQNIAHSISRNNPECILIVLLIDERPEEVTDMRRS
FT                   VRAEVVASTFDEPPTRHVQVAEMVLEKAKRLVEHKKDVVILLDSITRLARAYNTVIPSS
FT                   GKVLTGGVDANALERPKRFFGAARNIEEGGSLTILATALVDTGSKMDEVIYEEFKGTGN
FT                   MEIHLDRRVSEKRVFPAININKSGTRREDLLTSEDELKKMWILRKILHPMDEISAIEFL
FT                   IDKMRDTKTNDEFFDSMKRK"
FT   CDS_pept        complement(146738..147064)
FT                   /transl_table=11
FT                   /gene="trxA"
FT                   /locus_tag="HDN1F_01050"
FT                   /product="Thioredoxin"
FT                   /note="silverDB:HdN1F143"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43688"
FT                   /db_xref="GOA:E1VFU6"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU6"
FT                   /protein_id="CBL43688.1"
FT                   /translation="MSNNILNITDSTFEAEVLSSDSPVLVDYWAEWCGPCKMIAPILEE
FT                   VATEYAGKVKVAKLNIDQNPGTPPRYGIRGIPTLMLFKNGNVEATKVGALSKSQLTAFL
FT                   DSNI"
FT   CDS_pept        147406..148956
FT                   /transl_table=11
FT                   /gene="PPX"
FT                   /locus_tag="HDN1F_01060"
FT                   /product="Exopolyphosphatase"
FT                   /EC_number="3.6.1.11"
FT                   /note="silverDB:HdN1F144"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43689"
FT                   /db_xref="GOA:E1VFU7"
FT                   /db_xref="InterPro:IPR003695"
FT                   /db_xref="InterPro:IPR030673"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU7"
FT                   /protein_id="CBL43689.1"
FT                   /translation="MATIGGCVNPQARSDQNSGQLMAAIDMGSNSFHMVLARLEGGEVR
FT                   LVRKLGEKVTLASGLNDCVSLSDEAIERGLACLRRFAQLTANVDPAWVRCVGTSTLRRA
FT                   KNAESFLVQAREILNCPVEVVAGREEARLIYLGVSHSLPDTDGRRLVFDVGGGSTEFII
FT                   GERFNPLLTESRHIGCVEFRDSFFAGGKLSARAFQRAVTAARREVASVEVAARALGWSR
FT                   VFGASGSVRAVEKTAIACGYVSQGVTLEAMYKLRERVLLARTFAEMEIPGLKEDRRSVF
FT                   PSGLAIIIAVCEQLKIESLQTTDGALREGLLYDMLGRLATEDVRERSIRAMMGRYSVDV
FT                   AQANRVQALAMVLLDRVAKPWCLESDEWRECLGWAALTHEVGLIVSHSGYHKHGAYLLT
FT                   HTDLAGFTRQEQLIVASLVISHRRKMRVSYFDALPSADRPACVRVALLLRLAVVLNHSR
FT                   CDANLSELQVMADADGVSLSFPEGWLSERPLTEADLQEEVQVWKQFGGVLNIFERVPS"
FT   CDS_pept        149005..150990
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01070"
FT                   /product="probable sulfatase precursor"
FT                   /note="silverDB:HdN1F145"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43690"
FT                   /db_xref="GOA:E1VFU8"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU8"
FT                   /protein_id="CBL43690.1"
FT                   /translation="MRCCVLLPAFRFLRLVFVGSTAHAAQLIRFVLWSVCAALVFGLAG
FT                   CGESSNRNGPPSTDVTPEHPNILLVLVDDLGVNDIASWGDGSAQTPNLDKFSSESVRLR
FT                   RDYGDSTCSPSRASLLTGQYPARVGFLPIALGLSPDLPTLPGSLKSLGYSTFHVGKWHL
FT                   GEALEYPEIQPSYHGFDYWMGFLNHFVLQGPDETGKLVSRVPTHINPWLQENGAPPVQR
FT                   MGYLDDLLVDKAVELIENTGEKPWFINLWLYSPHTPYQPAPQYARRFPDTEEGKYLAVL
FT                   NQLDDNVARLLAALKQKGVDDDTIVVFASDNGGPNRARNNNLPLQGLKATYTEGGVRTP
FT                   VMVRWPARFSSRDVVQPTQLVDLFPTLVALAGGTAPAGLSGRNLVSVLAGEGDEGSIEP
FT                   LDRLFWVADTGRAGSTWAIDDFASGWGYYHGGLADFLVEPLAPAIGSSGVFASGSSVDK
FT                   REALRQLAEWESSARRVPLKWHEANAQQPAYLSGRDFQRAPAFGPYSIGFALPALAAGQ
FT                   EQTLVDQAGVWRLWVDPTRRLGVRYDGVELLSQPLAMEEGCNSLVVSVEVRPEVRMPIR
FT                   NEAYSRVSVYLNGARVLDDSTLLKRPASASVFAHPTTIGANTDGSNPLGVQTGEPIVFS
FT                   KFFTGENQDGYSLQAFTKALCPAPTF"
FT   CDS_pept        complement(151056..155003)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01080"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F147"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43691"
FT                   /db_xref="InterPro:IPR007739"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFU9"
FT                   /protein_id="CBL43691.1"
FT                   /translation="MTQRKHPKRCLIVVLGMHRSGTSAITRALQTLGVELGDNLLAPMP
FT                   NNNEKGFWEDLDILDLNTRMLAALGLDWDSLPVASQEQVESDALRSFREEATQTLQQKI
FT                   KNSSHFGIKDPRICLLLPFWKPIFQQLNLNVFYVICVRHPLAVAQSLARRDQFSIEKGL
FT                   QLWLGYSRTILAQTSNDPHVFLEYEFLLQAPEYSLKRIAKLVSLPVPKSSDLRLQDYKR
FT                   EFLSNDLNHFQTPTPQGLEIQAYAPAALLHIEMLESCYSDVSKALLPIRSQRFQKNLEA
FT                   FFQQFIGENTHDRANIEELKSSLQALRDESAREQRTLESLRSRIASLEEHNREARAALA
FT                   ALFASTSWKITAPLRFTRYLMDRNSQEAAAMLFPRLRTITRTFLEKLPTPLRYRLQAFL
FT                   RTLAHRLLPNAVQGRLAQTATNHPYPEQLKQLHELTLPKHTSNATIAIHIHLYYADLAP
FT                   TFVQALSRMERPFDLYISIQVRANPVEIEAVVRKIPCLRGLDIRATPNLGRDLYPFVCI
FT                   FGEALRKYDIIAHLHSKKSLYNQGATAGWLEYILDSLFRSPEDIARILERLSDASQTGI
FT                   VYPQNFSGLPYMAYTWLANRSRAQQVQARFGLTSLPSGYFDYPAGSMFWARADAIAPFF
FT                   EAQLNEDDFENESGQTDGTLAHTLERFLVLVPESLGFRHTILADQGSQDWSPWRFGQFF
FT                   SRTQTVVTQQILANHAELILFDIFDTLLTRPLTDPDAIKQLVASQLAPKIAEAYSEYRQ
FT                   IAEQQARTSKGSDVGITEIFAAFEKLSRLNPAEVAQIKALEISTEIASVRPRHDAIQLL
FT                   ETAMRSGKRVALASDMFLPAETILEMLHRCGIHNPPKLYLSNAEGFRKDEGTLYSHILK
FT                   QESVSADRTLMVGDNERSDFQIPCDMGMQFLHILRPTEIARASSRFAKLLAEHHASEFD
FT                   PDREILLGMLVQRNFGRIFYSELPHGGFSPSDLFSPTAEDIGYSLLGPLAVGFAQWVAE
FT                   IASQDAIDQLYFLAREGEFLKQVYDLWHEQTGLGPPASYLCVSRRAVTVPAIQTFEDIK
FT                   AIAEPNYFRNSLRNFLLERFGVQLSDEESITLETNGLWKQNRALEINDQNPTHILPLLQ
FT                   HLTPRILQQAAEESEALRLYLSACGLYGARKPAVVDVGYAGSIQSALCRFTGRKIHGLY
FT                   FATNTRAQQVADQNQVSIQACHANFVAEKSLEPALYSASFELEKLLSSNEAQVVRYYLD
FT                   SEGKTIAEHRTLSHQETESENTRRQIRKGAIAFLQDHLEVRRTLFPHHRVPNPLARELY
FT                   ARFIHPLSDTERQIFKSLALDDFYCGRGVVS"
FT   CDS_pept        complement(155016..155831)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01090"
FT                   /product="similar to Teichoic acids export ATP-binding
FT                   protein TagH"
FT                   /note="silverDB:HdN1F148"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43692"
FT                   /db_xref="GOA:E1VFV0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV0"
FT                   /protein_id="CBL43692.1"
FT                   /translation="MIADTVPNREVFVEHNNTNARRVLIRADHVGVSYRRHLGLLKHDR
FT                   FWALRDISFNVGAGETLGIIGGNGAGKSTLLRLIAGITTPDRGTIYRRPKTTSSLLALN
FT                   VGLKPELSGEKNAILGAMLLGLRYQEARRKLPEIREFSGLGEFFDEPVITYSTGMKARL
FT                   GFSVAMHADPDILLIDEVLGVGDQDFKERSTEAMKAKIRSNKTVILVSHSLESVSELCT
FT                   RVLWIEKGATIFCGDAQTALHGYKEAIKQAMHEARIAQQNKSSSLTTPA"
FT   CDS_pept        complement(155847..156602)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01100"
FT                   /product="similar to teichoic acid ABC transporter,
FT                   permease subunit (TagG)"
FT                   /note="silverDB:HdN1F149"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43693"
FT                   /db_xref="GOA:E1VFV1"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV1"
FT                   /protein_id="CBL43693.1"
FT                   /translation="MRNLEILLYGVYSDLQTEISRKLLGFLWWIIEPVLYMGTFYLVFG
FT                   LAMNNRTPDYVPFLLTGMVAWKWFDGSVRLASSAISNNMGLIQQIDIPKILLILMPILS
FT                   NTFKFFIILAILLIFLRIRGHHESWQLAYLLPVMLTQLVLIVALSVFLGSLVPFISDLK
FT                   QVIDNFFMLLMFMSGIFFTVKDTQGFVAAAFDYNPVFRIISAYRDVLLYAGVPEWSNLI
FT                   YPLAFSAPILLVGFVVLNKFERHYPKLTT"
FT   CDS_pept        complement(156737..157774)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01110"
FT                   /product="glycosyl transferase"
FT                   /note="silverDB:HdN1F150"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43694"
FT                   /db_xref="GOA:E1VFV2"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV2"
FT                   /protein_id="CBL43694.1"
FT                   /translation="MSPSASKIGVAIVNWNSFGLLDLCLQHIDRQTVDISRVIIVDNHS
FT                   ASQPAQTPRSTRFETDYILLPENTGFAHANNLAIEQLKNCEWVALLNPDAFPSPTWLET
FT                   LLQVAKHHPDVASFAGPTLMARNPHLLDGAGDAYHLSGLPWRAGYGQPKSTLPDSAYEI
FT                   FSACAAAALYRRSALTDAGIFDEDFFCYCEDVDLGFRLRLLGHKALFVPQATAQHVGSA
FT                   TSGGRHSNTSLYYGHRNMVWAYVKNMPSPLFELLLPLHLLAAIVVWARFCLRGQGSIIF
FT                   KAKRDAIRALPSMWRKRRSIQARRKASVREIWAVMEKGADRSHTLHSQNKLQQAKPNLG
FT                   TIRAR"
FT   CDS_pept        157814..158866
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01120"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F151"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43695"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV3"
FT                   /protein_id="CBL43695.1"
FT                   /translation="MWHKVWKDVNGRFHPKISCRTEASCRTIGHRKHSSRPCKSKAGSA
FT                   LLRVGEKNDKRRADRISFAVLLFARTLYGHNPVLASLKRMKNLIQKIKSVRKPKTTMVE
FT                   GVAPRLQNHSQSLLRSEVITPSVTMVLGMHRSGTSFLTGSLQEAGLELGKHSAWNPHNL
FT                   KGNRENEDIVALHDDILARNGSAWDQPPSTEISWQEHELARARAIALSYDGVPHWGFKD
FT                   PRVLLLVEGWQSVLENLGFVGIFRHPVAVAQSLNARGGMPQSQAFALWLAYNQRLLALY
FT                   QKQPFPVLCFDENEDVLLNKLDLVLRKIGLEVPKQERFFSSELKHHSATDITLPEPLMS
FT                   TYNALCVIAI"
FT   CDS_pept        158869..159795
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01130"
FT                   /product="predicted glycosyl transferase"
FT                   /note="silverDB:HdN1F152"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43696"
FT                   /db_xref="GOA:E1VFV4"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV4"
FT                   /protein_id="CBL43696.1"
FT                   /translation="MNMLSFRKPRLSIVLIVYKMPDQAEKTLYSLSPHYQQDVSAHDYE
FT                   VIVVENASDRLLGAERACQYASNVRYIVRNETQRTPVHAINHGASLARAGHLVIMIDGA
FT                   RMVTPGIVRAALDVFRLAPEAAISAPGFHIGEKLQQVAVNEGYDEAAEAKMLQRIDWPK
FT                   DGYRLYEIAVLAGSCQGGFFQANYESNFIGMSVKKWRALGGVDSRYNDYGGGNANLDLY
FT                   KRLLEYPETPFYMLFAEGTFHQFHGGVTTGTLKEERDRVYHLLDEQDIAIRGENRKPPH
FT                   RQPILFGKVHPSVYRFLRHSLNIVDPQ"
FT   CDS_pept        159886..160647
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01140"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F153"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43697"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV5"
FT                   /protein_id="CBL43697.1"
FT                   /translation="MTAIYLPPSIRHFEPKHMVFSTWVDHLAFGYDLVASIRPKLLVEL
FT                   GTHKGLSYFTFCQAMKENEIDGACYAIDTFEGDAHTDKYDESVFTAVNAHNREHYHGFS
FT                   YLMRMLFDDALRHFDAESIDLLHIDGFHTYDAVSADFQNWYPKVKPGGIILFHDVMARL
FT                   EDFGVWRFWNEVKEQHESFTFVHGFGLGVLRKAGGDRSVDPELLRLLFNDSSEQAQAKM
FT                   RAFYVHASKHMENTRKLKRLLKSKDTESNKS"
FT   CDS_pept        160686..161843
FT                   /transl_table=11
FT                   /gene="yrhL"
FT                   /locus_tag="HDN1F_01150"
FT                   /product="Predicted acyltransferase"
FT                   /note="silverDB:HdN1F154"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43698"
FT                   /db_xref="GOA:E1VFV6"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV6"
FT                   /protein_id="CBL43698.1"
FT                   /translation="MAPHQVRFIPELESARGWAILLVVLFHYLGILNLQQMPAEGVWQR
FT                   LISAGNTGVTLFFVLSGFLLSRPVVAAFQTDNSGAFRSFVIARVLRIFPLYYLVVLAAF
FT                   LFTSKLVALKGLLFIPIGFAAFPYSVPWWSLSVEMQFYVFLAVILLGIRYGAGRWWIAG
FT                   LVGVFIVWHILLLSGQVFSRTYAWHNSFPGRFPAFLFGALIAYVYDRDLDTPWGRRRVA
FT                   FYRILSGTALAALLGLLYWYGGHRQEMVLRIFPAFHDLEALLWALVLLCLLRVRSRLKR
FT                   LFVNRVMNYFGEISYSVYLLHVPAIFYITYPFVLAVNSSTANAAVERALAELVFALALS
FT                   VAATLGLSTLSWHWIEKPFLSLKRMFRTEKGKKAAIKNAKNVELT"
FT   CDS_pept        complement(161854..162600)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01160"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F155"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43699"
FT                   /db_xref="GOA:E1VFV7"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV7"
FT                   /protein_id="CBL43699.1"
FT                   /translation="MSESNFLLDYEKLSWLGDELRATYQANTPFPHIVIDQFLPEYSLQ
FT                   RLQKEYPTDQSLPAWNEASYKDKVSGEFVQKNKRNIRDIIQMPPAYRQIIWELNSAPFL
FT                   GFLSRLISIDNLIPDPNLRGAGIHQTGHDGYLKVHVDFTYHRDFGLDRRTNFLLYLNDE
FT                   WNPDWGGQLELWDPEMKGPPKCVMPIANRCVIFTTTASSYHGHPRPLCGPPEVFRKSLA
FT                   LYYYTNGRPEGEAEPVFSTDWKDVPY"
FT   CDS_pept        162718..163716
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01170"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F156"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43700"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV8"
FT                   /protein_id="CBL43700.1"
FT                   /translation="MMSNDTNPLLSIIVIVYDMPRQAMNTLMSLSAGYQLGVDATQYEV
FT                   IVVENSSANLIPPTEIRSLPSNFQYYCRDNLGVSPASAINFAALNARGKYLGLMIDGAR
FT                   MVSPGVIRNVLMAFRANENALVVVPGYHLGHQEQQYHLTHAYTEASEIALLESIAWPKH
FT                   PYRLFEIAVWSGANSHGFFHPFMESNCLFMPFGVFDALGRADERFQCPGGGMLNLDIYR
FT                   RAALHLDTELFMLAGEGSFHQLHGGVTTSEVVDRKAILRRQLDEYATIRDTPFRSPTIE
FT                   PILLGKFSAPALQFLKRSAERGEERFKRFAASGEHPFADELLKFADQPTSG"
FT   CDS_pept        complement(163727..164386)
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="HDN1F_01180"
FT                   /product="Ribose 5-phosphate isomerase A"
FT                   /note="silverDB:HdN1F157"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43701"
FT                   /db_xref="GOA:E1VFV9"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFV9"
FT                   /protein_id="CBL43701.1"
FT                   /translation="MTQDEMKKAVAKAAIEYVVDDAVIGVGTGSTANQFIDCLAEIKTR
FT                   IRGAVASSEETRRRLVAKGVPVFDLNEGHDIPVYIDGADEFDRNLCLVKGGGGAMTREK
FT                   IIAAVAKKFVCIADASKKVAVLGQFPLPIEVIPMARSYVAREMVKLGGDPVYREGFVTD
FT                   NGNIILDIHNLEIAEPVKLENIINNIVGVVTVGLFAKRGADIVLMGHQEGIEVIRP"
FT   CDS_pept        164690..166219
FT                   /transl_table=11
FT                   /gene="ilvA"
FT                   /locus_tag="HDN1F_01190"
FT                   /product="Threonine dehydratase I"
FT                   /note="silverDB:HdN1F158"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43702"
FT                   /db_xref="GOA:E1VFW0"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001721"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005787"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR038110"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW0"
FT                   /protein_id="CBL43702.1"
FT                   /translation="MPAHYIKRILSARVYDVAEETPLDPAPFLSQRLNNRVLLKREDLQ
FT                   PVFSFKIRGAYNKIVNLSAEEREHGVVAASAGNHAQGVALAATKLGIKSTIVMPKTTPD
FT                   IKVAAVKALGGKVVLHGDTFDQAYAHVQELIDKHGYTLVHPYDDPDVIAGQGTIGMEIV
FT                   RQHSGPLHAVFVPVGGGGLLAGVGAYLKYLRPETRLIGVEPEDAASLKAALEANARVIL
FT                   PQVGLFADGVAVAQIGAETFRVIRRFVDEVITVTSDEICAAVKDVYDDTRSITEPAGAL
FT                   ALAGLKKYVQREGITEQTLVAINSGANVNFDRLRHIAERTELGERREALFAVTIPERPG
FT                   SFRKFCQAVGRRNITEFNYRFAQPEKAHVFVGLQARDASEIQSLMEHLADEGYVLTDFS
FT                   DNEMAKLHIRHLVGGRGSDLNGQNSVPDEVLFRFEFPERPGALLEFLSRIGSRWNISLF
FT                   HYRNHGAAYGRVLVGMQVPETERLMVKAFFEETGYQFWDESDNIAYQLFLK"
FT   CDS_pept        complement(167002..167682)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01200"
FT                   /product="5-formyltetrahydrofolate cyclo-ligase family
FT                   protein"
FT                   /note="silverDB:HdN1F161"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43703"
FT                   /db_xref="GOA:E1VFW1"
FT                   /db_xref="InterPro:IPR002698"
FT                   /db_xref="InterPro:IPR024185"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW1"
FT                   /protein_id="CBL43703.1"
FT                   /translation="MSSQDLPAANKLPSPNADAPPDTQAPTSDTKKALRKILRARRLAL
FT                   TRGEQYLAALGLGRQFKRFAANRRITRVGVYFANDGEIDPSAIVQWCWKTNKQPLLPVL
FT                   HPTRTGELLFLPWLPETPLARNRFGIPEPDSARSNPRPVWTLDVILTPLVGFDVQCSRL
FT                   GMGGGYYDRTLAPAFTGYTPRRPLLIGVAHECQKVENLPIEAWDIPLDGVLTGDAFYQR
FT                   IRPV"
FT   CDS_pept        complement(167920..168237)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01210"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F162"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43704"
FT                   /db_xref="GOA:E1VFW2"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW2"
FT                   /protein_id="CBL43704.1"
FT                   /translation="MSSNETKTVQISILGREYGMACNSGEEEAVQASARMLDERLREIR
FT                   MSGKVMGMEKMLVMAGINIAYEYFKAQAQLAKHNQAIERHIEKLTAKVEEAIADARQTE
FT                   T"
FT   CDS_pept        complement(168234..168617)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01220"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F164"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43705"
FT                   /db_xref="InterPro:IPR012662"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW3"
FT                   /protein_id="CBL43705.1"
FT                   /translation="MYRIPAQKQGFYKNINDRTIIEEQRTTRTCRMSCPSFQPRKNAMS
FT                   LVAPQLLSESTTASIEQHLQKLETRLSDLLDACEHYQRQNRALKAREAQLLEERTQLLK
FT                   KNDLARVKVEAMITRLKAMEQDT"
FT   CDS_pept        168778..169332
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01230"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F165"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43706"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW4"
FT                   /protein_id="CBL43706.1"
FT                   /translation="MDALASAAEAHGILCGQLCAGSRLTGIGWLKQFLPMIGVKREPWE
FT                   ALTQRLYQLRHFCEEDLKGAELDFSPLLPDEEEPITARLNALSEWCSGFLAGFGSIGLS
FT                   AEIMPDEISAALKDLQAISQVDVASAEEQGESGENDFYEVFEYTRVVVIHLYQECVLRT
FT                   DVAPTTPMGNAPIGNAPDTLH"
FT   CDS_pept        169411..170751
FT                   /transl_table=11
FT                   /gene="pepP"
FT                   /locus_tag="HDN1F_01240"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /EC_number="3.4.11.9"
FT                   /note="silverDB:HdN1F166"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43707"
FT                   /db_xref="GOA:E1VFW5"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW5"
FT                   /protein_id="CBL43707.1"
FT                   /translation="MISRKEFLRRRQALMEQMEPESIAIIPSARDRLRNRDVEYPFRQD
FT                   SDFFYLTGFDEPDAVAVLIPGREHGEYVLFCRERHREQEIWNGYRAGQEGAIKQFDADD
FT                   AFPIADLDEILPGLIEGKSRVYYAMGRNPEFDRRVMEWVNTIRAKVRSGAVPPGEFFVL
FT                   DHLLHEMRLFKSKAEIAVMERAAEISAGAHVRAMQSCRPGMYEYQLEAEYLHEFTRAGS
FT                   RLPAYSSIVGGGANACILHYRENNAELKDGDLVLVDAGCELAYYASDITRTFPVNGRFS
FT                   AEQRAIYDLVLEAQYAAIKAVKPGNHWNHPHEAAVKVIARGLVKLGLLNGDVDTLIKEE
FT                   SYRPFFMHRTGHWLGMDVHDVGDYKIGGEWRVLEAGMVLTVEPGIYIALDNEDVEARWR
FT                   GIGVRIEDDVLVTGRGHKVLTSGVPKEASEIEALMASAKNIAHNQRC"
FT   CDS_pept        170807..171889
FT                   /transl_table=11
FT                   /gene="gcvT"
FT                   /locus_tag="HDN1F_01250"
FT                   /product="Glycine cleavage system T protein"
FT                   /note="silverDB:HdN1F167"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43708"
FT                   /db_xref="GOA:E1VFW6"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW6"
FT                   /protein_id="CBL43708.1"
FT                   /translation="MGHKTPLYSAHLASHAKIVDFGGWDMPIHYGSQIEEHNAVRTSVG
FT                   MFDVSHMTIVDVTGADAKRWLQKLLANDVERLLEPGKALYTAMCNEQGGIIDDLIVYRM
FT                   AVGYRMVVNCATREKDMAWMQKQLVGFDAQIRHQDQLAIIAVQGPRAVQKTADVLGNAY
FT                   ATAIAQLKTFHGIPVGEWFISRTGYTGEDGLELMLPAAAAESIWRSLLEHGVRPCGLGA
FT                   RDTLRLEAGMNLYGSDMDETISPLEAGMGWTLAWQPEMRRFIGRDALEAQKAAGVARAF
FT                   TGLVMAGKGVLRGHQKVRTSLGEGETTSGTFSPTLGYAIALARLPAGASGEAEVEIRGK
FT                   WQPVKIVKPPFVRNGKCVHS"
FT   CDS_pept        171996..172406
FT                   /transl_table=11
FT                   /gene="gcvH"
FT                   /locus_tag="HDN1F_01260"
FT                   /product="Glycine cleavage H-protein"
FT                   /note="silverDB:HdN1F169"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43709"
FT                   /db_xref="GOA:E1VFW7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW7"
FT                   /protein_id="CBL43709.1"
FT                   /translation="MSEIPSELRFMASHEWIRVENDGTAYVGISDHAQSALGDLVYVEL
FT                   PEVGDTITAGDEAGVVESVKAASDIYAPLTGEVVAINEALNDNPELVNSDPYGDGWIYR
FT                   IRMADPEELEDLLSAEEYAEQIEEEADDQAED"
FT   CDS_pept        172534..173892
FT                   /transl_table=11
FT                   /gene="gcvPA"
FT                   /locus_tag="HDN1F_01270"
FT                   /product="Glycine dehydrogenase (Decarboxylating) subunit
FT                   A"
FT                   /EC_number="1.4.4.2"
FT                   /note="silverDB:HdN1F171"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43710"
FT                   /db_xref="GOA:E1VFW8"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023010"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW8"
FT                   /protein_id="CBL43710.1"
FT                   /translation="MPYVPHTDEDVRIMLDTIGVASIDALFDEIPAEIRAKPLLEIPSG
FT                   RTEMDVTRLVGERAAADGNVINFLGAGAYEHHIPAAVWDIISRGEFMTAYTPYQAEASQ
FT                   GTLQVIYEFQSLMAHLTAMDVSNASLYDGGSALAEAALMAVRANRKSQSGRVLVLENVN
FT                   PFYCDAARNIVGNQHIEIVKVPFDATTGNVDQAALDAYAGQDFAALVVAMPSFFGTLED
FT                   VHALTDWAHANRMLMVAVVNPTALAVLTPPGEWGQKGADIVVGEGQPLGVPLSSGGPYV
FT                   GFICCRNEIVRQLPGRIIGRTVDLEGKRGFTLTLQAREQHIRRSKATSNICTNQGLAMA
FT                   AATIYLSLLGAEGLARVAQACHANTRKLIASLSEIPGVSVAHQSAFFHEAVLRLPKNAA
FT                   EVVAALAEQRIAGGLALGEFFPDHENALLVCATEMRNDADIARYQAALRQILA"
FT   CDS_pept        173907..175376
FT                   /transl_table=11
FT                   /gene="gcvPB"
FT                   /locus_tag="HDN1F_01280"
FT                   /product="Glycine dehydrogenase subunit B"
FT                   /EC_number="1.4.4.2"
FT                   /note="silverDB:HdN1F172"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43711"
FT                   /db_xref="GOA:E1VFW9"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFW9"
FT                   /protein_id="CBL43711.1"
FT                   /translation="MLIFERGQAGRRAVAQAPSTTDDLHDIPAALQRKQKPLLPEVGEM
FT                   QVVRHYTNLSRKNFSIDTHFYPLGSCTMKYNPRGAHRAAMQAGFLGRHPLAHESISQGF
FT                   LACLYELQEVLKGVTGMKGVSLTPMAGAQGEFAGVAMIRAYHEARKDHERKEILIPSAA
FT                   HGTNPATAVMCGYKVREIPVNDEGDVDVDALRDAVGPQTAGLMMTNPSTCGVFERSVRE
FT                   IAEIVHAAGGLLYYDGANLNAILGKVRPGDMGFDVMHMNLHKTFATPHGGGGPGAGPVG
FT                   VGERLLPYLPIPMVGKDEIEGKPRYRWLTEADIPQTIGRLSTFMGNAGVLLRAHYYASV
FT                   LGREGLLRVGEFSTLNANYLMKKVQDAGFQLAYPKRRATHEFIITLNKQAKELHVSAMD
FT                   FAKRILDYGYHAPTTYFPLLIPECWLIEPTETESRDELDGFVKAMVQIQAEAENNPELV
FT                   RGAPYSQPVRRLDDVRAARELDLVWRPTAEQ"
FT   CDS_pept        175383..176666
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01290"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F173"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43712"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX0"
FT                   /protein_id="CBL43712.1"
FT                   /translation="MLYANRASSHLNRQCQCVTLDRERLVSVLDAQANRPGFGVQLLQS
FT                   HPHLFSSTSTFVSEDHLFQVQALVDAVRRLAAHPSFQEYVFSRADPAARVSVPYESVFF
FT                   GYDFHIDPEGPKLIEINTNAGGALLNAALQHAQHQCGERVGLWRDGTGADVESKFLAMF
FT                   RREWQLARGDQPLNTVAIVDSSPEQQGLYAEFLLFQQLFEQDGIQALILSPEQLSFLDG
FT                   RLWGASTPIDLIYNRLTDFYFTDPAHAALRAAWMEDACVITPHPRAHALYADKRNLIVM
FT                   GDRDLLRIWGVSELDCDIFARCVPQTIAVDLVDADVLWQERKRYFFKPAQGFGSKAAYR
FT                   GDKLTRKTFDALLAAGDYVAQHFSPPGERMLSVAGEANALKYDLRAYVYERDIQLLAAR
FT                   LYQGQTTNMRTEGGGFSSVTVVPDEPQG"
FT   CDS_pept        176713..177507
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01300"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F174"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43713"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX1"
FT                   /protein_id="CBL43713.1"
FT                   /translation="MASLMIKCSEKASSKGGVLQAESRQKNSGKKSVQGALLALSLVAL
FT                   GGCKLNVSVSGEGLVTSDNGKIECPGKCKASLKRGKEITLTAAAAEGSYFAGWQGCHEV
FT                   NETLCTVVGSTSNRRVTASFASDAVLEEAKLSNDLKNCLIDQKYDLQEKTSAVTSLSCD
FT                   GTIVDFGGNFDPAGVNLLASLTELEIRNTTLDSLRLISSLSNLKTLKLVNLGLSDVSEL
FT                   LKLPVGNLKTLDLQENPSLDCITVGALRERFGYSNVYASLCN"
FT   CDS_pept        complement(177630..179993)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01310"
FT                   /product="predicted transcriptional accessory protein"
FT                   /note="silverDB:HdN1F175"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43714"
FT                   /db_xref="GOA:E1VFX2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX2"
FT                   /protein_id="CBL43714.1"
FT                   /translation="MSQITQTIAQELGVKETQVAATVTLLDEGATVPFIARYRKEVTDG
FT                   LDDTQLRTLEERLYYLREMEERRGVILKSIEEQGKLTPELEASIRAADTKNRLEDLYLP
FT                   YKPKRRTKAMIAREAGLEPLALSLYQDPSQAPEALAANFLNPEKGFADTKAVLEGARHI
FT                   LMERFSEDAELLGKLRQFLHDHALITAKVAEGKEEAGAKFRDYFDHKETLRDTPSHRAL
FT                   AIFRGRNEGILQVALALDNEAELQRHPCEPMIAQHVSIQDQGRAADAWLQDVVRWTWKV
FT                   KLLSHLEAELLADLREKAEEEAIHVFSRNLNDLLMAAPAGPKATLGLDPGLRTGVKVVV
FT                   VDATGQLLQHCAIFPHAPRNDWDGSLAVLAALCKKYNVDLISIGNGTASRETDRLAADL
FT                   LKQHPDIKAQKIVVSEAGASVYSASEFAAREFPKLDVSYRGAVSIARRLQDPLAELVKI
FT                   DPKAIGVGQYQHDVSQSKLARTLDAVVEDCVNGVGVDVNTASEPLLARISGLNKTIAGN
FT                   IVAFRNKNGAFTSRDALKQVPRLGEKTFEQAAGFLRVMNGDNPLDRSAVHPEAYPLVER
FT                   IAQKYEREPRTVIGDSNFLRQVKAADFVTEKFGIPTITDILKELEKPGRDPRPEFRMAQ
FT                   FKDGVESLEDLKPGMTLEGCVTNVTNFGAFVDIGVHQDGLVHISVLSDKFVKDPHEVVK
FT                   AGDIVKVKVVEIDIPRKRIGLSMRMDEPVGQVTTGNKGAPQKFGGKGAGRPSSEPKNTG
FT                   KNEGRRPAAARQPEPAMKGTSFADLFAKAKQIKS"
FT   CDS_pept        180347..181087
FT                   /transl_table=11
FT                   /gene="ompR"
FT                   /locus_tag="HDN1F_01320"
FT                   /product="Two-component transcriptional regulatory protein"
FT                   /note="silverDB:HdN1F177"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43715"
FT                   /db_xref="GOA:E1VFX3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX3"
FT                   /protein_id="CBL43715.1"
FT                   /translation="MVELSVSTELQPRILVVDDDARLRSLLQRYLEEQGYAVKAVADAP
FT                   QMDKALSRELYNLMVLDLMLPGEDGLSICRRLREATNRIPIIMLTAKGDDNDRINGLDA
FT                   GADDYLPKPFNPRELMARIKAVLRRQVKELPGAPSQSDESVEFGPYALDLSTRALTKHG
FT                   ESVALTTGEFAVLKALVQHPREPLTRDKLMNLARGREWSAMERSIDVQVSRLRRLIEDD
FT                   PSNARYIQTVWGVGYVFVPDGQSK"
FT   CDS_pept        181223..182515
FT                   /transl_table=11
FT                   /gene="envZ"
FT                   /locus_tag="HDN1F_01330"
FT                   /product="Sensory histidine kinase in two-component
FT                   regulatory system with OmpR"
FT                   /note="silverDB:HdN1F179"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43716"
FT                   /db_xref="GOA:E1VFX4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX4"
FT                   /protein_id="CBL43716.1"
FT                   /translation="MVLATWLIILLSQISTLWLSYYYFYLPGVKNSTELVAVQLETLQN
FT                   GIAHAGKQPFLDELPSNTELIITDDPAVIPPAHKYRFTSFLTRPFRERLGRDVEIRLQF
FT                   DPAPSIWFTRAELDGAWFCLPLPYFGRYQSVWLAVWLLGTPLLAFVVAALYVRQLNRPL
FT                   RQLELAALRIGRGESVAQLKPAGNPGEFKAVTDAFNQMNSNLQQVERERQLLLAGISHD
FT                   LRTPLTRMRLTAELLEASDPELTEGMVRDIEDMDAILDQFIAFVRDGRDEQVDVGDLNE
FT                   VIEEVIAQYESEDVILRSDLQALPPISLKRLSLKRLFANLIGNALRHGGGEVDISSGVE
FT                   RGEIRLVVADRGPGLPVGDLQALLQPFARGDSSRGTKGSGLGLAIVKRVVDMHHGRIEL
FT                   RNRIGGGLEAVVWLPITGSLVPPGSLMKSSR"
FT   CDS_pept        complement(182561..183601)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01340"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F180"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43717"
FT                   /db_xref="InterPro:IPR018976"
FT                   /db_xref="InterPro:IPR038352"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX5"
FT                   /protein_id="CBL43717.1"
FT                   /translation="MSLRSFAIAALCLCLPLVNGCDQPLPSPKQKDAQQKSNPSRPPLK
FT                   ESWRTALEHYHAAGLREIDLSIACLQNLTLDTNDFLLAPDTQALDELRAMALHCHRIYQ
FT                   PVQALTAGYSALETRLNTLRWRIDSRPITPHYVDYTADHPHAGIPNDPAQALDRVSLIT
FT                   EQGLGDQGDVVLGFEVLLFLLEGEHRYQVQLPPRSAQDYLSSDDGPLIENNALRDAPTK
FT                   LPPEYAPRNRRRVYLQRVLEILLADLTRLKGAWESFTYPTTQAAGSILVYACIRNWHSV
FT                   EASLPAEDVDEVTARLVKLFTSDDDQDIARLLKLDQLDGWPNKETPLNPTLLTQSLGQW
FT                   LVHRKH"
FT   CDS_pept        complement(183598..184263)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01350"
FT                   /product="HAD-superfamily hydrolase, subfamily IB"
FT                   /note="silverDB:HdN1F181"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43718"
FT                   /db_xref="GOA:E1VFX6"
FT                   /db_xref="InterPro:IPR006385"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX6"
FT                   /protein_id="CBL43718.1"
FT                   /translation="MILALFDLDNTLLCGDSDHAWGQFLVERKVVDADEYRRHNDAFYE
FT                   DYQLGRLDIRAYLEFALAPLVNRSQEELDALHADFMVSTIAKMRLPKADALIQKHIREG
FT                   HLPIIITSTNRFITEPIAKSLGIDILIATEPERDAKGYTGKIVGTPCFREGKITRIHEW
FT                   LATNGHTLSGSYFYSDSINDLPLLQVVSHPVAVDPDERLRQEAENQGWPIISLRQTPA"
FT   CDS_pept        184541..185074
FT                   /transl_table=11
FT                   /gene="nudH"
FT                   /locus_tag="HDN1F_01360"
FT                   /product="Probable (Di)nucleoside polyphosphate hydrolase"
FT                   /note="silverDB:HdN1F182"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43719"
FT                   /db_xref="GOA:E1VFX7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="InterPro:IPR022927"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX7"
FT                   /protein_id="CBL43719.1"
FT                   /translation="MIDEEGFRPNVGIILANPQGQVLWAKRVGQQDAWQFPQGGINDNE
FT                   NPEDALFRELWEEVGLTEASVDVIACTRGWLKYRLPRKFLRHRSKPLCIGQKQKWFLLR
FT                   MNGEDSAVTFQQGSPPEFDDWRWVSYWYPLQEVVSFKRDVYRRALTELAPSLHGFTSRN
FT                   RLAMPIRLAPLASP"
FT   CDS_pept        185322..187718
FT                   /transl_table=11
FT                   /gene="ptsP"
FT                   /locus_tag="HDN1F_01370"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="silverDB:HdN1F183"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43720"
FT                   /db_xref="GOA:E1VFX8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX8"
FT                   /protein_id="CBL43720.1"
FT                   /translation="MLETLRRIVQDVNAADDLRSALDVMVSSIREAVGTEVCSIYLLDR
FT                   RVNRYILMATKGLNEDAVGRVSLAINEGLVGLVGTREEPINLDDAPSHPRFHFIAEVGE
FT                   EPFHSFLGAPIIHHRRLLGVLVVQQRDRRCYDPNEEAFFVTMSAQLAAVIAHAEVTGTL
FT                   SGLMGVRVGPTRIEGISGSNGIAMGTAYVIYPTADLRSLPDRPAKDISKEMLLLDDALD
FT                   AVRADIRTLAEKALSHLPPEEQALFQVYERMLEESALAGEIRERVRAGNWVQGALREVV
FT                   LRHVRAFEAMDDEYLRARASDVRDLGLRILRYLQIEKVSNGEVPARAVVIGEELAPTVF
FT                   VDVPRERIVGIASLQGSSNSHMSIVARSMSIPTVVGIGDIPLSRVDGKEVIVDGYRGEL
FT                   IVSPTSEMRRHYLEIMEEERQVNRELDEVRHLPCVTPDGREIRLLVNTGLAVDVTMALE
FT                   RGAQGVGLYRTEIPFMVRDRFPTETEQMEIYRRQLEAFHPRSVVMRTLDVGSDKALPYF
FT                   PIKEENPALGWRGIRITLDQPEIFLVQVRAMLWASEGLDNLRILLPMISSVSEIEDALH
FT                   LIHRAYLEVLEEGAHIRMPDVGGMIEVPAAVYQVREFCRHVDFLSVGSNDLTQYMLAVD
FT                   RNNRRVARLYQPFHPAVLRALHQIVQIAGEENTPVSLCGEMAGDPRAAVLLLGMGYSML
FT                   SMSATSLLRVKWVLRRIGFARAQEIFNDVMRMESAQAVRSHLDYILEKEGLGSYIRPMH
FT                   SATGYIDKEEVPGVSVQPLPASTSAPLAPASGTLTAPSGVQVSRA"
FT   CDS_pept        187866..188504
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01380"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F184"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43721"
FT                   /db_xref="GOA:E1VFX9"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="InterPro:IPR016088"
FT                   /db_xref="InterPro:IPR036298"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFX9"
FT                   /protein_id="CBL43721.1"
FT                   /translation="MLLPLLPLQFTQSVRALPSKLSPLRVLFLAALLSGFALSQPQLAW
FT                   GFTVGGVSLTEQQTSGDTVLHLNGAGIRNKFFLDVYVAALYTPDRVANAEAVLDAHVPQ
FT                   TVRLVITSSAITRQRLVDAITEGVQRSAGKDFPRYAPYLDQVWEALTFEVKKGDIYDFR
FT                   YLPDQGVSIVRNGEVLRTIPEFEFKRVLFGIWLGKDPVQASLKKAMLHR"
FT   CDS_pept        188682..189482
FT                   /transl_table=11
FT                   /gene="lgt"
FT                   /locus_tag="HDN1F_01390"
FT                   /product="Prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="silverDB:HdN1F185"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43722"
FT                   /db_xref="GOA:E1VFY0"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY0"
FT                   /protein_id="CBL43722.1"
FT                   /translation="MLIHPSIDPVALAIGPLKIHWYGLMYLAGFLSGMWLLGRRAAKPG
FT                   SGWTKDEVSDLIFYGAIGVVLGGRLGYMLFYGGPHFMRDPSSIFRVWEGGMSFHGGLLG
FT                   VMFAVWLFGRRTKRSLWDILDFGAPIVPIGLGLGRLGNFINGELVGRTTDVPWGMIFPH
FT                   VDQLPRHPSQLYEMFFEGLVMFSILWWFSSTPRPRYAVSGMFALLYGVFRFSVEFTREP
FT                   DAQLGFIALDWMTMGQLLSIPLIVVGLVLLKIAYARKAPEYGRK"
FT   CDS_pept        189720..190553
FT                   /transl_table=11
FT                   /gene="thyA"
FT                   /locus_tag="HDN1F_01400"
FT                   /product="Thymidylate synthase"
FT                   /EC_number="2.1.1.45"
FT                   /note="silverDB:HdN1F187"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43723"
FT                   /db_xref="GOA:E1VFY1"
FT                   /db_xref="InterPro:IPR000398"
FT                   /db_xref="InterPro:IPR023451"
FT                   /db_xref="InterPro:IPR036926"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY1"
FT                   /protein_id="CBL43723.1"
FT                   /translation="MKQYLDLLRHVRDHGVRKSDRTGTGTLSVFGYQMRFDLAAGFPLV
FT                   TTKKVHLKSIIHELLWFLRGETNIQYLTDHGVSIWNEWATESGELGPVYGKQWRSWDGP
FT                   HGETVDQIAWLIDEIRNNPDSRRMVVSAWNPALLPDTRVSPRQNAANGLQALPPCHCLF
FT                   QFYVAEGKLSCQLYQRSGDVFLGVPFNIASYALLTLMVAQVTGLQPGEFVHSFGDVHLY
FT                   LNHLEQAETQLARAPLALPKMQLNPAITNVFDFRYDDFTLTDYAPYDPIRAPVAV"
FT   CDS_pept        190556..191065
FT                   /transl_table=11
FT                   /gene="dfrA"
FT                   /locus_tag="HDN1F_01410"
FT                   /product="Dihydrofolate reductase (FolA)"
FT                   /EC_number="1.5.1.3"
FT                   /note="silverDB:HdN1F188"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43724"
FT                   /db_xref="GOA:E1VFY2"
FT                   /db_xref="InterPro:IPR001796"
FT                   /db_xref="InterPro:IPR012259"
FT                   /db_xref="InterPro:IPR017925"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY2"
FT                   /protein_id="CBL43724.1"
FT                   /translation="MAHSYRLSLIVAVADNQVIGRQNSLPWRAPADLARFKQLTMGKPM
FT                   IMGRKTFDSLGRVLPGRPHIVISRQSDLGLPPQCYLAASLQDAIEIAKPLMDASQEIMV
FT                   IGGAEIYRQALALADRIYLTQVHLEPEGDAFFSPLGAEWQELEKTRAEGEPACSYLTYG
FT                   RREPVR"
FT   CDS_pept        191115..194012
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01420"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F189"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43725"
FT                   /db_xref="InterPro:IPR007139"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY3"
FT                   /protein_id="CBL43725.1"
FT                   /translation="MFKNLFKPKWQHTKPEVRLEAVRQLSDESSDQAQILEQVAASDEV
FT                   PAIRLAAARRMNNVDRVVRLLQSEKDSDTRIKIQGHLMSLLGPDSAPSAVMKQWLADLS
FT                   SDAVLQLLERTKSQDLGERMLAAIRDEQTLAVLAVQLPLAALRKAAAQRVDAPQLLEEI
FT                   LKGSRSKDKNVYRIVREKLDAIQVAQQAGADLDRAISELCSALEAHSRTTQDPYYAAKF
FT                   EHLQKRWLPLAEQASADQRARYLAGVTACRAIMEDVAAEALAETTRLEQEASQAQHNDA
FT                   LAGELCNTLETALTGATAQPEAASHKVLAELLSINRKRWSDEFSEAQPSARLKKRFQEV
FT                   CVRAENLAGALQSLNTQETAIRDAATALLERTEDHIHTLLEQKKQLDKAMQGLRWPTGL
FT                   ALPEVLQLQQRAAAHFDVVRDRLLMQEQQQQDALEKEITKLVKEIEKGNLKAAQQHLRD
FT                   CNRRVRELPIKKAQALQHKVRELTARVNELRDWQGFATLPKKEALCEQMEALAGVEMDP
FT                   QALAGRIKRLQDEWRTLGGGDGEQGQALWERFSKAADFAYEPCREYFEKLAAVRQVNLE
FT                   ARQLLCQQLDDYLHKTDWAVIDWRAAHEIFELAKEQWRTYSPVERKAGKDVQDRFNGLL
FT                   QEMEQRFHAEFEKNTQARRALIGQAESLLHAENLQDAIEKAKHLQQEWKQIGMVGPRQD
FT                   GKLWKQFRAACDGLFARRDQAREDAQAQRDRSVSEAGAICAALESLANAADARKDAQET
FT                   AQTREQTDALEAQFEALGPLPREQAGELRRRFQNALEAIRRGLARQQQQGRRDRFSSLW
FT                   VLAAWLDEQEGRRLTDAEFSVPSTLPEPGALPDMDALPNGAVNLAQQRLKALQQGDLQA
FT                   IEPVLVKNAETLRQLCLRLELGAGLETPSEDRAYRMQFQINQFNKGERAPATHQEADEQ
FT                   LERLQLEWLAVGPVAVADRERYLRRFQDGLSQAYR"
FT   CDS_pept        194014..197382
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01430"
FT                   /product="Mechanosensitive ion channel precursor"
FT                   /note="silverDB:HdN1F190"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43726"
FT                   /db_xref="GOA:E1VFY4"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY4"
FT                   /protein_id="CBL43726.1"
FT                   /translation="MFGCWPRRWSVLRVLVLAAWCLLGLGAANLAFTPIVHAAIPGLVP
FT                   APKPEENPADVEARQRATLDAQIADSRKALARVQNDTEQLIQLAATAPARAEAIRKDIE
FT                   KVSQTLGRENVDRLGLDAVRQRLQLIEAELQATDLALSEVYQKISEQQSIPSLTRERIA
FT                   GVLGEIDSAEKRVQNLQGSSEGIPALKLQLAQAELERLFAQRRFHEAQLESYQKLLEYQ
FT                   TAHRDLLSAQLAVARDTYGKLQQRLEKLSKDEAERKQAAFAEIEHALIGMPQPVLDIAV
FT                   RNKKDNDELIRLQQALRDANAQDKEYADVAQEIRQRYQVAVQQLDVGGYNRYYMEHVRY
FT                   MARVVRPLLNRGVEGKDSSVALVEARARQFTIDDQQREVRNRLERERKIERLLAKLSES
FT                   ERATPGLVDEVHKLYIQRGALLEQLSQVNGNYVVAMTNFELSRKRLQSEEAKFMAMLSQ
FT                   KMVWLHSSPPMSWDIGLVALKGAYSFFVQSPWAEIARLMDRFLADHFWQELLLFVVFAG
FT                   VFYFRHRLLQVLDHVGPRIGRVGQDRFRYTVRALGVTLIAALPVPLIMQVFGGVLVVNS
FT                   PYQSFPFGVGELMLRMSPIALMVAMVPVMMRNNGLGRLHFRWSRELLSTLKQQLPWIIL
FT                   QLCLFALGAYLMGSASEQRSVFTFARMVMLVANGVLAYNLWSMLRPGKGLIAKRDVMGF
FT                   FDVHWRARYLWMPTLIGLPVLCCLLVIVGYDFAVLFFARMFYVTLLAGFSIYLAHQVVT
FT                   RWFAVQERQIALERARARRAADRAARSREEADPAAEVILEREVIDEINLEAISEHNRTL
FT                   LKVVAYAVFVAVLLQMWSDVAPVLDGLDKYVLWKVSGKGVDGQVEELPITLWRLLTVLF
FT                   LLVVTIFSGRNLPGVVEVVLLQRFRMEKSVRFAMTTVARYVIFVVGITTAFKMLGIAWD
FT                   KIGWLMAAVGVGLGFGLQEIFANFVSGIIIILERPIRIGDVVTIADQSGVVTEIRMRAT
FT                   TVVDFDQKELIIPNKTIVTNQLINWTLSDSVTRIMISVSVRHGSDVEKVVQTLMEIATS
FT                   HPNVMKSPSPAAYFMSLGDKLNFELRIYVPEVSMRRTTLHDVNMAIERSFREQGIRIEP
FT                   AILDVRLGGVQGGGF"
FT   CDS_pept        complement(197394..197621)
FT                   /transl_table=11
FT                   /gene="slyX"
FT                   /locus_tag="HDN1F_01440"
FT                   /product="SlyX protein"
FT                   /note="silverDB:HdN1F191"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43727"
FT                   /db_xref="InterPro:IPR007236"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY5"
FT                   /protein_id="CBL43727.1"
FT                   /translation="MQNQALEAQTKRTDELEIKVAYLEDALRQLDDEVWRQQRQIEALE
FT                   TLCKKLAQDMQTITDRAGAAGTEPEIPPHY"
FT   CDS_pept        complement(197630..197953)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01450"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F192"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43728"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY6"
FT                   /protein_id="CBL43728.1"
FT                   /translation="MVPNMDSLSLTPSPTERQDDPIVSALEGQPVAFVQEKLGLPNQRD
FT                   DLPTGAMIWVYNDDAKGLNANSCKVSLSIRDGIVQRVSIQTHSASLVSAALSSCNRIRK
FT                   DLS"
FT   CDS_pept        complement(197970..198161)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01460"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F193"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43729"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY7"
FT                   /protein_id="CBL43729.1"
FT                   /translation="MPPVMARTDSHSLAPTIAMAHAYKNNDYIQGKPSHDHPYSVKDAC
FT                   TQTIFRQSASRRAGSSHV"
FT   CDS_pept        complement(198360..198737)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01470"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F194"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43730"
FT                   /db_xref="GOA:E1VFY8"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY8"
FT                   /protein_id="CBL43730.1"
FT                   /translation="MSIPPTTSPENRRRAPRTPVRDTLFVQAIDSAQITAIGADLKTGN
FT                   TVNASAYGIQVELDFEVLVDSDIMLWVKMGDHATRLMINGTVRWTSRQLGSENFLVGIE
FT                   LSEESAPEMQRWLHDQQILSP"
FT   CDS_pept        198926..199366
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01480"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F195"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43731"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFY9"
FT                   /protein_id="CBL43731.1"
FT                   /translation="MFLSPVSESSVVDASSATSVTLYRAVGPGQMRAIMERGFARFPAR
FT                   LPQQKFFYPMLTESFASFVATVWNVPHSGAGYVLRFRVAPEGIEGKRAFRVGGPEHREF
FT                   RIGREDFNRFNAAICGPIEVVAVFGEDRLGLAPKLAARAVVA"
FT   CDS_pept        complement(199411..200163)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01490"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F196"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43732"
FT                   /db_xref="InterPro:IPR014094"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ0"
FT                   /protein_id="CBL43732.1"
FT                   /translation="MTVLCRQRTLHPRKAPPKKSTPKKNPAKKNKDKDEKGMSIHTAIE
FT                   RTKAKTHPSTIVKFGLFCLLAALGSGCANTVQYGDSGRGETRTTETGIHDLQSATTQMT
FT                   EAMINDIRVMAYTYGRRPTIAISPFTNQSGNAVSVAPLQRSIVESLQKQDAYQIIDEQK
FT                   LAETRNQLQLPPNKALTTPGSGPQLAKALGADLLLYGEISEVIRVHPDSRETYYRIELH
FT                   LVDGKNGNLIWQEKKEFLKSGKKAIFGA"
FT   CDS_pept        complement(200227..201558)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01500"
FT                   /product="DSBA-like thioredoxin domain protein"
FT                   /note="silverDB:HdN1F199"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43733"
FT                   /db_xref="GOA:E1VFZ1"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ1"
FT                   /protein_id="CBL43733.1"
FT                   /translation="MSLKQPTSRPMPRDVTSNRARHLRRAWFDVTRYLRPSRNVVTFFH
FT                   KVDDPYSWLLLQALPRLLKDFRVQLSVQFVLDIPPDGVVDVAAKQAYTLIDAARLADFH
FT                   QLSFPDHPQQPSAQDAFAASAILIKHQNSPKLLHLMLEVTGALWKDSSTTFESCIKRYG
FT                   LASDKDTRSALSSSRENLYKLGHFQAGSLFYGNEWYCGLDRLGHLAERLDRPSLRQHAS
FT                   GNPSEIADYQRQYRHVLQSYNTLRPRPRQLKPMEFFFSFQCPYSYLAIGRLVKLQELYQ
FT                   FPLTLRLVYLDQQIASTSPQKRLYALYDANREAKRFNIPFQRQSEPADEGIHYCMALLP
FT                   WAQAQGKEREYILSIMNGIWAESIDTSEKLALKKLVERAGLNWESASKELENERWKTTS
FT                   NLNRKALHQAGGFGVPTFCYGELVAWGQDRLWAIEQAMLRSDRR"
FT   CDS_pept        complement(201837..203540)
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="HDN1F_01510"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="silverDB:HdN1F201"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43734"
FT                   /db_xref="GOA:E1VFZ2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ2"
FT                   /protein_id="CBL43734.1"
FT                   /translation="MTDETKNPSDTSHLRKYSSEVVDGISKAPGRAMLRAVGFKDADFK
FT                   KPQIGIASTWSMVTPCNMHIDGLADAAGEGADAAGGKSVIFNTITISDGIANGTEGMKY
FT                   SLVSREVIADSIETVAGCEGFDGIVAIGGCDKNMPGCVMAMSRLDRPSVFVYGGTIKPG
FT                   KNHTDIISVFEAVGAHAKGDLNLIEVKQIEETAIPGAGSCGGMYTANTMASAIEALGMS
FT                   LPGSSAQDAISGDKMEDCRRAGAAVVELLKRDIKPSDIMTRKSFENAITVVIALAGSTN
FT                   AVLHLLAMADAAGVKLEINDFVEIGKRVPVLADLRPSGKYMMSELVAIGGIQPLMKMLL
FT                   DAGMLHGDVLTVTGKTMAENLADVAAYPAGQDIIRPLNNPIKKDSHLRILFGNLAPTGS
FT                   VAKITGKEGLTFTGSARVFGSEEETLDRILDGTVQAGDVLVIRYEGPKGGPGMREMLSP
FT                   TSAIMGKGLGNDVALITDGRFSGGSHGFVVGHITPEAAEGGPIALIEDGDIITIDAVAN
FT                   TISVNLSDAELAARRTRWVAPKPRYTKGALAKFAKLVSSASEGAVTDKNL"
FT   CDS_pept        complement(203801..204655)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01520"
FT                   /product="Predicted signal transduction protein"
FT                   /note="silverDB:HdN1F202"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43735"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ3"
FT                   /protein_id="CBL43735.1"
FT                   /translation="MTIEIEQKERDILNGITLPPRPKALIAITEESRKPNANLAVIARA
FT                   IASDVSISAAVLKVVNSAAFRRPAPITAIDAAVNLLGIKRVLAIVNAVAVRGAIKTKVD
FT                   LEHFWQYGAAVANACVLTCKLLKKSGLMDDAYTIGLFHDAGIPVMIAKFADFHAFYTEA
FT                   EQEGWTLSIDKEREKYGTTHSTIGAILAQEWTLPEPLVNAIYNLHYADGIFDSGDLDKT
FT                   ALDLLAVLKCGREFARQLLRDGSSDAEWVQVEEQVLAHLDLDEDRYSDLQNEVLSQLRE
FT                   GQS"
FT   CDS_pept        complement(204842..205042)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01530"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F203"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43736"
FT                   /db_xref="InterPro:IPR022148"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ4"
FT                   /protein_id="CBL43736.1"
FT                   /translation="MEQDLSSIDFKQFKPMRFEVAKKEATLNMRLPAVLMDAIRAKAKA
FT                   KGIPYARYVRMVLEADLQRSR"
FT   CDS_pept        complement(205074..205355)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01540"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F204"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43737"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ5"
FT                   /protein_id="CBL43737.1"
FT                   /translation="MKIAGFDWDNGNWPKCGKHGVSREEIERLSLEGQVHVVPDLTHTT
FT                   PAESRHIAAGGVDGRPMFVAFAFRGNFIRPISARYMHAKEASNYEANT"
FT   CDS_pept        complement(205408..206328)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01550"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="silverDB:HdN1F205"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43738"
FT                   /db_xref="GOA:E1VFZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ6"
FT                   /protein_id="CBL43738.1"
FT                   /translation="MEISLDQWQTLVTIVDQGGYAKAAEHLGKSQSAISYAIQKLESSL
FT                   ELQVFRIEGRRAVLTPAGELLYQRAVRLVGAAHALENTARQLSQHWQAQISLAVETVFP
FT                   KPILFDALRKFSDAYPLTRIHLLETVLSGTSEALISREVSLAISSYLPPGFMGDALIQL
FT                   RFIAVAAPSHPLHQLKRPLTYTDLQQHRQLVVRDSGTRNLDAGWLGAEQRWTFNELSTS
FT                   IQAAIAGFGFAWYPESQIATPIDQGQLKPLPLESGGERYASLYLIYAEPEFASPACVEL
FT                   GRALHASSVYLGGCAAAKMAAQNPP"
FT   CDS_pept        206493..207350
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01560"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F207"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43739"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ7"
FT                   /protein_id="CBL43739.1"
FT                   /translation="MSQFTVQKTQRSVLQHWQAMAAKDGAGVKLKRALGARQGQRLDPF
FT                   LMLDAFSSDNPDDYIAGFPAHPHRGFETVTYIVDGHMRHRDHMGNEGDLKAGGVQWMTA
FT                   GRGIIHEEMPQQENGLLRGFQLWINLPAKEKMKPAHYEDVPASAMPWQPLAAQGAIKLI
FT                   AGSVDHNRLLADSSRVAAPIIADVKVAAGIEILALPPTHQAMVYVFEGRIRIQGQDLGE
FT                   TDVAILSAGEQLAIESDAPARVLLVAGAPLNEPIAQYGPFVMNSMEEIDQAITDYRDGV
FT                   LTGA"
FT   CDS_pept        207450..208043
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01570"
FT                   /product="Predicted oxidoreductase related to
FT                   nitroreductase"
FT                   /note="silverDB:HdN1F208"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43740"
FT                   /db_xref="GOA:E1VFZ8"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033877"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ8"
FT                   /protein_id="CBL43740.1"
FT                   /translation="MNIIEILKKRRTQYALGNKLPISEAAVESLIKDVVREAPSAFNSQ
FT                   SSRVVILFGEEHKKLWSIVKETLRAIVPADAFEPTDKKINSFAAGAGTVLFFEDHHVIR
FT                   SMQEKFPLYADKFPIFSGNSAGMAQYAVWTALANENIGASLQHYNPLIDAEVGRVWGLP
FT                   ESWELSAQMPFGSNEAAIADKTFVDDGERFRVFR"
FT   CDS_pept        208253..210703
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01580"
FT                   /product="Putative two-component sensor histdine kinase"
FT                   /note="silverDB:HdN1F210"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43741"
FT                   /db_xref="GOA:E1VFZ9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VFZ9"
FT                   /protein_id="CBL43741.1"
FT                   /translation="MLFLLLVGVFQTAQAAAGVVAQGEDPADREPTILVDGRPEYRLEH
FT                   FLEMYREPAAVFTVEDVISGAARNQFKGVDSATVALGQTSDAVWFRAKLKNVSDQWQDV
FT                   SWAIRYIFIERLDIYRIEDGNVVDHLQMGKDFPYSARRVDMAPYVYPLGLAPDEQAEII
FT                   WRVKSGVPMLLPFYLLDRDRLARMDRDYSVYLGVFFGLMSGLVLYNLFLFFGVRDRSYL
FT                   YYVCFVVFCTLLQLALMGALDKYTPSAVLLNRINGNLSSSLTVMFAILFAMRILNANNF
FT                   PSWVQRTANGLAVFFFLCAIGSVLNLKNIHIVLTLSGSVVSTLVCVLAVYNISKKHFGN
FT                   YYFLIAMVVWTLGVGVSTFLYMGLVPYTDFTVWTLPIVSVVLATLLSFTLAAQINDLRK
FT                   QQVQSLLAAREAQTESRAKSQFLAQMSHEIRTPMNGVIGMADLLRQTKLDVQQKQYLDI
FT                   IVNSGRTLLTIINDILDFSKIAAGKMDLEIRPIDFKQIVRECIQLFTLPAEEKAIYLKK
FT                   DWKEGASPIIYGDSTRLRQVLTNLLSNALKFTEKGGITLRVKPCLRDSEPYLQVEVEDT
FT                   GIGISVENQQRLFSAFSQAEASTTRRFGGTGLGLAISKQLVELMGGEIGVRSEEGVGSI
FT                   FWFTLRAQPGEALAVSQSGAVSQAGAALKSNADVALQEENPQGAQQLHEPLPERYVLVA
FT                   EDNLVNQKVIGVMLKKLGMRFDIAENGKEAVLKYMEANSPYDLVFMDCEMPEMDGYQAA
FT                   KEIRSYEHAKGMAAVPVVALSAHVMDEHLQAVKDSGMNDALAKPLTLDTLECTLRRYLA
FT                   SRNS"
FT   CDS_pept        complement(210739..211755)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01590"
FT                   /product="Response regulator receiver:metal-dependent
FT                   phosphohydrolase, HD subdomain"
FT                   /note="silverDB:HdN1F211"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43742"
FT                   /db_xref="GOA:E1VG00"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG00"
FT                   /protein_id="CBL43742.1"
FT                   /translation="MNIRIHQKRTLLLVDDEPVNLQVLRYALENDYNLIFAKSGQKALE
FT                   LANDAHPDLILLDIMMPEMSGYEVCKALKDNSNTRSIPVIFVTSLDNEMNEEKGLELGA
FT                   VDYITKPVSPAIVRARVRTHLSLVQAEVVLQTRLSIIQSLGIASEYRDNETGMHVIRIS
FT                   YHARRLALDSGYSEDAADELFYAAPMHDVGKIGIPDTVLLKPGKLEPHEWEIMKQHTKI
FT                   GAQIIGNHDASLLRMASTVALRHHEKWNGSGYPDGLSGENIPHQARIIAVVDVFDALLS
FT                   ERPYKKPWPLEKVIELLYEERGKHFDPALVDTFLDNLPAHQEIQEKYGDNSSNANTL"
FT   CDS_pept        complement(211777..212103)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01600"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F212"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43743"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG01"
FT                   /protein_id="CBL43743.1"
FT                   /translation="MENAISTVQKAWQALHAAYGQNQARGVKSTNEPTLAQEAPYSLSQ
FT                   ALRNSAQTAIRTLRKRQLPKHELESLTSALPASAITPILNAVEYFDLEQAANLIDTLLK
FT                   KESR"
FT   CDS_pept        212998..214068
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01610"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F216"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43744"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG02"
FT                   /protein_id="CBL43744.1"
FT                   /translation="MSAVNVNLVSNATSSKAASSKAASSKAILGAALLGLALTGCGGGG
FT                   GSSSGGDAGMTGSTQTGNSTNQIREGRFLDAAVSNARYVTLTPDGKVSMSGFTAEDGSF
FT                   FFRDGETVSFFIGDILLGKAAAAGIVTPSALVDGANSSDALPNMLRFLQTLDTDADPYN
FT                   GIQISQLVHEHSTNLKVDFDRLKGDFEVQSALTGLLAMATNSPTMPTVFAALDHFRTTM
FT                   LNAYDSNSGETVLNLVGTKWRSTFSSEACGDTSVELTHTFNKLGHFTTGYHDLKQRDDG
FT                   SCKGSSLAVLMALYENDDMFSCANGCSLTDLNRTVRINGPEAHDATIVHAPGTSTITII
FT                   HQYDDGREVLETMKKV"
FT   CDS_pept        complement(214132..214746)
FT                   /transl_table=11
FT                   /gene="gmk"
FT                   /locus_tag="HDN1F_01620"
FT                   /product="Guanylate kinase (GMP kinase)"
FT                   /EC_number="2.7.4.8"
FT                   /note="silverDB:HdN1F218"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43745"
FT                   /db_xref="GOA:E1VG03"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG03"
FT                   /protein_id="CBL43745.1"
FT                   /translation="MSGTLFVLSAPSGAGKTSLVKSILEALPNLVTSVSHTTRPQRQGE
FT                   QDGINYHFVDQERFTAMLDQNDFLEHAEVFGNFYGTSRSFVAETLAHGQDVILEIDWQG
FT                   AQQIRHLFPESISIFILPPSRNALDARLHGRGQDSEATIQTRLAKARDEMSHYVEYDYL
FT                   IINDDFDTALQELCAIIRASRLKILGQMRRHERLLQNLLNP"
FT   CDS_pept        214968..216353
FT                   /transl_table=11
FT                   /gene="tlyC"
FT                   /locus_tag="HDN1F_01630"
FT                   /product="CBS domain protein, hemolysin-related"
FT                   /note="silverDB:HdN1F219"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43746"
FT                   /db_xref="GOA:E1VG04"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG04"
FT                   /protein_id="CBL43746.1"
FT                   /translation="MEICYHRRSKITQVFFVDIAIIFGLILLNGVFAMSEIAIVSSKRL
FT                   RLQQAADNGDQGAKKALELSEEPTRFLSTIQVGITLIGIMAGAFGEAAIVQHLEAFILD
FT                   LGLKVEYAKPVAWTSMVVIITYFSLIFGELVPKRLALMNPELIARIVSRPMDLLSKMVR
FT                   PLVWLLSHSTELILKLLRARRQEEVSLIEEEIHSLIKQGAETGVLDLSEKNMVKNVLRL
FT                   DDKRVGNVMTLREDLFYIDLNDGDQANLAKINSGPYFWVPVCRGGLNQIVGMLSVKDLL
FT                   SSRSASPQAPLESLVQSPLYVPLSTTLLELLEQFKQARDPVVLVRDHHGQVAGLVTMSD
FT                   VMMAIVGDFPVADDDYEPDFVQRQDGSWLVSGQIDIATFKDHFAVRKLPEESSGLYHTL
FT                   GGLLLTVLDRVPKEADAVLIQNLRLEVVDMDGARVDKVLVCEAIAQEESRTSTVIQSRE
FT                   TDR"
FT   CDS_pept        complement(216103..217797)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01640"
FT                   /product="Drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="silverDB:HdN1F220"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43747"
FT                   /db_xref="GOA:E1VG05"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG05"
FT                   /protein_id="CBL43747.1"
FT                   /translation="MEDLKPMPPASQRWGFVMALLGMFMAILDTQIVASSLTEIQAGVS
FT                   ATLEEVSWIQTSYLIAEIIVIPLAGMLVRWLSTRLAFVLSCAAFTAASAACVLAQTIEQ
FT                   LILLRAIQGFVGGAMIPIVYSVSFSIFPNRAMGAVQATIGLVATLAPSIGPTLGGYITQ
FT                   HAGWHWLFLMNIIPGIIASIGVWMLLDIDKPQFHLLRKIDFLGLLYLALFLGPLEYVLE
FT                   EGPKHDWFDDTHICLISLLSVTSALLFFRRAFASSFPIVDLRVFRHRNFAVGCAMGFVV
FT                   GIALYGVVYMMPMFLGGVRHLNSLQIGAIMFVTGAVMFLAAPIAGRLTDKVDLRYLLVA
FT                   GLVILGIGLMMNNHLTADSDFDDFFWPQVVRGIGVLLCLVAASRLALGSLPQAEVPNAS
FT                   GLFNLTRNLGGAVGLALLDTLLDIRVDHHWNALIPAIDTGREPTLYALQETGALVAGAA
FT                   NDPASAAIAHLATRVMTQAQVLSFNDLFLWIGLLYLCAIPLALLLHKPAPYRPAHHPYP
FT                   QLPDADSGSAQHPPLWAPDPAQSTANHPACDRGHCSPREACAQRSGP"
FT   CDS_pept        218495..219481
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01650"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F222"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43748"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022002"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039569"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG06"
FT                   /protein_id="CBL43748.1"
FT                   /translation="MTPEEKKAFEAELYSWVGKEIIPPTPGLDLVNEPMIRQWAEVLGD
FT                   ENPVYTDRAYAEASSKGGIVAPASMLWIWSMRGYPMAFAAQQDLSKVDGQVRLHRWITE
FT                   QGLTGVLGTNCDQEYHQELRPGDTVIANMVVKSISEEKATAMGNGYFIETLTTFKNQHD
FT                   EVVGTMIFRVLRFTPAQAPKPVAESAATENKAPTRIRSVRGHDNAWWWDIVEKQKKLPI
FT                   QRCKGCQTLRHPPRPFCAECQSGEWDHIESTLEGEVFSFIELHYPEIPGYSYPLVCAVI
FT                   SLDEGTRIVSNIIDCKPEDVKIGKRVKGEILQVDADNIIPQFRLVAN"
FT   CDS_pept        219500..219934
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01660"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F223"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43749"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG07"
FT                   /protein_id="CBL43749.1"
FT                   /translation="MTSEARTLTTRKFSEVSVGEKLPNFNFPISVSFVVGSAIASRDFT
FT                   PVHHDKAAANAAGLGNVFPNILADNGLAGRYVTDWAGPESTVKRINIKLGAPVLPGEDL
FT                   KFTGEVAAKDDATGIVEIKVVAKGNWGMHLDGIVRVQLAK"
FT   CDS_pept        219961..221187
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01670"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F224"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43750"
FT                   /db_xref="GOA:E1VG08"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG08"
FT                   /protein_id="CBL43750.1"
FT                   /translation="MGSKSKIEYPVSVAHGAKAANLSNKSAIVGVGTTEFSKNSGRSEL
FT                   SLACEAVIDALRDSGLKPSDVDGMVTYTMDTNDEIEIGRAIGCNDLSFYSRVPHGGGAP
FT                   TGCIEQAAMAIATGVAEVVVCYRALNGRSGHRYSAGVSGNIVTGDMIHYGWYLPYGLLT
FT                   PASWVAMYHQRYEHLFGNTKDALAEIAIATREYAVTNPRAFFHKRPLTREEYNKGKPIA
FT                   LPFNLYDCCQESDGGCAVVVTTPERAKHLNHLPVMVKGVGMCAERNTEAMTNFYADEIA
FT                   AIRSMDLAAKQAYAQSGLTPEDIDAAIIYDAFTAIVMWQLESWGFADTGKAAEFVLSGA
FT                   LRKDGRLPTNTHGGQLSEAYIHGMNGVNEGVRLVRGTSNNQPAKVINNVLVTSGVGVPT
FT                   GGMLLGRPD"
FT   CDS_pept        221195..221689
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01680"
FT                   /product="thioesterase superfamily protein"
FT                   /note="silverDB:HdN1F225"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43751"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG09"
FT                   /protein_id="CBL43751.1"
FT                   /translation="MTNDTSASGSSIELTPSSERTASIPDGFTVGKGPYSQRIGPLVYR
FT                   REQAADGLWTGWVGVMMEDHHIGANQRGHGGLMLTLLDEAMGLNAFLNHGNTPVVTVSL
FT                   TTHFIAATLPGHFLKATGRVVRATRSLAFIEGEAWCGDTLVGTASGVWKYLKKSDSSQS
FT                   K"
FT   CDS_pept        221705..222493
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01690"
FT                   /product="Oxidoreductase, short chain
FT                   dehydrogenase/reductase family protein"
FT                   /note="silverDB:HdN1F227"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43752"
FT                   /db_xref="GOA:E1VG10"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG10"
FT                   /protein_id="CBL43752.1"
FT                   /translation="MYDFSNKTVIVTGGTKGVGLGVTRAFLKAGATVYICGRRAPEETI
FT                   EVDGNVARFIAADVRKPEETQAIVDQAVRETGHLDVLINNAGGSPPVNAADAPVKLTEA
FT                   IIRLNLIGPMIFAQQAHAAMRNNVGGGVIVNIASVSGVRPSPGTAAYGAAKAGLINVSR
FT                   SLAQEWGVDRVRVNAIIAGLIRTEAAEDHYGGQAGIALIEESLPMRRMAVPEDIANACL
FT                   FLAADSSQYISGAALEVYGAGEPPSFLKLAEQAAALAQKP"
FT   CDS_pept        complement(222513..224630)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01700"
FT                   /product="predicted chemotaxis transducer"
FT                   /note="silverDB:HdN1F229"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43753"
FT                   /db_xref="GOA:E1VG11"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG11"
FT                   /protein_id="CBL43753.1"
FT                   /translation="MNFKSLQTTITVFAGASILAVVAALTLYALYSSTQTESIIRKGSD
FT                   ATVSQAVRGQLQSLAKSEIQQIQADFQQGMQIVKDIAVLNSRIGDNLSIHRPELTSLLK
FT                   YYLTANPQLIDLYIGWEPNAFDNEDHLYRDQIDHGYDHTGRYMPWWFRNGDTYTLEPLK
FT                   NDEMESTTLQPSGMREGEYYLCPKETRQPCVADPVSYDFGGTQVLVAAITAPILVDGQF
FT                   RGVAGTELALDFIQKRLQSAKQSLYNGAAEVTLLASNGSVVASTKSPEAAGKSGSSVVS
FT                   SYLLSTFQRDSNNSVISMEDRSKPIELLMPFTVAGTTRHWALAIELPSNVVFADLTALQ
FT                   NQIAENSSRQLRFMVLVGLLVAGAGLVLIALVARNSAAPLQNLANMLRDIAQGEGDLTQ
FT                   RLHLNRKDELGTIASGFNTFLAKLQGMIGDVVHSVEGVSHASERTSQIAVRTNEDVQRQ
FT                   LSEIEQVATAMHEMTVTAQDVARNAAQAAEAAGNADTEANQGMLVVNDTANAISNLANE
FT                   LQQSMQVVMNLARDSENINAILVTIRSIAEQTNLLALNAAIEAARAGEQGRGFAVVADE
FT                   VRNLAQKTQQATGEIQTMIAQLQNGTNEVVRVMQNSQARSEDSVKQARQAADSLNAITA
FT                   AISVISDMNTQIASAAEEQSAVAEDINRNVTNIGSAAHEVAAGADKAKGTSGELTQLAE
FT                   QQKRLVGQFRV"
FT   CDS_pept        complement(224776..225966)
FT                   /transl_table=11
FT                   /gene="hemN1"
FT                   /locus_tag="HDN1F_01710"
FT                   /product="Oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /note="silverDB:HdN1F230"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43754"
FT                   /db_xref="GOA:E1VG12"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG12"
FT                   /protein_id="CBL43754.1"
FT                   /translation="MPRTSRVFSELPPLSLYVHIPWCVRKCPYCDFNSHQAIDVNEPHY
FT                   IDCLLDDLDRDLHWVQERPLHSIFIGGGTPSLFSAESITRLIKGIQQRIALEPSIEITL
FT                   EANPGTAEQARFYGYREGGVNRLSIGVQSFNTDHLQRLGRIHNGDNAKAAIQLARDAGF
FT                   ENFNIDLMHGLPGQSLNHALDDLQTALQFQPPHLSWYQLTIEPNTVFYNAPPKLPEDDT
FT                   LWDIQQAGIALLEQYGMNHYEVSAYAKAGRRSRHNLNYWQFGDYLGIGAGAHGKITVRD
FT                   RGEILRYRKTRLPRDYMAGIDPAKASYLAATEAVPAPELPFEFFMNALRLREGVPTKLF
FT                   EQRTGLDLREIAPTLEKALALGLLESSPSQLAPTPQGWLFLNDLTALFLEQEHKLG"
FT   CDS_pept        complement(225969..226583)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01720"
FT                   /product="Xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="silverDB:HdN1F231"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43755"
FT                   /db_xref="GOA:E1VG13"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG13"
FT                   /protein_id="CBL43755.1"
FT                   /translation="MSLPRTLVIATGNAGKLREIQQILAPFCWEIVSQKVYCVTDAEET
FT                   GLSFIENAILKARHACKQTGLPALADDSGIEVDALNGAPGIYSARYSGNDATDARNNQK
FT                   LLDALREIPEAQRTARFQCVIALMRHANDPTPLVCQGTWEGRILHAPQGNNGFGYDPLF
FT                   WVESHQCSSAELEPTVKSQISHRAQALLKLTEQMKTSLVWR"
FT   CDS_pept        complement(226602..227063)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01730"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F232"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43756"
FT                   /db_xref="InterPro:IPR025218"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG14"
FT                   /protein_id="CBL43756.1"
FT                   /translation="MQTIQPRWIALALLTGSALLANMANAKNQVEDDRFIVHYSAFNST
FT                   LLPEAVAKAQHLRRGPQIGMVNITVLKKRPDGQTPINVSAFLTGKTILHNGTNTPIEFT
FT                   QTSENGAVSYIGEFPIANGKSTRFEIDVSPGADNAKFQLRFSQTLFIDR"
FT   CDS_pept        complement(227082..227672)
FT                   /transl_table=11
FT                   /gene="metW"
FT                   /locus_tag="HDN1F_01740"
FT                   /product="Methionine biosynthesis protein"
FT                   /note="silverDB:HdN1F234"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43757"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG15"
FT                   /protein_id="CBL43757.1"
FT                   /translation="MRSELQLIQQWIHTGASVLDLGCGDGTLLAHLIATRNVLGYGLEI
FT                   NHDKIVECLNKGVNVIQQDLDQGLANIGNQSFDVVVMTQALQAVTYPEMVLDDMLRVGK
FT                   ECIVTFPNFGHWRNRLYLGLLGRMPMSRAIPYNWYDTPNIHLCTFRDFEAFCHKRDIRI
FT                   LHRTVVDMEYENGTAMRILPNLFGETAIYHIAR"
FT   CDS_pept        complement(227662..228846)
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="HDN1F_01750"
FT                   /product="Homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="silverDB:HdN1F235"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43758"
FT                   /db_xref="GOA:E1VG16"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG16"
FT                   /protein_id="CBL43758.1"
FT                   /translation="MPSQFPPDSVGVVHPQVAHFTEPFTLQCGKTLPSFELVYETYGTL
FT                   NTARSNAVLICHALSGHHHAAGYHRESDTKPGWWDTAIGPGKTIDTQRFFVVCLNNLGG
FT                   CHGSTGPRSINPETQEPYGGSFPIVTVKDWVNSQALLADRLGISCWAAIVGGSLGAMQG
FT                   IQWAIDYPARLRNAIVIAAAPKLSAQNIAFNEVARKAIQQDPDFHNGNYYSHNTKPRNG
FT                   LSLARMLGHITYLSDAAMREKFGRELRDGQIKFDFNVEFQVESYLNYQGEVFSQNFDAN
FT                   TYLLMTRALDYFDPAADFDHDLVKTMAQTQCKFLVLSFTTDWRFSPERSHEIVNALLAA
FT                   RKSVSYADINSPQGHDSFLLNVPRYLQLFKAYMDAIEIANHAPLLSSQENENAL"
FT   CDS_pept        complement(228954..230252)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01760"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F237"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43759"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG17"
FT                   /protein_id="CBL43759.1"
FT                   /translation="MVNTQRDFYRGAVQSIRDGLIAGTETIRDLHTSILDSLAAVGVQS
FT                   TINQLITKQVYRIISCMSARIGGLLDTVLFHIPIPGGELAPTENQRLLVSSINGAFGDW
FT                   LHHNHRTWAQPMEICREGNTLKLHPDCLQAALPNAKPHLILLIHGLCLNDSHWSPRRQM
FT                   GFAEAWETRGNCTTLTLRYNSGLHIHTNGQQLAHLMQQLVDAYPRSLQRITIVGHSMGG
FT                   LVARSACSYADQQEFGWVTQLQELACLGSPHEGAALERIGHWVTQTLGKTSLTASLGRA
FT                   GQARSAGIQDLRYASLRHEDWQDDPTHADTPTHLTVVPLLPHVRYCLLASNWKIGMAET
FT                   VGDGLVQVSSARGFSLQDQALGDDHTATDQATLVHTPPVHTPHPDHDIDVYRPLLQGIH
FT                   HMALTRHPLVYRELTIWLFGDLMQEQTDETFHA"
FT   CDS_pept        230542..230910
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01770"
FT                   /product="predicted response regulator receiver"
FT                   /note="silverDB:HdN1F238"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43760"
FT                   /db_xref="GOA:E1VG18"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG18"
FT                   /protein_id="CBL43760.1"
FT                   /translation="MSKTVLVVDDSSTFRQVVAQSLKTAGYEVVEGANGKDALEKLNGQ
FT                   KISLIVSDVNMPIMDGLAFVREVKKLANYKFTPIIMLTTESGEATKTVGKELGVKAWMV
FT                   KPFKADLLLSAASKLIQP"
FT   CDS_pept        230975..231319
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01780"
FT                   /product="predicted sulfate transporter/antisigma-factor
FT                   antagonist STAS"
FT                   /note="silverDB:HdN1F239"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43761"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG19"
FT                   /protein_id="CBL43761.1"
FT                   /translation="MSLVLEAEVDGGCKIRPEGELTIYRVADYKPQLIQVLESHPSIVV
FT                   DLSRVTEFDTAGLQLLILLKREAKARGITSSFTGHSAEVTELFQLFDMVPYFGDPLVMP
FT                   QDDSSRRASV"
FT   CDS_pept        231316..233586
FT                   /transl_table=11
FT                   /gene="cheA"
FT                   /locus_tag="HDN1F_01790"
FT                   /product="predicted chemotaxis protein histidine kinase"
FT                   /note="silverDB:HdN1F240"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43762"
FT                   /db_xref="GOA:E1VG20"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG20"
FT                   /protein_id="CBL43762.1"
FT                   /translation="MSLDDAFQAFVIESSELLQDMEDHLLAFSSATSPEESINCIFRAA
FT                   HTIKETAGLFGIHGVVGFTHVVESVLQRVREGSLPMTDALISLILECKDYISRQIGAIQ
FT                   DDVVIMDDGMIATEKGLFDQLCRYMKPGDDTSGVCCSIETEASAGAEESQPAGAQPAEK
FT                   VRDAALGNPTIEAKDDAQMENENWHISVQFSEDVLRQGMDPAAFLRYLNTIGKIQHIVT
FT                   HFERIPKADEMDPESCYIGYEINFKTEADKSTIEGVFEFVRDDCQLRIIPPHARASDFI
FT                   TAIQQVESAGHLKLGEILVQCGSLTSAELKRLLGLQKKLNEGGEKARLGELVVQDQSAH
FT                   PEVVQAALHRQEQNKHTQVKTNQTLRVDAVKLDHLINLVGELVIAGAGIESGAKELGNS
FT                   RLLEASLTMARLIEEVRDSSLRLRMVQIGETFNRFQRVVRDISKDLGKQIELEINGRET
FT                   ELDKSVIEKIGDPLTHLVRNAMDHGIEPPEVRRERGKSEIGMVGLNAYHESGSIVIEVS
FT                   DDGGGLNQKRIFEKAVEKGLVAADAVLTPQQIYQMIFEAGFSTAATVSNISGRGVGMDV
FT                   VRRNIESLRGSIEIDSEEGIGTKIKVRLPLTLAIIDGFMIGVDESCYVLPLDVVEQCRE
FT                   LSELEQAQCRKNNYINLDGAVLPLIRLRDFFEHHGPAPKRENIVVVKHGARKTGFVVDH
FT                   LLGELQTVIKPMGPIFGRMRGISGSTILGSGDVALILDTASLVERAVVKESSVVTSRRL
FT                   ACP"
FT   CDS_pept        233627..234160
FT                   /transl_table=11
FT                   /gene="cheW"
FT                   /locus_tag="HDN1F_01800"
FT                   /product="CheW-like protein"
FT                   /note="silverDB:HdN1F241"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43763"
FT                   /db_xref="GOA:E1VG21"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG21"
FT                   /protein_id="CBL43763.1"
FT                   /translation="MNALVQKKAQVEQVQVSEDDQYLTFSLAGEMFGVGIMSIKEIIEY
FT                   GSITSVPLMPGFVRGVINLRGRVVPVIDLQARFGRPSSPVEKRTCIVIVEVAGVEDALD
FT                   IGVVVDAVSEVMAIPASDIEKAPSFGAKLRQDFLRGMGKVDGKFVILLDISQVLSVEEL
FT                   SGLVGHLDEVQAAD"
FT   CDS_pept        234184..234711
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="HDN1F_01810"
FT                   /product="Chemotaxis protein CheD"
FT                   /note="silverDB:HdN1F242"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43764"
FT                   /db_xref="GOA:E1VG22"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG22"
FT                   /protein_id="CBL43764.1"
FT                   /translation="MQQTIVLMPGEFYFGDRTTVIKTLLGSCVSIVLWHPQKKIGGMCH
FT                   FVLPSRKVRGVLDGRYADEAMELFLISLRARHTEAPQYRASLYGGANMIRLAPGVCCAE
FT                   GAEPLAASKRCTNVACLNQREARTLLQRFGFSLVEQDMGGNTHRMVEFDVGTGKVKVQR
FT                   GGNCPQPSARYA"
FT   CDS_pept        234970..236178
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01820"
FT                   /product="response regulator, CheY-like"
FT                   /note="silverDB:HdN1F245"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43765"
FT                   /db_xref="GOA:E1VG23"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG23"
FT                   /protein_id="CBL43765.1"
FT                   /translation="MVEFPSPVLVVDDSGVQRQYMADLCRTLGASEVLQARGGAEALEI
FT                   LSTERDRLRLVIVDLEMPDVDGVQVMQESLQLKLEVPIIVASSRESSLLASIETMCANL
FT                   GVNLICALAKPLTVMQLTTAVSRIQPKSIAKKSIAEPEGHSFEPREFSEALMHHQFCAH
FT                   FQPKVTLDSGTLKGVEVLIRWQHPRRGLVMPGHFIPAMEGTPFIHYVTFEVLDLTLAQM
FT                   KDWLARGLVITASINLSASSLARPGFIDTLLERIKTSKVPPSLIICEITETAIMTDLGV
FT                   SLGALARLRLHGVGLSIDDFGTGFSSMQQLSQAPFTELKIDRAFVHGAHERTHLRVMLE
FT                   STIEMARRLNLNVVAEGVETAADWTLLRALSCEMAQGYHIARPMPSDTFLEWAQQTDRA
FT                   HLA"
FT   CDS_pept        236537..237823
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01830"
FT                   /product="ABC1 family protein"
FT                   /note="silverDB:HdN1F247"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43766"
FT                   /db_xref="GOA:E1VG24"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR009330"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG24"
FT                   /protein_id="CBL43766.1"
FT                   /translation="MIGDIFDTVGSLLEGGERYVAATRTGFDIEQIYRRYRHEADDHSV
FT                   EESRELLDAAHQKGASLLTRLFHENGAIWVKFGQFLSSRTDILPPQYVQELQKLQNDAK
FT                   PAEFRKIQKVLEAEWGADWRSRFAAFDETPVAAASVAQVHRATLTTGERVAVKIQLPQA
FT                   RRLFRQDSAVFKALARVGAPMVSHFDLRQVIDQIVDITLQELDFLHEESNLRKFENLPH
FT                   SPRIYVPKLFGEMSSERVLVTEWIDGVRLTDYLNQHPEQAERILREMLHSYIQQITAFG
FT                   VFHADPHPGNFLVMNNGRVAVLDYGAIGVLTQEEAQNYAILLQVLFGRITLDTPLGELF
FT                   RKAGFVAKDQRVFEEVADLVLKEALRNPTSSDILALALDRMRSLKVQIPDSFVSLARVV
FT                   LTFGGLLKTYQIKVSGLDDAAIGDAQAIA"
FT   CDS_pept        complement(237900..238694)
FT                   /transl_table=11
FT                   /gene="znuB"
FT                   /locus_tag="HDN1F_01840"
FT                   /product="ABC-type Mn2+/Zn2+ transport systems, permease
FT                   component"
FT                   /note="silverDB:HdN1F249"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43767"
FT                   /db_xref="GOA:E1VG25"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG25"
FT                   /protein_id="CBL43767.1"
FT                   /translation="MIELLLPPLLVGLLLALISGPLGAFVVWGRMAYFGDTLAHSALLG
FT                   VGLSLAFGFHMLVGVALVTALVAIVLTLPSSQRYFANDTLLGIMAHGTLALGLILVSLA
FT                   GNARVDMMGLLFGDVLAVTWDDVRFIVAGSALVAVTLLFTWRALLSCILSAELSAAEGV
FT                   PVERLRALLMVLLALTVAVGMRVVGALLITALLIIPPAAARRISSTPEQMALKASLVGV
FT                   IAVSLGLGFSWYLDTPTGPSIVLAAVLLFMGIHTLAPERAAR"
FT   CDS_pept        complement(238687..239409)
FT                   /transl_table=11
FT                   /gene="znuC"
FT                   /locus_tag="HDN1F_01850"
FT                   /product="High-affinity zinc uptake system ATP-binding
FT                   protein"
FT                   /note="silverDB:HdN1F250"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43768"
FT                   /db_xref="GOA:E1VG26"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017882"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG26"
FT                   /protein_id="CBL43768.1"
FT                   /translation="MSLAPSPLLELQTVSLRIEGKLILDQIQLSLHANEIITVVGPNGG
FT                   GKTSLIKLALGLIRPSEGKVQRRKGLRVGYMPQRLMVDNSVPITVERFLQLAGGRRAPI
FT                   ADTLARVKASAVRHAPLQSISGGEWQRVLLARALLRKPDLLVLDEPAQGVDLQGQQEMY
FT                   HLLGAIRSETGCGIFLVSHDLHLVMASSDRVVCLNQHICCSGAAHAVARHPEFLALFQN
FT                   SSAEDIGIYTHHHDHQHD"
FT   CDS_pept        239483..240508
FT                   /transl_table=11
FT                   /gene="znuA"
FT                   /locus_tag="HDN1F_01860"
FT                   /product="high-affinity zinc uptake system protein"
FT                   /note="silverDB:HdN1F251"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43769"
FT                   /db_xref="GOA:E1VG27"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG27"
FT                   /protein_id="CBL43769.1"
FT                   /translation="MGLARLELGMLGFTQQKRLAMSARSAVAHLWFRSLITASVVLTSV
FT                   LFAEAAVAEPERPLQVVVSTQPLLRVIQSVAPTGSVEVNVLLPRAASPHDATLRPRQLQ
FT                   QLVDADWLIWMGPVVEPYLQTWIQKRQGPSLDVTTLEGVIKLPPRKPMEGGDPHDHDSE
FT                   AGHQHSGTANFDVHLWWSRENLLLAADAVAERLIALRPNLKPEVQQKRDQLQIAMQQLA
FT                   TEYPQGGTKIQPFAVFHDGWQYLERDLGQKAQAGFVLDGELAMSLRHLAKLKQHFRTHP
FT                   VACVLIEPGMNTALVGKVLPDTPTVLLDPMGWDVPSEGIVPMLRHAYESLARCGRAGAK
FT                   N"
FT   CDS_pept        complement(240512..241504)
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="HDN1F_01870"
FT                   /product="Homoserine kinase"
FT                   /EC_number="2.7.1.39"
FT                   /note="silverDB:HdN1F252"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43770"
FT                   /db_xref="GOA:E1VG28"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR005280"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG28"
FT                   /protein_id="CBL43770.1"
FT                   /translation="MSVYTQLQFDEVTTFLARYGNLKLLRLEATTSGIENSNYFLEVAQ
FT                   AAQHTGQNDRDSLETNTTNRSLVLTVFESVNERDLPYFANLLTHLQQADLPVPAPLLDH
FT                   QGNFLQFLHNKPCMVVPRLPGKHIQTPNIAQCRAIGKALAELHAASKGFSLHRQGDFNG
FT                   EWRKQSAARVQPLLDANDTSLLQREIARWQKREIAGPELPRGVTHGDLFHDNALFEGNQ
FT                   LTGIIDFYYACNDVFVYDIAIVMNDWCIHDDGTLDEARYSAVLSGYQEIRPLQAIEIAA
FT                   LPEYLVFAALRFWLSRLVNNCDPAKAGVQQKSPAPMKALLLQRLREFLQ"
FT   CDS_pept        complement(241555..241866)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01880"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F253"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43771"
FT                   /db_xref="InterPro:IPR021357"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG29"
FT                   /protein_id="CBL43771.1"
FT                   /translation="MKPIFIALIAATLAALPTLSNARVEPQTPDEQPIVPSKRDKVTIV
FT                   QNADQTIEIHQIDGKIYGIKVVPKHGKPYFLVDLNGDGNFIQNSSDRMLVPQWVIKSW"
FT   CDS_pept        242101..242838
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01890"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F255"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43772"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG30"
FT                   /protein_id="CBL43772.1"
FT                   /translation="MGLAEGGLNGALIDEFDELEYSIVILATAEVVMPAPMLSYPTALD
FT                   EVGSTLSVPVAMPEDIDPAVVSSFVQALEKALVVMAHARQGEVIARADQLAELASGLLE
FT                   PSTELLADRVNRMNTLRQVFADGDWLSAEQLNVLQDKPPKNKSQPASDWKRRGRVFAVS
FT                   HGSREYYPRYQFDAMYEPLPIIREVLAAFGEVADPWVLAAWFHYPNGWLAGVDGAPLAP
FT                   KDALNRGEDVVRAAAKRQGSYLA"
FT   CDS_pept        242835..243491
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01900"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F256"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43773"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG31"
FT                   /protein_id="CBL43773.1"
FT                   /translation="MTAPADGALQAPRASEDFEVRELQHGEVAEWFHVYCTRNYPDTNA
FT                   RTFAQGWGDTRFAPIQEVDGTAVHTYYVASTPEAAYMESVLHDVPLAPAGMFEVASLRY
FT                   FHLVRLRLPPVLRYVSFHTPFLPQLGITRAQLIDSPPAFYDSTRKWSQAACLQCADAQA
FT                   VGYGSKRDDAARCLLLFGQRLPDPPFEVLGEEPLALGPRRDELLRLVRALKLHEV"
FT   CDS_pept        complement(243509..247729)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01910"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F257"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43774"
FT                   /db_xref="GOA:E1VG32"
FT                   /db_xref="InterPro:IPR007452"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG32"
FT                   /protein_id="CBL43774.1"
FT                   /translation="MIARLFRFGWRSLLVLAVVPLLLTAFLLFSNAGLRVLLHSGLSAL
FT                   PNLTVEDASGSILTGFTLHNLRYVDSNLQLNLDQLALDLSPRCLLKMDLCVERLAIGKT
FT                   TLEFSPASDDAPDFDFPAISLPPIHLPIRVDVQEASLQELKFLDGEDSWAIRDGLLRFR
FT                   NEGDVIFLDDAHTRIEFSGLTIHAAVNGSLDLRGETAASLSTQVKLDFGADLPDLDIGA
FT                   EIRGSALSPKIEAVTHGLVEAEATIGASFRETGWPVNAQLKQNAPIQLVDEVPITLGRT
FT                   VAAISGHINRWHVEGTTTVGGIPETPDVEAKIITDGDFFGLDNGTVDLAVGDQRAQLAG
FT                   KFTWYPKLFWDVESEFSQIDAATWIPDVQSNVNAKAHVTGEWFLDLPFRNHVEIRETSG
FT                   TWQNHPIQLATDLTHTADSLDVREFSARVGSNRALFSGKLASTWDFNGTLQLPALQELL
FT                   PTLAGGAEGQLKLTGALNAPEVALTLASKNLVLQGEQLRESKLQLHGTLEKHELNATAQ
FT                   WNGYQAQAKIAGAWIDEHWRGSFAGTQVSKDGSSLRINPPAMLVYAKEENALTLEATCL
FT                   QAVPVSKQPSQLPSPSPSKPLARTNPSEALCIDAKWRPANDSGTVALRAQQFDPDFLIH
FT                   LLSSLPVSPKNTSWLNGKAGRWTGNADATLGSRGISQAQWQLNGEQIHLNELAGKPITP
FT                   SLDANHIQLKGQLRQKRIDAEAQIHWNPATKSQFSIQIPNYEQPQTQTISLQTDPIPIR
FT                   WAAPWVDAITLREGTFSGAVSGTIQRGWPDLSGELQLLSTTLGDRDAQWGLEALDLHLS
FT                   LRGESAELRGAAQDDRGLHWQLSTPLVAHWSQTSGEFTFSQGCLSSTQSVLCGKGYYAL
FT                   KGGLDLTLDAHGNVSPWLALALDDSALIDGPFEGQAHFYHRNGELHGEARLGATLTTTA
FT                   PLAGDDTPPTVQANIDAALTGDALTAKLSLLGEQGGKVQGELRADLHNERALVGHIDIQ
FT                   QVDLAPLRSFVTEADKLDGQINGRFTIGGRLALPAIEGDLQLSEGRFSSAALPISFTGI
FT                   AARAHFTQQSARVDAEMRAGKDSQATLKSTADWSSGKLLTHSSFQGQQLLVKQGSDINL
FT                   RADTNLTLASDGERLTLGGLVHLKEGFIRIVKLPENSVDVSKDALYTDSRKSLEPERAL
FT                   NVDVNVGVQISDLIKLEGFGADVRMNGVVGIQRIEPNDPEGHGVINISEGTYTGYGQKL
FT                   KITKGQILFNGPVDNPVLSITAVREILTPEGTTVTAGINITGTPQQPESSLFSTPAMPE
FT                   QDILSYIVLGRSRESSGSTGSFAMNQALLTLGLYGTGDYTRDLASKVGIDDFEISTSTD
FT                   NDNNDSINVGGYLSPRLFVQYGVGLNTPVNTLTLRYRLTQKIFLEALSGAENALDILYS
FT                   FEVQ"
FT   CDS_pept        complement(247726..249432)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01920"
FT                   /product="predicted outer membrane protein"
FT                   /note="silverDB:HdN1F258"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43775"
FT                   /db_xref="GOA:E1VG33"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR010827"
FT                   /db_xref="InterPro:IPR035243"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG33"
FT                   /protein_id="CBL43775.1"
FT                   /translation="MCTRWLAALLLTLAAGWVYAAPLDVNVSGGTQALRQNVKLHLSDL
FT                   DTRDLLQPRRLETNVLTSTNAALNALGYYDAEIKVSGIEKGAKEIKVRITPGKAVTWLK
FT                   PDVVLTGEGESNHLLQRWIAREAPKRGDVLNHAKYDDFKRGLREFSIQQGYFDAHWTRS
FT                   ELRINRDKHSARMRLTLDTVQRYHFGEVVMQGTRIEQARLHQFLRFKPGDPYQESKVTE
FT                   LYKSLLDCGFFKDLNVKADRDQIVDRKVPIIVNLIDDRAHHFNVGLGYGTDSGARSRFQ
FT                   WNKPVINDYGHSTGATLQLTERQKSMEFEYKIPDGHPLKNYYLGQASYIDELIGDTQVQ
FT                   TTSFTFSHNHEFENLWVRNLYVTLTQENKTEGISNRFFVTPGFAFSQLVLRGTPIIREG
FT                   HRYLFETEYSNPTLGADTRFYRVHGLAKWLVPVSERQQVLLKVEGGYIDADEFFKVPYT
FT                   RRFFAGGDQSIRGYGYQTLSPKDANNNTQGARYLSLASTEYLYRFLDRWQWALFVDRGR
FT                   AFNNSDEPYHTGIGTGIRWLSPVGNIRLDIAKRVDDNNKGYEFHIFMGPPL"
FT   CDS_pept        249783..250220
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="HDN1F_01930"
FT                   /product="transposase, fragment"
FT                   /note="silverDB:HdN1F260"
FT                   /db_xref="PSEUDO:CBL43776.1"
FT   CDS_pept        250700..255511
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01940"
FT                   /product="probable rhs-related protein"
FT                   /note="silverDB:HdN1F264"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43777"
FT                   /db_xref="GOA:E1VG35"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG35"
FT                   /protein_id="CBL43777.1"
FT                   /translation="MSAALLLGHSGLLNAACNVSNAKVHRDIDISACIQICDAGIPSNG
FT                   FVCTHSERKNYCLAECAGATAQCPKGNPIDILTGAKMQQEVDYSTGGDFPLEIRRSYNS
FT                   LSSEISPEFGAKWAGFGEAKIVSYLDAGKRYAVVQRPTGETWKYVWSGEDGTTQPTQSG
FT                   SGNALTAMEYDAERDIYELSLSDGSVEYYHFKQSELDSNKRFESKLWWKEDAAFRKHTY
FT                   VYNATGQLASVADDFGNALGFAYYPDGKIQAITAPGDKTFSYEYKIASVVDKVTSVVTE
FT                   VDILSKVCFSGASGAESSCKEYLYEDTRFPLALTGIVDENGNRFATFTYNSQGLAVSTE
FT                   HAGGADRMEVLEYRYGSGTFSPTSLYTPLSLGDRVVRLKNANGLETEYRFGYSGPEGGF
FT                   NAQLKSVTGDATLNCGATNSTYSYDAKGFQDKITDGRGFVTDLDHNAKGQEIRRTEALG
FT                   QPEQRTTETDWYPGGTIKEIRAPSKTTRFTYTQGNGLGRLASRTEIDTTTHSAPYATQG
FT                   LSRTWSYSYTYHDAPANLKVATVTVDGPRTDVNDITVQHVNPAGRIYRVEQQNGTGAPL
FT                   VNEVTEFSAEGLPKTIVDPNGTVTQLAYTPRGWLKSRTVVTPQGNVTTTYAYDLVGQVT
FT                   QVTLPTGTQLNYQYDAAHRLQSISTQDNERIEYELTAQGAHRIERILSSSGSLRRLVHQ
FT                   EFDDLGRLWKSFGVQDQVLETNQYDENGNLVRITDAYQQPILRAFDGLNRLRTQTERDT
FT                   GATQYEYNAQDQLVSITDPNGLTTTWVVDGFGRKIQETSPDRGTTVYRYDLADNLIQKT
FT                   DARNSVTKYSYDALNRLTEIQYPASAQDNVGLKYDETSLPTANGSIANKGKGRLTSAIV
FT                   ANGDKIQWAYDALGNITNDVRVQAGKTFQATYTYNVAGQLATLTYPSGRELSYGYDNKG
FT                   RIHQLRSRENSSKSWTTLANNLSYEPFGPLTGFTWGNGLTETLSYDTHYQPETIQTRSG
FT                   SSDVRNLQYGFNLANELDHLTDAKTPARSQLFSYDPNGRLNQAQGQYGILAYQYDLTGN
FT                   RVSQAQTNASDGQNFTESYQYPANTHRLTQVNASGQGGQNRSFQYSAAGNLTQDESYTY
FT                   VYNDANRLTKIFSGPAIVAEYRYNHLGERVSKTADGKTIQFIYGANHQLLAEHHQDGTP
FT                   IRDYVYLGNKLLAMVDADTTTNPDTGTKADLAITLKGATGNSVKQPDGRYQVTYKVNVQ
FT                   NAGGSAAENVVLTNTFPATDVNLVSYTASQGTCTEDAGSCDLGTISAGQTATVTLIANK
FT                   GKKAKENFSASVTTSSEESNTDNNSATAAFGGAFGLWIMAFLAAMLGLRSLTAKRALNR
FT                   KNTISTACLLLCGLSLMGANTSQAEQIYYVHSDHLNTPTLVTDSNKTVVWEGVRKPFGE
FT                   TEEVVNSVRQPIRFPGQYFDGETGLAYNLMRDYDARVGRYVQSDPIGLAGGMSVYGYAY
FT                   QNSVMYYDPDGRNVIALPGLGLGLGLGFLYCAITPSCSSAWGELAERIGDGASDLQQDI
FT                   EYGANWAQYHSRCDEPEPPYFLNPCDKARWKLRRAQDCKKLRQEMTDKWFGGVADQSHM
FT                   DHMAQLDNQIANAVRAVKANCCKE"
FT   CDS_pept        255522..256148
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01950"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F265"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43778"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG36"
FT                   /protein_id="CBL43778.1"
FT                   /translation="MKSVEEWISFVFDRPPSDIRAEWFHADDFVEPDIEKSLLCSHVSK
FT                   VFGNINKLMNVYSDVQLANGLNYIISPFASSTAYALLDQSVPEVDRLSAISSMKNVFVD
FT                   LFEKKCNSSSAHLNFICHMWWDMFPRHGVPFKSFLKMTDELVLSLMEDLLHLENPECKK
FT                   SGLHGLGHWYFGYPDTVAEIIERNIVCMPGELKEYARKAKHGEMQ"
FT   CDS_pept        256372..256605
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01960"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F266"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43779"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG37"
FT                   /protein_id="CBL43779.1"
FT                   /translation="MSDVTQRAIPDLLTPVVEAFNQWRGHGRRGRIPNDLWDQATALVD
FT                   HYPRTVITEALCVSVDALEQQCIKRNLPASKT"
FT   CDS_pept        256757..256996
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_01970"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F267"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43780"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG38"
FT                   /protein_id="CBL43780.1"
FT                   /translation="MIPMANTPTARSLEMMDETEMERLIVQLEQDALSTDEKARIIRVL
FT                   RSYYFAARLLKEAGTKLKTIRDFFSEGAQKQRRP"
FT   CDS_pept        257023..258408
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="HDN1F_01980"
FT                   /product="transposase"
FT                   /note="silverDB:HdN1F268"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43781"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG39"
FT                   /protein_id="CBL43781.1"
FT                   /translation="MAPVDTTASRERPLTTVPERSTRTLFNANPREGHGRLSAQDYVGA
FT                   ERRECSHAHLAAGQRCPACGHGSLYREPNKHQVELIGHAPISAICWQVEVLRCSACKTI
FT                   FNARNPCAKYQPSVKTSIVLARYYLGLPYHRLDAFQQLVGVPLPDATQWELAESLFSDV
FT                   LPVIEVLIKAAAQATLIGLDDTQGRILTLLAENKHLPADARHGIHSTGFVTVGAHTIIL
FT                   FFTSRAHAGENLDKLLDLRRPSMEKPTQMSDASANNGAKRHRDATEVTHCNAHAVRKFK
FT                   EIQANFPAPCDFVLETLSAVFAHDAFAREQRMNPEARRDYHAEHSGPLLADLKAWMEMQ
FT                   FREHREEPNSDLGQAMNYMLKRWERFTRFLTRPGVPLDNNFVERALKRLIFQRKNSLFF
FT                   ANERSAYVGCALTSLIMTAVEAGVNVFEYLNVLQENRFWVGREPERWLPWNYQQALPRR
FT                   EAA"
FT   CDS_pept        complement(258405..258755)
FT                   /transl_table=11
FT                   /gene="istB"
FT                   /locus_tag="HDN1F_01990"
FT                   /product="putative transposition helper protein, IS66"
FT                   /note="silverDB:HdN1F270"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_01990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43782"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG40"
FT                   /protein_id="CBL43782.1"
FT                   /translation="MLQLTPQSRIFLAVEPADFRAGIDGLAQRCRRHLEQDPFSGALYV
FT                   FRNRARTALRILSYDGQGFWLCTKRLSQGKLQWWPRSDENVCPLTHRQLQLLLWNGNPD
FT                   LTMLPSDWKRVA"
FT   CDS_pept        complement(258901..259149)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02000"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F272"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43783"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG41"
FT                   /protein_id="CBL43783.1"
FT                   /translation="MADATHQAIPDLLTPVVEAFNQWRGHGRRGRIPNDLWDQATALVD
FT                   HYPRTVITEALCVSVDALEQQCIKRGDVAAIRMHQRL"
FT   CDS_pept        259471..260670
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02010"
FT                   /product="alpha/beta hydrolase fold-3 protein"
FT                   /note="silverDB:HdN1F273"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43784"
FT                   /db_xref="GOA:E1VG42"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG42"
FT                   /protein_id="CBL43784.1"
FT                   /translation="MSIFTNQILRRITVADLQKFKIGKFERKGLETLLSSKRVTGARLW
FT                   MEHQFLAQVNRLPHAMLYRLMGGRPETLGTRTLGAEMQAIAFTSRRMKPFHEYPKDAMR
FT                   VRYQYVSRMMGRQGPPALQVRRKRIHLNSVAGGDRWLQIRTYTPAQTRLPRPMLVYFHG
FT                   GGWCIGGADTHEDFCLYIAERTNMAVVSVDYRLAPEHPYPLPVEDVIDAWQWIAEHAAM
FT                   LGGDERYLLVGGDSAGGNLSAVLCQQAYLRGFRMPAGQVLLYPSTDMRCQHASHQEMGD
FT                   DYLLTGKWIHWFITSYLQSNQKRVEPQASPLLADFEVFRHQPPAIVVTCGFDPLRDEGE
FT                   EYAEKLSAAGVSVDYHEFSHLLHGFIGMLGVSGQAISAANTISAQILGLLARLEGIQNS
FT                   "
FT   CDS_pept        260893..262569
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02020"
FT                   /product="Putative glutamate decarboxylase"
FT                   /note="silverDB:HdN1F274"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43785"
FT                   /db_xref="GOA:E1VG43"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022517"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG43"
FT                   /protein_id="CBL43785.1"
FT                   /translation="MHQDKRPATQRFAEANMDAMYRIFTVPEAPGSTLGQIDNMISQNL
FT                   MGFLQNHIVAVEKDLSEVEKDFADAHIPEKPWFVSDQTQFLLDKLVAQSVHTASPSFVG
FT                   HMTSALPYFMLPLSRIMMALNQNLVKIETSKAFTPLERQVLGMMHRLIYERDDKFYDQW
FT                   MHKSGHSLGVLCSGGTIANMTALWVARNAMFKPSKGFKGINHTGVFGALKHHGLEGMAV
FT                   LVSERGHYSLAKAADVLGIGRDHLLTVRTDDNNKVNIRKMRQKLEECRSRNIGVMAIVG
FT                   VCGTSETGTVDPLNDLADLAEEFGCHYHVDAAWGGATLFSQKYSHILEGIRRADSVTID
FT                   GHKQLYVPMGAGMVFFKNPTALSNIQHHAEYIIRQGSKDLGSHTLEGSRPGMAMLVHSG
FT                   LRIIGRSGYEILINEGIEKARAFADMVRAEPDFEMITEPELNILTYRYVPEFVKKKLAT
FT                   ANAREIDHIHDLLNRLTKLIQKTQRARGKSFVSRTRLTPEKYGHRLTVVFRVVLANPLT
FT                   NHQILRGVLEEQRTIASLEDCQQLLRQLSEACAEARHVSNG"
FT   CDS_pept        complement(262584..263318)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02030"
FT                   /product="nitroreductase family protein"
FT                   /note="silverDB:HdN1F275"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43786"
FT                   /db_xref="GOA:E1VG44"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG44"
FT                   /protein_id="CBL43786.1"
FT                   /translation="MSHFHEPLPEINAEEFRKVVMSRRSVRRYLPDPVPEAVIQDCLEL
FT                   ALLAPNSSNLQPWSFYVVETPEMRKKLAQACMNQNAAKTAPLLFVMVARTDTWKQNSLR
FT                   VLDVWPEETIPKVVQDYYGRLALFHYNQGPLGLLGLAKRVSGALAGLARAVPRGPYSLS
FT                   EMRVWAAKSTALACENLMLGLRAHGYDSCPMEGFDEWRVRKLLKIPSDGFVVMVIAAGK
FT                   RADNGVYHARFRFPLEDVVTRC"
FT   CDS_pept        263399..266161
FT                   /transl_table=11
FT                   /gene="polA"
FT                   /locus_tag="HDN1F_02040"
FT                   /product="DNA polymerase A"
FT                   /EC_number="2.7.7.7"
FT                   /note="silverDB:HdN1F276"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43787"
FT                   /db_xref="GOA:E1VG45"
FT                   /db_xref="InterPro:IPR001098"
FT                   /db_xref="InterPro:IPR002298"
FT                   /db_xref="InterPro:IPR002421"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR008918"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR018320"
FT                   /db_xref="InterPro:IPR019760"
FT                   /db_xref="InterPro:IPR020045"
FT                   /db_xref="InterPro:IPR020046"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR036279"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG45"
FT                   /protein_id="CBL43787.1"
FT                   /translation="MPSNPPIVLVDGSSYLYRAFHAMPPLTTSNGQPTGAIKGVLNMLR
FT                   KLQADVKPLRMAVIFDAKGKTFRDDIFPEYKAQRPPMPDDLRAQIEPLYDCIRALGLPL
FT                   ISISGVEADDVIGTYCVEASRLGERVLVSTGDKDIAQLVNEHVTLINTMNDTLLDRDGV
FT                   IEKFGLPPEQIVDYLTLVGDSVDNIPGVPKCGPKTALKWLDDYGSLDNLIAHADEIKGK
FT                   VGENLRASLEQIPLSRQLATIKCDVPLAQGVMELQLENANTEKLVELYQQLEFKSWLHD
FT                   LLGSNEAAGAHQNGASVSIASPTAESIPTQDGFAFEPENDYHTILDAAELERWVVRLLA
FT                   SDVFSVDTETTSLNYMDAELVGISFSLQAGEAAYVPVGHTAIGTPEQLPLDYVLNALKP
FT                   ILEAETPAKIGQNLKYDMNVLARYGITLSGVRFDTMLESYVLDAAATRHDMDSLALKYL
FT                   GQKTIAFEDVAGKGAKQITFDQVPLLQAATYAAEDADVTLKLHQALWPRVQKTPTLTKV
FT                   FQEIEMPLVGVLSRMEREGARIDVAALKQQSRQLGERMAELEAEAHTLAGQPFNLASPK
FT                   QLGEILYDQLQLPILKKTPKGAPSTDESVLQDLAHDYELPKVLLEYRGCAKLKSTYTDK
FT                   LPELVNPRTGRIHTSYHQAVASTGRLSSSDPNLQNIPIRNESGRKIRQAFIAEPGFTMV
FT                   AADYSQIELRIMAHLSDDESLIDAFARGLDIHRATAAEVMGVPLEDVTSDMRRSAKAVN
FT                   FGLIYGMSAFGLARQLGISREQAQAYMDRYFHRYPGVLRYMEDIRKQAHDQGYVETLFG
FT                   RRLYLPEVRAASKMRRQAAERVAINAPMQGSAADIIKRAMIDIDTWLRTQPAKIRMIMQ
FT                   VHDELVFEVPNDVVPDAIEQIQKRMSGAASLKVPLIVEAGTGTNWEQAH"
FT   CDS_pept        266342..267151
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02050"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F278"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43788"
FT                   /db_xref="GOA:E1VG46"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG46"
FT                   /protein_id="CBL43788.1"
FT                   /translation="MQYQVRYYHRIIQFRWRRFHRRSSCQYGLFGVIGSLLSHGHIAYG
FT                   IIGLFLTISAGVIGAVPAANAAMLDYDGCRVDEQRLLRGDLLACERAISVFNRKPQGDV
FT                   AGVILVNAPYSTVWRVLSNWEAQSGFVPGIKYYRVIHKFSGGNRSAWHALIEGRLLVPF
FT                   VAGRYTLDAHFDQRIGRVSWNMLTKDDAARYQAEGIQVKSFGEEQLKRLEGVARIVAYD
FT                   TKRTVFYYAPVLEPATPTPDFIRGAVRSVVLDDYMLAIKQAAEKRAK"
FT   CDS_pept        complement(267281..267643)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02060"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F279"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43789"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG47"
FT                   /protein_id="CBL43789.1"
FT                   /translation="MKNKAAICYFMASFALISVAGCASVAVTEDAIKSNTARAISADPS
FT                   TLVISERSDSGIQTNFKATTSDGRAYNCYVTGMVSVVGRTVSDAICSPVASNTGAGKPA
FT                   QAGIQCNALLKAAGKC"
FT   CDS_pept        complement(267852..268460)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02070"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F281"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43790"
FT                   /db_xref="InterPro:IPR041494"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG48"
FT                   /protein_id="CBL43790.1"
FT                   /translation="MTTRTNFVLVDFENVQPKDIGLLKDGSFKVKVFLGPNQSKIPIAL
FT                   AAALQSLGECAEYIILETAGKNALDFHIAYYLGALSTVEPTAFFHIISKDSGFDPLLKY
FT                   LKGKKIFAQRSTCIADIPYFKPSLPVAPEAQVEAAIADLVRRKASKPRTQKTLLSTLHA
FT                   LFKKELSEQQLATLFAALCKRGIVKIEGAKVSYVLPSEP"
FT   CDS_pept        268679..268933
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02080"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F283"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43791"
FT                   /db_xref="GOA:E1VG49"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG49"
FT                   /protein_id="CBL43791.1"
FT                   /translation="MAAKICPFSIVVLMECLQALKLELQRNGELLRDMRRFETEIWFEL
FT                   GCFWSRLGSFVANWIAGCHGAVGILVFLVRGKIHELSRH"
FT   CDS_pept        complement(268930..270222)
FT                   /transl_table=11
FT                   /gene="tnp"
FT                   /locus_tag="HDN1F_02090"
FT                   /product="Transposase"
FT                   /note="silverDB:HdN1F284"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43792"
FT                   /db_xref="InterPro:IPR001959"
FT                   /db_xref="InterPro:IPR010095"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG50"
FT                   /protein_id="CBL43792.1"
FT                   /translation="MQRRKATFKLYPNASQQKTLEEWTRLHCELYNAGLQDRIEAYRKA
FT                   GISISYYDQQNALPEIKGFRPELAALGSQALQQTLRRLDLAMQAFFRRVKSGESPGFPR
FT                   FKSAARFSGFSYPAQAGWKLFQQGSRGATLRLGSGKNAMMIRARGQHRFAEFQPNDLTI
FT                   TRRNGQWFASVTLRVSDEVCARERSGDQQRGVDFGVTDWATFEDGTTIENPRFMRRELP
FT                   KLAELQRQRARKKKGSCRYKRLTKRLGQIHERIANLRRDFIHKQTAKLVETCAVIATEE
FT                   LKPKNMSGSAKGTAENPSKRVRQKAGLNREILSAGFGMAHQMLAYKAVEAGTRLHLANT
FT                   RQLKPSQRCCACWELTPKTLAERTHVCQHCGHTMPRDQNSAAVVLIDAYVISERNTPGT
FT                   GVAVRSKPLARQRAKPRSKTRETPTTTALAV"
FT   CDS_pept        271043..272212
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02100"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F285"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43793"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG51"
FT                   /protein_id="CBL43793.1"
FT                   /translation="MQIPALASQAPTVVVDSAATVVRGFSTEVRSDIPPVQEPEGVVYT
FT                   KDRPADSSTYEAMFNSRAKSQTSEDASAESQNAARQDPAKATEGDTKTKEASAEDRASL
FT                   GRAAVKGSGAEEMTPEQQAQVTELRQRDAEVRQHEMAHQAVGGQFTGAASYEYQTGPDG
FT                   KRYAVGGEVGVDTGSAGSPEATIAKARQVKAAALAPAQPSGQDLRVAQGAEKMIAQAAL
FT                   EQRAAERSAASPASKSASIDGDAHREQGANPEQASAAGLNQEKRVEEQRKDERQVKEDK
FT                   KQDDEKEAAQAASLNSDSGVPAAQVGPSKQASPSAQAVGSSSSGNQAGQGGGGGDGKAV
FT                   VNQSDKPTAKESLEKILLASGSLAEQANRAGYIQPDSPGGKSGFLSFVV"
FT   CDS_pept        complement(272247..273461)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02110"
FT                   /product="Drug resistance transporter Bcr/CflA subfamily
FT                   precursor"
FT                   /note="silverDB:HdN1F286"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43794"
FT                   /db_xref="GOA:E1VG52"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG52"
FT                   /protein_id="CBL43794.1"
FT                   /translation="MDYPPVPASPSWLLLLGCLIALGPLAIDMYLPAFPAIEAELGSGA
FT                   QLTLSGFFAGLVIGQLVYGPISDRVGRRRPILVGTVIYTLASLASTQVTSLEALAALRF
FT                   LQALGACAGMVLTRAIVRDCCKVRAAAQAQSRLMLVMGLAPILAPTLGGWLLQHAEWRA
FT                   IFMAQGIAGALIGLACLFSLNESLPPEKRHHTLSIPQITHNFGALLRHRYYMGCTLSSG
FT                   LTLTGMFAYIAGSPAVLITQYGLSPQEFAVFFGVNAAGFIVTSQVNAWLLKRHHMLPIL
FT                   NRSLWVPMLASLAALTANHYQALSFPLFAVLLFMFIASLGFIVPNASAMGLDTQKQQVG
FT                   AAASLQGALQFLLAAVAATLLSQWQTHDALPLTLVMSVASVSAFLANRWMLSTATEATW
FT                   RLDGD"
FT   CDS_pept        273676..275604
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02120"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F287"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43795"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG53"
FT                   /protein_id="CBL43795.1"
FT                   /translation="MTHFCYRIVFLFLFAFPLTLALPLNAHAIAKNGDHVKSQWLELHF
FT                   QKLEATWKDEVQFWQSITDEASAAGREEELFDLYKTRVAHQQAISNQAKKDPNSEESAA
FT                   IFKKLMAIRASADDALMKEWIRLKDNKKVPALIDEANKRSQPKRPELTLNDVLATGLLK
FT                   AEDLPLLNSQDKMLDQIDNDLDKWTELSFAERDYAAVRLSQILRLNDKNARAYVALAKW
FT                   YLNNGYIKGTSYKPEDYRKAKFCNDMAMKLEPELVSAWSQKVAMAKTFRDAETIKTTLN
FT                   TYAAKLDDTFPEKANALLWLYKNNGDRDAYGKLIARLAEKVRQGVASNDPDVKRYDLIM
FT                   ESMQEYYLNADDVKAADQFFAWLRVWMEDHPWVLGNYANIRLKKTGDYKTSIELLETAL
FT                   QKMNYGIGRYNLARAYYVASVMEKRSLHLITAADYQLRLARMGVQGAEFIPEMGEFNHA
FT                   ETVAAIMDDFGKSGVEITDGRLERTALHNAALDGNLETVKVLLERGANPRLFDVTGNNA
FT                   FFYAAKINDVEMLKLLLEKGAAVSEKSPESGLTALHIAAQNGSIAAVEFLLSHGAEINA
FT                   VGRYRNTPLVDAVLGSRLEMVKYLVSKKADTGVRTQGDATLKDLVDMGVSKEIKSYIEE
FT                   LFSENKS"
FT   CDS_pept        275816..277315
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02130"
FT                   /product="Mg2+ chelatase family protein"
FT                   /note="silverDB:HdN1F289"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43796"
FT                   /db_xref="GOA:E1VG54"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG54"
FT                   /protein_id="CBL43796.1"
FT                   /translation="MTFAVVQTRARLGMHAPSVLVEVHISNGLPAFNLVGLPDTAVRES
FT                   KERVRSAILNAGLEFPQRRITVNLAPADLPKDGGRFDLAIAIGVLAASGQIVSDALEGQ
FT                   EFLAELALSGELRPVSGALSASLAATQSERTLLIAPENAREATLPENARVLAARHLLDL
FT                   VAHLQGNDLLKPVASSAPERITGPVGPDLSDVRGQHLAKRALEVAAAGKHNLLMIGPPG
FT                   AGKSMLAARLPGLLPPMTEAETLEVAAIHTLNSRSGSLRWGCRPIRTPHHTSSAGAIAG
FT                   GGSNPRPGEISLAHRGILFLDELPEFPRKVLEVLREPLETGEICISRAACQVVFPANFQ
FT                   LVAAMNPCPCGKPTQAPEGCSNPQRCCNKYQSRLSGPLLDRIDMHLQVDAVPVAALQAP
FT                   RESGSETSEVVRARVVRARERQLARCGKPNHDLDAAEVERYCALSAVDRELLGKAVDRM
FT                   GLSARAYHRVLKVARTLADLAGEETISTAAVMEALSYRAVF"
FT   CDS_pept        277470..278429
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02140"
FT                   /product="Zinc-containing alcohol dehydrogenase superfamily
FT                   protein"
FT                   /note="silverDB:HdN1F290"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43797"
FT                   /db_xref="GOA:E1VG55"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG55"
FT                   /protein_id="CBL43797.1"
FT                   /translation="MKAAVLHAYGQIPQYDDLPKPQPQAGQVLIKLEAASIKQLDKLKA
FT                   SGKHYTRYDHFPVAVGVDGVGRLVSSGERVYAMGLTGMLADYALVNPEDCAPVPEAIDA
FT                   ALAAVLPNALLGSDAALLYRADFQPGQTLLIHGATGVSGRMAVQAARLRGAHKIIVTGR
FT                   NAESLNYLRCLGADACISLLDTPEQIVAQLSEIQQQSPLDVVLDYLWGEPTLWLLQALN
FT                   RHCPKPVRIITIGQMAGADISLPSGLLRSKPISLSGSGLGSISSQQLRDYNQKQLGFMF
FT                   EQAIQEKITADYRCYRLDAVEQAWQATLAPGERAVIKI"
FT   CDS_pept        complement(279275..279682)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02150"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F291"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43798"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG56"
FT                   /protein_id="CBL43798.1"
FT                   /translation="MSGVIVDTCAWSHALRRNTPKEQTIAVELSKLIDENRAKIIGPIR
FT                   QELLSGYSDQKSYEKLRNKLLYFPNEQIVDSDYEFAAEYSNICRKKGIQGSHTDFLICA
FT                   VSARLKMSIYTTDKDFLNYKKRLPIDLHEEK"
FT   CDS_pept        complement(279679..279873)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02160"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F292"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43799"
FT                   /db_xref="InterPro:IPR019239"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG57"
FT                   /protein_id="CBL43799.1"
FT                   /translation="MATNLSIDQQLLNEAVVVGGFNTKKDAVNQALKEFIQRRKQREIT
FT                   ELFGKLPADSDYDYKKSRK"
FT   CDS_pept        complement(280037..281083)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02170"
FT                   /product="putative methyltransferase"
FT                   /note="silverDB:HdN1F293"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43800"
FT                   /db_xref="GOA:E1VG58"
FT                   /db_xref="InterPro:IPR010017"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG58"
FT                   /protein_id="CBL43800.1"
FT                   /translation="MDATTPVNRPVNALPLEWQHALGIAEFSHALKASKLGAWHEPLMQ
FT                   ALDAALTPGRHGDLPRWVSALQDLPELTLSTYALGNAIVTAGAAADCDDATRALLTAAL
FT                   QGLHPWRKGPFEIAGVKIDTEWRSDWKWQRISPHIAPLEGRTVLDVGCGSGYHLWRMLG
FT                   EGARYVLGIDPSLLFYCQFHAIRRYLSGEPRTLNAGFLPIGIEHLPPKTGAFDTVFSMG
FT                   VLYHRRSPLDHLLELQEQLRPGGQLVLETLVIDGDENTVLVPEGRYARMGNVWFIPTVS
FT                   MLLRWMNKLGFHQPRMVDIGTTTTDEQRSTEWMRFQSLQDFLDPSDDTYTIEGYPAPKR
FT                   AVLIAEAR"
FT   CDS_pept        complement(281087..282181)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02180"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F294"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43801"
FT                   /db_xref="GOA:E1VG59"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG59"
FT                   /protein_id="CBL43801.1"
FT                   /translation="MSEIVLFGATGYTGALTAKAMVARGLKPVLAGRNRSSLEALANQL
FT                   GGLPVRIADVADPQSVYQLVKEGDVLVSTVGPFARWGSPALDAALAAKAHYLDSTGEPA
FT                   FVRRVFEQYNERARQNGRVFLPAFGYDYVPGNTVAAAALERAGSSAVRVDVGYFVGAGK
FT                   SFNMSQGTFASLAGAMADPGVFFNQGKRSLSYGGLRTRKFSLDGQPIGSMSVPGSECLA
FT                   LPSSYPSLRDVNVYLGWFGNLSSAISVSAHVQRLMLKVPGYKRLLDLLVTRLGSSGRGP
FT                   NETERAAEGSHIIAEAFDASGQLLATAELRGVNGYTYTANMLAWGAQQAAEGRAIAAGA
FT                   LGPVEAFGLPALVEGNREAGLILN"
FT   CDS_pept        complement(282203..282973)
FT                   /transl_table=11
FT                   /gene="yecO"
FT                   /locus_tag="HDN1F_02190"
FT                   /product="Putative SAM-dependent methyltransferase"
FT                   /note="silverDB:HdN1F295"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43802"
FT                   /db_xref="GOA:E1VG60"
FT                   /db_xref="InterPro:IPR005271"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG60"
FT                   /protein_id="CBL43802.1"
FT                   /translation="MSAEFHRDDIFSEQQRHLVDFTFDEQVACVFPDMIRRSVPGYETV
FT                   ISMTGVFARQFTQPNSRIYDLGCSLGASTLAMATYVCADQVRADQVGADQIEFVAVDNA
FT                   QAMLDKCRIIVEAKAPNRNVRYLEADIRDVPIHNASLVVLNFTLQFIPVADRLALLKKI
FT                   AEGLKPGGALVLSEKIAYPDTAQQQLLTDLHHEFKRANGYSDMEISGKRQAIENVLIPE
FT                   SPQTHEQRLKQAGFANATLWFQCFTFASWVATKS"
FT   CDS_pept        complement(282995..283693)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02200"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F296"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43803"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG61"
FT                   /protein_id="CBL43803.1"
FT                   /translation="MSTTQYFIGFQASEQLTTQAKRLLELRGNVPPQTLLKPLEQVVEP
FT                   FIPEVLTNMLANSVEAVGLSPMASKVVNGAVDTLNSAARLLVSKLLKKRSDDEIVNMSG
FT                   FIDDIYLPANRTSNGLDCCGAEISQKDFEEMKFIISEIRAGRAQSVVPRLNAIMIDVAD
FT                   LVLESFMKRPLSVLDLNFVIRKVVDGTFATSRAATHMVVNRVYKQLNDEELLRFADYFD
FT                   KQLFSATARI"
FT   CDS_pept        complement(283813..284184)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02210"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F297"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43804"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG62"
FT                   /protein_id="CBL43804.1"
FT                   /translation="MRESPTGQDLLETARQTLLDRILPALSAEQRYDALMIANAIAIAQ
FT                   RQWQTGDAWLHEERLRIEALTGTSSPSDAPLGDALLTANRTLIAQIRAGHFDEPRPEQA
FT                   ELLTWMVSQRVRESAPKAL"
FT   CDS_pept        complement(284181..285260)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02220"
FT                   /product="predicted aminoglycoside phosphotransferase"
FT                   /note="silverDB:HdN1F298"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43805"
FT                   /db_xref="GOA:E1VG63"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG63"
FT                   /protein_id="CBL43805.1"
FT                   /translation="MLDEHALTKLVIWLQSQGVAASGLSHARKLSGGAIQENWALDLAL
FT                   ENSHGTQIVPLVLRADAPSSVGESLGRAQEFNLLRAAFSAGVTVPEPLWLNEGSLLGRP
FT                   FFIMRRAAGTAAGHRIVKDPSLGGDKIALTRRIGEEFARLHKIRPPASTLAASPTQAPN
FT                   LDFLTLPRTTPVQDAIRDWRHWLDQHHTPFPALEWGLRWLELHEPTSLGIVLCHRDLRT
FT                   GNYMVDEHGLTAILDWEFAGWSDPREDLGWFCARCWRFGQTGPGKEAGGIGPKEVLLAS
FT                   YQAVSGIDISPADLHYWEVYAHARWAMIALMQGERHNSGQERSLELALTAHIVPELELQ
FT                   ILRMTLAYPDASPTHKEPR"
FT   CDS_pept        complement(285264..286466)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02230"
FT                   /product="Acyl-CoA dehydrogenase"
FT                   /note="silverDB:HdN1F300"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43806"
FT                   /db_xref="GOA:E1VG64"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG64"
FT                   /protein_id="CBL43806.1"
FT                   /translation="MDFTLSPEIESLRLKVRAFVSEHVIPLESQASAYDAHENLNEAAV
FT                   AELRRLAKAQGLWAFQMPHTLGGLEVGVQGMAALYEEAARSPFGPLAFHCAAPDDGNMI
FT                   LLNKILKTDAEKQRWLVPLINGEVRSAFAMTEPEGGCGSDPSLTYTRAEKHGDVWRING
FT                   RKWFITGAEGAQTFILIARTSNEDRRQLTAFLFDAQQPGWRIERRIPIMGPEEHGGHCE
FT                   LVFENLEIPDQNRLLNVGDGLKVTQIRLGTARLTHCMRWLGLAKRCMEIAAEYTRERMS
FT                   FGIPLAQHEGVQWMLGDVAKNIHTGRLLTMHAAWKLDQGDFARKEISMAKIHVADTLHQ
FT                   AADTAIQLCGAKGYSRDTLLEWIYRYARQARLVDGASEIHKMVLSRAYLEEGADFFRWG
FT                   C"
FT   CDS_pept        complement(286493..287263)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02240"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="silverDB:HdN1F301"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43807"
FT                   /db_xref="GOA:E1VG65"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG65"
FT                   /protein_id="CBL43807.1"
FT                   /translation="MHDPLFSLAGQSALITGASSGFGHYFAETLAARGARVAIAARRSD
FT                   RLSTLAERIRDAGGACHTIAMDVTDANSVTKGVQDAWEWSGGLDILVNNAGIGANAAFL
FT                   DMTEADWDSNLDTNLKGAFLVAQQVAKHCAQHQRPASIINIASILGLRVASHLASYAAS
FT                   KAGLIQLTKAMALELARYNIRVNAIAPGYIETDINRDFFATTAGERMIKRIPSQRLGCL
FT                   HELLGPLLLLASDASAYMTGSVITVDGGHTINTL"
FT   CDS_pept        287630..289636
FT                   /transl_table=11
FT                   /gene="rep"
FT                   /locus_tag="HDN1F_02250"
FT                   /product="ATP-dependent DNA helicase participating in
FT                   chromosome replication"
FT                   /EC_number="3.6.1.-"
FT                   /note="silverDB:HdN1F302"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43808"
FT                   /db_xref="GOA:E1VG66"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG66"
FT                   /protein_id="CBL43808.1"
FT                   /translation="MKDLNPRQQEAVRYIDGPLLVLAGAGSGKTSVITRKIAHLVQKCG
FT                   IPANRIVAVTFTNKASREMKERVGHLISGAEARGLTVSTFHNLGLNILRKEHKSVGLKN
FT                   GFSIFDDQDSRSLLTELSHKETAVAGEDVDYLRNKISQWKNDLVTPSQAQSHAAGEEEM
FT                   RAAHVYSAYDRCLRAYNAVDFDDLISLPTLLFRDNEEVRERWQHKIHYLLVDEYQDTNT
FT                   SQYLLVRLLVGRRARFTVVGDDDQSIYAWRGARPENLVQLAEDYPALKVVKLEQNYRST
FT                   QRILKAANAVIDNNPHVFTKQLWSEHGFGEQIRIIRCLNEESEADRVAMEIMHQKMQKG
FT                   RDFKDFAVLYRGNFQSRTLEIKLQAYQIPYKVSGGTSFFSRSEIKDVMAYLRLVINPDD
FT                   DNAFLRIINTPRREIGPSTLEKLAGYAQQRGVGLFAACDEMGLEQTLTGRPLQNLQRFS
FT                   RWLAETTERIQRTDAIPAIQQMLRDIDYQAWLLEQAPSAKAAEKRMENVNQLVESMERM
FT                   LGKQEEEDIAAVIGKLILIDLLEQRDEEDASDKVQLMTLHASKGLEWPYVFIMGLEEEL
FT                   LPHRNAIEEDTIEEERRLMYVGITRAQRELTLSLTAKRKQYGEEFEPAPSRFLDELPTD
FT                   DVVWEGKGGEQRSVEQKKALGRAYMANIRSLLE"
FT   CDS_pept        complement(289720..290301)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02260"
FT                   /product="Cytochrome c, class IE"
FT                   /note="silverDB:HdN1F305"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43809"
FT                   /db_xref="GOA:E1VG67"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG67"
FT                   /protein_id="CBL43809.1"
FT                   /translation="MIGLYFTPILRMAVSRIFNLRYASMHSAKPQHTPSRTVSTVLVSA
FT                   FLALGIAWTAPAVAASDAASGQYSINSPIKVEERTSPSAKVCVEGDTCGGGAAAAPAAA
FT                   AAEPAAPATRDPQTVFNTGCAACHASGAAGAPKPGDKAAWAPRIAEGKDTLHQHALHGF
FT                   KGMPARGLCGSGCTDEEIMGVVDWMVSQSE"
FT   CDS_pept        290425..291549
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02270"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F307"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43810"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG68"
FT                   /protein_id="CBL43810.1"
FT                   /translation="MIKSQSRKKVLWVAVGLPLLVVLASAAAWFYRLDERWALVLASWR
FT                   APDRIPMAVLGDSDSHSYHDRVSFGAQPGLRGGAYRATTWQWPEVLAGVRGDALNLGPW
FT                   SRWGTNLDLVALLRQWRGQEGRVPMKEDYRHNMAVSGAHCEQLMTMPYAQAVHLRRIMD
FT                   EAPQSWEKGVVVIRIGVNDFGQPEDLEPLAQNPADPVMLARMDSCVNNIQSAVSYLHAH
FT                   HPKVAFLVVGIFNNAHYAAALDRWQSAQAQRNLDQGLDHFDSVLKAWADRDPHVAFFSD
FT                   RDWFKQWMGGRNGDGVPAYHDAQIGTHFKVHNTAGDAPTNAFLADEHAGSVLNAMWARS
FT                   IIEHLNAEFATAIPVPTDDELTNFLDPDGKLGMR"
FT   CDS_pept        complement(291592..292059)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02280"
FT                   /product="conserved hypothetical protein, YbaK/prolyl-tRNA
FT                   synthetase associated region"
FT                   /note="silverDB:HdN1F308"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43811"
FT                   /db_xref="GOA:E1VG69"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG69"
FT                   /protein_id="CBL43811.1"
FT                   /translation="MLIRSINEYFEKNAVRYHACIHPYAVTAPEVAEVTHISGQHLAKT
FT                   VVLNADHQMVMAVLPADRQVDLAALRSALGATKLELAKEEDFAGLFPDCDPGGIPPFGN
FT                   LYDMQVVLEQSLADQAWLAFSAGSHTVVVKMDVAEFIQLANPLVCSFTCLH"
FT   CDS_pept        complement(292176..293600)
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="HDN1F_02290"
FT                   /product="Cysteinyl-tRNA synthetase"
FT                   /note="silverDB:HdN1F309"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43812"
FT                   /db_xref="GOA:E1VG70"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG70"
FT                   /protein_id="CBL43812.1"
FT                   /translation="MNIYLHNTLSGQKERFVPISPDRVTMYVCGPTVYNYVHIGNARPV
FT                   VVFDTLYRLLKRHYPEVRYARNITDVDDKINKAASDNRETICELSSRYADAYRSDMQAL
FT                   FNLTPQFEPRATDNIGAMIEIITTLIEKGHAYEAEGHVLFNVSTDPHYGCLSKRNLDDM
FT                   IAGARVEVAPYKKNPADFVLWKPSSDDLPGWDSPWGRGRPGWHIECTAMINAHLGKTID
FT                   IHAGGLDLVFPHHENEIAQGTCAHQDERYVNYWLHNGYLTIDGEKMSKSLGNFATVHEL
FT                   LQHWPGEVLRYALLSAHYRSPLDWSDDALTQARASLDRLYGALRGHTPSSCADTHATAP
FT                   DALQHPLLDTLEQHLADDLATPQALAVLHQLAGEANRSSDTPSRTQLQAVLASAGERMG
FT                   LLTQDPESWFKWQAPAARDATGNGLDDAAIEDLIQQRRDARKAKNFARSDEIRDLLKAQ
FT                   GIELEDTREGTRWTRG"
FT   CDS_pept        complement(293612..295555)
FT                   /transl_table=11
FT                   /gene="thrS"
FT                   /locus_tag="HDN1F_02300"
FT                   /product="Threonyl-tRNA synthetase"
FT                   /note="silverDB:HdN1F311"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43813"
FT                   /db_xref="GOA:E1VG71"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG71"
FT                   /protein_id="CBL43813.1"
FT                   /translation="MSSTSNSSTGQPIAITLPDGSVRQFERPVSGLEIAASIGPGLAKA
FT                   SIAMTVDGEQQDLSRVIDHNVQLAFITRDKPEALEILRHDAAHVMAQAVKELYPETQVT
FT                   IGPAIENGYYYDFCRATSFTPEDLEKIEARMMEIVDRDTPIVREVWDRNEAIAFFEKQG
FT                   ELFKAEIIRDLPENETITLYRQGEFIDLCRGPHLPSTGKLGKGFKLTKLAGAYWRADST
FT                   KQQLQRIYGTAWRDVKELKAHLTLLEEAAKRDHRRIGKDLDLFHQQEEAPGMVFWHPKG
FT                   WAIWQKVEQYVRKVYRESGYQEVRGPQILDVSLWKKSGHWENYQENMFFTESEKRTYAV
FT                   KPMNCPGHVQIYNNTLHSYRELPIRYAEFGGCHRNEPSGALHGIMRVRAFTQDDGHIFC
FT                   TEDQVQAEVTAFHRQAMKVYADFGFENISVKLALRPDKRIGTEDAWDKAENGLRAALAA
FT                   AGVAWEELPGEGAFYGPKIEYHLKDSIGRAWQMGTIQFDPMMPERLNAEYVDENSQRQR
FT                   PIMLHRAIVGSMERFIGVLIEHFAGNFPLWLSPVPVVVATITDDARDWAETVVAQLKAA
FT                   GIQAEADLRNEKIGYKVREHSNAKIPQIWVVGKQEAAEQKVAIRRLGSQQNEVVGFADA
FT                   LAALAQATRLPE"
FT   CDS_pept        295779..296723
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02310"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F312"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43814"
FT                   /db_xref="GOA:E1VG72"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG72"
FT                   /protein_id="CBL43814.1"
FT                   /translation="MQSFVRRYWLPLLTLVAIIVGSLLPLRKWVPSYLETDLTNAAHYP
FT                   SGVLLGLLLAPYIQRNWRRALLVAAIGSAAFGAIEVLQPFFGRFQSMDDWIKSSSGMVI
FT                   GVAATFVRFSTPRWVIAALGGVALVLFAIFVLPLVQTLRTVAAYEQRFPVLADFERWDD
FT                   FLIWRTTGHSFYDRRENTAETGDAASAARGAYHAAVRRRSEGQPGVAVDNVVVDWRAYR
FT                   ELCFDSRASAEPGNASAPNQALEVLLADNRDGGIWHERFPNPAYWHTVCISLDGLKAAD
FT                   GSPLNLAHISQLRILGSKVAAGQGFDLDRVYLR"
FT   CDS_pept        complement(296826..297209)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02320"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F314"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43815"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG73"
FT                   /protein_id="CBL43815.1"
FT                   /translation="MRRAADETPTFREPLVELADLFYRQQNWKELVRFCNRALAITHQP
FT                   MSYPSDQHAWGSQPWDLLSIGLWNLGDKRGAHAAACHALTLEPSSERIRNNVALLAREL
FT                   PKCDALETAFATAPAQKAAEPAV"
FT   CDS_pept        complement(297236..297571)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02330"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F315"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43816"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG74"
FT                   /protein_id="CBL43816.1"
FT                   /translation="MTPSVPLVPDFLREAGSGTTSVMEDVNVRGENGEVIPVVDRTGHW
FT                   VGLTDNFPVSQAGPKGVTGAFGEQGPHEPQGLISAPSLPAEAICRSEARKANAPSACGI
FT                   LPAATAH"
FT   CDS_pept        298095..298919
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02340"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F317"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43817"
FT                   /db_xref="InterPro:IPR033399"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG75"
FT                   /protein_id="CBL43817.1"
FT                   /translation="MRMIGFPAVRVAGFCLTLLAVFLSPALVAAEKSGPVDVVARGLEI
FT                   MRAADARLHGYTDQQVSLEMTLISPSGGKASRALRVQSIETPDGERTLMVFETPRDLSG
FT                   TALLSNNRRSGADEQWLYLPAIKRVKQIGARNKSGPFMGSEFAYEDIVTPFVEKYSYQY
FT                   LEQTPCGELTCDVIERKPKDEFSGYSFQKVWIDTTHQLVRRIEYYDRKQTLLKTCTASG
FT                   FSEYQSKYWRPAEMLMENHQSGKKTVLRWADYRFESGLSEQDFTQNALMRSR"
FT   CDS_pept        298922..300217
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02350"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F318"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43818"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG76"
FT                   /protein_id="CBL43818.1"
FT                   /translation="MRAVLMSFRSDCVHACAVFGCLIGFLITMPGISFAAGALPNAQSK
FT                   GEWRGEFAPEFTAFAHSGVAGQASESLSASLRLEGWYSPDDGRNTFAFVPFVRWDQRDP
FT                   ERSHHDIRELSWVHVSGSREIRAGWRQVFWGVTEGIHLVDIVNQTDAIESVDGEQKLGQ
FT                   PMLSLGIERGDQMLDLFWLVGSRERTFPGREGRLRLPLVVDSDFARWESSKGRDRQDLA
FT                   FRWQWNPYPLRLGVTGFSGTAREPELQPVLTGKGVVLAPYYPVIQQLGVDVQVTQGDLL
FT                   WKLEAIQRNGGQRNYHAADAGLEYTQVGVFATQADLGWLLEWLYDSRNRKAATPFQRDL
FT                   LLGWRVAFNDVASSSLLFYVIFDPDDGEQLWSLEAQRRLAEDWQLALEIRQVAGTAAPQ
FT                   SEAEFLVAPDLTHALRPLAHDNFARVTLSWFF"
FT   CDS_pept        300262..302628
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02360"
FT                   /product="Predicted exporter of the RND superfamily"
FT                   /note="silverDB:HdN1F320"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43819"
FT                   /db_xref="GOA:E1VG77"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG77"
FT                   /protein_id="CBL43819.1"
FT                   /translation="MVFMNVDRSQRSATAWIARWLVNHPWLALIAGLAIVAGCAGGLGG
FT                   YQYSMDHRAFFSADNPQLQGYEQLQTDYSRTDTVLVVLAPKDGKVFQRDFLAVLQKLTQ
FT                   DAWQIPYSQRVESLTNFQHVQVEGDSIETHDLVEDPAALTDAELKHIQSVATHDAFLVN
FT                   ALVNPGASVTGVRITLNLPGKDPRKEVPEVVMPLRELAAKITAAHPDIQVHLVGQTIAN
FT                   QAYPEESQADFTRVWPWFTITLLVVLTWLFRSAKAMLATWIACQLAVVAGAGAAGYWKP
FT                   VVNDAVIVAPIMILTLALADCIHLVVGWIQAQQRGMDRRAAMEDSLRHNLVAMTITSGL
FT                   TVIGFLTLHFNDSPPFQVMGYIVAFGVSFALLFTMLITAPMLILLPGKPPKNPLPLQSP
FT                   DSLAMSRFAGFVIRRRWALLICLLSIGSVLSALSLTNRINDDIVKYYTEETPFRQSMEF
FT                   VNANLTGTGEINYPVVAGGADQISDPEYLKALDAFSTWLKTQPDVVQVNSIVDIIKRVN
FT                   QVMHGDDPSYYRIPDRRDEIAQYLLQYELSLPFGMDLNYLIRFDRAASRVRVAVGTSSG
FT                   QRLIELDQHAQEWQKKHWPAAMQTPGASLSLMFAHIGERSISGMFWGLIGSLALASLFL
FT                   WMIYRYWVYAVACFVGNLLPVGAAFGVWAMINGNIDLGLTVVLGIAFSVVVDDTVHFIN
FT                   KYDWSRRDGLLPLDAVHRSFMRVGFALITTSVVLGLGFAWLGNSAIQLTVNTAFMICLS
FT                   IVFALVVDLLVVPPLLAVLDGRNMGNVNNVDGDVH"
FT   CDS_pept        302671..303639
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02370"
FT                   /product="predicted UbiA prenyltransferase"
FT                   /note="silverDB:HdN1F321"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43820"
FT                   /db_xref="GOA:E1VG78"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG78"
FT                   /protein_id="CBL43820.1"
FT                   /translation="MSQLTPLTVGSSFRSRFLAWMKERFPFANALLFFILYLTTAAVAR
FT                   FSQTADGSIETSFRDIFGALITWSFFLVLRVFDEHKDYALDCQNHPQRILQSGLITLNH
FT                   LKVAVGIAILAQVVWSLVLDRGIGQTTYAWCAMFVWTCLMGKEFFIPEWLNKHLTWYAV
FT                   SHMLVMPLIVWWLANLAVPSLQMSTPLVIMMLLAFVSGFCFEITRKTKGPEEERDTIES
FT                   YSRIFGTRGSAWLVIALVSSMVFVQLWLIVTLTDGLSLWATVILLAFWGLAMVQLRSFL
FT                   AAPDAKKRGKNEAAVALAMLAGYAVLIAVVISARGLHFALF"
FT   CDS_pept        303701..306499
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02380"
FT                   /product="peedicted hydroxymethylglutaryl-CoA reductase"
FT                   /note="silverDB:HdN1F323"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43821"
FT                   /db_xref="GOA:E1VG79"
FT                   /db_xref="InterPro:IPR002202"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR004554"
FT                   /db_xref="InterPro:IPR009023"
FT                   /db_xref="InterPro:IPR009029"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR023074"
FT                   /db_xref="InterPro:IPR023076"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG79"
FT                   /protein_id="CBL43821.1"
FT                   /translation="MTERCFGKSWMCSIPRIGITEVALTRKNTLVPPPRYSFGLEHDVR
FT                   CEWPEHPEIKLRPRDVSKGHLSLLLSSRSWVPAIGELMQDLSVYLDGRQFELPKLSIRT
FT                   LRDEPGGLCVVLWSVDCELTAQRLWELSYALRMKCMAKPSIVWNEHNLPKVPARGLYTE
FT                   DARQERLGFIREQIGVELPEVSSTRLESRKLVSNIEALIGSVEIPVGLAGPLQIQGVHA
FT                   EGLYYAPMATSEGALVASATRGATALSRSGGVNARVLGQRMMRVPLFSFDDMSAALFFA
FT                   EWVQDHEPEIAEEIRKYSNFARLVELRAQVMGRNVHVHFIYETGDAAGQNMTTTCTWQA
FT                   CQWIIKGIRHFEELKIRNFLIEANLSNDKKVTYQTFLKGRGVRVLAEAVLTDEVCLRVL
FT                   KVSASQLVRAFQDFMSGSVAAGMVGFNINVANVVAAMFTALGQDIACVHESALAQLHME
FT                   LNDNGDAYCTMTLPSLVIGTVGGGTNLPQQRECLSILGCVGAGNSHKLAEIIAAFCLAL
FT                   DISTLSAIAADQFARAHEKLGRNRVVNYLKLGDLTPEFFELCIQNLGRHAMQVESAVQI
FT                   PLTQTGSSIITELTSHKVSKMLGHFPFRLETSAGVRDVMVKVKPLDGEVILMLNSMAAM
FT                   CDARLAQEFNTFREQIGFKGVHIRELAVMSQSDPRFVKHAPQIYGIVNDPAREAWVIVE
FT                   ELLCGLELMDSADDTSGWQPEHMEAAVRGIAEVHAIWYGREQELLQQPWLVDYPTTAGM
FT                   TAKRRLWELLGVHAREEFPEWFSDTDLARYQTVVGSLGEWWAEIEAMPRTLVHNDFNPR
FT                   NIAFRRDGDGVRLCAYDWELATLHLPQHDLVELLGFTLNQPISREQVDYYLELHRTTLE
FT                   QSSGIAIDTEQWRRGYVLALLDMTVNRIPMYLLAHTFRHYAFMERVHNSFRQLLELERW
FT                   VS"
FT   CDS_pept        306499..309300
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02390"
FT                   /product="phosphoenolpyruvate synthase like"
FT                   /note="silverDB:HdN1F324"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43822"
FT                   /db_xref="GOA:E1VG80"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG80"
FT                   /protein_id="CBL43822.1"
FT                   /translation="MTINTGKASTNTESVKSDSSLPLFLSQQDALFLPPESLGGKAMNL
FT                   AWLSREGFPVPRWWVLTTEAFQQLLEANQLDGWIEGVLSDAQLLEDSALLEAAARAIRE
FT                   RVLSASIPESLIEIVTRHLAGQEDCYFAVRSSVLGEDALGASFAGQMDSYLFQRGLPAI
FT                   LESILQVAASAFNARALQYRISKGIALAEIRAAVIVQEMVEGEISGVMFTAHPMSGSRR
FT                   HALISATFGVGEGVVSGICNTDEYTVGLFDDSVVTTLGDKDLALVFDHQRGRGTCEVSI
FT                   EAARRKVACLDHRQLLALRDMGKKIAGLQKFPQDIEWTIRKGVVHILQTRPVTRLPPLS
FT                   ESIGEVRVFDNSNIQESYCGVTTPLTFSFASRAYETVYEQTMRLLGVSERSVLAHRHML
FT                   ENMLGLVRGRVYYNINHWYQGLLLLPSFRSNKADMERMMGLTDPVDLVQDKNPGLSEKL
FT                   RKLPQVLRALLRLLYGFQRMNQDVQKFRAMFETVYCSVSRPLLHTLTPGELIAELRRLD
FT                   RELLQRWTTPIVNDFYVMMMNGRVHRALVAAGFEQPAVLQNNLLSGEEGIESTEPTRRL
FT                   LQMCDYVRKQPPLRNLLEDPSTKNSRLLDRIQVLDPVFYAQCEDFIERYGDRTIGELKL
FT                   ESVTLRQDSSFLFAVLRNYLARTDLTPETLAANEARFRHEAEAEAFNAVRKQLGVRALK
FT                   RFQKHLSKLRDAIRNRENMRLARTRMFGLYRELFLELGQQWAMHGLLSEPRDIFWLSVE
FT                   EIYALNDGRAVQTNLLPLVAARKEEYAGWESRQVPEPAHHFHTHDTVSFFNDYTYPFAE
FT                   PESSDSAELIGTGCYPGIVDAKVRLIFSPDDELALDGQILCTVRTDPGWAPLFPTAGGI
FT                   LVERGSTLSHSAVVARELGIPAIVGIPDITRRVRDGERVIMDGAKGTVRRVEFDASVDN
FT                   DGE"
FT   CDS_pept        309305..310420
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02400"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F325"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43823"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039968"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG81"
FT                   /protein_id="CBL43823.1"
FT                   /translation="MVTSIIGGEWNPREALPKEFIALPQQIYAQDPSWLGEDASALGHQ
FT                   FSEANPWFSGGRAWLGVIPEQARLAGFYCGQLVEGEPAAFFGFWEGIDELSAHAALFSE
FT                   FKTWAVNQGAKRVYGPINFTTFGAYRIRLDSFESGAFPSEPWNPPYYSMLLRKLGLSEH
FT                   YRYLSTFNDAKETAQAVAADYLRVKPKLEKVVKLEAMTPDFWMSNLDALYGFVDEVFGA
FT                   NFAYTPIRKDAFISQCGEAFATRFCPHSSVLARTHDGRIAGFFLVYPDYSPLIRMASRD
FT                   HIAASTLRYDLHYAVLPKPRLALAKTGGVHPDFRALGLFTAMGCELTLRAEPFYERISG
FT                   ALVREDNNSRQFALRHGVSEVRHYALFHQAL"
FT   CDS_pept        310463..312757
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02410"
FT                   /product="predicted AMP-binding enzyme"
FT                   /note="silverDB:HdN1F327"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43824"
FT                   /db_xref="GOA:E1VG82"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG82"
FT                   /protein_id="CBL43824.1"
FT                   /translation="MNFCTPIVAAAQRHPDRIALTVPNLAYASEEAYANERVSYAALLA
FT                   RAAELQKGLRNAGLKPGDRVLVFARPGTGLYALILALLGEGVVAVLLDRGMSRSRIMAS
FT                   IRQSHAKAAIGEASLLRLWWLFKPLWSIPKLAIDGRAMGVTQLVTATNEAHVDTRAHEF
FT                   RCVDLPIQAEGLITFTSGSTGNPKGADRTHSSLLAQHHAIREHWPDRDDDIDSPCFPVL
FT                   VLHNLCCGIRTVLPYADLAHPAQVNPDRVLSQIDREGITRLACAPAYLGALLQRAIGLG
FT                   RNFEGVRAVAVGGSTLTRSLALRAREVFPQAEIVSVYGSTEAEPIASVTLEELLQGWDC
FT                   NPGHLLGHPADCVEVVIVAVGAGLGSESDVDQSRLAQDQVGEILVAGPHVLQCYVDNPE
FT                   ANRANKILRARGDVWHRTGDAGYFDAHGRLRLMGRVKDAVWLHNQRYYTFDLERMLDEL
FT                   PGIRRSALLNGQSDVSVPTLVLEGSPYDVVAFNRVLDHHGIEDIEIAPVEAMPVDGRHN
FT                   SKIDRVHLQQMFSSGNLHANRRLRYISSGCVRHEERQFGRYLVRPNLADWLTLSGVLTG
FT                   SLAAVAGLQGNSFLAISLLFLAMLCDGLDGWLARRLGISRAFGRYLDGFMDMLIYLVVP
FT                   SLIYYLNGFGGSWSIFLLLMMAAGCVRLSVFNEIGNVREGGQLAYLGMPVFWSVFILGG
FT                   YLLIHGWIGSNGWTGSWLAQAMLAIMLLWFSHSMLLRKAFFKFKQLSHIIGISVGGALL
FT                   FLSLHLAQATF"
FT   CDS_pept        312795..313367
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02420"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F328"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43825"
FT                   /db_xref="GOA:E1VG83"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG83"
FT                   /protein_id="CBL43825.1"
FT                   /translation="MVSDSGWFQIVDGFSTFFAALYIQIPVVIGGVLHMLAVTKDWLPA
FT                   LKVPIHERLFGANKTWRGMVLVPLFTALGAICIWPLEWLLGPHAVFGTSLLLAGVVAGF
FT                   GYVLAELPNSWFKRRAGIPPGVVPTRAPGLFIFLDQFDSGLGVALAYLIYPGFGVQVFF
FT                   WYILTFPITALLVKRWLFWMKLKKSAV"
FT   CDS_pept        313475..314374
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02430"
FT                   /product="lipocalin family protein"
FT                   /note="silverDB:HdN1F329"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43826"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG84"
FT                   /protein_id="CBL43826.1"
FT                   /translation="MVRCAFLGRWQGRFTSSEKTAVLTSLIRQSLALLLAALISGCSSL
FT                   YFYPLKPWLQNPANLGVDYQDVVLIHRDGTRITGWWLPASTPLQGTVYFLHGNAENIST
FT                   HVVSVAWLPAQGYQVFLIDYRGYGLSDGEADLDGSMADIQGGLNWLHASGRLQSSPLIV
FT                   FGQSLGASMAIWVLAQPQNRGKAACLIEEAGFADYREVVNAAMKRSWLLWPLRPVVVPL
FT                   MDNRYAPATVVGQLAPMPLLIAHSREDLVIPFRQAEKLYQAARPPKEMLVLRGAHARGP
FT                   EQPEVQEALLQFMRSQCR"
FT   CDS_pept        complement(314432..315316)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02440"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F330"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43827"
FT                   /db_xref="InterPro:IPR007115"
FT                   /db_xref="InterPro:IPR038418"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG85"
FT                   /protein_id="CBL43827.1"
FT                   /translation="MAALFVHHLTVMDFTYVDSARGLVGESWIVDVVLEGALDEHGMVF
FT                   DFGDVKKQIKRLLDESFDHKLIVPAALATLSVSPDPAAANLDKAGALLTLAWSDAKGRH
FT                   WKHTSPSQAVVLLPGSEVTKANSTSWLIRQIRPHLPANVSGIRLVLRNEAIEGAFYHYS
FT                   HGLKSHLGNCQRIAHGHRSQLQILVDGQRTREIEQEWAQRWRDIYIGTQEDLLERFELE
FT                   GVSYLRFAYSGTQGEFELTLPSDCVYLIETATTVELLARHIARETSTALSGRCVEVHAF
FT                   EGVWKGAIAYYPS"
FT   CDS_pept        315458..316684
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02450"
FT                   /product="predicted oxidoreductase"
FT                   /note="silverDB:HdN1F333"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43828"
FT                   /db_xref="GOA:E1VG86"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG86"
FT                   /protein_id="CBL43828.1"
FT                   /translation="MAFFFGGPKKKHRICIVGGGFSGLHAAQYFKPEKYEVTVIDPQPF
FT                   IEWLPNIHEVLSGMKKGDELRLPRQPVIERLGHTFRMEKVTDISANSLTTEWGKVLPFD
FT                   ACIVCTGNSYDLQQVPGANQFTFPFKSVESCQQIAKRLHRGTLSSRVTRVTVVGSGLGG
FT                   VEVLGEVLRAYRARPQFEFQVVSPTQKMLENAPSDLEASIRHHTRRLPMEYHLGNEVDT
FT                   VDREGLVLTSGRLIESDVTIWTGGAAPRSGKVQSESSQWGKVNEFLQSQHSNVFVVGDA
FT                   AQFDDKVIKQAFHAVEMGRLAAENAERFLTDKPLKSYKPSHRPQLVTFGDLDTFMLFDD
FT                   FAISSSLLGAVKEVLFTMGLLQMAPPRNAKDVMRHLDILQRSVRNVYLPTINPMAILDR
FT                   WPKARIFRN"
FT   CDS_pept        316769..317107
FT                   /transl_table=11
FT                   /gene="phnA"
FT                   /locus_tag="HDN1F_02460"
FT                   /product="alkylphosphonate uptake protein"
FT                   /note="silverDB:HdN1F334"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43829"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG87"
FT                   /protein_id="CBL43829.1"
FT                   /translation="MSGLPACPKCGSSFTYEDGALLICPECAHEWPKDGESESANKKII
FT                   RDANGNELADGDTVTVIKDLKVKGSSSVLKVGTKVKNIRLVEGDHDIDCKIDGFGPMKL
FT                   KSEFVKKA"
FT   CDS_pept        complement(317116..320097)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02470"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F335"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43830"
FT                   /db_xref="GOA:E1VG88"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033425"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG88"
FT                   /protein_id="CBL43830.1"
FT                   /translation="MPATTGQLFEAYDFSRPMSSSTPSNWLIQLLNARYSRQATRSFSV
FT                   LTCLGLGLMLLLWLAPRLPPLSPTFALLLHTMLESISILVSMLVFAICLHTSKHGLAGY
FT                   LALLAYTFAAVGLIDFSHMLTYKGMPQFLDHATPEMSINLSIVGRLVISSTLLIIAIKP
FT                   TIAIRTQTQRNQLLTAAILIVVLVHGVILFKADWLPTLFTSNAGQTLFKLLFEYGITAI
FT                   NAITALVLLRRMANKHDPASRESGLNITALFTVTILLILSQLCFSRYSNFNDYLLILGH
FT                   IYKALAYFVIYRTIFVSTVELPFDHLHASQEQLKATLSALPDLLFEVDQDGRYVDFHTS
FT                   QDDLLFVSPKDFLGHTYDEVMPPAISAIIRKALQEASVQGISRGHQYAIDLPMGTRWFE
FT                   ASVSLKSTDSSGNQRFIMLTRDISERIEANMRVRQLSHAVEQSPLPIIITDINGHIEYA
FT                   NPAFSTVSGYSTDEVIGKNPRELQSKRTQESVYVELWQTLLKGQTWKGEFVNRRKNGEH
FT                   YVARAIISPVRRPDGSVSHYVGITEDVTEKKRTEAHIHKLAHYDPLTGLANRVLLVDHF
FT                   DSALALAQRHSLPLALMFMDLDRFKIINDTLGHSVGDEVLIHVAKQFKTSIRDEDTVAR
FT                   RGGDEFVFIFPGINSQQARNVAQKLSRSISEPFRSEHQELNITSSIGIAMYPDDGGDFE
FT                   TLARKADVAMYRAKQNGRNQFAFYTQEMQIHSLRILQLGNGLRHAIERNQLYLVYQPQI
FT                   CLERSEICGVEALVRWRHPEWGEISPGEFIPVAEETGAISQIGEWVLQTALQQAAEWVK
FT                   RGLPAIKVAINLSALQFRNSNLPDRIQASLEEYQVPASQVELELTEGTAMEDPLGAIEM
FT                   LKNLHALGIQIAIDDFGTGYSSLNYLKKFQVSKLKIDQSFVRDISVDQEDRAIVTTIIH
FT                   MAESLGFRTIAEGVETHEQLTFLREHGCDEVQGYYFSKPLLPAQFEFFLEQWTRRHTEP
FT                   HPDD"
FT   CDS_pept        complement(320249..321172)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02480"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F337"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43831"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG89"
FT                   /protein_id="CBL43831.1"
FT                   /translation="MAVQAAAGSAVGQLASTLINGIVASFGEKVGGAIAEQLGKLLKGL
FT                   GAEVIEQLPITSAQKDALCKALGTERSDSAHSCKQSAAQELLAQVKGKLSPMEYHQLEN
FT                   AIEELQTLIANAFNGKVPDHSNCKQSEGTKPADGTKSAEDTKASEEAKKAEGSSGGDDW
FT                   FMAIAKALAKVAQDQANRVKEASDKVTGLNDEIENMRKDNGATDTKGTEGNTNAKGTET
FT                   KGTEGNANAKGTETKGTEGNANAKGTETKDAEAKKADAIATKENALLQAQTELKAQAQK
FT                   LEFLTTAINTTLDKIAQSLSSLGRTN"
FT   CDS_pept        321483..322274
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02490"
FT                   /product="Oxidoreductase"
FT                   /note="silverDB:HdN1F338"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43832"
FT                   /db_xref="GOA:E1VG90"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG90"
FT                   /protein_id="CBL43832.1"
FT                   /translation="MDIHHPTYVPGHQLLKGKSVLITAAAGAGIGFAAAKKAIEEGCRG
FT                   IVISDIHAGRLEQSVQKLKDETGLAQVFGLVANVAVEGDVQALIDFAEKQLQGVDVLIN
FT                   NAGLGTSRLLIEMEDDEWNKVLDVTLNGTMRMTRYMLKIMKARGQGGVIVNNASVLGWR
FT                   AQKEQSHYAAAKAGVMALTRCAALEAAEFGVRINAVSPSLAVHPMLKKSAPAELLAELE
FT                   GREAYGRGAEVWEVANIMMFLASDYSSYLTGEIISCSSQRA"
FT   CDS_pept        322284..322742
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02500"
FT                   /product="MaoC-like dehydratase"
FT                   /note="silverDB:HdN1F339"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43833"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039375"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG91"
FT                   /protein_id="CBL43833.1"
FT                   /translation="MTTIFKTPLDLEASVGMRLGESEWLAIDQTRINLFADATGDHQWI
FT                   HVDPERAKDGPFGATIAHGYLTLSLVNLFLPQIVDVQGISMGVNYGADKLRFPSPVKVG
FT                   SRVRGVGELVAVENVKGGVQATIRVTVEIEGSDRPACVVDTISRYYPA"
FT   CDS_pept        322791..323993
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02510"
FT                   /product="predicted thiolase"
FT                   /note="silverDB:HdN1F341"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43834"
FT                   /db_xref="GOA:E1VG92"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG92"
FT                   /protein_id="CBL43834.1"
FT                   /translation="MREAVIVSTARTALAKSFRGSFNDTEAPALGGHVVRAAVAAAGID
FT                   PASVDDCVFGAAAQQGTQAYNLGRLCAIAGGLPDTTAGMAIERQCSSGLMSIATAAKSI
FT                   ICNEYDVAVAGGVESISLTQNKFKNTYRAVSKTVTDIDPTAYIPMIETAEIVAERYGIS
FT                   RDAQDEYSLQSQLRVAHAQKTGIFEGEIIPMKAIQANFNKDTKETTYEEVVVRQDECNR
FT                   PSTTIESLRALEPVWKDGKWVQQGRFITAGNASQLSDGASASVLMDRKRAEQLGLNPLG
FT                   VYRGIAVAGCKADEMGIGPVFAVPKLLKRHGLKVDDIGLWELNEAFACQVIYCRDKLGI
FT                   DNEKLNVNGGAIAIGHPFGMSGARMVGHALLEGKRRGVKYVVVTMCIGGGMGAAGLFEV
FT                   F"
FT   CDS_pept        324084..325673
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02520"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F342"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43835"
FT                   /db_xref="GOA:E1VG93"
FT                   /db_xref="InterPro:IPR004255"
FT                   /db_xref="InterPro:IPR009721"
FT                   /db_xref="InterPro:IPR014292"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG93"
FT                   /protein_id="CBL43835.1"
FT                   /translation="MERLSGLDASFIYMETPTMRMQVAFLVICDPANTPGGYSFRKIVD
FT                   LIDERTRSEPAFRRRLVEIPYNLHHPIWVDDPEFNIMNHVYQYTLPQPGSLRDLGKKLG
FT                   HVISQPLRRDCPLWEAWVIEGLEGGRYALMLKVHHAAVDGVSGTALIRHLFDPTPEVRH
FT                   LPDTRTHCGERIPTRSELIAFAMGSRVVRPRGFFELVKDSATVAVRTFLKRQNLGEIRR
FT                   SAPLSAPRTHFNRRIGPHRDVALVRMPLSEIKAVKNATNATVNDVVLALCGGVLRDYLH
FT                   SKDDLPQKSLISMVPISVRTEEKSRMTNNQVSGMWATLATHVEDPMERLRIINADTEAA
FT                   KRAMNPVNAGLLQDWAEYNTLGAFNLAVRLFASSGLVDRVTPVHNTIISNVPGPREPLY
FT                   LAGSRIETLVPLGPVMEGVGLNISLASYENTVCFSIQADSSLIEDVGEIGALFEPAFLH
FT                   LKEAAGLLPAGAARAARAAGSTDKTPTKAKAASVNGASVNGATGNSASAKGSAAVKGAA
FT                   RKKSNGAARPQA"
FT   CDS_pept        complement(325793..326620)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02530"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="silverDB:HdN1F345"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43836"
FT                   /db_xref="GOA:E1VG94"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG94"
FT                   /protein_id="CBL43836.1"
FT                   /translation="MQELRNKVAVITGAGSGIGRALAQAFASEGCNLALADINETGLAE
FT                   TAALLAHHSIKITTHTCSVADRTQMQALPAEIEAAHGAIHLLFNNAGVTINKTFEDSSL
FT                   EEFEFVTNINQWGVIYGCHYFLPYLKKQSEAHIVNTSSMAAFLGLPNQTSYCMTKAAVK
FT                   SFSESLRAELSHYNIGVTSIHPGTIRTNILNAAAGRSGKNAEGTQKLASLMARYGMPPE
FT                   KLAVKVVKAVKTNTMQVRIGWDAVLADWLKRMLPYAIHAPLQWGFNRSLKKGG"
FT   CDS_pept        complement(326635..327909)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02540"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="silverDB:HdN1F346"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43837"
FT                   /db_xref="GOA:E1VG95"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG95"
FT                   /protein_id="CBL43837.1"
FT                   /translation="MNPYLDRCFSPASLNGLQLSNRFIKAGTFEGMTPSGYPSTALQNF
FT                   HERIADGGISMTTIGYCAVEADGRLNENMLYMHEGIRAPLTALIDRVHARGVKVSGQMG
FT                   HGGGFSKNRELTRKRPLGPSFGLNMLGIAYGMIFCDAMTKADIKALIQTYHDAALYMKS
FT                   VGFDALELHLGHGYGMCQFMSPKTNRRKDEYGGSLQNRMRLPLEVLAAVRKAVGDQFPI
FT                   IAKISLTEGVRGGLDYDDAIAISVMLDKAGIDGIITSGGTSTMNPMIMFRGGNMYKPML
FT                   AAEKHPLMKLMIAIAGPRLFRDYPYEELYFLEQARRIREKVQCNMIYVGGASTNESFEK
FT                   LMREGFDFIQLGRSLLSDPDLPKQARLDHNYKSRCVHCNECVATIELPKGIHCTRFNDF
FT                   SQEKPAQVLSTPTSNEQKSKKQNLA"
FT   CDS_pept        complement(328024..328836)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02550"
FT                   /product="Transcriptional regulator"
FT                   /note="silverDB:HdN1F348"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43838"
FT                   /db_xref="GOA:E1VG96"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG96"
FT                   /protein_id="CBL43838.1"
FT                   /translation="MTEAANVEPQASATPQPQTSPERVPQKATALTRERIIKAAYLIAK
FT                   KDPLNAMSMRKIAGKLKVTPMAIYKHFSDKDELTAAVIDMLLEESELIPANIDPSDWRA
FT                   WIKASFLRMHDVYEEAPGMVQYMSHATTFGPAVLTWQNEVLKVLITAGLAPAKALTAQA
FT                   AMAELVTGSTILTQLRRLGMERIFPSIFHALQEGKAPTPEELQAGLASMVDHPWLLLCG
FT                   AAMLEDMHDPRKALSKELDILLDGIEMQVNQHRQNQTSDGAIDLNKGK"
FT   CDS_pept        complement(328833..329594)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02560"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F349"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43839"
FT                   /db_xref="GOA:E1VG97"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG97"
FT                   /protein_id="CBL43839.1"
FT                   /translation="MTPLKTSPSLQPGGRARSRRGRNPTIDLDKIEQAVRELDHGQNDL
FT                   SMKEVADHLAVNVTTLYRHVGGIDGLRRIRASLSRSNLPSLPAAEGLDWKQWIAVLSDY
FT                   YRRALIEHPDLLDFVQAALDPDFANLEAEARILVEYGFEPRAALLAHSFLITTITGYVH
FT                   QELKTLEEARAGYAPYYTRLFQNLDAHPERLPTLSAVNLSQRDLDRDLNFKAIINYAIA
FT                   GIAGLRGAPDHPDTKSRPRDALTPPARTVTP"
FT   CDS_pept        complement(329618..331342)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02570"
FT                   /product="AMP-binding family protein"
FT                   /note="silverDB:HdN1F352"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43840"
FT                   /db_xref="GOA:E1VG98"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG98"
FT                   /protein_id="CBL43840.1"
FT                   /translation="MTQTTAHKAITSSYQAGPASQPLLYETIGNCFDRIANTYPDRDAL
FT                   IVRHQNIRWTFREYQKQVNALATGLLKLGIQPGDRVGIWAPNRVEWCLTQFATAKIGAI
FT                   MVCINPAYRLYELEYALNKVECKAIITAEKFKTSEYLKMLNDLAPELARCEPGKLDAHK
FT                   LPHMKSVIRMGSEKSPGMFNFDEVCASAGEREYQLLADIAALLQPDDAINIQFTSGTTG
FT                   NPKGATLTHHNILNNGYQVAQGMNFTEQDRLCIPVPLYHCFGMVMGNLACLTHGAAAIF
FT                   PAEAFDPISVLETVQAEKCTALHGVPTMFIAELQHPDINKYELSSLRTGVMAGSPCPME
FT                   VMKQVIAKMNMRDVTIMYGQTETSPVNHMTAIDSPLEKRVSTVGRVSPHLEVKIVDTAG
FT                   RVVPIGETGELCCRGYSVMQGYWGDREKTADTIDLANWLHSGDLAVMDAEGYVKVVGRI
FT                   KDMIIRGGENVYPREVEEFLYTHEAIQDVQVFGIPHEKYGEEVVAWIQLREGFGHVTPE
FT                   NIRDYCKDKITHFKIPRVIRIVNSFPTTVTGKVQKFRMREMMEEELGEKKAASTETA"
FT   CDS_pept        331697..333505
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02580"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F354"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43841"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1VG99"
FT                   /protein_id="CBL43841.1"
FT                   /translation="MQTQAHANKPAGTESAGGRFDKGFDKEVDVLVIGSGAGALTAAVT
FT                   ASVEGLRDILVVEKSEKYGGTSAMSGGGIWIPNSHYARKEGVNDSAEDALRYLKAVIGD
FT                   EISEERLRCYVEKSAEMLEYMDKHSRLKYETVPYSDYYPEKPGGKEGHRTHQPTPMHAK
FT                   HLKENFNALREPPSQVLVMGKFTMTMKEGRAFLTQAKGWKMTALLMALRYYLDFRGRML
FT                   GKRSRRLTMGNALVGQLRWSMMERGIDLWLKSPMLELIEANGEVLGAVVEHEGKKLRIR
FT                   ARKGVVLGAGGFEHNQAMREQYLPKPTSAEWSGSQVNNTGDAIQETIRLGAKLDLMEHA
FT                   WWAPAVKIPAWDRPYIVFAERSLPGLVIVNKAGKRFSNEAAPYLEAGLAFYQANSEAEP
FT                   TVPSHVIFDANFRRKFPFGPIPPGYSMPDQMISKRVWEVLVKADTIAELAKKIGVDPEG
FT                   LAQTVAKNNEYAASGKDSEFHRGESYYDRYYGDARTSPNPCIAPISEGPFYALPIHPGD
FT                   IGTKGGALTDVNGQVVHASGKVISGLYAIGNSAASVMGSKYPGAGSTLGPAMTFGYLAA
FT                   KHMASSQRSGNVPSTAATQAPAGVSA"
FT   CDS_pept        333631..334410
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02590"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="silverDB:HdN1F355"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43842"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA0"
FT                   /protein_id="CBL43842.1"
FT                   /translation="MRKQTPEFGPGASLVFGGSGGIGAAIATRIAQGGSDVAITYKSRK
FT                   EKALAAAEQIAAYGVRCTVHQVDIANRQQIDHAIQEAVEAHGRLHSVVVAAGSDIKQPY
FT                   LADVTDAEWDEVINGDLNGFFRIVKGIIPHFRANDGGSLVHISSAGLGRTPPKDVLSVA
FT                   PKAANEALVKYVAKEEGIHNIRANSVAVGVIETGIFKRLEAEGVFNDAWKQAVLGALPI
FT                   KHFGQPEDIAEAAVFFASNRSKYVTGQLLFVDGGYAV"
FT   CDS_pept        334439..335194
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02600"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="silverDB:HdN1F356"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43843"
FT                   /db_xref="GOA:E1VGA1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA1"
FT                   /protein_id="CBL43843.1"
FT                   /translation="MKRFEGKVALVTGAASGMGKASALRLAAEGAKVLLGDLNAEGNQA
FT                   TANEIEAAGGVAHAVAFNAADEASCKALVQAAVDQFGGLDVVVNAAGIASFYHLHELTN
FT                   DIFNKFITINLTSVFTICREAMPHLKKTKGNIVNFASLNAKVMTAYQTAYCASKAGVAA
FT                   ITKCMAQEFEADGVRANVICPGGIETPMVKNIRFPEGLNRRLLANLQPLGRKGEPEEVA
FT                   ALVAFLASSEASYISGEDIFIDGGARSAL"
FT   CDS_pept        complement(335198..335692)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02610"
FT                   /product="cytochrome b-561 membrane protein"
FT                   /note="silverDB:HdN1F357"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43844"
FT                   /db_xref="GOA:E1VGA2"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA2"
FT                   /protein_id="CBL43844.1"
FT                   /translation="MDKRTQYTIAKTLHWLAFVLITFNVLGGWRLGNFETETRQILVGL
FT                   HAGVGILIFLFMAGRWWWRRSNRLYAPKNWWRKPLLLGQWVFYPILIVQTFIGIALAAV
FT                   IDLDINAFGFLPFSALAPNSADQEAWVRMIHASAAWSVLALITLHTFDKIRWFYTEKGG
FT                   N"
FT   CDS_pept        complement(335783..338167)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02620"
FT                   /product="nitric-oxide reductase, subunit B"
FT                   /note="silverDB:HdN1F358"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43845"
FT                   /db_xref="GOA:E1VGA3"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA3"
FT                   /protein_id="CBL43845.1"
FT                   /translation="MSTNSLLGGSIRAKKNIALWLVSKKNWILQFLIVAAICTGGLLYL
FT                   GAQTYISAPPIVNFVNDKGDTVFSEQQIMDGKHVWSIRGLMAYGSFWGDGAERGPDFTA
FT                   DSLHRSVVAMREFYAKEKKAELGVDALPVYETDAIAARVIRELHNNAYDEEAGIVRLNP
FT                   AQEYAFAEVREHYRKMFNDATYSEAFHPQGLISDPEQITSLTSFFFWGGWASAANRPGE
FT                   TYSYTHNWPHDPGAGNAPTPATWIWSFLSILALFLCIVVVLYVYGQMRELPIDVFGTST
FT                   ENPFALTTHDLENGYVRPTQKATYKFFALAMILFGVQIFAGIAAAWDFVKPFGISLNDF
FT                   LPFTASRSFHAIIQIVWFFVCWVGYTIFFLPRLSKLPSSQRTMINSLFAMIVIVGLGTL
FT                   IGVYLSTMGFLDGWVAYWFGTMGWEFMEMGRFFQLFLLVTFSFWIYIIYRGVKNWLTRK
FT                   NIWSVPAWLLYGSGIMVLFLFFGVLILEDQNFAIADYWRWMVVHMWVEVTFEVFTTVIV
FT                   GYLLVQMGLVTRLMAERTIFLAVMLFLITAVIGISHNFYWIAKPTGIIALGSIFSTLQV
FT                   LPMLLLTLDAWKMRQELGRAHDLRQQGRQVHVMEGVWLFILGVNFWNIVGAGVLGSLIN
FT                   LPIVNYYEHATYLTPNHAHAAMFGVKGNIAIAGMLFCLQHMFHKSAWSETRIKGIFWSL
FT                   QIGLVLMMVLDMFPVGLYQVWLTLQDGLWHARSSEVILGPVFASFTYLRVIGIAVFVLG
FT                   GALPLIWFVLSRGRTLQQETEVAEGEWTAYEDDEPWVAVKK"
FT   CDS_pept        338620..339378
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02630"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F359"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43846"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA4"
FT                   /protein_id="CBL43846.1"
FT                   /translation="MRGSLLQSLFKREDKASIQKPADVFPSDGTCEFLNDDGSPRFQGS
FT                   FASGTYHGIQKWFDRRGVLREVQTWVNGVKEGEWLLYHANGQLRARGGFSGGIRNGSFE
FT                   VFFENGKQRSKGEHRDDERHGGYISRHENGEVECVGEFFKGKKNGEWKRYHNNAAIAEL
FT                   GSYRLGEKHGEWFGYSADGCVIAHELFAYGKLEGCQERFYENGVLKNRDMYVDGARNGY
FT                   QELYSENGKLLRVAFYKKGVMQRTEATRAP"
FT   CDS_pept        339375..340028
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02640"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F360"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43847"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA5"
FT                   /protein_id="CBL43847.1"
FT                   /translation="MMKKIIASLYKSSIEGIRLVFGKSRHQAVLIQVEEAGEKRGIFQS
FT                   ARLTGSAKRYFENGQLELTGFYKDGKEDGLWEFFYPNGKREFRGRFKEGQRDGEWEMFY
FT                   ENGQTKLKGYSIFGIPEGSFERYHRDGQLVEKSNYKDGEYHGPFEQYFLDGCIHCKGEY
FT                   ESGERNGLWEIHAEDGRSFRKGYYRLGEKEGKWEVFNYQGQCIECLYYQEGMIV"
FT   CDS_pept        340144..340470
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02650"
FT                   /product="Ferrodoxin"
FT                   /note="silverDB:HdN1F362"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43848"
FT                   /db_xref="GOA:E1VGA6"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA6"
FT                   /protein_id="CBL43848.1"
FT                   /translation="MAHVVLDNCINCKYTYCAEVCPVEAFHEGPNFLVIDPEACIDCML
FT                   CVPACITGSIMEERDVPHSQRSMVRANAMLSQQWPSIIERKPAFPDAEEWDKVPGKRRF
FT                   LEMW"
FT   CDS_pept        340562..341257
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02660"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F363"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43849"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA7"
FT                   /protein_id="CBL43849.1"
FT                   /translation="MEDLRTFERLLRSMDIEWLRGAAVSAIGAVALLSLLAGCGERVQT
FT                   MIPIKLTLDVTGVAASSVDAKVVGRIYGATYRMHRGENDEVTLIPISKFYSDSGTITRR
FT                   LEFPEGSRDQLAVWAWQDLDGDGQLCENGAQDEPSGWVSAERFVVTRENSTVKGFSRLP
FT                   GGMVMEQRVDQKVQLSLPLDSKCGVADRLAKAALSEHAHAVNATQNQNIDNHNKSEATS
FT                   TSGVVAAVH"
FT   CDS_pept        341278..341958
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02670"
FT                   /product="Probable regulator, LuxR family"
FT                   /note="silverDB:HdN1F364"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43850"
FT                   /db_xref="GOA:E1VGA8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA8"
FT                   /protein_id="CBL43850.1"
FT                   /translation="MNLKAIFGNSGDGVYAIDGGGVIRFWNSAAQEILGYSFSEVQGKH
FT                   CRDLFKGRDASGNRLCSEICWVKIQAMEGVPVRHFEMQTTTAKGSAVWLDISVLRIPAS
FT                   VLSDTLAVYMFRDVTASHYVKLALQSGPKAVQPIQISAANSEVSAVLNGLTARQNEVLS
FT                   LLKSGASTTEIGDRLGISLATVRNHIQGIFARLGVHSRTEMLAVLHGFKFDKQPAAELE
FT                   KLAI"
FT   CDS_pept        342094..345243
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02680"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F365"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43851"
FT                   /db_xref="GOA:E1VGA9"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGA9"
FT                   /protein_id="CBL43851.1"
FT                   /translation="MLQFPIFRRRSQALGNTAMNVFASRNDWQAIGSGQVRLDLHDRPA
FT                   GLGLAWNFAGPTGFAVARRLVNWQVPPRFRMRFRWHGEGNLNRLEIKLIDHANNAMASV
FT                   WWYQRDALPWPEPGTESVLESGDFAFAWGAAGGGLPARVAALEIAIVAGEGGSGELILE
FT                   SLSIEDLAVVQTCRFTEFRSGDGVYDRASAIGWSAHSAEDWLQLNWSEPISFAALRLEW
FT                   AENAWPTHCSVTGFSATGAPEVLLDASTDTRRHFLYFGARRIQGLRLQGFREGTAIKLL
FT                   ALEWIPPERARSWTDFLHEVAAHLPQGSLPSYFSRRQCYWTVIGAPTCPFQALINEDGG
FT                   IEVQRPGFSVDMQWLHDDSSLGIDVTSTLQSIGKMDAELSLADRRWPIPSVSVSSAPLQ
FT                   IVVTGAATFVGGRWCVLAEYRVQNTGEKRLSGKLLARLRPFQVTPPWQAWREFGGVFPV
FT                   NDLCWNERFLQVNERFAVGPIEPVDACLLIPWLNFDDALLRDRLRMPCMKRITDPVSLA
FT                   QAVMAWPISLASGESNSVHLLLPFERMEPEEQKQWWAKCQHEISFPSAFPAKLLDAAIR
FT                   DWKALVGGFALAGNDEIKRRFDVICTATAHILVNRSGPALQPGPRRYARSWIRDAATMG
FT                   AALLRMGRVQEVVEFLEWYHPFLREDGYVPCCVDRDGADPLVEHDSHGQWLFLVAEACR
FT                   YGAGSVFSNRMLPSMRRVARYLFQLRSQRCTSAYQNGENVVRYGLLPESVSHEGYLAQP
FT                   VHAYWDDVWAWRGLLHAVDYFTSEAPNSSEAHTLAERCRQESEALEQAIRNSMTMVMSS
FT                   AKIEFLPGSVEWADYDPASTACAVGQLNAFACLPESAIPATFRQFLDGWRERKLQGRES
FT                   GKYSAYDIRVVAALLRLGWRDEANELLNFLLADMRPQNWQQWPEISWPNPRSPGHLGDL
FT                   PHSWIGAEAVLAILSLFVLEDERALVLGQGIKLDWLEEGVSGTGWPTPFGTLDFAYQKV
FT                   SNGCIRVTLAGSVVPPDGIVLALPGISEKTHYQLLSGNLRPSTGGRLCLQSSPAELLFT
FT                   C"
FT   CDS_pept        345257..349009
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02690"
FT                   /product="Cyclic beta 1-2 glucan synthetase"
FT                   /note="silverDB:HdN1F367"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43852"
FT                   /db_xref="GOA:E1VGB0"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR009342"
FT                   /db_xref="InterPro:IPR010383"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR033432"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="InterPro:IPR037824"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB0"
FT                   /protein_id="CBL43852.1"
FT                   /translation="MKYSWPTSLSLQGLPEFRLLSSHGYHVLAHARGSCFSRFRHWALN
FT                   DWVRDGLQDYGGVQVYLRDEDSGELHHLDLGLAPSAVEQWEHSDAGAAWDFRLGDLQFR
FT                   VSLSLSTQCPMEIRTMDLMSPATSDHSTRRLSLTVFVPIALNAPAAHESHPAFSKLFVQ
FT                   TRFCEANERLIAQRRPRGAGEVSPCVMATFEGPGELHWETDRIRFIGRGSSIANPAGLR
FT                   DRLSKSADNVLDACFVLQRSFHLKSGESARFHWTMAAAEDIDSLNAYPKQSVAKVENRA
FT                   SDLKLDSLLGAMFCRSPRLKPPASYWKDLYAEPGNVWGYGMPTESPFVLLLTDLQAEIE
FT                   WAASSKRYWAEHGIEIPVLVVWYGAENSICEMQRDVGKGLAFRGAATVPTRDLQALVAA
FT                   SAAVCGTRAPACAPPFRSAAPHAALQVVPPCASTLPEKSQNLQLSNSYGGFSEDGREYV
FT                   IHITTEVSRSRLPPMPWINVLANPIFGALVSETGAGCSWSGNSHQRRLTPWANDPVRDR
FT                   HEEALYLHDENTGTTWSPLPGPLPVEGETETRHGFGYTTFSRFCADLHQQVQVFVHLEK
FT                   PVKIWRITLRNSLNRERNLRLTSLQRLVLGFLPQHASGGLLVWQATSGRTLFARNPLGG
FT                   AFKQRVAFASVVGDGVWRGSGNRRMLLGDEGDLSKPVGMLAPWEGDPAIGDAAFLQQLS
FT                   LTLPANGELSLSVLLGDAADEAEAAQFVLSLKTDTEIFAALTEVKAFWRKQVGVIQVKT
FT                   PSQEINFMLNGWLLYQTLVCRLWGRTAFYQSSGAYGFRDQLQDCGAFAITHPEITRKQI
FT                   LLHASRQFIEGDVQHWWHEPPLGSGLRTRFSDDLNWLPFITAHYLDVTGDVSVLDEIVP
FT                   FLTGRLLQEGEDEAFETPQMSGEPGTLYEHCCRALDRSLTRGAHGLPLMGTGDWNDGMN
FT                   RVGREGRGESVWMGFFLYTILGDFIPLAEKLEDAGRAEQYRDYRRHLLEVLNRAGWDGE
FT                   WYRRAYYDNGDVLGSSENDECRIDALAQAWAVLSGVASPERAHKAMAATEKYLIDREGG
FT                   LIRLLTPAFANTKNDPGYIKGYVAGVRENGGQYTHAAAWVVKAMAKLQREDCVAELYEM
FT                   LLPARHTRTPEGVARFKVEPYVAVADVYGEAPHVGRGGWTWYTGTSGWLYRVGIENVAG
FT                   FSLIGGDTVGIKPCIPAEWPGFSLRYQLPKGGCLQVEVERQAGSLGSAVLSALLDGVEV
FT                   ILKDGVALACLDGMKDGSILQVVVG"
FT   CDS_pept        complement(349032..350732)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02700"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F369"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43853"
FT                   /db_xref="GOA:E1VGB1"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB1"
FT                   /protein_id="CBL43853.1"
FT                   /translation="MPSAPLLGKRAILVRAVQMLLSFVSSPAGVRARLMFTVLVLLLVS
FT                   TNGFNVLISYASRDFMTAIEQKHVSEFLHQALLMTGLFVASTVAASFARFFEERLGLLW
FT                   RKALTERTLHQYMSAGTFYFIEAKHSEQRPDQRISEDIRALTSTALSFLLMMLNSLLGI
FT                   IAFAGVLLDISPLLLLVSFLYAATGSLIALWLGNPLIALNSRQVDREADFRSELLNVRT
FT                   HAERIALLQRETILHKRLLERLDALVANTKRMIAVNLRLAFFTGSYSYMIQIIPALVVA
FT                   PLFMEDQADFGVIAQSALAFTVLVNAFSLIVSQFPSISSFAAVVTRLHALNQVSDEAQK
FT                   QQANALEVLSAADCIRYENVSLFPIGDDDDEKSPLLRDFNIEIRAGQRTLIHSTHKVLL
FT                   LRLFNATAGTEKQSEGKLWLPTQSQVFFLPEKPWIPPGTLRDALDATRHGRSDGEIAQV
FT                   LAQLGIAQVVESVGGLDSPQTDWNASLSIGEQKLLDIGRLLLARPRFAFLFRLHSVLSH
FT                   SCIDELMPILYRSGITYIHLGRYEYPECYEQIIELCNDGSWKIQPQDDA"
FT   CDS_pept        complement(350819..352060)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02710"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F370"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43854"
FT                   /db_xref="GOA:E1VGB2"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB2"
FT                   /protein_id="CBL43854.1"
FT                   /translation="MEFWTSFWTSASADIQANWHYLLMPLIAGFVGYITKLLALEMMFR
FT                   PIEFMGIKPPYLGWQGVVPRKAPKMASTATDLLMGRIFQLEELMARLDPKRMIKEVEGP
FT                   LNRAVDELVNEIGDRFMGVFWTTTPDLIKRRVIRHVQKSIPDIAGEVWSEISREPQKYI
FT                   DIKHLLIENLVRDKVLLNDIFRRIGHKEFVFFRSAGFWFGCALGFVQLLCWLIWHEPML
FT                   IPMFGGIVGLLTDWAALQLLFRPLNPIYFMGMKIQGKFIARQKEVARDYAALIAKQLLT
FT                   PANMIEEILRGPCAENVTNLIRDRITQSMDEQFGRARPVVRYALGKEKYDNIHEFVAER
FT                   VLESIPESSRHIEKFALDAMDINNTIVSRMDLLTPEEFEGMLRPAFKEDEKTLIIAGAV
FT                   LGFLVGELQVHLML"
FT   CDS_pept        352298..353593
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02720"
FT                   /product="predicted saccharopine dehydrogenase"
FT                   /note="silverDB:HdN1F371"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43855"
FT                   /db_xref="GOA:E1VGB3"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB3"
FT                   /protein_id="CBL43855.1"
FT                   /translation="MVGNREDDRQEMSGTDKKYDVVVWGATGFSGRPAALHLNRFYASQ
FT                   GKIRMAVAARSKSRLQALLKELDSPEIDMLVCPGDDAEAAAQVARSARVVCSAVGPAAR
FT                   WSTPMVDACIAHGTDYCDLSGELHWLRKMIDTRDAIARARGVLILNATGVDSIPTEYGV
FT                   QRLQQAAREAFGEYCVRVKGCFAHGKIAVAGGSFLSGKGVMEAIADDPEMREIISNPYS
FT                   INPTGDLHGYPPCPDLEHVVYDEDFAQYIKPFPVGQINARVVRRAHSLAGYPYGHEFTY
FT                   IECALAGHSAWDRLKAILETRAVGLFVNTNPRTPLGKMLMALGPREGSGPSDEQMHRNG
FT                   PFGFVYWGRTQSGKVMRSWATSPLDVHRATAAMMAETAVYLAKQRADVLQQGGFWTPGT
FT                   AIGDALLKPLQRHRVLDTGTTQGLWPNIRIYS"
FT   CDS_pept        complement(353644..353997)
FT                   /transl_table=11
FT                   /gene="ksi"
FT                   /locus_tag="HDN1F_02730"
FT                   /product="Steroid delta-isomerase"
FT                   /EC_number="5.3.3.1"
FT                   /note="silverDB:HdN1F372"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43856"
FT                   /db_xref="GOA:E1VGB4"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB4"
FT                   /protein_id="CBL43856.1"
FT                   /translation="MDTAHKIKVVNQYIQAVSTLDLDLIREIYASNATVEDPVGSPRHE
FT                   GIDAILAFYGRIKGVGVTLALKDTPKCAGNAVAFPFTATIGPTVMDIIDVFEFNEDGKV
FT                   LSMKAYWGPENRK"
FT   CDS_pept        354441..355832
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02740"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="silverDB:HdN1F374"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43857"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB5"
FT                   /protein_id="CBL43857.1"
FT                   /translation="MSYSFAGKVAIVTGAGGGLGFEYAKYLAQHGAKVVVNDLGGSTFG
FT                   LDGAKNSSVAEAAAQKIRAAGGEAIANGNSVSDEKGAKAIIDQAIKKWGRVDIVINNAG
FT                   IASTQVFPNVDTKEINLHLGVHVLGAVNMMKAAWPHMVKQGGGRIINTSSSSTLGFSPQ
FT                   ISYPTMKSALFGLTRNTALLGKEQNIHVNVILPAAFTRLTNMLPPSAFREHLERDFQPE
FT                   RLAPVIAYLCHDSCDISGEFFTVGGGKFARLVFAETPAAEIDMSVESVASSIQGMMADR
FT                   PNLSLMKTSFDDLFNLGFSEEEYSMFYNMSVTQGEPAEIENFKPVAKTSVDNVWDIVVK
FT                   SPVGDQKSVLTLKSQGKTLVGNAMNAEYGMQVAEKGEIKGQTITWKTKITKPVPLTLTY
FT                   TGELDADDNMQGTMKLGIFGESKFIARPVKDQQARETAQQRFQEQQANPVQKKGLIKRL
FT                   LAMID"
FT   CDS_pept        355894..356985
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02750"
FT                   /product="Rieske (2Fe-2S) region"
FT                   /note="silverDB:HdN1F375"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43858"
FT                   /db_xref="GOA:E1VGB6"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB6"
FT                   /protein_id="CBL43858.1"
FT                   /translation="MSKYAKIEAAVIEERYARGWHCIGKGTDYGKEPVRLDYFGTRFVA
FT                   YRGEDGQLIVLDGFCPHMGADLSEGYVEGNSLRCPMHSWRWGEDGVCDDIPYAKKIPSK
FT                   ACIKSWPILERNGLVYIYNDPEDNAPIPEQMPPVIEACSSDDWSDWQVVKMEIKTNVRE
FT                   LVDNMADKAHFGPVHGSAALKFENEFDRHIAIQRMEGKSPRLAGDAILKTVATYYGPAY
FT                   MITEMSGEMNGVPVESKLLVAHIPTTTESFDLRFGVMVKLFPGMTKEQSDAMVKGYVDL
FT                   AQEAFFEDVAYWHTKKRVDNPLLCDGDGPIYRLRQWYNQFYVDIADVPTMWNEPKHYTT
FT                   DSVNPIPVQKSSAWPKGKQPVEA"
FT   CDS_pept        357111..357500
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02760"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F376"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43859"
FT                   /db_xref="GOA:E1VGB7"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB7"
FT                   /protein_id="CBL43859.1"
FT                   /translation="MDNEKFLRVLARILLGIGALFYLLYAVYLPLPQWFEAAGAERGNT
FT                   GILFYCLATAGAAFVVWGILLGKLGEQGLGRKQVLSASAIGLGMLALMRLGTVLFPHPP
FT                   FDGLVVVPAIECVVFALVAIKLYRA"
FT   CDS_pept        357541..358731
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02770"
FT                   /product="Predicted flavoprotein"
FT                   /note="silverDB:HdN1F377"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43860"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB8"
FT                   /protein_id="CBL43860.1"
FT                   /translation="MQTRGYDVVVIGAGAAGLQCAALAAQRGRRVLVLERSAKPGRKIL
FT                   MSGGGRCNFTNLDVTPANYLSENPHFCKSALSRYTQWDFIDLVAKHGVAWHEKKLGQLF
FT                   CDHGAEDILNLLLKECEIAGVTIKTRCEIQELDGQDPFSILTSLGRFEADSVVIASGGL
FT                   SIPSMGSTGFGYQVARQFGLNVLPQRAGLVPFTFSDAVGAMAKRLSGLSLEVVLENSRQ
FT                   SFREDLLFTHRGLSGPAVLQLSSWWREGESVTANLLPAIDATGWLQTCKREQPKSLLRS
FT                   IISEHIPRKLVLELEAFWWPAFAETPLAEISNKNLDAIATKINAWQLKPAGTEGYRTAE
FT                   VTLGGVDTKELSSRTMEATKKSGLFFIGEVIDVTGWLGGYNFQWAWSSAYAAAMAV"
FT   CDS_pept        358756..359652
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02780"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="silverDB:HdN1F378"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43861"
FT                   /db_xref="GOA:E1VGB9"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGB9"
FT                   /protein_id="CBL43861.1"
FT                   /translation="MEKMPVLWCIGCGDIGSGVGTALGAKNWEVIGVRRHPQAASFSQL
FT                   AVDVINAPNDLRKLPSPDYVLYTLTPSERSEGAYTAAYDQAVQSVLSLLPATLKRFFLV
FT                   SSTSVYPQQNGEWVDEQSPVAHSGFAARALLAGEQHALNGALPASVIRLSGIYGPGRDW
FT                   LVRRAKADTPVVKEPPKWTNRIHRDDAVGFLVHLLERVEQGQEVEPLYLATDSHPATEW
FT                   EVMSFLHQQLGLPDPRIATAEADPKMNKRLRNTQMLASGYTLRYPSFQQGYASPTPSLN
FT                   TPPAVLQNSPPKSSSQN"
FT   CDS_pept        360048..361118
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02790"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F379"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43862"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC0"
FT                   /protein_id="CBL43862.1"
FT                   /translation="MSAVNVNLVSNATSSKAASSKVASSKAILGAALLGLALTGCGGGG
FT                   GSSSGGDAGMTGNTQAGNSTNQIREGRFLDAAVSNARYVTLTPDGKVSMSGFTAEDGSF
FT                   FFRDGETVSFFIGDILLGKAAAAGIVTPSALVDGANSSDALPNMLRFLQTLDTDADPYN
FT                   GIQISSLVHEHSTNLKVDFDRLKGDFEVQSALTGLLAMATNSPTMPTVFAALDHFRTTM
FT                   LNAYDSNSGETVLNLVGTKWRSTFSSEACGDTSVELTHTFNKLGHFTTGYHDLKQRDDG
FT                   SCKGSSLAVLMALYENDDMFSCANGCSLTDLNRTVRINGPEAHDATIVHAPGTSTITII
FT                   HQYDDGREVLETMKKV"
FT   CDS_pept        361356..366242
FT                   /transl_table=11
FT                   /gene="rhsA"
FT                   /locus_tag="HDN1F_02800"
FT                   /product="Rhs family protein"
FT                   /note="silverDB:HdN1F380"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43863"
FT                   /db_xref="GOA:E1VGC1"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR006530"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="InterPro:IPR031325"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC1"
FT                   /protein_id="CBL43863.1"
FT                   /translation="MEINNNNRTRYKEEYRELTVHRPPSTVHRPPSTVHRPPFLINPLS
FT                   LAVSAGLLFAHSGIVAAGCDTSLITANLAEPRSQCVEQCSKDFNGHTSMDCTRVHVENT
FT                   VCPEYCAQARDDSCESFAGNPINLSDGSKYQEETDYVGGGSNPLEIRRHFRSIGNRDSA
FT                   FGYNWSGLVSSRVEVRFTQKDGDVFNVVKQDGSIVSFYWADVVNNTIVIVPYKSTVADK
FT                   LSMFQEAGAWVLNFTSSDGTVDRYDINMTEYGNTNRYTSKLLWRQFTTGEKHYFSYASD
FT                   GTLDSIADDFGNKLQYTYHPSSHHVASIAVTPGNRVYRYDYDANGNLTHVYFPDDTPAN
FT                   TTDDPFKRYHYEDARFTHYLTGITDERGKRYATFAYNEDGKAISTEHAGGVDKVEVVSY
FT                   AEPNGGVRVRNALGKDTIYRYTKTGSGASTSKRLTAVDGQASSNCAASNSTYSYDANGF
FT                   RDKITDGRGFVTDLDHNALGQEIRRTEALGQQEQRTTETDWYPGGTIKEIRAPGKTTRF
FT                   TYTQGNGLGRLTSRTEIDTTTHSAPYATQGLSRTWSYSYTYHDAPANLKVATVTVDGPR
FT                   ADVNDTTVQHLNPAGQVDRIEQHSGSGAPLVTEITAFTAEGLPQTVVDPNGIVTQLSYT
FT                   PRGWLKTRTTTTPKGPITTTYEYDNAGQVTKTILPTGVALNYLYDDAHRLQEISTDDNE
FT                   RITWELTALGDRRMERVQSSSGSLRRIVHQEFDDLGRLWKRFGVQDQVLETYGYDANGN
FT                   PETTTDANQRTITRAFDGLNRLRSVTERDTGATQYEYNAQDQLVALTDPNGLTTSWVVD
FT                   GFGRKIQETSPDRGTTVYRYDLADNLIQKTDARNSVTKYSYDALNRLTEIQYPASAQDN
FT                   VSLKYDETSLPTANGSVAHKGKGRLTSAIVANGDKTQWAYDALGNITNDVRVQAGKTFQ
FT                   TTYTYNAAGQLITLGYPSGRELSYGYDNKGRIHQLRSRTSSTASWTTLANNLSYEPFGP
FT                   LTGFTWGNGLTETLSYDTHYQPETIQTRSGSSDVRSLQYGFNLANELDHLTDAKTPARS
FT                   QLFSYDPNGRLNQAQGQYGTLAYQYDLTGNRVSQAQTNATNGQNFTESYQYPATSHQLT
FT                   QVNVSGQGGQNRSFQYSATGNLTQDERYTYVYNDANRLTQVMSGPAVIAEYRYNHLGER
FT                   ISKTTDGKTTQFIYDPNHQLLAEHHQDGTPIRDYVYLGSKLLAMVDADTTTNPDTGTKA
FT                   DLAITLKGATGNSVKQPDGRYQVTYKVNVQNAGGSAAENVVLTNTFPATDVNLVSYTAS
FT                   QGTCTEDASTCDLGTISAGQTATVTLIASKGQKAKENFSASVTTSSEESNTDNNSATAA
FT                   FGGAFGLWIMAFLTAMLGLRTRFAKHALNRKNTISTACLLLCGLSLMGANTSQAEQIYY
FT                   VHTDHLNTPTLVTDSNKTVVWEGVRKPFGETEEVVATVRQPIRFPGQYFDGETGLAYNL
FT                   MRDYDARVGRYVQSDPIGLAGGVSAYGYAGQNPITNYDSDGMYWRGMAGVGVALCLKNP
FT                   RLCKEVGKDAWKACKRAQKKIWDKARKEYWKWRAAHNNGEYSPEDLARMTQGKPPRHTE
FT                   FDVSKELHHEVPQREGGSNSADNLKEVWPWEHDSIDPYRNYKGPRPDGW"
FT   CDS_pept        366246..366698
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02810"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F395"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43864"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC2"
FT                   /protein_id="CBL43864.1"
FT                   /translation="MKMPVKKVVNSQLSMKYGMTVVLWDVIDIRHADYAKLCFLGVNSK
FT                   WRQGVWVKSNASILVEGQTCSSVSLWFDTAPPCVVLTFEPGAEFLHLYNIWETPYAQGS
FT                   QSRTSGMIIEESENLRTYHCTDFGEDADFTRLVFQLELCPLRPIAG"
FT   CDS_pept        366893..368953
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02820"
FT                   /product="Rhs family protein"
FT                   /note="silverDB:HdN1F381"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43865"
FT                   /db_xref="GOA:E1VGC3"
FT                   /db_xref="InterPro:IPR000096"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR001826"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC3"
FT                   /protein_id="CBL43865.1"
FT                   /translation="MAANLIQITYPSGRELSYGYDNKGRIHQLRSRTSSTASWTTLANN
FT                   LSYEPFGPLTGFTWGNGLTETLSYDTHYQPETIQTRSGSSDVRSLQYGFNLANELDHLT
FT                   DAKTPARSQLFSYDPNGRLNQAQGQYGTLAYQYDLTGNRVSQAQTNATNGQNFTESYQY
FT                   PATSHQLTQVNVSGQGGQNRSFQYSATGNLTQDERYTYVYNDANRLTQVMSGPAVIAEY
FT                   RYNHLGERISKTTDGKTTQFIYDPNHQLLAEHHQDGTPIRDYVYLGNKLLAMVDADTTT
FT                   NPDTGTKADLAITLKGATGNSVKQPDGRYQVTYKVNVQNAGGSSAENVLLTNTFPATDV
FT                   NLVSYTASQGTCTEDGSSCDLGTISAGQTATVTLIASKGQKGKENFSASVTTSSEESNT
FT                   DNNSATAAFGGAFGLWIMAFLTAMLGLRTRFAKHALNRKNTISTACLLLCGLSLMGANT
FT                   SQAEQIYYVHTDHLNTPTLVTDSNKTVVWEGVRKPFGETEEVVATVRQPIRFPGQYLDG
FT                   ETGLAYNLMRDYDARVGRYVQSDPIGLMGGVSTYGYAGGNPIRYTDPLGLYWGETYVDY
FT                   TVGAIGGAADFVDNYGDMRDANTIGGDKYFHCKANCEAAQRGQGGQDAARCISDSREWF
FT                   DQHWPKNDPPSASAADQVANLYGRTQGAENTGGNCQQICAPFRPNGLPSQY"
FT   CDS_pept        complement(369262..370812)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02830"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F383"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43866"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC4"
FT                   /protein_id="CBL43866.1"
FT                   /translation="MQRKRLPIGIQTLREIREDNCYYVDKTPLALRLVQQGKYFFLSRP
FT                   RRFGKSLFLDTLKELFEGNEALFKGLYAEKHWDWSVKYPVIRISFGGGVTRTAQELEDQ
FT                   IDSHLRRFETAHELAVVDKTLAERFRSLILHVAQTSGQRAVVLIDEYDKPILDNIEQKE
FT                   IALQTRETLKDFYSVIKDADAYIRFAFLTGVSKFSKVSLFSGLNNLEDITLSAEYSAIC
FT                   GYTDQDVDRVFAAELEGLDREEIRCWYNGYNWLGDSVYNPFDLLLLFRNRAFRAWWFET
FT                   GTPNFLVKLLSQRGFFTPDLANLQTGEQLISSFDVDAIKSEALLFQTGYLTIHEVQQPI
FT                   LGHWVYTLGYPNREVESSLNASLLEGLGVDSSKGFENRIKLIKLLREQNIPAMRDLFHA
FT                   FFASIPHDWYRNSPIAQYEGYWASIFYSHFAALGLDIKLEDATNHGRIDMTVCFEGHVY
FT                   LFEFKVVELVPEGRALKQLKDRVYAEKYQNDGPVHLIGVEFSKDTRNIVGFEVEEQVG"
FT   CDS_pept        complement(370852..371235)
FT                   /transl_table=11
FT                   /gene="tdcF"
FT                   /locus_tag="HDN1F_02840"
FT                   /product="Putative translation initiation inhibitor, yjgF
FT                   family"
FT                   /note="silverDB:HdN1F385"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43867"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC5"
FT                   /protein_id="CBL43867.1"
FT                   /translation="MSNHQVITTDKAPAAIGTYSQAIKVGNTVYMSGQIPLVPATMQMV
FT                   EGGIDAQIVQVFENLKAVAEAAGGGLENVVKLNIFLTDLGNFATVNEIMARYFQQPYPA
FT                   RAAIGVAALPRNSGVEMDAVLAL"
FT   CDS_pept        complement(371261..373372)
FT                   /transl_table=11
FT                   /gene="spoT"
FT                   /locus_tag="HDN1F_02850"
FT                   /product="Guanosine-3\',5\'-bis(Diphosphate)
FT                   3\'-pyrophosphohydrolase"
FT                   /note="silverDB:HdN1F386"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43868"
FT                   /db_xref="GOA:E1VGC6"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC6"
FT                   /protein_id="CBL43868.1"
FT                   /translation="MLNTRALLDKLDYLDPEQVSQIQKAYTFAASAHEGQFRRTGDPYI
FT                   AHPLAVSMILADMHMDAPSIMAGLLHDVIEDTHVSKEAVKQEFGETVANLVDGVSKIGA
FT                   IKFESKAEAQAQNFRKMMLAMTKDIRVILVKLADRLHNMRTLAVLHPQKRRRIATETLE
FT                   IYAPIAYRLGMNEVRIELEDLGFQAIYPMRATRIKKAIIKARGTRKDMIVSIQEMLVHA
FT                   LEHNHLPARVIGREKHLYSIYQKMKTQRKPFSEIMDVYGFRIIVDNVDACYRALGTVHN
FT                   LYTPIPGRFKDYIAIPKSNGYQSLHTTLKGKNGVPIEIQIRTEDMEDMANSGIASHWLY
FT                   KSDTDPAGDAQNRARSWLKSLVEMQQRAGNSLEFIENVKIDLFPDEVYVFTPKGRILEL
FT                   PTGATPVDFAYAVHTDVGNACVAARIDHRLVPLSTIMQSGQTVQIITAPNARPTPGWLG
FT                   FVGTAKARANIRHYLKTQRRSESVELGLRLLNKALTPYHVSANELPKERIQSILEDTNF
FT                   REFDDLLEDIGLGNQMAQLTARRLLPPEGAKSEDAGSNSPLVIRGSEGLIINFAKCCRP
FT                   IPGDTIVGHLSAGRGMMVHRDICRNVQQEQKQNPEKCLPVEWAPDAQGEFSVDLKVEII
FT                   NERGILATLANSLSEVGANIELINLKERDAQISTVNLRLGVAGRIHLARIFKRLRAIKA
FT                   ITRLVRIRH"
FT   CDS_pept        complement(373619..373861)
FT                   /transl_table=11
FT                   /gene="rpoZ"
FT                   /locus_tag="HDN1F_02860"
FT                   /product="DNA-directed RNA polymerase omega chain"
FT                   /note="silverDB:HdN1F388"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43869"
FT                   /db_xref="GOA:E1VGC7"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC7"
FT                   /protein_id="CBL43869.1"
FT                   /translation="MARITVEDCLQQIPNRFELVLVSAKRARQLATGGKEPFVPWENDK
FT                   PTVVALREIAKQYVGMSILDNAPSEADIQQELENV"
FT   CDS_pept        complement(374005..375552)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02870"
FT                   /product="Drug resistance transporter EmrB/QacA subfamily"
FT                   /note="silverDB:HdN1F389"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43870"
FT                   /db_xref="GOA:E1VGC8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC8"
FT                   /protein_id="CBL43870.1"
FT                   /translation="MLDTRPMPSVSQRWGFVMALIGMFMAILDIQIVASSLNEIQAGVS
FT                   ATMDEISWIQTAYLIAEVIAIPLAGMLIRWLSTRIAFVISCASFTVASVGCALAQTIDQ
FT                   LIIMRAIQGFVGGAMIPIVYSVSFSIFPNRVMGMVQAVIGMIATMAPSIGPTLGGYVTQ
FT                   HIGWHWLFLMNIIPGIAASIGVWMLLDIDKPQFNLFRKIDFVGLLYLALFLGPLEYVLE
FT                   EGPGDDWFASSTISGMAILCGVSALLFFHRVFSASFPIVDLRVFRNRNFAIGTGMGFII
FT                   GIALYGLVYVMPMFLGGVRRLNSLQIGEIMFVTGAVMFLFAPIAGRLTDKIDLRYLLTT
FT                   GMIIVGIGSLMNANLTFQSDYDDFFWPQVVRGIGLLLCLVSAARIAMGTLQPSEVGNAA
FT                   GLFNVVRNLGGAVGLAAMDTLLDLRADYHWQQLIPAVNSARDGAVLALQDSVGLMTGPT
FT                   SDPSAAGLVQLSHRVLAQAHVLSYNDIFMWLGILYLCAVPLTLLLKKPQAHEGAAGH"
FT   CDS_pept        complement(375590..376684)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02880"
FT                   /product="Secretion protein HlyD"
FT                   /note="silverDB:HdN1F390"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43871"
FT                   /db_xref="GOA:E1VGC9"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGC9"
FT                   /protein_id="CBL43871.1"
FT                   /translation="MASSTRKFLVPSIALIVAVSAASMGILWFEQHRFVESTDNAYVKA
FT                   DTIAIRPEVAGRIKAVPVHENQQVRKGDVLVQLDTSDFEAQLAQTNAETNVAQAALADI
FT                   GEQILLQEKKVLAANANIDAAKAELQRARVELNRAATLARQDFGSKQLLENKQADTEVA
FT                   KAHLDQAFAALAAEQQMLAVYHTKQDSAKAQIEAAHARARFASHQLSKATITAASDGVI
FT                   GNLAAFAGGYAQPVQTLLQLVPIPQTYVIANFKETQIGRMSMGQHVKLTVDALPGITFT
FT                   GKIDSLAPATGTEFSLLPQDNATGNFNKIVQRVPVKIQVIGPMEQVHLLRPGLSVLPEV
FT                   DTSNFTEQLSYRSQTSTATPVATR"
FT   CDS_pept        376995..377627
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02890"
FT                   /product="Transcriptional regulator"
FT                   /note="silverDB:HdN1F391"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43872"
FT                   /db_xref="GOA:E1VGD0"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD0"
FT                   /protein_id="CBL43872.1"
FT                   /translation="MSEKTELSLSDRGLQRRTRFLDAATEVFLQCGYESASLQEIVSRA
FT                   GGSLTTLYRLFGNKEGLFQAVIDRRASWLLEQFDLPQMKGRDPQTVLNKVGNRFLETML
FT                   APEVLSLYRLLVVEAVRNPRLREIFLAVAPERSIRALADYLESEVQIGRLQLPDCATAA
FT                   TLFFSMVKGERHARSLMGEEIRLTEEQREQAVAEVVDLFLNGCRPRG"
FT   CDS_pept        complement(377624..378832)
FT                   /transl_table=11
FT                   /gene="fsr"
FT                   /locus_tag="HDN1F_02900"
FT                   /product="Fosmidomycin resistance protein"
FT                   /note="silverDB:HdN1F393"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43873"
FT                   /db_xref="GOA:E1VGD1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD1"
FT                   /protein_id="CBL43873.1"
FT                   /translation="MNPSASLATMEGTPAKPTFKILGAISTTHLINDMMQSVLLALYPV
FT                   LQGNFKLSFVQIGFITVAFQFSASLLQPIVGRYTDKQPRPYSLPFAMGFTMAGLVLLSV
FT                   AWSYPIVLLSAVLIGMGSSVFHPESSRVARMASGGQHGLAQSIFQVGGQMGTAIGPLLA
FT                   AAMIVPMGQPSVALVALAAFLGIVILLRVSRWYADNLISKSGKASLAARATGLATRQIR
FT                   IAMLLLLILMLSKFLYLTSLQSYLTFYLMHHFGVGVQTAQYCLFVLLAGAAVGTIIGGP
FT                   IGDRIGRKRIILGSILGVAPFTLALPFVGFHTTVALIFIIGLIISSAFPAIVVYGQELV
FT                   PGKTGAISGLFFGLAFGIAGIGAAALGMVADRWSVELVYHICAYLPLLGVVAFLLPDMR
FT                   KTR"
FT   CDS_pept        complement(378897..380255)
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="HDN1F_02910"
FT                   /product="Magnesium transporter"
FT                   /note="silverDB:HdN1F394"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43874"
FT                   /db_xref="GOA:E1VGD2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD2"
FT                   /protein_id="CBL43874.1"
FT                   /translation="MSELDEELVNTVTELIQNNRITSATDRLKSLHPSDIADIITQLPA
FT                   SQSWRVLERLPERAEVFAYFEPEQQIRLATELPRLSLARLMNEMSADERTDLFKRFSRG
FT                   VRESLLQALALDEQEDIRILASHMEGTAGAIMTTELVILRKAMTVARAMAMLRKEAPEA
FT                   ETIYHAYVVDLNRKLIGVVSLRELLIADPEARIADLMISEVVSAKVTDKQEEIARTIAR
FT                   YDLLALPITDDEGTLLGIVTYDDAMDVVNEEVEDDFHKSAGMGTVTGSFKEASIYLLYR
FT                   KRVFWLVFLVFGNLFSSAGIAHFEDIIASNLVLVFFLPLLVGSGGNAGSQSSTLMVRAI
FT                   ATGDVEVKDWLQLIGRETLVALALGGTMGAAVASLGYWRGGSEIAIVVCLSMVSIVLVG
FT                   CLVGLSLPFVLDRLGFDPAGASAPLVTSICDATGVVLYLFIASQLLVGVGAGT"
FT   CDS_pept        complement(380397..381308)
FT                   /transl_table=11
FT                   /gene="gst"
FT                   /locus_tag="HDN1F_02920"
FT                   /product="predicted glutathione S-transferase"
FT                   /note="silverDB:HdN1F396"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43875"
FT                   /db_xref="GOA:E1VGD3"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD3"
FT                   /protein_id="CBL43875.1"
FT                   /translation="MLCWLKISGIAPQFRPAQTLLPLERSMTSSYVPPRVWKWEPKNDN
FT                   QFASINRPTAGPRTEKTLPVGQNPLQLYSLATPNGQKITILLEELLALGISGAEYDAWL
FT                   IDIGAGDQFSSGFVEINPNSKIPALVDHSVQPPLAIFESGAILLYLAEKFGVFLPKDIA
FT                   ARTHCLSWLFWQVGSAPMLGGGFGHFYHYAAEKYQYPIDRFTMEAKRQLDVLDRQLACN
FT                   EYIAGRDYTIADMAIWPWYGGVVSNQVYGAAEFLEASGYQNLLRWQQQIAERPTVKRGR
FT                   LVNRKEGGIKERHSAADFQGLV"
FT   CDS_pept        381360..382127
FT                   /transl_table=11
FT                   /gene="yafJ"
FT                   /locus_tag="HDN1F_02930"
FT                   /product="Glutamine amidotransferases class-II"
FT                   /note="silverDB:HdN1F397"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43876"
FT                   /db_xref="GOA:E1VGD4"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD4"
FT                   /protein_id="CBL43876.1"
FT                   /translation="MCELLGMSANTPTDLCFSFTGLTQRGGKTGPHSDGWGVAFYDGRG
FT                   VRLFHDPQPSATSPVARLVQDYPIKSEIAICHIRQANVGAVTLANTHPFVRELWGRYWV
FT                   FAHNGQVHSFQPCSGLFEPVGSTDSEALFCDLLNELQANLMRDVPISELTAFLEQKARS
FT                   YAEQGVFNCLLSNGEWLFTYCATKLASITRRAPFGAAQLKDTEMIVDFRAVTTPNDVVS
FT                   LIATEPLTSDETWDVYQPGEWRLWQRGEVVARS"
FT   CDS_pept        382246..384615
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02940"
FT                   /product="sensor histidine kinase"
FT                   /note="silverDB:HdN1F398"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43877"
FT                   /db_xref="GOA:E1VGD5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD5"
FT                   /protein_id="CBL43877.1"
FT                   /translation="MLFFLWILSAHAAPEPAVRGLLEKQWALNEDVWFLADHDHSLTIE
FT                   KLLAPSASGVGAADAWQQDANKVTNFGYTKDVLWLKLDLNNSSKAALQRLLVFSYTMLD
FT                   KVEVYLVRQGDIVAQYRVGDHYPFFQRPIRNRLFVLPFSFEAQTEYHLFVRVQSTSSMQ
FT                   LSMTLWEPNSFYEDYSIGEIGLGFFFGALLIIAAYNFFLWFSVRDVSYIYYVLFVLSFS
FT                   GLVATLEGVGFQYLWQDWVWWANHCVVFFGCITLFFAGLFARRFLRLKIFNPRLDKLAV
FT                   GYLCVVIVVAAIVPFVPYRVSVLLLIFSSVVWSALSMTLGICNYRAGNASARFFILAWG
FT                   FLLLCNVFYAAGQVALIPRTALVGLALPIGEMVEVLLLSFALADRINILRSEKLAAQLH
FT                   VLDADRRSAETLRDANLKLQKALALAEEDHRKKDRFIMAISHELRTPLNAISASVGQLN
FT                   DAENETERLGLHRFIKYGAERLATQVENLIMLAETENRKIQPHFRVFFLDQLLRSVVRV
FT                   ADAYVFNKSVAFRIEKTGESYPVWRGDDYLLVRMLIPLVENACKYTDQGQVVFSVHQRS
FT                   DGIDFSISDTGIGIPEGFQEIIYESFTQLSEGYQRTHEGLGIGLTACKRIVEVLGAKIS
FT                   VESSPGKGSCFRVSVAMQPETNVVPMRTSELRGHVLIAEDNPVNAKVLDSLVKRFGLTT
FT                   SLAENGEVALELSRLESFDLILMDLQMPVMDGFTAVENMRSEGVRCPIIAVTANSDYEA
FT                   RMRSIESGMDDILAKPLNRDVLKEKLQVWLPETESL"
FT   CDS_pept        complement(384701..385099)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02950"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F399"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43878"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD6"
FT                   /protein_id="CBL43878.1"
FT                   /translation="MALRKEAAILKLLTASQNEGPLMLLQTSVLNEMAAYVRDVSALVR
FT                   QGYISFNNASDHFWIAQQADLILTQAATMNTEFIHEAACILAGFDDILTAECFSRRSDF
FT                   ERVKQGMDLLAGCYAEVLEARHETRQAA"
FT   CDS_pept        385207..385818
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02960"
FT                   /product="arylesterase"
FT                   /EC_number="3.1.1.2"
FT                   /note="silverDB:HdN1F400"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43879"
FT                   /db_xref="GOA:E1VGD7"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD7"
FT                   /protein_id="CBL43879.1"
FT                   /translation="MLAPVVQAVPAEDQKPFRVMVLGDSLSAAYGISPKQGWVTLLAER
FT                   LRQEAYSAEVVNAAISGNTTAAGRSRLAGALAEHQPNLVLLELGGNDGLQVLPLQAMRK
FT                   NLETMIDEIRESGADVVLLGIRIPPNYGQRYTHAFERVFKEVAEEKKTPFLPFLLEGVV
FT                   EHSGWMQDDGIHPTAAAQPAILENVWPVLKPLLPAGKKRE"
FT   CDS_pept        385832..386455
FT                   /transl_table=11
FT                   /gene="ligT"
FT                   /locus_tag="HDN1F_02970"
FT                   /product="predicted 2\'-5\' RNA ligase"
FT                   /note="silverDB:HdN1F401"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43880"
FT                   /db_xref="GOA:E1VGD8"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="InterPro:IPR014051"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD8"
FT                   /protein_id="CBL43880.1"
FT                   /translation="MRVPETCRPASNLVRCFLAVSAADMAIQSELASVLEIACTADELS
FT                   GLRRPPPDFLHLTLAFLGEQPLEKVGVLAEKMASFFEGVASFPIAFTRLASFPDAKSPI
FT                   LAALPELDPALLTLQNTSRALVESEAIVLETRPFRPHVTLARQRKRGAGKGVDDPIVWS
FT                   RGGLPGDTLREGTLWGKVSAVSLYRSEITPLGSHYSVIQRCELS"
FT   CDS_pept        complement(386452..387582)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02980"
FT                   /product="predicted acyl-CoA dehydrogenase"
FT                   /note="silverDB:HdN1F402"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43881"
FT                   /db_xref="GOA:E1VGD9"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGD9"
FT                   /protein_id="CBL43881.1"
FT                   /translation="MNFNYSEDQLTIRDAAERIFRDLCADDALRDLYRKEPPFHRELWQ
FT                   ALASAGLLAATLPAEFGGSEMGMTELGQVLELHGKSVAPIPLVETVVECAMPIAQFGGD
FT                   ALKKRVLPGVAGGEILLSFVRPYQGLRDREPLSVSKQGDSWKLNGASALVNYAPLANGF
FT                   LVTATSLEGEAWVGYCDANAAGIEVVAQRSTSAELAGHISFSNVEVSAENTLAFGEQAN
FT                   ELLEWQVQRIYTATAAQQVGVLAEGLRRAAEYTNERKQFGRSISSFQSVAQQAADAWMA
FT                   IEALRGVYWRALDDLENVGQAEISARVAKFWIAEAGHVAAHIFLHLHGGMGQDLDYPLH
FT                   RFFLWAKKNEIYRGGASTQAAALGALIAAHPERVAV"
FT   CDS_pept        complement(387684..388859)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_02990"
FT                   /product="acyl-CoA dehydrogenase family protein"
FT                   /EC_number="1.3.99.-"
FT                   /note="silverDB:HdN1F403"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43882"
FT                   /db_xref="GOA:E1VGE0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE0"
FT                   /protein_id="CBL43882.1"
FT                   /translation="METRYSPEQTALRKQLRDHFTQLMTPEKVAACMGKEGGPIFRGIV
FT                   EQLGRDGMLTLGWPKAYGGKELTAVEQLILFEEAWKTHTPFPLITLNSVAPSLMAFGSE
FT                   EQKKEFLPKIAAGKAIFAVGYSEPGSGTDLASLKTRADFDGTHWVINGTKVWTSAGHDC
FT                   DYIWLAARTSSEGKRPSDGITLFIVDAKDPGYTHAPIHTVAGVDTNVTYYDNVKVSPDR
FT                   VVGKVNGGWKAITSQLNHERITLAAMTVIARKQFGHILQLLAKPHANGQRYLDDPLVAS
FT                   RIGEIYARLESMEVLNLRNASLVDEHKVDVALASGGKVINTLEQIRVLRMLIELVGEDA
FT                   AVQHESADAIFDGHLEYDYRSAQIMTIGGGVLEVMRSMTASFGLGMPNTIV"
FT   CDS_pept        389263..390489
FT                   /transl_table=11
FT                   /gene="acrA"
FT                   /locus_tag="HDN1F_03000"
FT                   /product="probably acriflavine resistance protein A
FT                   precursor"
FT                   /note="silverDB:HdN1F405"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43883"
FT                   /db_xref="GOA:E1VGE1"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE1"
FT                   /protein_id="CBL43883.1"
FT                   /translation="MEGASRKTAFSALLLSLALAGCGQNAANSADASMPQHPMPKQEVV
FT                   VTTLQAEDVVLTRELPGRTVASLVAEVRPQVSGIVMQRQFTEGTKVEAGQALYQLADDS
FT                   YRADLNKAEAGLAAARVVLENARMTASRTARLLAINAISTQANDDAQAALQKAQADVRV
FT                   AEAAVDSAKVQLSYSRITSPITGFIGKSTVTQGALVTTAQTSALATVQQLDPIYVDLTQ
FT                   PSTEMLQFRKALASGTLEKMKSVPVTLVLEDGTPYEHTGKIAFNEMTVDPSTGSFSLRV
FT                   EVPNPERLLMPGMYVRGEFGMGVRPGAILVPQRALSRTPQGTASVLVVDATGSVSNRSV
FT                   SVSQTVGDKWLVESGLNAGDQVVIEGLQKIKPGDDVIVSESVTRTDASQLSQHNAPQGA
FT                   NSTSTPAAG"
FT   CDS_pept        390592..393717
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="HDN1F_03010"
FT                   /product="Acriflavine resistance protein B"
FT                   /note="silverDB:HdN1F406"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43884"
FT                   /db_xref="GOA:E1VGE2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE2"
FT                   /protein_id="CBL43884.1"
FT                   /translation="MARFFIDRPVFAWVIAIIIMLVGGLSIVQLAVERYPTIAPPSVTV
FT                   RATYPGASAKVVEDSVTQIIEQNMKGLDGLIYMSASSESTGSASITLTFSNETDPDTAQ
FT                   VQVQNKLQLAMPLLPQEVQRQGVNVSKARTGFLMVAGFVSKDGSMTRDDISDYVTANLV
FT                   DPLSRVAGVGNVQVFGGQYAMRIWLDPNKLDTYRLTPSDVAAAIQSQNQQVSLGQLGGT
FT                   PAIDGQQLNATITAQSRLQTPEQFRAVIVRSNLDGSALKLGDIARVELGAETYEFISRY
FT                   NSAPATGVAISLATGANALNTAAAVEERLDELQAFFPAGLEVVVPFDTTPFVKVSIEGV
FT                   VKTLFEAIVLVFLVMLLFLQNLRATIIPTLAVPVVLLGTFGVLAATGFSINMLTMFAMV
FT                   LAIGLLVDDAIVVVENVERIMRDEGLSPREATRKSMSQITGALVGIGLVLSAVFVPMAF
FT                   MSGSTGIIYRQFSITIVSAMALSVIVAIVFTPALCATLLKPIKAGEDHGTKGFFGWFNR
FT                   GFERASGAYQRGVNGIIRRSVRFMLLFFALCGLAVFLFTRVPGSFLPEEDQGILLAMIK
FT                   TPVGATQERTMESIKRVEEYFQQEEKENILSIFSVQGFSFGGSGQNNGIAFIKLRDWDE
FT                   RTSPDASAAAIAKRASDAMEKVLDAKIFVFSPPALPELGIASGFAFFLQDNANLGHAAL
FT                   TAARNQLLGMADKDPLLEGVRPNGQEDTPQLHLEVDVEKAAALGLSIADVNNTLATAWG
FT                   GKYIDDFIDRGRVKRVYLQAEAPFRMVPEDFGHWSVRNAKGEMVPVNSFTTARWEYGSP
FT                   RLERYNGVPAMEINGQGAEGISSGVAMAEIEKLVSQLPKGIGMEWTALSYQERSAGSQT
FT                   PMLYALSLLVVFLCLAALYESWTVPTAVLLVAPLGILGTIAAASLRGMERDVYFQVAML
FT                   TTVGLTSKNAILIVEFAKANFESGMELLEATFAAVRDRLRPIIMTSLAFGLGVLPLAIA
FT                   TGAGSGAQVAIGTGVLGGMLVGTLLGIFFIPLFFVVVQRLFGRRNSASDQAE"
FT   CDS_pept        393728..394357
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03020"
FT                   /product="Transcriptional regulator"
FT                   /note="silverDB:HdN1F407"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43885"
FT                   /db_xref="GOA:E1VGE3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE3"
FT                   /protein_id="CBL43885.1"
FT                   /translation="MEQMTKTTNSTPKISERAQAQRERILSAAQICFVDRGFHAASMAA
FT                   IAETAGMSQGLIYRYFAGKDEIILAIIARELTDSRNDIASLQTGNQLAARIEELFSNWL
FT                   AAREDTMNARLFLELTSEASRAPKILEAVKNSDLQAREDLGELFRRASQEHGRQLSEGE
FT                   LCWRAFSLQVFVEGLVVRALREPEVDPQLLTQSLQAFLPIWLGRSG"
FT   CDS_pept        complement(394362..395642)
FT                   /transl_table=11
FT                   /gene="hemL"
FT                   /locus_tag="HDN1F_03030"
FT                   /product="Glutamate-1-semialdehyde 2,1-aminomutase"
FT                   /EC_number="5.4.3.8"
FT                   /note="silverDB:HdN1F408"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43886"
FT                   /db_xref="GOA:E1VGE4"
FT                   /db_xref="InterPro:IPR004639"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE4"
FT                   /protein_id="CBL43886.1"
FT                   /translation="MSRSESLFKKACHRIPGGVNSPVRAFRGVGGAPLFFKQAEGAYLI
FT                   DEDDRRYIDYVGSWGPMIAGHCHPEIVAAVQQAAAQGLSFGAPTAIEVEMAERVCSLMP
FT                   SIESVRMVSSGTEATMSAIRLARGFTGRDNIVKFEGCYHGHADSLLVKAGSGALTLGVP
FT                   SSPGVPASVAEYTLTLRYNDLDSVREAFATQGDKIAAIIVEPVAGNMNCVAPLPGFLHG
FT                   LREVCDQYGALLIFDEVMTGFRVALGGAQARFGVVPDLTTLGKVIGGGMPVGAFGGRSD
FT                   VMRKIAPEGPVYQAGTLSGNPVAMAAGLKMLSLISAEGFHQRLEASAYQLMEGFAAEAG
FT                   KAGIPLATTVVGGMFGFFFTDLPRVDYFEQVMTCDVERFKRFYHLMLDEGVYLAPSAFE
FT                   AGFVSSAHTEALIEASVAAAGRCFAKL"
FT   CDS_pept        395773..397641
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03040"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F409"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43887"
FT                   /db_xref="GOA:E1VGE5"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE5"
FT                   /protein_id="CBL43887.1"
FT                   /translation="MALERKAAVERKTAVERSATVEKGTHLFKELQFQAPMVSYSPLGR
FT                   VLSATVFPWLIAGISMLFALWVQWGVVSGLSVPVEEDLYRDAGSAQAFLNGIDAHDPQF
FT                   AGEVRWYNPAAPFLVSLISRFTGIGVLDLYTYSGPFLNLLGPIFLMAWVSRAFSPWAGC
FT                   FSVIAYLFLGSHGLKVWVSPSYSPWLWPFNFGQGLAFAALWVLQMAQDSKRIWGHVLSG
FT                   TLMGVLFLVHLAPAAIIASALLLLAAYRLASRTWTLHQALRVLLINGVCSLGFAMIMIA
FT                   PLIAAYDLETLNPAPANFAGASIGDILAAWSNPKYLIALPALLWLFWRACYDLFAVVRR
FT                   SRQTERPLQMGSSLLTERSSYLLLLAVSLASAVWFSYGIIADILRDRGIAQLPVLVPAF
FT                   HFNLYWLICLNVAFGVAIAHLVRVVQFSKQAQPWSASVLAIVLIACAQPSYRHSADFEG
FT                   MTQMGRNIEQRTELKSLYLWCLQNSSQQDVFLADDDYGQYAIGAAARKVLALDPIFSSP
FT                   YVGLEPHTRDRRQLYEWLAEGRWQDFDALATRYNVHYVIASPRLRFGLYGTTPIAFSFA
FT                   GEPPGGALRSWPDTVGSLQKVVELGEIAVYHHTPKRFVPSQPASKS"
FT   CDS_pept        397947..399185
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03050"
FT                   /product="HlyD family secretion protein"
FT                   /note="silverDB:HdN1F410"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43888"
FT                   /db_xref="GOA:E1VGE6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE6"
FT                   /protein_id="CBL43888.1"
FT                   /translation="MFSTAFRPLPIRAIFLIGFAATLSACDGKQSVAAQTPATMPPMPV
FT                   EVVTVTSSTRHRTVNMPTRLQAIRTAEVRARVDGILEERVYREGSQVHAGDVLFRINPE
FT                   ELAANAAVAQATVAEREADAKVAAQTLERMRSLLKSNAISSQQYDEAVARQAQAEAGVS
FT                   AAKAALRRSEIDLKYATVRAPISGHAGRALVTEGVLVSKVEATPLTTIEQTNPIQANFS
FT                   QASADYLRFRKQMFGDFGSPNSDAAASQEALVELILEDGSVYPHKGRLLWAEVGIDSNT
FT                   GSVLMRAEFPNPDGALLPGQFAGIRLPFAAAETSLTVPQRAVMAAATGQFVYRVNQEHK
FT                   VEVAPIAVGGLAGNDWLILSGLSEGDQVIINGLQKVRPGATVNPIVAEPQQQQSEQGAP
FT                   KDQAAQTATKQGH"
FT   CDS_pept        399189..402332
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03060"
FT                   /product="Hydrophobe/amphiphile efflux-1 HAE1 precursor"
FT                   /note="silverDB:HdN1F411"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43889"
FT                   /db_xref="GOA:E1VGE7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE7"
FT                   /protein_id="CBL43889.1"
FT                   /translation="MLPQFFISRPIFAWVIALAIVLGGALSIRYLPVEQYPEVAPPTII
FT                   ITATYPGASAQVLEETVTNLIEQEMNGIDHLLYMESTSDSNGILNTLLTFRSGTSLDLS
FT                   SVEVQNRIKRVEARLPEEVRRQGITVAKYRRNFMLILAFFSPDKSLDGTAIGSFVASNV
FT                   LDNIRRVRGVGEAMLLGTEYSMRIWLNTYKLAEFNLSPAEVLRIVRAQNVQLATGELGA
FT                   LPSRPGQEIAATVLTQGRLKTPEEFGNIIIRANPDGATVYLKDIARIELGPQDYLLRTR
FT                   YNGQPATALGIKLAPGENALDTSRRVHERLTELGEGFPASIGWVIPYDTSRFVEISIRE
FT                   VIKTLTEAFILVFLVMWLFLGSFRTAMIPALVVPVSLFGTLCGLYLLGYSINVLTLFAM
FT                   VLAIGVVVDDAIVVVENVERIMREEKLAPLPATRKAMKQVIGAIIGITVILCSVFLPMA
FT                   FFGGSVGAIYQQFSVTLVLTMGFSALMAMTLSPALCATLLRPHQDHRGFLAWFNDRFTG
FT                   FNHRYGHWMQWMVVRPARFLVVYLAIAAIAIVLFLRLPSGFLPDEDQGYLISVVQMPAG
FT                   ATQERTLKVLGQLEQYFLQQEEVGGIVSIAGFSFLGRGQDAAIAFTRLKSWDERKDPNQ
FT                   HALSVMQRANRALFGIKQAFMFVVNPPPIPELAALGGFDFRMVDEGVVGRDKLNEARGI
FT                   ALALAAKDPRLAGVRFEGKESGTQMMLDIDRLRAQTLGIDIGDLNDTLSISLGSAYVND
FT                   FYREGRALRVNLQLDPESRATPEDILAIRVKTRNGTLVPLSEIAQMRWIVGSPRLDRYN
FT                   GMPVMKLAGNPSPGHSTGEAMQAMEEIATHLPPGIGFEWSSTSMEEKLAAAQTPLLFTF
FT                   SILAVFMCLAALYESWSVPFAVLLMVPMGLFGAVLAVVFREMPNDVYFKVGIVTIIGLS
FT                   AKNSILIVEFARQLEEAGHSALEAAVEAAKLRLRPIIMTSFAFVFGVMPLVFSTGAGAS
FT                   SRHAIGTGVMGGMIAATVLAVLLVPVLYVVIRKLFPGGLGHHEEESGTQASENPEQGV"
FT   CDS_pept        complement(402445..403092)
FT                   /transl_table=11
FT                   /gene="dedA"
FT                   /locus_tag="HDN1F_03070"
FT                   /product="Uncharacterized membrane-associated protein"
FT                   /note="silverDB:HdN1F412"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43890"
FT                   /db_xref="GOA:E1VGE8"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE8"
FT                   /protein_id="CBL43890.1"
FT                   /translation="MPIIDFILHIDHHLLELAQTYGVWLYGILFVIVFCETGLVVTPFL
FT                   PGDSLLFAAGALAAGGAFDPLLMGGLIVLAAFLGDNVNYWLGRTIGPKVFSSPDSKLFN
FT                   RKYLEKTEAFYHQYGARAIIMARFLPIFRTFIPFVAGVGRMPYGHYIGYSFVASALWVP
FT                   GFLGAGYFFGNIPVVKENFVVMVMGIVVISALPAIIAVIRHQIAKRRDSASN"
FT   CDS_pept        complement(403200..403751)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03080"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F413"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43891"
FT                   /db_xref="InterPro:IPR010835"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGE9"
FT                   /protein_id="CBL43891.1"
FT                   /translation="MLLVWLAIFTSGCATLATYEVNEAELEGYLQKAVVDFDRKQLEAG
FT                   SPFSVSLKDAKIKVGPDNRDVVQLDVAGEAAFNAVITKIPLNLALKIEGTPIYSGKDKA
FT                   VYIKRLRLIDSNFNSSLLRGSFGAEIQPVAKAIVAALGSVLEEMPVYRLDESDPRQRLL
FT                   ANMPVDVVVGQGVLRIVPRK"
FT   CDS_pept        complement(403808..404434)
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="HDN1F_03090"
FT                   /product="Thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="silverDB:HdN1F414"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43892"
FT                   /db_xref="GOA:E1VGF0"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF0"
FT                   /protein_id="CBL43892.1"
FT                   /translation="MRGLYVITDPILTPPDLLEKKVRAALLGGAAIVQYRNKDAGAKAR
FT                   RLQEAQSLRALTDEYGALLIINDDTELALACNADGVHVGLEDTPIALARAQLGLQRIVG
FT                   ATCHGDTQLALRAIEEGADYVAFGRFFGSNTKPDAPPAALDAIRPALSRLTRPAVAIGG
FT                   IRLENAQPLVNAGFAMLAVVGDVFSHDSAEITLHCAAYARLFQNK"
FT   CDS_pept        complement(404479..405321)
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="HDN1F_03100"
FT                   /product="Hydroxymethylpyrimidine kinase"
FT                   /note="silverDB:HdN1F415"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43893"
FT                   /db_xref="GOA:E1VGF1"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF1"
FT                   /protein_id="CBL43893.1"
FT                   /translation="MATSSTPPYVLVIAGHDPSAGAGIHADMEAIRSMGCGVATVITAL
FT                   TVQDTRNVSGFEVTPSRLLVQQAEAVLNDLPIAAIKIGMIGSEENVHAIASLLRKWSAL
FT                   PVVLDPVLVAGGGGALARGNMARSIREHLFPLATLITPNLPEVRELYESGPASAGDLPS
FT                   IGSMLSSQTRGYLLITGGHGDESEVHNTLWQNSECVATERWPRLEGEYHGSGCTLAAAC
FT                   SGLIARGLSVPEAVSGAQEYTWQTLKNATRPGHGQFVPNRFFWWSQERFLTTSQVEKQ"
FT   CDS_pept        405532..405933
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03110"
FT                   /product="Thioesterase family protein"
FT                   /note="silverDB:HdN1F416"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43894"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF2"
FT                   /protein_id="CBL43894.1"
FT                   /translation="MFSTSISPRFCDTDALGHINNTVLPVWFLEGREDILRIFNPSLKT
FT                   EDVSLVLAKIEIEYLGEIFFGREVEIRTFVLRIGTSSILVGQEAWQDQQLRSTATATMV
FT                   NFDKHTRKSIPIPAEIRKRLAPYLLEAEG"
FT   CDS_pept        406171..407637
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03120"
FT                   /product="probable patatin family protein"
FT                   /note="silverDB:HdN1F417"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43895"
FT                   /db_xref="GOA:E1VGF3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021771"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF3"
FT                   /protein_id="CBL43895.1"
FT                   /translation="MKRALKACLAAMERAENYHAWSEAAKEYDRISGNDDWKEDDASPH
FT                   YDYKMIRLRLNELRAARERGDIQQTVFYINEGLHGNLGRIANLALYERCFFGTKTLIKD
FT                   YLDEVCAAIRWLADVEQPSFTYDRKLDFFERTTTAFGQSALMLSGGAALGLFHMGALKA
FT                   MWEEGLLPKVISGSSAGSIMAAVLATHTDDELDSIFDPEYLYVEAFRTVGWRGTLKGQG
FT                   ILDPAQLELCLERNVKDMTFEEAFRLSGRQINITVSPADPHQESRLLNALTSPHVLIRK
FT                   ASLASCAIPYVYPPVMLWAKNMRGEKVPYIPSRQWVDGSIKNDLPFLRLARLYGVNHTI
FT                   VSQTNPHIVPFLARREREKTFSTYLMDMLTSNVRYDVAQVLDYAKHRVASRGVALLFDK
FT                   AQSIVSQRYVGDINIVPPRQPGNVFRIISNASPADVAEFIRSGEETTWPRIELIRNTTC
FT                   VSRTIASCYETLKQQGPRELVVIPDQRNTA"
FT   CDS_pept        complement(408089..408325)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03130"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F418"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43896"
FT                   /db_xref="InterPro:IPR025427"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF4"
FT                   /protein_id="CBL43896.1"
FT                   /translation="MPTVLRIGGYRFFFYSNENGEPCHIHVQRERMAAKFWLRPVSLAS
FT                   STGFAAHELRKLISLVEEHKQTFEEAWDEFFSN"
FT   CDS_pept        complement(408358..408816)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03140"
FT                   /product="protein of unknown function DUF589"
FT                   /note="silverDB:HdN1F419"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43897"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF5"
FT                   /protein_id="CBL43897.1"
FT                   /translation="MAYWVFKTEPNVFSIDDLKARDKQGEIWDGVRNYQARNMLRDDTR
FT                   VGDLVFVYHSNCKIPGIYGIGRIIETKVVDPTQFLPESHYFDLKSSPDAPRWFTVKLAY
FT                   ERHLERPITLTELKDHPELQEMQLVKRGNRLSILPVSNAQWAIMSRLL"
FT   CDS_pept        409048..409329
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03150"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F420"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43898"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF6"
FT                   /protein_id="CBL43898.1"
FT                   /translation="MFLQSPSRVLRSPPVASILRLVTVYGSQTYCCQQKFAVINNVLPE
FT                   KRRSCCREERRIQRWVPAMYDRITVCSQCLLQKSSLCRLSLLISSRRY"
FT   CDS_pept        409474..409908
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03160"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F421"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43899"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF7"
FT                   /protein_id="CBL43899.1"
FT                   /translation="MLQELKPEINFCSCGCEARLVKENTSSGKRRKPKYFVACLDEVCG
FT                   KRGKVSSFPWQAILEWNAGEESEFPDDFPVPFVNAFGLTNDETRQLLARKRNHCEEQIQ
FT                   KLKGANNNGASAQEKLKSLHLQLDWLRYGQTWLDCRTARL"
FT   tRNA            complement(410016..410092)
FT                   /gene="tRNA-Pro"
FT                   /product="transfer RNA-Pro"
FT                   /note="tRNAscan-SE-score 84.12"
FT   CDS_pept        410485..410796
FT                   /transl_table=11
FT                   /gene="rplU"
FT                   /locus_tag="HDN1F_03170"
FT                   /product="50S ribosomal protein L21"
FT                   /note="silverDB:HdN1F422"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43900"
FT                   /db_xref="GOA:E1VGF8"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR018258"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF8"
FT                   /protein_id="CBL43900.1"
FT                   /translation="MYAVIQSGGKQYRVAEGALLKLELIEAEPGSTIEFDKVLMVANGE
FT                   SVQVGAPLVAGSKVSAEVVGHGRHDKVKIVKFRRRKHHRKQMGHRQWYTQVKITGISA"
FT   CDS_pept        410823..411083
FT                   /transl_table=11
FT                   /gene="rpmA"
FT                   /locus_tag="HDN1F_03180"
FT                   /product="50S ribosomal protein L27"
FT                   /note="silverDB:HdN1F423"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43901"
FT                   /db_xref="GOA:E1VGF9"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGF9"
FT                   /protein_id="CBL43901.1"
FT                   /translation="MAHKKAAGSSRNGRDSESKRLGVKRYGGQVIKAGNIIVRQRGTEF
FT                   HPGANVGMGRDHTLFAKVEGEVRFDVKGPFNRRIVSIVPAA"
FT   CDS_pept        411101..411268
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03190"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F424"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43902"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG0"
FT                   /protein_id="CBL43902.1"
FT                   /translation="MASKNPTLVGFLCIWAADPVNETLYNGQDERCKVGGRIGCKRKPW
FT                   VVASNLSSGW"
FT   CDS_pept        411357..412544
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03200"
FT                   /product="GTP-binding protein Obg"
FT                   /note="silverDB:HdN1F425"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43903"
FT                   /db_xref="GOA:E1VGG1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG1"
FT                   /protein_id="CBL43903.1"
FT                   /translation="MKFVDEAKISVEAGDGGNGCLSFRREKFIPLGGPDGGNGGAGGSV
FT                   YIETDVNLNTLVDYRFTRMYRAQRGDGGAGANCTGASGDDIVLRVPVGTTIIDEDTEEV
FT                   LGDLAEAGQQLLVARGGRGGLGNSCFKSSRNRAPRKTTPGTPGEKRNLRLELKVLADVG
FT                   LLGMPNAGKSSLIRAVSAAKPKVADYPFTTLVPNLGVVKVDKMRSFVMADIPGLIEGAA
FT                   EGAGLGVRFLKHLARTRLLLHVVDIAPWDGSDPAENVARIAVELERFSLALSERERWLV
FT                   LNKIDLLPEEEANARCEAIIEALGWQGPVFRISASERIGTERLAQNIMVHIEALNQRMA
FT                   EDPEFAEREHAARSRLEEEAREKVRELAARRREARGRDFDDDDDDDHDVEVIYAH"
FT   CDS_pept        412549..413694
FT                   /transl_table=11
FT                   /gene="proB"
FT                   /locus_tag="HDN1F_03210"
FT                   /product="Glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="silverDB:HdN1F427"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43904"
FT                   /db_xref="GOA:E1VGG2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG2"
FT                   /protein_id="CBL43904.1"
FT                   /translation="MTKKSVVQRSDLGACRRWVVKIGSALLTDNGRGLDRAAINGWVEQ
FT                   IAWLRAQGVEVVLVSSGAVAEGMCRLGWKTRPHAVHELQAAAAVGQMGLVQTWESLFQQ
FT                   HQLQTAQILVTHDDLSNRKRYLNSRSTLLTLLSFGIIPVVNENDTVVTDEIRFGDNDTL
FT                   GALVANLVEADLLVILTDQLGMFDKDPREYADARLLEMGHAGDPALMEMASGKSGSLGR
FT                   GGMATKVRAARLAARSGAPTLIVGGKQPDVIRRAFQGDSLGTLLLADLAPLTARKQWLA
FT                   GHLQMRGTVQLDEGAVRALREKGVSLLPVGVSGVTGDYSRGEMVLCVGPDGERVARGLT
FT                   NYSAEETRKILRASTDSITARLGYVYEPELMHRDNMVIFPG"
FT   CDS_pept        complement(413856..414122)
FT                   /transl_table=11
FT                   /gene="rpsT"
FT                   /locus_tag="HDN1F_03220"
FT                   /product="30S ribosomal protein S20"
FT                   /note="silverDB:HdN1F428"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43905"
FT                   /db_xref="GOA:E1VGG3"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG3"
FT                   /protein_id="CBL43905.1"
FT                   /translation="MANTKQAKKRARQSEKRRRHNIGLRSVVRTYIKKVIAAIRAGDKP
FT                   AAQEAFKEAQPVIDRIASKGIIHKNKAARHKSRLNARIKAMAA"
FT   CDS_pept        414454..415404
FT                   /transl_table=11
FT                   /gene="ribF"
FT                   /locus_tag="HDN1F_03230"
FT                   /product="Riboflavin kinase / FAD synthetase"
FT                   /note="silverDB:HdN1F429"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43906"
FT                   /db_xref="GOA:E1VGG4"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG4"
FT                   /protein_id="CBL43906.1"
FT                   /translation="MEIIRGLHNLGPQPHSTQACVATVGNFDGVHLGHAAIIQQLKEHG
FT                   ARLGVPSCVMVFEPQPREFFAPQTAPARLTTLREKAEILAEMGVDQLLCVRFDRKFCAL
FT                   SAAEFCERVLVGGLGVQHLVVGDDFRFGHDRVGDFHFLEQAGATFGFGVEATRTFALEG
FT                   ERVSSTRIREALAAGDFAAAQHLLGRPFGFSGRVAHGDKLGRTLGVPTANLWPNRLKSP
FT                   LHGVYAVWADLGDGARRPAVASIGARPTVGGTRWRLETHLLDFQGDLYGRRMRVEFITR
FT                   IRDEKKFSGLEELKANIDNDIQIAREIFSGISAAC"
FT   CDS_pept        415499..418312
FT                   /transl_table=11
FT                   /gene="ileS"
FT                   /locus_tag="HDN1F_03240"
FT                   /product="Isoleucyl-tRNA synthetase"
FT                   /note="silverDB:HdN1F431"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43907"
FT                   /db_xref="GOA:E1VGG5"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010663"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG5"
FT                   /protein_id="CBL43907.1"
FT                   /translation="MADYKHTLNLPETSFSMKANLPQREPEMLSHWDKIDLYSAMSQVG
FT                   EGRPLFVLHDGPPYANGDIHIGHAVNKILKDVILKSRRLSGYNAPYVPGWDCHGLPIEH
FT                   NVEKKFGKAGVKLPVAEFRQKCREYAMKQVEGQRKDFIRLGVAGDWQRPYLTMDYKVEA
FT                   NIVRALGRIIANGHLVKGFKPVYWSVVGGSALAEAEVEYQDKTSTQVDVRFAFASPALL
FT                   VERCGIQLSDSEKVSVVIWTTTPWTLPANQAVALGAELEYSLVRVQSSQGNEVLLLASD
FT                   LLNTALARYEVSKSEVLGVVAGKALEGLQLQHPFYDRIVPIILGDHVTTEAGTGAVHTA
FT                   PDHGLDDFFVGQRYGLGTLNYVGADGSYSAATPLFAGDHVYKVEDKILAALREHGALLH
FT                   EAKLRHSYPHCWRTKTPLIFRATPQWFISMQEKGLLEQCRREVEKVEWLPDWGKNRMDA
FT                   MLDSSPDWCVSRQRTWGVPITLFVHKETQALHPQTAALIENVAKRIEEEGIDAWYQLDA
FT                   SELIGAAAPDYEKVMDTLDVWFDSGVTHSTVLEQRDHLRVPADLYLEGSDQHRGWFQSS
FT                   LKTAVAMRGEAPYKAVLTHGFTVDQQGKKMSKSLGNVVSPQDVAKALGADVIRLWVAAT
FT                   DYRAEMTVSDEILKRTADSYRRIRNTARFLLANLNGFDPKEHLIATEDMVALDQWVVHR
FT                   AAELQEEIVAHYAQYQLHAIYQKVHNFCSVDLGGFYLDVIKDRQYTARRGGHAHRSVQS
FT                   AIYHVAEALVRWIAPILSFTADEIWAFMPGERSASVHLETWYLPLTTLPADLLMNAEYW
FT                   ENVLAVRDAVNKQLEAARAAGLIKGSLQAEVDLYCGDELRQLLNRLQDELRFVLITSAA
FT                   RVHAISEVGKNTELGDLRVQISATEHAKCARCWHHRSDVGQHAGNEDLCGRCIDNVDGV
FT                   GETRRFA"
FT   CDS_pept        418423..418971
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="HDN1F_03250"
FT                   /product="Lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /note="silverDB:HdN1F432"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43908"
FT                   /db_xref="GOA:E1VGG6"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG6"
FT                   /protein_id="CBL43908.1"
FT                   /translation="MASRRPPVGKATSQDTLAESTKSPLVWLWLSGLVILLDQITKLAI
FT                   TELYAYGDSTSVWSFFNIVRAHNYGAAFSFLAGESGWQRWFFAAIAVGVSVMLVQWLRK
FT                   LPRDDWFMAVALSLVLGGALGNLIDRIVLGYVVDFLDFFWSGYHFPAFNIADSAITVGA
FT                   CMLGLDILRQTRKKPEGKS"
FT   CDS_pept        418968..419435
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03260"
FT                   /product="Peptidylprolyl isomerase, FKBP-type"
FT                   /note="silverDB:HdN1F433"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43909"
FT                   /db_xref="GOA:E1VGG7"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG7"
FT                   /protein_id="CBL43909.1"
FT                   /translation="MNDETMRVGPGTRVTLHFSVSLADGQLLDTTKNGKPAEFTFGDGN
FT                   LINGFESGLLGLKAGDHRSLFLTAEKAFGARSEENIQHFSRSQFSNMDLEPGLMVSFSD
FT                   KRSSELPGVVTEFNDDTVVVDFNHPLAGRDLNYEVEIINVVDASSAKVRLA"
FT   CDS_pept        419485..420423
FT                   /transl_table=11
FT                   /gene="ispH"
FT                   /locus_tag="HDN1F_03270"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /EC_number="1.17.1.2"
FT                   /note="silverDB:HdN1F434"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43910"
FT                   /db_xref="GOA:E1VGG8"
FT                   /db_xref="InterPro:IPR003451"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG8"
FT                   /protein_id="CBL43910.1"
FT                   /translation="MTIGIKMANPRGFCAGVDRAIAIVNRALEVFGAPIYVRHEVVHNR
FT                   FVVDDLRARGAVFVEELDQVPDGATVIFSAHGVSKAVQAEAQRRKLKVFDATCPLVTKV
FT                   HIEVARYAREGRECVLIGHAGHPEVEGTTGQYDRNFGGDIYLIEKLDDVDTVHPRNPEK
FT                   LAYITQTTLSVDDTIAIIAALRKRFPKIIGPRKDDICYATQNRQDAVKTLALENEVVFV
FT                   VGSPNSSNSNRLRELAERCGARAYLVDSTEQMQKNWIEGVSNVGVTAGASAPEELVAQV
FT                   VAQLRNWGCDVPMELVGCEEDMVFSMPKELR"
FT   CDS_pept        420470..420901
FT                   /transl_table=11
FT                   /gene="pilE1"
FT                   /locus_tag="HDN1F_03280"
FT                   /product="Type IV fimbrial biogenesis protein"
FT                   /note="silverDB:HdN1F435"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43911"
FT                   /db_xref="GOA:E1VGG9"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGG9"
FT                   /protein_id="CBL43911.1"
FT                   /translation="MRIAYYPKRERAFSLRGFTLIELIVALAIISILSALVYPSYQQYV
FT                   RKARRVDAAVKVLALAQQLERIFLQSLSYAEGANVKAEAAGYLISTAISANGASYVIYA
FT                   KPKSTSDQSRDPCGTLVYEQTGRWQFVDGSQTVGCLVLE"
FT   CDS_pept        420950..421492
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03290"
FT                   /product="Probable pilin protein, similar to PilV"
FT                   /note="silverDB:HdN1F436"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43912"
FT                   /db_xref="GOA:E1VGH0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH0"
FT                   /protein_id="CBL43912.1"
FT                   /translation="MKHQISRSYQWQTGYSLIEILISMLILGIGLLGLFSVSLASVQSH
FT                   QDTSNQLIAGHLAQDLVERIYSNPDAWPNGYQGSEGASASPCTLRSPCFGAEQMAAADL
FT                   ADVRRAIQKQLPRGSLAVLEHCGESAALSCVLIAWNAVPATLDGCSSALANQDELAPSV
FT                   GGIARASCVVQQFWMSH"
FT   CDS_pept        421492..422283
FT                   /transl_table=11
FT                   /gene="pilW1"
FT                   /locus_tag="HDN1F_03300"
FT                   /product="probable Tfp pilus assembly protein PilW"
FT                   /note="silverDB:HdN1F437"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43913"
FT                   /db_xref="GOA:E1VGH1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH1"
FT                   /protein_id="CBL43913.1"
FT                   /translation="MQTCSFNDGYLYKLYGGKTFNWMRGLTLVELMIGLLLSSMLVVAI
FT                   FQLLLSVRGLSAQAQASASLVARASYVSTYLMSHLVEAGYAPVSEPRPYPVGVEGAFAG
FT                   MDHPLYDQIVLLSHGGRGCTDLALNSGEALSWRRFSVGQSNGRSELRCTDSEGGPYPVL
FT                   EGVDALQVQYGVDANRDGSPDYYTNFLNLPKGAPIVALRVGLLLRSDVPARYGLLNPQV
FT                   GVGALDLLDQQLPTVGASRIDQADGYLRKAQVITVALRNLM"
FT   CDS_pept        422283..422828
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03310"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F438"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43914"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH2"
FT                   /protein_id="CBL43914.1"
FT                   /translation="MTKVPQSGSTLVITLIALLILSLACLSMLQSGIFSQRIVAGGYYG
FT                   LSTFNAAESALRASVASLSVNAELRARLESGEIVQTCLSRSGLHVGGCGVDGFPAISAT
FT                   TGRATSQQHQGEFFANVETRYLGSKPADGFSQDLVLQKQYQSVVSVASKQAQSSFNANL
FT                   QHEQIWQLLVLGDGSVPE"
FT   CDS_pept        422885..424621
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="HDN1F_03320"
FT                   /product="probable Tfp pilus assembly protein,
FT                   tip-associated adhesin PilY1"
FT                   /note="silverDB:HdN1F439"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43915"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH3"
FT                   /protein_id="CBL43915.1"
FT                   /translation="MTMKRILQRGLVVATLGIIAPNGVSAASEYDALCLTPPQNMAPRT
FT                   NEASIDRTGFGSAATVRYSGQGHEPFVVEWSGGSDGFLRGIESDSGRTVAKVPLSGQRP
FT                   STTELASEAMARAVLWPDSHWMALQSDVNKDGVIQRADGDWAYLFGGMRRAGRSVFGFD
FT                   ISNPVSPDLLFELTGATNPEYEQLAQTWSGPSVVRLRLQSRGAAEPVLVFGGGYDGRYD
FT                   LPSTQDNVEGRTGHCVAETDRCGAAIYFVKASGSDAGKLLWTITGDGALDQEERRGERR
FT                   GDPIDRFSAVPALRSPIVAGVKSVDLNSDGIADALYAIDVDGRVFRITPASQSRALDVA
FT                   LIAELGNIAQESSSDTGWDTRFFFDPSVAVLPLPMGKKAVILAVGSGTIVQPFQRSQKG
FT                   ILYLLRDDPALEVQRPVTPASDGAQWLRQGLANFDAKARLTIVPLELRGEKLFAPPLVV
FT                   DYKAFFKTWAPRQSDSKMESETSSSGDGCSGISRIWGIDLLSGRPVFDASGSIDAVGAS
FT                   AYAVQSEAQAFARLDLVAQSCGKHGRTCFSLSDGLHQYSFPPSLTAPHKMRWRQLPSAT
FT                   AF"
FT   CDS_pept        complement(424639..425154)
FT                   /transl_table=11
FT                   /gene="fimT1"
FT                   /locus_tag="HDN1F_03330"
FT                   /product="Pre-pilin like leader sequence"
FT                   /note="silverDB:HdN1F441"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43916"
FT                   /db_xref="GOA:E1VGH4"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH4"
FT                   /protein_id="CBL43916.1"
FT                   /translation="MKRASAFTLTELLIVVAIISILSVIATPNLGKMLARQKQESLQQR
FT                   FVDISSLARLAAIQNVSASVICGSSDGQQCNQEKVWTGRVLAFLDRDGDHQWSEGDQLL
FT                   HQTLLGDGQISGTRSRIEFNQSGAGYMGSWLYCPYLHQNDRNGFRLILSLGGRLRTELA
FT                   SNACATRA"
FT   CDS_pept        425288..426382
FT                   /transl_table=11
FT                   /gene="dadA"
FT                   /locus_tag="HDN1F_03340"
FT                   /product="Putative D-amino acid oxidase"
FT                   /note="silverDB:HdN1F442"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43917"
FT                   /db_xref="GOA:E1VGH5"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR012727"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH5"
FT                   /protein_id="CBL43917.1"
FT                   /translation="MHALVVGGGVIGMMTARNLVQAGCSVRLFDQAAAGSEASWAGGGI
FT                   MSPLYPWRYPAPVNQLASWSQQHYPSLAAKLVEETGIDPELRTYGMLMLGGNDSESAIQ
FT                   WASANNAQIQEYDEQALRSLLPPYLDVSEQALWMPEIRGIRSPRLLKALLVALQASPLF
FT                   ELHTNETVLRLEETDGRVQRVITSKECYCADAIIICAGAWSAALLEPFGYRLPIKPVRG
FT                   QMLAIQAPAGWLPHILMKNGAYLIPREDGLILAGSTLEFVGFNKALTETAKSFLLQRAY
FT                   GMLPALKEFPVVHHWAGLRPSSPNGIPYIGPIQGLSGVYINAGHYRNGLVMAPASGRLI
FT                   ADIVLGRSPMMDATPFLPCRELVS"
FT   CDS_pept        complement(426392..427783)
FT                   /transl_table=11
FT                   /gene="pilR"
FT                   /locus_tag="HDN1F_03350"
FT                   /product="Response regulator, type IV fimbriae"
FT                   /note="silverDB:HdN1F443"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43918"
FT                   /db_xref="GOA:E1VGH6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH6"
FT                   /protein_id="CBL43918.1"
FT                   /translation="MTTPNALIVDDEPDIRELLQLTLSRMGIHCHTAATLSEAHTLLDT
FT                   GSFDFCITDMNLPDGSGIELITYVQQRFPMLPIAVLTAYGSMETAVFALKAGAFDFVSK
FT                   PVELQRLRDLVTSALKLSAPNKPKLEGNAAHSPIFGKSERINKLRQQIIKLARSQAPLY
FT                   ISGESGSGKELVARQIHLSGSRAEGPFVPVNCGAIPSELMESEFFGHKKGSFTGAYEDK
FT                   QGLFQAAKGGTLFLDEVADLPLAMQVKLLRVLQEKAVRPVGSMKEVATDVRILSATHKD
FT                   LGALVERGEFRQDLFYRINVIQVQVPSLRERQEDIAILADHFLAELAEEWQMTLPKLSP
FT                   AAIRALEGYSFPGNVRELENTLERAVTLCDSGTIQPEHLQLPENEAAGRTSIPPSSSST
FT                   EMLPNFSANGETLENYLVDIEKTAILKALDDTRWNRTAAAKKLGMSFRSLRYRLKKLGL
FT                   DTDED"
FT   CDS_pept        complement(427927..428508)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03360"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F445"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43919"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR014878"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH7"
FT                   /protein_id="CBL43919.1"
FT                   /translation="MTTMSNDEFDYGPLKALIGVWKGDQGMDIAPDQADGREENPYFET
FT                   ITFTPIGDVTNADRQTMTGLRYHQTVTRKSDNKVFHDECGYWLWEAATSTIIHSLQIPR
FT                   AVAVMAGGTWKPDPSTSAITLEVKAGINNKDWNIAQSPFMRDNAKTIAFKHKITVNGDK
FT                   LHYFESTIIDIYGSKFDHTDENTLSRVSDK"
FT   CDS_pept        complement(428600..430270)
FT                   /transl_table=11
FT                   /gene="pilS"
FT                   /locus_tag="HDN1F_03370"
FT                   /product="Sensor kinase, type IV fimbriae"
FT                   /EC_number="2.7.3.-"
FT                   /note="silverDB:HdN1F446"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43920"
FT                   /db_xref="GOA:E1VGH8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH8"
FT                   /protein_id="CBL43920.1"
FT                   /translation="MSTTWRDYPLTPNLQGTPNAIDASRHDWQLLRIYTIYRALLSASI
FT                   LAFLLTANIKSFNHFERIGLEARVYFWVAAAYFALCMFAGMIAYTKLGRAQVQAFIAFL
FT                   IDTAALTLLQSIQPANFIDLTLLQLVAVAAGSLILRGHMPYLLAAIASLSILASEVGLH
FT                   ILNNTLDSNDLMHAGLMGASMFATALFTRQLAVRLRESEALTEQQAENLASLEALNHHI
FT                   IQRMRTGILVVNAKNHIVMMNDSCWRLFNMPTFGEQPSLERFSVELRQQLDAWRNNDLL
FT                   RGRPFRTFPNGPEVLVNFTLLESSGAQGTSDILIFVDDNTRLVQQAQQLKLASLGGLTA
FT                   SIAHEIRNPLGAISHAAQLLAESKGLDEDDIRLTNIIQQHSLRMNRVIENVLQLSRRRP
FT                   TLPERADLCAWIHTLIDDYKATCSDPCEIILNRPDTPLWFFADRVQMQQVLENLIQNGL
FT                   RYSDKQTGHRTLTINVGLTLLNEQAFVEIIDQGPGIPAELADKIFEPFYTSERSGTGLG
FT                   LYIARELCESNQARLDLVPIKSGSCFRITFAHPGKQMAL"
FT   CDS_pept        complement(430271..430510)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03380"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F447"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43921"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGH9"
FT                   /protein_id="CBL43921.1"
FT                   /translation="MSRIILLAAIGFAVYYIYKKLAAKKLAAQQASNESGRAQVMLKCA
FT                   QCDVHVPKQEAISSGSLHFCSESHKNLYLKDHHS"
FT   CDS_pept        complement(430599..431417)
FT                   /transl_table=11
FT                   /gene="comL"
FT                   /locus_tag="HDN1F_03390"
FT                   /product="competence lipoprotein ComL"
FT                   /note="silverDB:HdN1F448"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43922"
FT                   /db_xref="GOA:E1VGI0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017689"
FT                   /db_xref="InterPro:IPR039565"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI0"
FT                   /protein_id="CBL43922.1"
FT                   /translation="MWRLVCLVLSVVLVAGCASTKVENELSERQYYEDAQKALKDEQFS
FT                   RAVERLEALNARYPFGRYAEQAQLDLVYAYYRSMDYASSGVTAERFIRMHPDHTELDYA
FT                   YYMKGLSTYSVDRGIFERFIPSDYSERDLEPAKESFNDFSRLLNRFPNSIYAPDARKRM
FT                   VYLRNLFAEHELKAAHWNMRRGAYVASANRARYVVENFDRTPAMAEGLAILYKSYRELG
FT                   LNDLANDTLKVLVSNYPHYPELDAKGRLAYTPGKTGRQSLLSVVSFGLLD"
FT   CDS_pept        431575..432531
FT                   /transl_table=11
FT                   /gene="rluD"
FT                   /locus_tag="HDN1F_03400"
FT                   /product="Ribosomal large subunit pseudouridine synthase D"
FT                   /note="silverDB:HdN1F449"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43923"
FT                   /db_xref="GOA:E1VGI1"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI1"
FT                   /protein_id="CBL43923.1"
FT                   /translation="MTQIQHQATIPDDLSGKRLDQAAAQLFPDYSRARLQEWIKMGALT
FT                   INQQVGVAKEKVIGGEQLFLSVELQADERVKPQNISLDIVHEDDSLLIINKPAGLVVHP
FT                   GSGHSEGTLVNALVNHAPKLAELPRAGLVHRIDKDTTGLLVVAKTLEAHTDLVAQLQAK
FT                   LVKREYEAIAQGVMTGGGKVDAPIGRHPTQRTKQAVVSSGREAVTHYRVVARYRAHTHI
FT                   RLALETGRTHQIRVHMAHIHYPLLGDPDYGGRLRLPKAASPEFIEALQGFRRQALHAQR
FT                   LALHHPESGDWVAWEVPLPEDFVQLLAAIKADHALDG"
FT   CDS_pept        432624..433448
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03410"
FT                   /product="Protein of unknown function DUF152"
FT                   /note="silverDB:HdN1F451"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43924"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI2"
FT                   /protein_id="CBL43924.1"
FT                   /translation="MASQTPHPPLAAQWIQPDWPAPNNIRAWVSTRGEPRIPNHPFGRF
FT                   NTASHVQDDPARVHNARTELVAAFGFQYPPLWLDQVHGTDVVRATPDTRSQAADAVITD
FT                   VPGLPITIHTADCLPVFFCNRSGTQIALAHAGWRGLAAGVIENTVEAFSEPPQNLIVWL
FT                   GPAIGPQAFEVGDDVRQAFLRHDPEHEAAFIPTVASVAGESIETSSAAAKKSSSAQHWH
FT                   CDLYLLARQRLRQLGITQISGGNFCTATDDCFYSFRRDSKTGRMLSILWLNP"
FT   CDS_pept        433588..436161
FT                   /transl_table=11
FT                   /gene="clpB"
FT                   /locus_tag="HDN1F_03420"
FT                   /product="Heat shock protein F84.1"
FT                   /note="silverDB:HdN1F452"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43925"
FT                   /db_xref="GOA:E1VGI3"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI3"
FT                   /protein_id="CBL43925.1"
FT                   /translation="MRLDKLTSKLQSALSEAQSIALGRDHNYIESAHVLMALIEDNASG
FT                   IRPLLAQAGCNVGQLKDEITAILIRMPHIKNPDGDIRLSPELARLFNLADRHAQKRGDQ
FT                   YISSELLLLAMLEDKGDLGTVFKKLGISAKDVENAIEKVRGGSTVDDPNAEDQRQALQK
FT                   YTIDLTERARKGKLDPVIGRDDEIRRTIQVLQRRTKNNPVLIGEPGVGKTAIAEGLAQR
FT                   IVNGEVPEGLKNKRVLSLDMGSLLAGAKFRGEFEERLKSVLTELAKEEGAVILFIDELH
FT                   TMVGAGKAEGAMDAGNMLKPALARGELHCVGATTLDEYRQYIEKDAALERRFQKVLVDQ
FT                   PSVEDTIAILRGLKERYEVHHGVDITDSAIVEAAKLSQRYITDRQLPDKAIDLIDEAAS
FT                   RIRMEMDSKPEELDRLDRRLIQFKMEREALKKEDDEASRKRLEKLNEDIAKNEREYADL
FT                   EEIWNAEKAALQGSQQIKVELEQARIDMDGARRRGDLARMSELQYGRIPELEKRLDMAT
FT                   QAEMTEMKLLRNRVTEEEVAEVVSKWTGIPVSKMLEGEREKLLQMEDSLHKRVVGQHEA
FT                   IVAVANAVRRSRAGLSDPHRPNGSFLFLGPTGVGKTELCKALAEFLFDTQDALVRIDMS
FT                   EFMEKHSVARLIGAPPGYVGYEEGGYLTETVRRKPYSVILLDEVEKAHPDVFNILLQVL
FT                   EDGRLTDGQGRTVDFKNTVVVMTSNLGSDMIQTLAREADYNSMRDAVMDVVGQHFRPEF
FT                   INRIDEVVVFHPLADSQIRGIAEIQLANLRKRLLDRDLKLDLDAEVMNRIIEVGYDPVF
FT                   GARPLKRAIQRLIENPLAQDILAGRFMPGDVIHSHLQDGSLVFTK"
FT   CDS_pept        complement(436230..436559)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03430"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F453"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43926"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI4"
FT                   /protein_id="CBL43926.1"
FT                   /translation="MGEQIRVNAAGTTRVDAEKEAANKKQTDVPLATTEGSAPPPNPQA
FT                   KMQAELLKKSCELYSTNLKVMKERGQIRETTTDGKARMLTDEEKQSRIQEAEKYLEEKC
FT                   QGVGN"
FT   CDS_pept        436860..437204
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03440"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F492"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43927"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI5"
FT                   /protein_id="CBL43927.1"
FT                   /translation="MLSLPIVSVLTKAQFLSTYSAHKRGYRTNRKPCSPVQERSYCLTQ
FT                   LITAATPSPACKPTRIQSARGRQRPNLALCLLKPAPAHQSCANGIDRNSACKRVTCKHT
FT                   PNRNLPAQNG"
FT   CDS_pept        437237..438958
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="HDN1F_03450"
FT                   /product="Acetolactate synthase isoenzyme I large subunit"
FT                   /note="silverDB:HdN1F454"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43928"
FT                   /db_xref="GOA:E1VGI6"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI6"
FT                   /protein_id="CBL43928.1"
FT                   /translation="MELLSGAEMVVRALRDEGVKTMFGYPGGAVLHIYDALFQQKDITH
FT                   ILVRHEQAAAHMADGYARASGKPGVVLVTSGPGATNTVTGIATAYMDSIPMIIVTGQVR
FT                   SDWIGNDAFQETDILGVSRPIVKHSIMVRDAREIPAAIRKAFYIATTGRPGPVLIDIPK
FT                   DCTSPLEKFEYPAPAKVKMRSYNVVTRGHPGQIKKAVDLLVQAKRPIFYTGGGVILGGA
FT                   AQALTQLVRQLGAPITNTLMGLGGFPGDDRQFLGMPGMHGTYEANMAMHHSDVIVAVGA
FT                   RFDDRVTNNTAKFCPNAKIIHIDVDPASISKNVPVDIPIVGPCEQVLAEMLDIVKKDEV
FT                   CLDKEALDAWWKQINAWRAYHGLRYSKDESILKPQQVIEALYRVTKGDAIVTSDVGQHQ
FT                   MFAAQFYKFRRPYQWVNSGGLGTMGFGLPAAMGCAVAHPDATVACVTGEGSIQMNIQEL
FT                   ATCLQYRFPIKIITLNNQSLGMVRQWQDMQYHGRHSSSTYEESLPDFVKLAEAYGHVGI
FT                   RVTNPADLDSAMEEAFSLKDQLVFMDINVDPTEHVYPMQIGEGSMRDMWLNKTERT"
FT   CDS_pept        438931..439452
FT                   /transl_table=11
FT                   /gene="ilvH"
FT                   /locus_tag="HDN1F_03460"
FT                   /product="Acetolactate synthase isoenzyme III (small
FT                   subunit) protein"
FT                   /note="silverDB:HdN1F455"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43929"
FT                   /db_xref="GOA:E1VGI7"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI7"
FT                   /protein_id="CBL43929.1"
FT                   /translation="MVEQNGAYLIMRRIISILLENEPGALSRVVGLFSQRGYNIETLTV
FT                   APTNDPTLSRLTLTTQGGDRVIEQITKQLNKLVEVVKLVDLSEGPHIERELMLVKVKAT
FT                   GAQRAEIKRSADIFRGQIVDVTSSVYTVQLAGTTDKLDAFIEAIGDASILEVVRTGVSG
FT                   LARGDKTLSL"
FT   CDS_pept        439520..440605
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="HDN1F_03470"
FT                   /product="Ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="silverDB:HdN1F456"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43930"
FT                   /db_xref="GOA:E1VGI8"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI8"
FT                   /protein_id="CBL43930.1"
FT                   /translation="MGASSAGYIHSNHRSTTKNQGNTMQAFYDKDCDLSIIQSMKVAII
FT                   GYGSQGHAHANNLRDSGVEVAVGLRAGSASAKKAQAAGLTVKTVEEAAKWADLVMILAP
FT                   DEHQAKLYNEQLAPNLKDGATIAFAHGFNIHFKLIEPTSDKDIIMIAPKGPGHTVRGTY
FT                   LEGGGVPSLIAVYQNATGRAREIALSYASANGGGRAGILETNFREETETDLFGEQAVLC
FT                   GGAAALVQAGFEVLVEAGYAPEMAYFECLHELKLIVDLMYQGGIADMRYSISNTAEYGD
FT                   YTRGPRVITDATKVEMRKILKEIQTGEYAREFVLENLAGAATLKAKRRISEEHLIEEVG
FT                   GKLRAMMPWIQAKKLVDRSKN"
FT   CDS_pept        440816..441661
FT                   /transl_table=11
FT                   /gene="pssA"
FT                   /locus_tag="HDN1F_03480"
FT                   /product="CDP-diacylglycerol-serine
FT                   O-phosphatidyltransferase"
FT                   /EC_number="2.7.8.8"
FT                   /note="silverDB:HdN1F459"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43931"
FT                   /db_xref="GOA:E1VGI9"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGI9"
FT                   /protein_id="CBL43931.1"
FT                   /translation="MGKLIMQDSEKKPDGSILHSDSTDLDQETSGVVFEVVEKEFHEGK
FT                   RVRRRGVYLLPNLFTTGALFSAFYAIIYAMNGRFELAAIAIFVSMIFDGLDGRVARLTN
FT                   TQSEFGAQYDSLADCISFGVAPALVSYAWALSSLGKIGWTIGFIYLACAALRLARFNVQ
FT                   LDTADKRYFTGLPSPSAAAVVAGMVWLGVDQGIAGADIAWVAALLTGFSAVMMVSNVKY
FT                   NSFKQLDFKGRVPFVAIPVVVLATAIIAVYPSGFLLALFLLYAISGPVLHFWRKDALAP
FT                   "
FT   CDS_pept        complement(441741..441959)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03490"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F460"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43932"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ0"
FT                   /protein_id="CBL43932.1"
FT                   /translation="MLSSSPEEALILSEFTMVSTFYFEAFPLQNSFVFTSQLLRIPTDA
FT                   LAHPLVLQEWFAAGNNSPMPNLIQGHR"
FT   rRNA            442155..443677
FT                   /gene="16S rRNA"
FT   tRNA            443769..443845
FT                   /gene="tRNA-Ile"
FT                   /product="transfer RNA-Ile"
FT                   /note="tRNAscan-SE-score 92.90"
FT   tRNA            443860..443935
FT                   /gene="tRNA-Ala"
FT                   /product="transfer RNA-Ala"
FT                   /note="tRNAscan-SE-score 90.68"
FT   rRNA            444286..447174
FT                   /gene="23S rRNA"
FT   rRNA            447320..447434
FT                   /gene="5S rRNA"
FT   CDS_pept        447558..448169
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03500"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F461"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43933"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ1"
FT                   /protein_id="CBL43933.1"
FT                   /translation="MLSRPNLMKSIVCLVILNLAAPSFVHLSVYKPSAPLRGAGEALEA
FT                   GKEGAKRLVLLDEQKALYRTLSESPAGMRQLASARATVGQEGYLSEACYKLGPFSDGAL
FT                   MRSVQLALDDRNAEWRQIGASSMLTDRDAQGTKGRYADQKKGDGDLEKLSVPDLQREQW
FT                   LLLKDGGRPREGRLARMASLNMTNQAIISCKIFAQSEIIP"
FT   tRNA            448195..448270
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /note="tRNAscan-SE-score 92.40"
FT   tRNA            448339..448423
FT                   /gene="tRNA-Tyr"
FT                   /product="transfer RNA-Tyr"
FT                   /note="tRNAscan-SE-score 70.19"
FT   tRNA            448470..448543
FT                   /gene="tRNA-Gly"
FT                   /product="transfer RNA-Gly"
FT                   /note="tRNAscan-SE-score 82.51"
FT   tRNA            448557..448632
FT                   /gene="tRNA-Thr"
FT                   /product="transfer RNA-Thr"
FT                   /note="tRNAscan-SE-score 92.48"
FT   CDS_pept        448707..449900
FT                   /transl_table=11
FT                   /gene="tufB1"
FT                   /locus_tag="HDN1F_03510"
FT                   /product="Elongation factor Tu"
FT                   /note="silverDB:HdN1F462"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43934"
FT                   /db_xref="GOA:E1VGJ2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ2"
FT                   /protein_id="CBL43934.1"
FT                   /translation="MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTIVCSEVWGGERK
FT                   GYDQIDNAPEEKARGITINTSHVEYSSGARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDF
FT                   PGDDTPIITGSALMAVEGRDDKGMGRTAVQKLVETLDSYIPEPVRAIDQPFLLPIEDVF
FT                   SISGRGTVVTGRVERGIVKVGEEVEIVGIRDTVKTTVTGVEMFRKLLDEGRAGDNVGVL
FT                   LRGTKREDVERGQVLAKPNSIKPHSHFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGSVELPEGVEMVMPGDNIKMVVTLIAPIAMQEGLRFAIREGGRTVGAGVVAKVIA"
FT   tRNA            449950..450025
FT                   /gene="tRNA-Trp"
FT                   /product="transfer RNA-Trp"
FT                   /note="tRNAscan-SE-score 86.00"
FT   CDS_pept        450069..450440
FT                   /transl_table=11
FT                   /gene="secE"
FT                   /locus_tag="HDN1F_03520"
FT                   /product="Protein translocase subunit"
FT                   /note="silverDB:HdN1F504"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43935"
FT                   /db_xref="GOA:E1VGJ3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ3"
FT                   /protein_id="CBL43935.1"
FT                   /translation="MEPSASKERNSALDAVKIVISIVLVSVAIVGNSLFESEPFLYRLG
FT                   GVIVLIGAGVLLALSTSRGLQFRTLVKDSRVELKRVVWPTKQETWSTSAIVLVVVVVSA
FT                   LILWGIDYLLGSSVSFLMG"
FT   CDS_pept        450465..450998
FT                   /transl_table=11
FT                   /gene="nusG"
FT                   /locus_tag="HDN1F_03530"
FT                   /product="Transcription antitermination protein"
FT                   /note="silverDB:HdN1F463"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43936"
FT                   /db_xref="GOA:E1VGJ4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ4"
FT                   /protein_id="CBL43936.1"
FT                   /translation="MAKRWYVVHAYSGFEKQVKRSLEERVKRFGLEDKFGEVLVPTEEV
FT                   VEIRGGQKRKSERKFFPGYVLVQMEMDEESWYLVKECPKVMGFIGGTLDKPAPISDVEA
FT                   NAILRRVEDGVEKPKPKTLFEPGEVVRVIDGPFADFNGVVEEVNYEKSRLQVAVLIFGR
FT                   STPVELEFGQVEKT"
FT   CDS_pept        451173..451601
FT                   /transl_table=11
FT                   /gene="rplK"
FT                   /locus_tag="HDN1F_03540"
FT                   /product="ribosomal protein L11"
FT                   /note="silverDB:HdN1F464"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43937"
FT                   /db_xref="GOA:E1VGJ5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ5"
FT                   /protein_id="CBL43937.1"
FT                   /translation="MAKKITAYIKLQVKACQANPSPPVGPALGQHGVNIMEFCKQFNAQ
FT                   TQGVEPGLPIPVVITVYSDRSFTFIMKTPPAAILLKKAAGIKSGSAVPNKNKVGKVTRA
FT                   QLEAIATTKMPDLTAASMDAAVNTIAGSARSMGLEVEG"
FT   CDS_pept        451604..452299
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="HDN1F_03550"
FT                   /product="50S ribosomal protein L1"
FT                   /note="silverDB:HdN1F466"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43938"
FT                   /db_xref="GOA:E1VGJ6"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ6"
FT                   /protein_id="CBL43938.1"
FT                   /translation="MAKQTKRQKAIAEKVLPGKTYTVVEAAGLLAELSRVKFKESIDIS
FT                   VNLGVDPRKSDQVVRGASVLPNGTGKSVRVAVFAQGANADLARAAGAELVGMDDLADEI
FT                   QKGIINFDVAIASPDAMRVVGRLGQILGPRGLMPNPKVGTVTTDVALAVKNAKAGQVRY
FT                   RTDKAGIIHCIVGQVGFTTEAIKQNVDTLLADLRKMKPATSKGSYVRKVTLSSTMGPGL
FT                   VIDLSTLES"
FT   CDS_pept        452491..453015
FT                   /transl_table=11
FT                   /gene="rplJ"
FT                   /locus_tag="HDN1F_03560"
FT                   /product="50S ribosomal protein L10"
FT                   /note="silverDB:HdN1F467"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43939"
FT                   /db_xref="GOA:E1VGJ7"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ7"
FT                   /protein_id="CBL43939.1"
FT                   /translation="MALRLEDKKVIVAEVNEAASNALSAVIADYRGLTVSQMTKLRRAA
FT                   REQKVFVQVVRNTLAKVAVRGTEFECLSDSLVGPTILAFSMEDPGAAARLLKDYSKEFE
FT                   KLKVKGLAVGGVAYPATEIDRLANLPTRQQALGILAGVLQAPISKFARTINEVPTKIAR
FT                   VIAAVKDQKAA"
FT   CDS_pept        453055..453429
FT                   /transl_table=11
FT                   /gene="rplL"
FT                   /locus_tag="HDN1F_03570"
FT                   /product="50S Ribosomal protein L7/L12"
FT                   /note="silverDB:HdN1F468"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43940"
FT                   /db_xref="GOA:E1VGJ8"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ8"
FT                   /protein_id="CBL43940.1"
FT                   /translation="MALSKDDILNAIAEMSVMDLVELISAIEDKFGVTAAAPVAIAAGP
FT                   AAAAAPVEEQTEFNVIMTSFGENKVNVIKVIRAITGLGLKEAKDMVEGVPATVKEGISK
FT                   KDADDLKKQLEEAGAKVDIK"
FT   CDS_pept        453651..457721
FT                   /transl_table=11
FT                   /gene="rpoB"
FT                   /locus_tag="HDN1F_03580"
FT                   /product="DNA-directed RNA polymerase beta subunit"
FT                   /note="silverDB:HdN1F469"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43941"
FT                   /db_xref="GOA:E1VGJ9"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGJ9"
FT                   /protein_id="CBL43941.1"
FT                   /translation="MAYSFTEKKRIRKAFGQINDAMDVPYLLAIQLDSYRKFLQLDKLA
FT                   AGRGDDGLQAAFKSVFPITSYSGSAALEFVEYVLGEPAFDVKECQLRGATYSAPLRVKL
FT                   RLIIYDKDSPSKAIKDIKEQEVYMGEIPLMTDTGTFVINGTERVIVSQLHRSPGVFFDH
FT                   DRGKTHSSGKLLYSARIIPYRGSWLDFEFDPKDLVYVRIDRRRKLPATVLLRALGYESE
FT                   QILELFFDTNKVLVESGEFKLELIPERLRGETALFDIKAGDTVVVESGRRITARHIRQL
FT                   EKAELRSLLVPKEYLVGKVLAKGVIDRSTGEVIAPCNAEVTDELLDKLVGLSVTSFETL
FT                   YTNELDRGPFLSDTLRTDQTTSALEALVEIYRMMRPGEPPTKDAAEGLFKNLFFSAERY
FT                   DLSAVGRMKFNRRLGRKETTGEGTLSREDIVAVLKTLVAIRNGQGVVDDIDHLGNRRVR
FT                   SVGEMAENQFRVGLVRVERAVKERLSLAESEGLMPQDLINAKPVAAAIKEFFGSSQLSQ
FT                   FMDQNNPLSEITHKRRVSALGPGGLTRERAGFEVRDVHPTHYGRLCPIETPEGPNIGLI
FT                   NSLAAFARANDYGFLESPYRKVTNGRATDEVVFLSAIEESEYMVAQASAELDEEGNLVE
FT                   DLVPVRHKNEFTVTTTENVEYMDVSPRQVVSVAASLIPFLEHDDANRALMGSNMQRQAV
FT                   PTLRSEKPLVGTGMEGTVARDSGVCVVAKRGGLIDRVDASRIVVRVNEDEITDGEAGVD
FT                   IYSLTKFTRSNQNTCINQKPLVHVGDRVARNDILADGPSVDIGELALGQNMRVAFMPWN
FT                   GYNFEDSIMLSERVVQEDRFTTIHIQELTCVARDTKLGPEEITADIPNVSESALAKLDE
FT                   AGVVHIGAEVAAGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDTSLRVPSGTSG
FT                   TVIDVQVFTRDGVEKDQRALQIENAEIEKYRKDLNDEFRIIQIATVQRLKKALLDRRVN
FT                   GGAGFKRGDSLTQELLEGLDNSALFELRLADEDAAESLEKAKAYLDEVRSEQERKLANK
FT                   KRKITTGDDLAHGVLKIVKVYLAIKRRVQPGDKMAGRHGNKGVVSVIMPIEDMPHDENG
FT                   VAVDVVLNPLGVPSRMNVGQILETHLGLAARGLGERINRMLEEQREIFEIREFLDRVYN
FT                   GDKQTRVNLKSLTDDEVRTLATNLRAGVPMATLVFDGAKEQEIKEMLRLAGQPESGQMD
FT                   LFDGRTGEKFNCKVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRF
FT                   GEMEVWALEAYGAAYTLQEMLTIKSDDVNGRTRVYKNIVDGDHRMEPGMPESFNVLVKE
FT                   IRSLGIDIELEQD"
FT   CDS_pept        457775..461980
FT                   /transl_table=11
FT                   /gene="rpoC"
FT                   /locus_tag="HDN1F_03590"
FT                   /product="DNA-directed RNA polymerase beta\' subunit"
FT                   /note="silverDB:HdN1F470"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43942"
FT                   /db_xref="GOA:E1VGK0"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK0"
FT                   /protein_id="CBL43942.1"
FT                   /translation="MKDLLNLIKQPGQETEFDKIRIGLASPEMVRSWSFGEVKKPETIN
FT                   YRTFKPERDGLFCARIFGPIKDYECLCGKYKRLKHRGVICEKCGVEVTLAKVRRDRMGH
FT                   IELASPVAHIWFLKSLPSRIGMLLDMTLRDIERVLYFESFVVVEPGTTTLERGQIMSDE
FT                   QYYEALEQFGDEFEAMMGAEAIHRLLTDMDLDLEIKQLREELPSVTSETKIKKITKRLK
FT                   LMESFVDSGNKPEWMILTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKR
FT                   LLDLNAPDIIVRNEKRMLQEAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQ
FT                   NLLGKRVDYSGRSVIVVGPTLKLHQCGLPKKMALELFKPFIFAKLETRGLATTIKAAKK
FT                   MVERETPDVWDILAEVIREHPVLLNRAPTLHRLGIQAFEPTLIEGKAIQLHPLVCVAYN
FT                   ADFDGDQMAVHVPLTLEAQLEARALMMSTNNILSPANGEPIILPTQDVILGLYFISREK
FT                   INAPGEGMCFSDTAEVHRALLNKVITVHTRIKVRLKEWIKLEDGTIAERVFVASTTAGR
FT                   CLIWDIVPKGLPFEVVDKPMTKKAVSYLINICYRRLGLKATVIFADQLMYLGFHQATLS
FT                   GSSIGIDDMVIPQAKARIISEAEDEVREIEDQFASGLVTQGERYNKVIDIWSRTNDLVS
FT                   KAMMEVLSKETVEDKSGKQVDQKSFNSIFIMADSGARGSQAQIRQLAGMRGLMAKPDGS
FT                   IIEQPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVVNED
FT                   DCGTKRGLMMTPIIEGGDVVEPLGERVLGRVVAVDVLKPGTDEVVVPAGTMIDERWVEQ
FT                   FELLGVDEVLCRSPISCETRYGVCRKCYGRDLARGHLVNIGEAVGVIAAQSIGEPGTQL
FT                   TMRTFHIGGAASRSSAVSNVQVKSEGTIRLHNFKHVRQQSGKLVSVTRSGELAIADARG
FT                   RERERYKLPYGAVISVGEGDRVQAGQVVAVWDPHTHPIITEVAGYVSFGDFEEGISVKH
FT                   QTDDLTGLSNYEVIDPKERPISGKDKRPIVRLLDEKGKQISMPGGDTPVQYFLPAGSIV
FT                   QLTDGAKLDMGDVIARIPQESSKTRDITGGLPRVADLFEARKPKESSILAEKSGAISFG
FT                   KETKGKVRLIITPDDGGEPYEELIPKWRQVNVFEGEKVNKGEVISDGPSNPHDILRLKG
FT                   VNAVANYIINEVQDVYRLQGVKINDKHIEVIVRQMLRRVEVTDSNDSEFIRGEQVELSR
FT                   VLDGNDLLDKQSKFPARYDRVLMGITKASLSTESFISAASFQETTRVLTEAAVTGKMDD
FT                   LRGLKENVVVGRLIPAGTGFAHHADRRRRRQLETDGPKPLQFSEVESRLSEALNSPSE"
FT   CDS_pept        462082..462477
FT                   /transl_table=11
FT                   /gene="rpsL"
FT                   /locus_tag="HDN1F_03600"
FT                   /product="30S ribosomal protein S12"
FT                   /note="silverDB:HdN1F521"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43943"
FT                   /db_xref="GOA:E1VGK1"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK1"
FT                   /protein_id="CBL43943.1"
FT                   /translation="MEFHYMATVNQLVRKPRSPKVEKSDVPALQGCPQRRGVCTRVYTT
FT                   TPKKPNSALRKVARVRLTNGYEVTTYIGGEGHNLQEHSVILIRGGRVKDLPGVRYHTVR
FT                   GTLDTAGVNNRKQARSKYGTKRGKKSK"
FT   CDS_pept        462581..463051
FT                   /transl_table=11
FT                   /gene="rpsG"
FT                   /locus_tag="HDN1F_03610"
FT                   /product="30S ribosomal protein S7"
FT                   /note="silverDB:HdN1F471"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43944"
FT                   /db_xref="GOA:E1VGK2"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK2"
FT                   /protein_id="CBL43944.1"
FT                   /translation="MPRRRVVAKREILPDPKFGSQILAKFINHVMVDGKKSVAERIVYG
FT                   ALDKISERTKKDPVEAFEKALETLRPVVEVKSRRVGGATYQVPVEVRPGRRTALAMRWL
FT                   VDSARKRGEKSMPLRLAGEIMDAAEGKGAAIKKREDVHRMAEANKAFSHYRF"
FT   CDS_pept        463106..465196
FT                   /transl_table=11
FT                   /gene="fusA1"
FT                   /locus_tag="HDN1F_03620"
FT                   /product="Translation elongation factor G"
FT                   /note="silverDB:HdN1F472"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43945"
FT                   /db_xref="GOA:E1VGK3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK3"
FT                   /protein_id="CBL43945.1"
FT                   /translation="MRKTPLERYRNIGICAHVDAGKTTTSERILFYTGVSHKLGEVHNG
FT                   TAVMDWMEQEQERGITITSAATTCFWRGMDRTREEHRINIIDTPGHVDFTIEVERSLRV
FT                   LDGAIVVFCGAAGVEPQSETVWRQADKYHVPRLVFVNKMDRTGADFLRVVRQVQSRFNK
FT                   KCVPIQLNIGAEDGFVGVVDLILMKGVIWSDEDQGLSYTHTEIPPELLDIALALREDLV
FT                   ATASEASDELTDKYLSGESLSESEIKAGLRARVLRNEVVPALCGSAFKNKGVQAVLDAV
FT                   LDFLPAPDEVASIAGLQEDGVSYEERRSSDDEPFAALAFKIATDPFVGNLTFIRVYSGV
FT                   LASGDAVYNPTKRKRERIGRLLQMHANARQDVKEVRAGDIAAAVGLKDVTTGETLCDVA
FT                   RPIVLERMDFPEPVISVAVEPKSTADQDKMALALQRLAQEDPSFRVKTDEETGQTIISG
FT                   MGELHLEILVDRMRREFKVDASVGKPQVSYRETIRKEVEVEGKYIRQTGGRGQYGHVWL
FT                   KLIPIEPDGEFKFSEQIVGGSVPKEFFAPIEKGVRQQLQSGVLGGYPLVGLQVVLFDGS
FT                   YHDVDSNENAFRMAGAMALRQGVADASPILLEPIMKVEVVTPDEYMGDVMGDLNRRRGL
FT                   VQGLEDGVAGRIIRAEVPLAEMFGYATDVRGISQGRATFSMEFLKYAETPQAVANAVIK
FT                   RI"
FT   CDS_pept        465229..466422
FT                   /transl_table=11
FT                   /gene="tufB2"
FT                   /locus_tag="HDN1F_03630"
FT                   /product="Elongation factor Tu"
FT                   /note="silverDB:HdN1F473"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43946"
FT                   /db_xref="GOA:E1VGK4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK4"
FT                   /protein_id="CBL43946.1"
FT                   /translation="MAKEKFERNKPHVNVGTIGHVDHGKTTLTAALTIVCSEVWGGERK
FT                   GYDQIDNAPEEKARGITINTSHVEYSSAARHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VCSAADGPMPQTREHILLARQVGVPYIVVFLNKADMVDDAELLELVEMEVRDLLNTYDF
FT                   PGDDTPIITGSALMAVEGRDDKGMGRTAVQKLVETLDSYIPEPVRAIDQPFLLPIEDVF
FT                   SISGRGTVVTGRVERGIVKVGEEVEIVGIRDTVKTTVTGVEMFRKLLDEGRAGDNVGVL
FT                   LRGTKREDVERGQVLAKPNSIKPHSHFESEVYVLSKEEGGRHTPFFKGYRPQFYFRTTD
FT                   VTGSVELPEGVEMVMPGDNIKMVVTLIAPIAMQEGLRFAIREGGRTVGAGVVAKVIA"
FT   CDS_pept        466598..466918
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="HDN1F_03640"
FT                   /product="Ribosomal protein S10"
FT                   /note="silverDB:HdN1F474"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43947"
FT                   /db_xref="GOA:E1VGK5"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="InterPro:IPR027486"
FT                   /db_xref="InterPro:IPR036838"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK5"
FT                   /protein_id="CBL43947.1"
FT                   /translation="MSAMQNQKIRIRLKAFDHKLIDQSASEIVETAKRTGAQVRGPIPL
FT                   PTRQERFTVLISPHVNKDARDQYEIRTHKRLVEIVEPTDKTVDALMKLNLAAGVDVQIS
FT                   LG"
FT   CDS_pept        466956..467594
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="HDN1F_03650"
FT                   /product="50S ribosomal protein L3"
FT                   /note="silverDB:HdN1F475"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43948"
FT                   /db_xref="GOA:E1VGK6"
FT                   /db_xref="InterPro:IPR000597"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR019926"
FT                   /db_xref="InterPro:IPR019927"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK6"
FT                   /protein_id="CBL43948.1"
FT                   /translation="MAIGLVGKKCGMTRIFNEDGSSTSVTVIEVDPNRVTLIKSVDRDG
FT                   YSAVQVTTGVRKASTVNKAEAGLFSKAGVEAGSGLWEFRFPDDAAITLSVGDSVGVSIF
FT                   EAGQAVDVTGVSKGKGFAGVVKRWNFRTQDATHGNSLSHRAPGSIGQRQTPGRVFKGKK
FT                   MSGHLGDAQVTVQSLQLVRVDVERNLLLVKGAVPGAAGNNVIVRPALKG"
FT   CDS_pept        467613..468215
FT                   /transl_table=11
FT                   /gene="rplD"
FT                   /locus_tag="HDN1F_03660"
FT                   /product="50S ribosomal protein L4"
FT                   /note="silverDB:HdN1F476"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43949"
FT                   /db_xref="GOA:E1VGK7"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013005"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK7"
FT                   /protein_id="CBL43949.1"
FT                   /translation="MNLNIASGGSVSVSEVAFGRDFNEALVHQVVTAFMAGSRQGTKGQ
FT                   KTRSEVSGGGKKPWKQKGSGRARAGTIRSPIWRGGGKVFAASTRDHSQKVNKKMYRGAM
FT                   QCILSELIRQDRVVVVDQFAMENPKTKELIQKLKGLGLDSALIVSDFVDENLFLSARNV
FT                   VNVGVCDVEAIDPVSLIAFDKVVVTVGALRKFEEMLG"
FT   CDS_pept        468212..468508
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="HDN1F_03670"
FT                   /product="50S ribosomal protein L23"
FT                   /note="silverDB:HdN1F477"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43950"
FT                   /db_xref="GOA:E1VGK8"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR012678"
FT                   /db_xref="InterPro:IPR013025"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK8"
FT                   /protein_id="CBL43950.1"
FT                   /translation="MNQERIFKVLVGPHVSEKASVSADKNNSIVFKVARDATKVEIKTA
FT                   VEKLWDVKVKAVRTVVIKGKSKKFGRFQGRRQDWKKAYVALHEGYDVDFLGAE"
FT   CDS_pept        468520..469350
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HDN1F_03680"
FT                   /product="50S ribosomal protein L2"
FT                   /note="silverDB:HdN1F479"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43951"
FT                   /db_xref="GOA:E1VGK9"
FT                   /db_xref="InterPro:IPR002171"
FT                   /db_xref="InterPro:IPR005880"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR014726"
FT                   /db_xref="InterPro:IPR022666"
FT                   /db_xref="InterPro:IPR022669"
FT                   /db_xref="InterPro:IPR022671"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGK9"
FT                   /protein_id="CBL43951.1"
FT                   /translation="MAVINSKPTSAGRRFVVSIRTPDLHKGDPYAPLVESKTRKGGRNA
FT                   AGRITTRHQGGGHKQLYRLVDFRRDKDGVPAIVERLEYDPNRTAHIALLKYLDGERRYI
FT                   IAPKGVKVGDKLQSGSDAPIKIGNALPLRNIPIGSTVHCVEIKPGKGAQIARSAGAGVQ
FT                   ILARESGYVTLRMRSGEVRKVLADARGVIGEVSNSEHSLKVFGKAGAKRWKGVRPTVRG
FT                   IAMNPVDHPHGGGEGRTKGGRHPCTPWGVPTKGHKTRKNKRTDNMIVRRRSSKV"
FT   CDS_pept        469371..469646
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="HDN1F_03690"
FT                   /product="30S ribosomal protein S19"
FT                   /note="silverDB:HdN1F480"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43952"
FT                   /db_xref="GOA:E1VGL0"
FT                   /db_xref="InterPro:IPR002222"
FT                   /db_xref="InterPro:IPR005732"
FT                   /db_xref="InterPro:IPR020934"
FT                   /db_xref="InterPro:IPR023575"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL0"
FT                   /protein_id="CBL43952.1"
FT                   /translation="MPRSLKKGPFVDHHLLKKVEAAMDNSVKKPIKTWSRRSMILPEMV
FT                   GMTMAIYNGRQHVPVFVTEHMVGHKLGEFAATRTYRGHAADKKAKR"
FT   CDS_pept        469657..469989
FT                   /transl_table=11
FT                   /gene="rplV"
FT                   /locus_tag="HDN1F_03700"
FT                   /product="50S ribosomal protein L22"
FT                   /note="silverDB:HdN1F481"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43953"
FT                   /db_xref="GOA:E1VGL1"
FT                   /db_xref="InterPro:IPR001063"
FT                   /db_xref="InterPro:IPR005727"
FT                   /db_xref="InterPro:IPR018260"
FT                   /db_xref="InterPro:IPR036394"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL1"
FT                   /protein_id="CBL43953.1"
FT                   /translation="MEVAAKLFSARISAQKARLVADQVRGKPVAQALNVLTFSPKKAAH
FT                   LIKKVVESAIANAEHNEGADVDELKISAIFVDEGMSMKRVKPRAKGRADRIVKRTCHIT
FT                   VKVSDK"
FT   CDS_pept        470000..470683
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="HDN1F_03710"
FT                   /product="30S ribosomal protein S3"
FT                   /note="silverDB:HdN1F482"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43954"
FT                   /db_xref="GOA:E1VGL2"
FT                   /db_xref="InterPro:IPR001351"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR005704"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR018280"
FT                   /db_xref="InterPro:IPR036419"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL2"
FT                   /protein_id="CBL43954.1"
FT                   /translation="MGQKVHPTGIRLGIVKKHSSTWYASPKNFGDYLLKDIKVREYLSE
FT                   KLKAASVSRIEIERPAENARITIKTARPGIVIGKKGEDVEKLRKEVASIMQVPVHINIE
FT                   EIRKPELDAKLVAEGIASQLERRVMFRRAMKRAVQGTMRLGAKGIKVQVSGRLGGAEIA
FT                   RTEWYREGRVPLHTLRADIDYATARAETTYGSIGVKVWIFKGEVLGGVEPVEDTKVAPK
FT                   RTRAN"
FT   CDS_pept        470695..471108
FT                   /transl_table=11
FT                   /gene="rplP"
FT                   /locus_tag="HDN1F_03720"
FT                   /product="50S ribosomal protein L16"
FT                   /note="silverDB:HdN1F536"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43955"
FT                   /db_xref="GOA:E1VGL3"
FT                   /db_xref="InterPro:IPR000114"
FT                   /db_xref="InterPro:IPR016180"
FT                   /db_xref="InterPro:IPR020798"
FT                   /db_xref="InterPro:IPR036920"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL3"
FT                   /protein_id="CBL43955.1"
FT                   /translation="MLQPKRTKFRKQHKGRNRGLALRGAKVSFGTVGLKALERGRLTAR
FT                   QIEAARRAMTRHIKRGGKIWIRVFPDKPITEKPLEVRMGSGKGNVEYWVALIQPGKVLY
FT                   EMEGVAPDVAKEAFALAAAKLPIKTAVVTRTVM"
FT   CDS_pept        471108..471308
FT                   /transl_table=11
FT                   /gene="rpmC"
FT                   /locus_tag="HDN1F_03730"
FT                   /product="50S ribosomal protein L29"
FT                   /note="silverDB:HdN1F483"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43956"
FT                   /db_xref="GOA:E1VGL4"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR018254"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL4"
FT                   /protein_id="CBL43956.1"
FT                   /translation="MKSNELREKSVDQLQEQLIKLLKEQFEYRMKQATGQLGQTHVIKR
FT                   ARKDIARLKTILGEKTRGSQV"
FT   CDS_pept        471305..471568
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="HDN1F_03740"
FT                   /product="30S ribosomal protein S17"
FT                   /note="silverDB:HdN1F546"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43957"
FT                   /db_xref="GOA:E1VGL5"
FT                   /db_xref="InterPro:IPR000266"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019979"
FT                   /db_xref="InterPro:IPR019984"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL5"
FT                   /protein_id="CBL43957.1"
FT                   /translation="MTEQQTTARTVTGRVVSDKREKTITVLIERKVKHPVYGKYVRHST
FT                   KLHAHDEDNACAIGDLVTIQECRPISKSKFWNLVKIEEKAKG"
FT   CDS_pept        471609..471977
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="HDN1F_03750"
FT                   /product="50S ribosomal protein L14"
FT                   /note="silverDB:HdN1F484"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43958"
FT                   /db_xref="GOA:E1VGL6"
FT                   /db_xref="InterPro:IPR000218"
FT                   /db_xref="InterPro:IPR005745"
FT                   /db_xref="InterPro:IPR019972"
FT                   /db_xref="InterPro:IPR036853"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL6"
FT                   /protein_id="CBL43958.1"
FT                   /translation="MIQTETTLDVADNSGARRVQCIKVLGGSHRRYANVGDVIKVSVKE
FT                   ASPRGKVKKGDVLNAVVVRTRSGVRRSDGSLIRFDENAAVLLNNQKQPIGTRIFGPVTR
FT                   ELRGEQFMKIISLAPEVL"
FT   CDS_pept        471991..472314
FT                   /transl_table=11
FT                   /gene="rplX"
FT                   /locus_tag="HDN1F_03760"
FT                   /product="50S ribosomal protein L24"
FT                   /note="silverDB:HdN1F485"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43959"
FT                   /db_xref="GOA:E1VGL7"
FT                   /db_xref="InterPro:IPR003256"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR005825"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR041988"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL7"
FT                   /protein_id="CBL43959.1"
FT                   /translation="MMRKIKNNDEVVVISGKDKGKRGKVSRVLGEKVLVSGVNIVKRHQ
FT                   KPVPQRGTQGGILEKEAPIHISNVAIWNPNTSKADRVGFRVNGEGAKERFFKSTNETIV
FT                   TKV"
FT   CDS_pept        472330..472866
FT                   /transl_table=11
FT                   /gene="rplE"
FT                   /locus_tag="HDN1F_03770"
FT                   /product="50S ribosomal protein L5"
FT                   /note="silverDB:HdN1F486"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43960"
FT                   /db_xref="GOA:E1VGL8"
FT                   /db_xref="InterPro:IPR002132"
FT                   /db_xref="InterPro:IPR020929"
FT                   /db_xref="InterPro:IPR020930"
FT                   /db_xref="InterPro:IPR022803"
FT                   /db_xref="InterPro:IPR031309"
FT                   /db_xref="InterPro:IPR031310"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL8"
FT                   /protein_id="CBL43960.1"
FT                   /translation="MSGLKEFYKAQVVEDLKQQFGYKSVMEVPRITKITLNMGVGEASQ
FT                   DRKAIEGAVTDLTAISGQKPVVTKARKSIAGFKIRQGWPIGVKVTLRGERMYEFLERLV
FT                   GFAIPRVRDFRGLNPKAFDGRGNYSMGLREQIVFPEIDYDKIDKIRGLDITITTTAKTD
FT                   EEGRALLRSFRFPLK"
FT   CDS_pept        472880..473185
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="HDN1F_03780"
FT                   /product="30S ribosomal protein S14"
FT                   /note="silverDB:HdN1F487"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43961"
FT                   /db_xref="GOA:E1VGL9"
FT                   /db_xref="InterPro:IPR001209"
FT                   /db_xref="InterPro:IPR023036"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGL9"
FT                   /protein_id="CBL43961.1"
FT                   /translation="MAKTSMVEREKKRAKAVEKFAKKRAELKALISGPATSDEDRWAAM
FT                   IALQKLPRNSAAVRGHNRCGVTGRPHGVYRKFRLGRNKLREHAMNGDVPGLVKASW"
FT   CDS_pept        473202..473594
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HDN1F_03790"
FT                   /product="30S ribosomal protein S8"
FT                   /note="silverDB:HdN1F547"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43962"
FT                   /db_xref="GOA:E1VGM0"
FT                   /db_xref="InterPro:IPR000630"
FT                   /db_xref="InterPro:IPR035987"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM0"
FT                   /protein_id="CBL43962.1"
FT                   /translation="MSMQDPLADMFTRIRNGQMAKKASVTMPSSKLKVAIARILVEEGY
FT                   VGGFNVHEGVKPELQIDLKYYQGKAVIDSLQRVSRPGLRIYKGADKLPKVLGGLGVAIV
FT                   STSQGLMTDRAARAAGVGGEVLCLIS"
FT   CDS_pept        473613..474143
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HDN1F_03800"
FT                   /product="50S ribosomal protein L6"
FT                   /note="silverDB:HdN1F488"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43963"
FT                   /db_xref="GOA:E1VGM1"
FT                   /db_xref="InterPro:IPR000702"
FT                   /db_xref="InterPro:IPR002358"
FT                   /db_xref="InterPro:IPR019906"
FT                   /db_xref="InterPro:IPR020040"
FT                   /db_xref="InterPro:IPR036789"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM1"
FT                   /protein_id="CBL43963.1"
FT                   /translation="MSRIAKNPIALPAGVKAECSSDQVRISGPLGALEFRFNSDVAVAV
FT                   DGNALRITATESAENSAMSGTTRAILNNMVTGVSKGFERKLELVGVGYRAQAKGNVVSL
FT                   SLGLSHPLDYELPVGVSAATPTQTEIVLKSIDKHLLGHVAAQIRSFRPPEPYKGKGVRY
FT                   AGEVIRQKEAKKK"
FT   CDS_pept        474164..474511
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="HDN1F_03810"
FT                   /product="50S ribosomal protein L18"
FT                   /note="silverDB:HdN1F489"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43964"
FT                   /db_xref="GOA:E1VGM2"
FT                   /db_xref="InterPro:IPR004389"
FT                   /db_xref="InterPro:IPR005484"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM2"
FT                   /protein_id="CBL43964.1"
FT                   /translation="MNAKKVARVRRAKKTRLRVRELGQVRLAVHRTGQHIYAQVISGCG
FT                   GKIIAAASTVEAGFGALGSNKQAAASVGKLIAERAREKGIEKVAFDRSGFKYHGRIQAL
FT                   ADAARESGLQF"
FT   CDS_pept        474524..475024
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HDN1F_03820"
FT                   /product="30S ribosomal protein S5"
FT                   /note="silverDB:HdN1F490"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43965"
FT                   /db_xref="GOA:E1VGM3"
FT                   /db_xref="InterPro:IPR000851"
FT                   /db_xref="InterPro:IPR005324"
FT                   /db_xref="InterPro:IPR005712"
FT                   /db_xref="InterPro:IPR013810"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018192"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM3"
FT                   /protein_id="CBL43965.1"
FT                   /translation="MAKTDEKAEGFQEKLVQVNRVAKVVKGGRIFAFTALTVVGDGKGK
FT                   VGFGRGKAREVPQAIQKALESARKNMIRVELNGTTLQHPVRARHGASAVFMQPASEGTG
FT                   VIAGGAMRAVLEVAGVQNVLAKCYGSTNPVNVVRATYEGLKAMKSPEDIAAKRGKTVEQ
FT                   ILS"
FT   CDS_pept        475033..475212
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="HDN1F_03830"
FT                   /product="50S ribosomal protein L30"
FT                   /note="silverDB:HdN1F616"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43966"
FT                   /db_xref="GOA:E1VGM4"
FT                   /db_xref="InterPro:IPR005996"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM4"
FT                   /protein_id="CBL43966.1"
FT                   /translation="MSDFVTIRLVKSTSGRLKKHQGTVKALGLRRIGHSTQVRDTVEVR
FT                   GMINSVSHLVKVEG"
FT   CDS_pept        475217..475651
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HDN1F_03840"
FT                   /product="ribosomal protein L15"
FT                   /note="silverDB:HdN1F491"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43967"
FT                   /db_xref="GOA:E1VGM5"
FT                   /db_xref="InterPro:IPR001196"
FT                   /db_xref="InterPro:IPR005749"
FT                   /db_xref="InterPro:IPR021131"
FT                   /db_xref="InterPro:IPR030878"
FT                   /db_xref="InterPro:IPR036227"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM5"
FT                   /protein_id="CBL43967.1"
FT                   /translation="MKLNSLAPAPGSKPAKKRLGRGIGSGLGKTSGKGHKGQKARAGGG
FT                   IMPGFEGGQMPIQRRLPKFGFTSRKSLESAEVRLSELAKVEGDVVSVETLKAAGVVRKD
FT                   KRFVRIMASGAVTKPFTVRGVSLSSGAKTAIEAVGGKVEA"
FT   CDS_pept        475655..476995
FT                   /transl_table=11
FT                   /gene="secY"
FT                   /locus_tag="HDN1F_03850"
FT                   /product="Preprotein translocase subunit"
FT                   /note="silverDB:HdN1F493"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43968"
FT                   /db_xref="GOA:E1VGM6"
FT                   /db_xref="InterPro:IPR002208"
FT                   /db_xref="InterPro:IPR023201"
FT                   /db_xref="InterPro:IPR026593"
FT                   /db_xref="InterPro:IPR030659"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM6"
FT                   /protein_id="CBL43968.1"
FT                   /translation="MAKNLPAKAQGGPTQGVSSELIARIKFLLLAMVVYRIGAHIPVPG
FT                   IDPEQLKHMFQQQAGTILSLFNMFSGGALERMSVMALGIMPYISASIIMQLMQAVSPQL
FT                   EQLKKEGEAGRRKISQYTRYGTLGLGVLQSFGMSLALQSQGVTLAVGLAWILPAVLTLT
FT                   TGTMFLMWLGEQITERGIGNGISMIIFAGIVAGLPQAIGQSLESARQGELSEILLVALL
FT                   GVAVLVVAGVVFMERAQRRITIHHARKQQGRAVYQAQQSHLPLKINMAGVIPPIFATSI
FT                   LLFPASLGQWFGETEYASWLQDVANALNPGQPLYVILFAAANVFFCYFYTAIMFNPKDV
FT                   AENLKKSGALVPGIRPGEQTARYIDSVLGRLTFIGSIYITLVCLLPLILQAFGNVPFYL
FT                   GGTSLLIVVVVVMDFMSQVQSHMLSHQYEPLMKKANLKGYGSSGITR"
FT   CDS_pept        477225..477581
FT                   /transl_table=11
FT                   /gene="rpsM"
FT                   /locus_tag="HDN1F_03860"
FT                   /product="30S ribosomal protein S13"
FT                   /note="silverDB:HdN1F624"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43969"
FT                   /db_xref="GOA:E1VGM7"
FT                   /db_xref="InterPro:IPR001892"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR018269"
FT                   /db_xref="InterPro:IPR019980"
FT                   /db_xref="InterPro:IPR027437"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM7"
FT                   /protein_id="CBL43969.1"
FT                   /translation="MARIAGVNIPDNKHAVISLTYIYGVGRTTAQSICSAVGIDPEVKI
FT                   KDLAEAKLDEVRNEVAKYTTEGDLRREISMSIKRLTDLGCYRGLRHRRGLPVRGQRTKT
FT                   NARTRKGPRKQIRK"
FT   CDS_pept        477603..477998
FT                   /transl_table=11
FT                   /gene="rpsK"
FT                   /locus_tag="HDN1F_03870"
FT                   /product="30S ribosomal protein S11"
FT                   /note="silverDB:HdN1F495"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43970"
FT                   /db_xref="GOA:E1VGM8"
FT                   /db_xref="InterPro:IPR001971"
FT                   /db_xref="InterPro:IPR018102"
FT                   /db_xref="InterPro:IPR019981"
FT                   /db_xref="InterPro:IPR036967"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM8"
FT                   /protein_id="CBL43970.1"
FT                   /translation="MAKAKAAARVRKKVKKTVVDGVAHINASFNNTIVTLTDRQGNTLS
FT                   WATAGGSGFRGSRKSTPFAAQVACEKACQLASEYGLKNVDVMVKGPGPGRESAVRALHS
FT                   SGIKVNSITDVTPIPHNGCRPPKKRRV"
FT   CDS_pept        478013..478633
FT                   /transl_table=11
FT                   /gene="rpsD"
FT                   /locus_tag="HDN1F_03880"
FT                   /product="30S ribosomal protein S4"
FT                   /note="silverDB:HdN1F496"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43971"
FT                   /db_xref="GOA:E1VGM9"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGM9"
FT                   /protein_id="CBL43971.1"
FT                   /translation="MARYLGPKCKLSRREGVDLGLKSGVRAHESKCRSEKAPGQHGERR
FT                   GRLSDYGTQLREKQKVRRIYGILEKQFRGYYAEASRRKGSTGENLLQLLESRLDNVVFR
FT                   MGFGATRAEARQLVSHKAILINGKTVNIPSYQLAAGDVVSVREKSKSQLRIGAAQELAE
FT                   QRGFAAWIEVDTKKREGVFKSVPERIDLPSDINENLIVELYSK"
FT   CDS_pept        478659..479663
FT                   /transl_table=11
FT                   /gene="rpoA"
FT                   /locus_tag="HDN1F_03890"
FT                   /product="DNA-directed RNA polymerase alpha subunit"
FT                   /note="silverDB:HdN1F497"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43972"
FT                   /db_xref="GOA:E1VGN0"
FT                   /db_xref="InterPro:IPR011260"
FT                   /db_xref="InterPro:IPR011262"
FT                   /db_xref="InterPro:IPR011263"
FT                   /db_xref="InterPro:IPR011773"
FT                   /db_xref="InterPro:IPR036603"
FT                   /db_xref="InterPro:IPR036643"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN0"
FT                   /protein_id="CBL43972.1"
FT                   /translation="MQRSVSEFLTPKSIAVQQVTATQAKVTLEPLERGFGHTLGNALRR
FT                   ILLSSMPGAAIVEVEIDGVLHEYSTIEGVQEDVLDVLLNLKNVAVKMQDRDEAFLSISK
FT                   EGPGLVTAGDIKCDASVDIVNKAHIIANLSAGTKLNMRVKVVRGRGYCPAEAQLEADES
FT                   KTIGRLMLDASFSPVRRVAYVVENARVEQRTDLDKLVIDLETNGTIDPEEAIRRAATIL
FT                   QQQLSIFVDLEKESLPEPVEEREEIDPILLRPVDDLELTVRSANCLKAENVYYIGDLVQ
FT                   RTEVELLKTPNLGKKSLTEIKDVLASKGLSLGMRLENWPPASLKDDDRVLKKR"
FT   CDS_pept        479706..480092
FT                   /transl_table=11
FT                   /gene="rplQ"
FT                   /locus_tag="HDN1F_03900"
FT                   /product="ribosomal protein L17"
FT                   /note="silverDB:HdN1F498"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43973"
FT                   /db_xref="GOA:E1VGN1"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN1"
FT                   /protein_id="CBL43973.1"
FT                   /translation="MRHGKSGRKFNINSSHRSALFRNLAVALISNEVIKTTLPKAKELR
FT                   RVAEPLITLAKEDSVANRRLAFSRTRDKAAVGKLFTDLGPRFKERPGGYIRILKCGYRA
FT                   GDKAPMALVELVDRPSVDESSEND"
FT   CDS_pept        complement(480160..483048)
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="HDN1F_03910"
FT                   /product="Excinuclease ATPase subunit"
FT                   /note="silverDB:HdN1F500"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43974"
FT                   /db_xref="GOA:E1VGN2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN2"
FT                   /protein_id="CBL43974.1"
FT                   /translation="MDKIIVRGARTHNLKNINLVIPRDKFVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSTYARQFLSIMEKPDVDHIEGLSPAISIEQKSTSHNPRSTVGTVTEI
FT                   HDYLRLLFARVGTPYCPEHHQPLEAQTVSQMVDEVMALSEKQRFMLLAPVIKEKKGGHQ
FT                   QLFENLKAQGFIRARIDGAVIELDEAPSLSKNKKHTIEVIVDRFKVKDGLQTRLAESFE
FT                   TALKLSGGIAIIATMDGTGAERLFSSSFSCPHCNYSLGELEPRLFSFNSPSGACPTCDG
FT                   LGISQYISEKSVITAPSSSLENGAIRGWDKKNFFYHQMLISLSRHYQFNISTPFNQLSA
FT                   KIQSTILHGSGTESIQFRYSNERGDLVTRHHAFEGIIPNIERRYKETESESVREELSHY
FT                   MSTTDCPDCNGSRLNLSARNVYVNSYNLPTIVNFAVTDALEHFSSQHFTGQKKAIADKI
FT                   LKEVIERLQFLANVGLGYLTLNRRAETLSGGEAQRIRLASQIGAGLVGVLYILDEPSIG
FT                   LHQRDNDRLLKSLLRLRDLGNTVIVVEHDEDAIRSADHIIDMGAGAGVHGGNVVAEGKI
FT                   EDILNQPLSLTGRYLSGEEKIEIPTQSLAPNPERMIVLTGANGNNLKDVTLRIPVGLLT
FT                   CITGVSGSGKSTLINGTLYPIAAQTLNGATTTHAEPYEAISGLEHFDSVIDISQQPIGR
FT                   TPRSNPATYTGLFAPIRDLFASTPEARSRGYTAGRFSFNVKGGRCEACQGDGLIKVEMH
FT                   FLPDMYVHCDVCKGQRYNRETLEISYKGKTIHDVLEMTVEVAHEFFSNIPTVTRKLKTL
FT                   VDVGLSYVRLGQSATTLSGGEAQRIKLSKELSRRSTGRSLYILDEPTTGLHFHDIKQLL
FT                   AVLQRLRESGNTIVIIEHNLDVIKTADWIVDLGPEGGKGGGQIIAEASPADLIQIKTNS
FT                   TGIYLARHIDQHNAGIRNPKKEKKPSRKRSAQ"
FT   CDS_pept        483368..483904
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="HDN1F_03920"
FT                   /product="single-stranded DNA binding protein"
FT                   /note="silverDB:HdN1F501"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43975"
FT                   /db_xref="GOA:E1VGN3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN3"
FT                   /protein_id="CBL43975.1"
FT                   /translation="MAKGGINKVILVGNLGNDPETRYLPSGGAVTNISLATSESWRDKE
FT                   TGQTQERTEWHRVVFFNKLAEIAGEYLRKGGKVYVEGALRTRKWQDQNGQDRWSTEIVA
FT                   SDMLLLGGGRSGEGGDFRSGMDEYDRMPERSRDVDRDAGQRRAPAAAPQKREDTSSQRA
FT                   LEGAGADSFDDDIPF"
FT   CDS_pept        484123..485304
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03930"
FT                   /product="phage integrase"
FT                   /note="silverDB:HdN1F502"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43976"
FT                   /db_xref="GOA:E1VGN4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN4"
FT                   /protein_id="CBL43976.1"
FT                   /translation="MKIELVTHKTGEQIPMMLDASGMPVVLPNEFVLSRRSLSTNTLVR
FT                   NLRELSVLYRWLDKSNCDLSAKLLAQNSFNEAELKGGLVEALRIDQANGRISAVAPNTF
FT                   NQRLTTIRQFFSWCMDVLTSQLPLSSLDYERLRERKSFLLKTLDGSFMSATPMRKSIRK
FT                   GLNEAEVDFLLAVLHPDAEQGYGRDSAVKFRNYVSVGLMLFCGLRPGELLSLRVEDVQV
FT                   GAISAIKVERRPADPLDVRRPRPQIKRNGRVIPIENRQLAFALNEYIVTWREVLESKSQ
FT                   NESDYLILSDEGSPLSQSSITQFFQLLRSQYADHLPENLTAKSLRHTFSSRLERVLRAS
FT                   GMDEQRRREALALLRGDSSLDSQDIYIAQEVEEQAIKSLKRYQAEIMSGRMPE"
FT   CDS_pept        485301..486884
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03940"
FT                   /product="Phage integrase, probable truncated"
FT                   /note="silverDB:HdN1F503"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43977"
FT                   /db_xref="GOA:E1VGN5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN5"
FT                   /protein_id="CBL43977.1"
FT                   /translation="MNKILSKPQAVEQSWPEIEKLITREGKEVDISGDTWRLPYSARDN
FT                   STLNFTKITNSEIREAFKDHVADRLKRISTHAGYAAYQDVWREVLRHWGSPVSQVDTES
FT                   HLIGLFETAINRARSRKRLWAMYRPIQWYIWSADNKPECGFSEIYAQELEALELPGNPK
FT                   GEAVRMEDPESGPLHKSLELPLLINALKSDEGRSLGYLQQRVVVALSIAFGRNPANLTF
FT                   LRESDFECLVPGGEDPCYIIRMPRIKKRFVNPRDDLLDEYLDPHFGAMIEQLIEISKLV
FT                   PLSFADRAFVIPEERPLLINRNGNKAAILSKDIDNVFNLTSSDIARLLSAFVKRHNIIS
FT                   PLTGELLHVTPRRLRYTLATGLAAEGISKRELARILDHTDTQHVNVYFEMAGKIVEHLD
FT                   KATAKGFSKYLSFFKGRLIDNDEDAVNGERDDKHLTFVDEQNPNDQADIGVCGESSVCH
FT                   LDPPYSCYLCPKFQPYRHADHEHVLECLLAGREERLKKYENARLGIQLDEVIAAVAQVA
FT                   KLCEKGVHNV"
FT   CDS_pept        486877..488886
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03950"
FT                   /product="putative integrase"
FT                   /note="silverDB:HdN1F505"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43978"
FT                   /db_xref="GOA:E1VGN6"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN6"
FT                   /protein_id="CBL43978.1"
FT                   /translation="MSDGRSNRKAKVVPFVDRLERDRNENLNSLVSKAKLIKLEGFESV
FT                   VWEDPEWQVNAGRLVKLTGKNTKSVSFGFSLSPRLGSEPLVGCWELVAKALFVLRFHRK
FT                   HQSAPNQRSFITAIGYVSYAAEQLGQELVGLTPEALDNASGLISKHYSETTAYNLHKHV
FT                   AEFAAHCDSNGLCRVLFQYKYAKMKRPASTGGINYKRLDDPEVLDTKSDKLVDPAVFRV
FT                   IGELYLNVPKEHKYRFYILMLTLLACTGRRFSEISLLPNQQLSSDEDGNAYIEYFPRKA
FT                   SRGDVFTPKRRLYLPSEVTPIVGDVLVELAEITFEARLTAEETHKVGEPDLRFLDGIPE
FT                   DKKLYAADLTELGISHTLLGTTGWLRKQNLAWPDHSALTKQGIKPANPIFYTYKGGLVE
FT                   YCFRDFSGAYLSALHTDQFGKEYYLKDLLFIRSLGLSSGSYAHWLATSCSQSMFTTFLR
FT                   YFPALAAEYASSSIEVDFTSHHFRHTLNTLLDEGGLSDLLQTEWFGRTNPRDTKAYQHT
FT                   SREKRALMLRDDIKKGLVGGQLAEQIKVVPVEVQDAILKARIQAVHDVGTGICIHNFSQ
FT                   TPCERHLQCSADCKDYVWAKDDKGRLDEQKRQYALTALARKNAEKQLDSAKPKKSADWL
FT                   AHSDKKLKTLASQLADNGVEHFDPEQYLHEVEHG"
FT   CDS_pept        488879..489355
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03960"
FT                   /product="Protein kinase"
FT                   /note="silverDB:HdN1F506"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43979"
FT                   /db_xref="GOA:E1VGN7"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN7"
FT                   /protein_id="CBL43979.1"
FT                   /translation="MVKRFRRMSDSDINTIVADLDRWALGELGSKLTWAVLEERFGFSR
FT                   QSLQAKTEIKAAYDNAKQALSGGLVKTKEQATKEAEELQVEVDRLKAELDAYKRKEEQW
FT                   LRRWQQIAFHVRQKGIQMASVDKVPPEGADLPSNTETAQILRPFDKEVPPSGRV"
FT   CDS_pept        489416..490561
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03970"
FT                   /product="lambda C1 repressor like protein"
FT                   /note="silverDB:HdN1F507"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43980"
FT                   /db_xref="GOA:E1VGN8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN8"
FT                   /protein_id="CBL43980.1"
FT                   /translation="MQKRLNTDKAQQAIDKAGLTQTAVADALGVTKEAVSQWLLHKSFP
FT                   RPNKLLQLGKLLNLAFDDLIIKEDPHAPKVAFRKMRGTKTRDHHIEKAQEIGRFLRHLV
FT                   PYLPFDTFEMPPVLKSPSCDYDYLRTVTAKVREDINLGPIECVDFTHLIHRFSELQAVV
FT                   VPVMWGAKQRHENAVHIHLPDSGSTWVYLNLDTNIHDFKFWMAHELGHCLSPSLEGDDA
FT                   EDFADAFAASLLYPHELAEQAYASIMSQASPAAKITHVIGLADQLTISPWTVIGQVNKY
FT                   AESAGQPQIQLSKSAFPGAVTNFNKKYKNLSEALFGNTELDEHGHPSARDYIEKAEGAF
FT                   ETPFFDLLRKYLKEHDKGPGYVQTVLDMPLLDARSIHAELI"
FT   CDS_pept        490561..491112
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03980"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F508"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43981"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGN9"
FT                   /protein_id="CBL43981.1"
FT                   /translation="MPQSKILVDTNAYLRLAKTIRPLLFVPFGDNVYCLYILPELNDEL
FT                   GTRKLQSKFPWVDDEEFAENRKHFPQIGKRQKKSIQQSFEYVWDHVQTELLGPSRVDAW
FT                   YIAYALELGVPVVTDDQDMTELAKAFDAQVMPTLELLKIMLDCGHTDMKTINGLVEYWK
FT                   YFSDMPANFKVDYQRLFGDQ"
FT   CDS_pept        491210..491434
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_03990"
FT                   /product="Excisionase, phage related"
FT                   /note="silverDB:HdN1F509"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43982"
FT                   /db_xref="GOA:E1VGP0"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP0"
FT                   /protein_id="CBL43982.1"
FT                   /translation="MSDPILTIKDVADYLKVNERTIYRLAASGELPGFKVGNSWRFKQS
FT                   ELEQYIAAQHNRASVSEAMKSANSKSEDN"
FT   CDS_pept        491447..493588
FT                   /transl_table=11
FT                   /gene="hsdM1"
FT                   /locus_tag="HDN1F_04000"
FT                   /product="Type I restriction-modification system
FT                   methyltransferase subunit"
FT                   /note="silverDB:HdN1F510"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43983"
FT                   /db_xref="GOA:E1VGP1"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP1"
FT                   /protein_id="CBL43983.1"
FT                   /translation="MAQLENIEAIEKRLWKSADTLRANSELASNEYFLPVMGLIFLRHA
FT                   YSRYLSVKDEIVATLPSRGGKTRELTKEDFSKKSAIYLKPEAQFDYLIALTDADNRAEA
FT                   IIHAMDSIEADYTNLRNQLPKQEYNNIPNDVLGMLLRTLNPEELKKATGDIFGRIYEYF
FT                   LTQFADQGAHDGGEFFTPVSLVQLIVNVLEPDHGKIFDPACGSGGMFVQSAHFMERHAQ
FT                   DPHELTFYGHEKNRVTTRLAKMNLAVHGLEGNVEGGEAAITYYNDPHEGLFGTVDYVMA
FT                   NPPFNVDEVDADKIKGDKRRLPFGLPGVNKNKKVSNANYLWIQYFYSYLNDTGRAGFVM
FT                   SSQASSAGRDEAKVREQLVKTGHVDIMVDIRGNFFYTRTVPCQLWFLNKNKPAHLKDKV
FT                   LMLDARNVYRKVTRKIYDFSPEQQQNLTAVVWLYRGEGERFVELVQQYIDKSIFEARSC
FT                   EQSEALACEPVPDFIIQLEKLSQAFQPFMDKLEQNGVSVEPYVDFLNAKGSVEGGWSAF
FT                   QILTNDLQKWWNEYEYNDAASLLDFIDKDVCLKDLAEQSRNLIKEIDLAYKLATRVIEL
FT                   AEVNDAKDSELWDNTLLNGRGRSNLKKNADEARKLAVEQLKQVRYFYKQAHWLLSRFPE
FT                   GKLCDVEGLVKLVDIKDIEAADWSLTPGRYVGVAPEEVDEDFDFEEALRDIHIELQGLN
FT                   AEAAELAEKIARNFEELGV"
FT   CDS_pept        493585..494784
FT                   /transl_table=11
FT                   /gene="hsdS1"
FT                   /locus_tag="HDN1F_04010"
FT                   /product="Type I restriction-modification system
FT                   specificity subunit"
FT                   /note="silverDB:HdN1F511"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43984"
FT                   /db_xref="GOA:E1VGP2"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP2"
FT                   /protein_id="CBL43984.1"
FT                   /translation="MSWISAPLSDFCIDVKSGGTPSSHVESYYGGEIPWLRTQEVVFKK
FT                   ILDTELKITDEGLNNSSAKWIPENSVIVAMYGNSAGRSAVNKIPLTTNQACCNLIIDDE
FT                   TSDYRYVFYALCKSYEELKSLSKGAAQNNLNAAQVKSFNIPKPPKKVQEKIGDILSSYD
FT                   DLIENNRRRIQLLEESARLLYQEWFVHLRFPGHEQVKIIDGVPEGWSSGVLSDFFETSS
FT                   GGTPSRKIPEFYAGDIPWVKTQELNDSYIFNTSEKISEEAIIKSSAKLFPAGTVLIAMY
FT                   GATIGETGVLAISAASNQACCALFPKNKELTTEFTHLFAMNSKQGLINLSQGAAQNNIS
FT                   QQIIRNFPFVLPSELILKEFNDVVSNIYNQKFNLERQNISLLKARDLLLPKLMSGELTV
FT                   "
FT   CDS_pept        494799..496931
FT                   /transl_table=11
FT                   /gene="recQ2"
FT                   /locus_tag="HDN1F_04020"
FT                   /product="ATP-dependent DNA helicase"
FT                   /note="silverDB:HdN1F512"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43985"
FT                   /db_xref="GOA:E1VGP3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP3"
FT                   /protein_id="CBL43985.1"
FT                   /translation="MNRTQAQQLLKTALANPAAEFRDGQWEAIDALVNHRQKLLVVQRT
FT                   GWGKSSVYFISTKIFRDRGMGPTIIVSPLLALMRNQIESAQRLGIVAETMNSTNQNDWQ
FT                   AVTQQILNNQVDGLLISPERLANDNFIESVLQPIADRIALMVIDEAHCISDWGHDFRPD
FT                   YRRIVNILRQLPANTPVLGTTATANNRVVEDIQAQLGDIQIHRGPLTRESLALQTMILP
FT                   DQASRLAWLAQVIPTLPGTGIVYVLTQRDADMVAKWLNQQGVSAFAYYSGVTHPNFVNN
FT                   AGKEDTDLYRQFLETQLLENNIKVLVATTALGMGYDKPDLGFVLHYQAPSSIVAYYQQV
FT                   GRAGRGIENAIGVLMSGTEDNDIHAFFRRTAFPSQDDVQRLLAALDDADGLSLEKLEKE
FT                   ANLPQKRIEHVLKYLRTESPSPVIAIGKTWFRAPVRYQMDLEHIRKITAIREREWSEIN
FT                   DYLNTSGCLMLALRNALDDPSQEACGKCENCIAEPVLTKVFDQEIGIRATQFLRHSEEI
FT                   IKPRKQIAASNDEAARTFVEYEFPRNLGDLVAQEGRVLSRWGDAGWGRTVADNKHAGRF
FT                   SDELVEAMAEMIQQRWQPDPAPQWVCCVPSRNHPELVPDFARRLAARLDLPFVDAVSKV
FT                   KDNQPQKGQQNRFHQCRNLDGAFAVTQLYQGQPVLLVDDIVDSGWTLTVVAALLQQAGS
FT                   GVVYPVALASSSVKDS"
FT   CDS_pept        496928..498313
FT                   /transl_table=11
FT                   /gene="smf"
FT                   /locus_tag="HDN1F_04030"
FT                   /product="predicted Rossmann fold nucleotide-binding
FT                   protein involved in DNA uptake"
FT                   /note="silverDB:HdN1F513"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43986"
FT                   /db_xref="GOA:E1VGP4"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP4"
FT                   /protein_id="CBL43986.1"
FT                   /translation="MNVSRFSSADGSLPANGSLSPTAQATLLLTSYFSKASSESAKPLT
FT                   NAEWGRFALWLKEKATTPADLLVSDPKALLQGWHDARISAERIIKLLNRGHSLALAMEK
FT                   WQRAGLWVVTRSDPEYPKRLKQRLKTDSPPVLFGCGNKALLNTGGLAVIGSRNASEADL
FT                   AFTDQVGAKAAKEGIAIVSGGARGVDETAMLGAMKQGGVVIGVMADSLLKAATSSKWRK
FT                   GLMDDHAVLVSPFYPEAGFSAGNAMARNKYIYCLADSSLVIHSGKKGGTLNGAEENLKK
FT                   AWVPLWVKQTTDKDAANADLVTKGGRWLEADTQAFKIAELMCNEGGPVNQVKEQMGDLF
FT                   SMPAQPELFFEPESNPEPESGPEEVIESEREIVVSESQTKIQAIPEQTAESEAAPSGPV
FT                   DFYQMFISELQHLAEKPVTVDALIESTQLNKSQLTEWLKRAVDDEQVKKLNRPVRYQVK
FT                   NKK"
FT   CDS_pept        498326..501568
FT                   /transl_table=11
FT                   /gene="hsdR1"
FT                   /locus_tag="HDN1F_04040"
FT                   /product="Type I restriction-modification system
FT                   restriction subunit"
FT                   /note="silverDB:HdN1F514"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43987"
FT                   /db_xref="GOA:E1VGP5"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP5"
FT                   /protein_id="CBL43987.1"
FT                   /translation="MAMTEETLVQEVTADYLLNQLHWDESVLGMYEKLGKEGDLGRLSE
FT                   QEVVLTRYLGEKLIELNPGLPDVAYQEALRVVCEMPASTNIVAVNKEKYSLHKNGVEVS
FT                   FHNDKGERVKKRLRLFDFDNYENNHFLLVREFWIKGDIYRRRADLAGFVNGIPLLFMEV
FT                   KNVHKDIRAAYEQNLADYKDTVPHLFYHNAFIILGNGIDAKIGSVSSKFEHFNDWKRLK
FT                   ENEPGVVDMETLLKGTCSKPNLMDIFENFTLFDQSSGRLVKIVARNHQYLGVIRAIDAV
FT                   VNRGERLGKLGVFWHTQGSGKSYSIVFFAQMVHRKLGGNYTFVVLTDREDLDTQIYKTF
FT                   AGCGLVDNDKDPCRADSGKDLKALIGQQKAFVFTLIQKFNEKVDPKKPYSERDDIIVIT
FT                   DEAHRTQYGTLSLNMRNALPNASFIGFTGTPLFKDDEITKKVFGDYISTYDFQRAVEDK
FT                   ATVPLYYDARGEELVFTDEDGNEHTVADPKGINERIAEKLDELEIEDVDVQQRLERELK
FT                   RDYHIITATSRLDQIARDFVTHYANAWETGKAMFVCLDKITCVRMHKLINFYWQQEIKT
FT                   KEKALLSATDEQELAWRERQLAWMKETLMAVVVSEEQGEVAKFEKWGLDIKPHRQLLKA
FT                   GFELADGSRLDMEEAFKSNEHPFRVAVVCAMWLTGFDVPTLSTLYLDKPLKAHTLMQAI
FT                   ARANRVAEGKNNGLIVDYCGILKNLRKALATFAGASDEGHGGGEGENEPAKPNEELLES
FT                   LNESISFVADFLRKHDFELSRIITETGFAKNAAIAQAKEIINQNDETRKRFEVMAREVF
FT                   NKFKACINVPGVNGYRDMRDAINVLYKSLQADKEKADISDIMKELYEIVAGSIDTTHKV
FT                   KEPKPDGDRIYDISKIDFERLRQEFSRSERKNTTVQSLKHAVEKKLARLMMQNPLRTDY
FT                   QEHYEKLVKEYNQEKDRVVIEKTFEALLKLNEELSHEERRAIREGLDEESLVLFDLLSK
FT                   PSLQPKEIAKIKQVATTLLATLKAERLKVANWQQKESTRDAVKQQIFDFLYDERTGLPV
FT                   EQYEEDEISHITERVFLHIYRAYPELPSPIYR"
FT   CDS_pept        502285..503028
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04050"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F515"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43988"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP6"
FT                   /protein_id="CBL43988.1"
FT                   /translation="MKIGTYLLVGGFALVLFGIALLPASLIWQMVGPGVAASIPFKIEK
FT                   VGGTAWDGFVVGRPIGAFTDRVAVQWEWLPARLVTGKLGFYLEAESADFRASGVVYKGV
FT                   SGEGAHNVSGVMNVAMLDPFLKGLGASATGAVSIGDGVVVVNSERQITEAGGELVWREA
FT                   SVRTSLGDGLQTYTLPAISGVVAQRPEGTFVEVKQVDGGLPLGELGISSDGIFSATVLQ
FT                   RVMKLVGMQTSDENKVLIRTQQPLF"
FT   CDS_pept        503298..504284
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04060"
FT                   /product="similar to Type II secretory pathway component
FT                   PulC"
FT                   /note="silverDB:HdN1F516"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43989"
FT                   /db_xref="GOA:E1VGP7"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP7"
FT                   /protein_id="CBL43989.1"
FT                   /translation="MAQTPAASQVWINRAFSWLSLALVVAIAYLLVKLTYLFWMPSATD
FT                   VPPSFYSQSSGKQGGPAVSALRVDTAAIPLWNLFGREGAGNVAAVTPANVDAPITSLQL
FT                   ELQGVFVAPNEDNSAAIIAEKMREANLYRIGEAVPGNATLAAILSDRVLLNTQGRTEAL
FT                   YFPDGGANAGGGAKILSRSGVGAAAAAQGAGGGGASTMSSLRSGGPATPVPSGGGALGL
FT                   MSGNITSTEDLARAVREELGSNPQQALKELGLEMNAGNGYKVGASGNPVFSALGARPGD
FT                   EILSLNGRPLGNPESDLNMIESACDSGSITIELSRGGKRFSTQVPCP"
FT   CDS_pept        504303..506468
FT                   /transl_table=11
FT                   /gene="gspD"
FT                   /locus_tag="HDN1F_04070"
FT                   /product="General secretion pathway D protein, outer
FT                   membrane secretin"
FT                   /note="silverDB:HdN1F517"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43990"
FT                   /db_xref="GOA:E1VGP8"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP8"
FT                   /protein_id="CBL43990.1"
FT                   /translation="MFNSWIRDVAPAWVRGSCLAVMLTFTAGVLASSAIAEEPEPTWRI
FT                   NMKQADIRQLIELVSEATGNSFIVDPRVKGNITVISDTEMSKKEIMEMFESVLKVHNFA
FT                   TVRTGKMLKIIPTQMAKQDNVPIEKPDRDSDLFITQVIPVRFASATELVPILRPLIPQY
FT                   GHLAAVTSANALIISDHSDNVQRMIDIVRRLDTSESEESEVIQLKNAWVGDVVKMLEQL
FT                   GSGGSKAGGGSAGGSGRVKAVADERTNRLILRGDRDARRKLHALVLDLDRPGEHSISTR
FT                   VIYLRYADAVKISEVLRGIVTGQATTPTSTTAGGMQTASRTPGSSFGNSSAGLGGNSSM
FT                   GMSGAGVSSSTSRQRGTSTPIQAGNITIQADDTLNALVVRASPSDMGEIRSLIKQLDVR
FT                   RAQVLIEAAIVEVTGSAGNSLGVQWGAANENRVVGGTNFSNVGNSISALLGAALSSSGS
FT                   DSTGTTSSTTTTMPTLSNGITLGGGHRNSAGKVDFGLILQAVNTASNTNVLSTPSIMTL
FT                   DNEEAEILVGQNVPFITGNQLSYSGTNPFQTVERKDVGLNLKVIPQVNAGDTISLRVTQ
FT                   EASSIADSSNVKTTDVITNKRLINTTILASDGQVIVLGGLMEDTLSDAVQKVPLLGDIP
FT                   LIGALFRSTSKVQEKRNLLLFLRPTVIRDDAKAESVMDRKYGQIRGAALDRDSIGEIEL
FT                   DVNELLNKTAHETLDRGSDAFSAGGRP"
FT   CDS_pept        complement(506634..507404)
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="HDN1F_04080"
FT                   /product="competence protein ComF"
FT                   /note="silverDB:HdN1F518"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43991"
FT                   /db_xref="GOA:E1VGP9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGP9"
FT                   /protein_id="CBL43991.1"
FT                   /translation="MKTPNNTLQHYAAKWLALSQRCEICRASAHKSNTNSTVPLCSNCK
FT                   QQLPWISRSCRSCGEPITNHTLCARCKQQALPFLEVIIPLRYDFPINHWIGTFKYQTAP
FT                   GMAFWLAQILSEQVLARGSGFLPRSPNCTPTIISGIPSHPQKQRQRGYNQSQLLARHVA
FT                   KQLQLPIDFSLTKKVRNTANQRTLNAGARHVNLIDAFEVTPKGNTYLQISSANVILIDD
FT                   VVTTGATSAELAHCLLKAGANSVSLWALAKTPLS"
FT   CDS_pept        507657..508718
FT                   /transl_table=11
FT                   /gene="bioB"
FT                   /locus_tag="HDN1F_04090"
FT                   /product="Biotin synthase"
FT                   /EC_number="2.8.1.6"
FT                   /note="silverDB:HdN1F519"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43992"
FT                   /db_xref="GOA:E1VGQ0"
FT                   /db_xref="InterPro:IPR002684"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010722"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR024177"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ0"
FT                   /protein_id="CBL43992.1"
FT                   /translation="MTLRHDWTVNEIEALYALPFNDLLFRAHTVHRQYHDPNAVQVSTL
FT                   LSIKTGACPEDCKYCSQSGHYNTGLEKEKLLEIEKVVDQAKSAQAGGASRFCMGAAWRS
FT                   PREKDMPYVLEMVRQVKALGLETCMTLGMLSHDQAFALAEAGLDYYNHNLDTSPEHYKS
FT                   IITTRTYQDRLDTLAHVRDAGMKVCCGGILGLGEARKDRAGLLMALANLQVHPDSVPIN
FT                   MLVKVAGTPLSGVEDLDPFEFVRTIAVARILMPQSFVRLSAGREKMNEQMQAMCFFAGA
FT                   NSIFYGDKLLTTSNAETSADQQLFEKLGIHPLHPVAQPSDEAHVAAIERAVEQQKFQHL
FT                   VTDAAAGRSASVN"
FT   CDS_pept        508728..509912
FT                   /transl_table=11
FT                   /gene="bioF"
FT                   /locus_tag="HDN1F_04100"
FT                   /product="Aminotransferase class-I"
FT                   /EC_number="2.3.1.47"
FT                   /note="silverDB:HdN1F522"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43993"
FT                   /db_xref="GOA:E1VGQ1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR022834"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ1"
FT                   /protein_id="CBL43993.1"
FT                   /translation="MAKPFDFRSELDALLQRQRYRRRRILSSAQGVNALVGGKSVRVFC
FT                   SNDYLGLASHPKVTKAFQDAAGRFGVGSGASHLVVGHHALHHELEEALAARVGAPRALL
FT                   FSSGYAANLGVIAALVGRRDVLLQDKWNHASLLDGGQLCGAKFHRYGHLDLDGLQRRLD
FT                   AVDEQQHCLVATDSVFSMDGDIAPLPRISALCASRNAWLMVDDAHGFGVLGEGRGTPQA
FT                   LGCAEGVPVYMATLGKAIGVGGAFVAGNDSLIEYLIQRARTYIYTTALPPAMAAACLAS
FT                   LRLLDEEAWRRDHLRMLIERFQRGAQHLGLRVGASQTAIQPLMLGADAAAVEASEWLWE
FT                   EGFFVSAIRPPTVPEGSARLRITLSADHSEQDVDDLLCALAALPLESGEPHGNE"
FT   CDS_pept        509965..510738
FT                   /transl_table=11
FT                   /gene="bioH"
FT                   /locus_tag="HDN1F_04110"
FT                   /product="Carboxylesterase, biotin synthesis protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="silverDB:HdN1F523"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43994"
FT                   /db_xref="GOA:E1VGQ2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ2"
FT                   /protein_id="CBL43994.1"
FT                   /translation="MSEYAIVLLSGWGVRSCVWDAVRPTFERYARVFRLDLGELASCAA
FT                   AQGRSITLDVLVDLLAEATPERAVWIGWSLGGMVAARFAVRWPERVAALVTVATNPCFT
FT                   ARETWRQAMPEAEFLDFSRRFERDVEGALQRFLTLQCSGSETARVDARALKACVSPCDG
FT                   DTLKWLQDGLRILRDADLREDYQRIDVPSMHLLGENDALVPAGVAEDILRLQPGARVRV
FT                   MQGLSHVPFVSAPRVFAGLVEEFLGGCYAGRSSRA"
FT   CDS_pept        510740..511600
FT                   /transl_table=11
FT                   /gene="bioC"
FT                   /locus_tag="HDN1F_04120"
FT                   /product="Biotin synthesis protein"
FT                   /note="silverDB:HdN1F524"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43995"
FT                   /db_xref="GOA:E1VGQ3"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ3"
FT                   /protein_id="CBL43995.1"
FT                   /translation="MDEGENLESEGRLEQKPEGVVQVDKSRVASSFGRAAERYDSVAYL
FT                   QRLVADQLLEWAQLSDVTGLVLDVGCGTGYVAKQVLRDYPALACLGLDIAEGMLQYAQR
FT                   DQSNDAGKVHWLCADAERLPLADSSIAAAVSNFALQWCPNLSNALTEVFRVLVPGGRLL
FT                   MTLPAHDTLRELKESWRRADTSYSHVNEFPDEERVLRDIAAGGLRVRRAARISRCAYYP
FT                   SVVDLTMELKTLGAQNATLGRNRAMTSKRRYQDMLAHYERFRCANGKLPATWRILAFEL
FT                   EKPRD"
FT   CDS_pept        511650..512315
FT                   /transl_table=11
FT                   /gene="bioD"
FT                   /locus_tag="HDN1F_04130"
FT                   /product="Copyrinic acid a,c-diamide synthase:dethiobiotin
FT                   synthetase"
FT                   /note="silverDB:HdN1F525"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43996"
FT                   /db_xref="GOA:E1VGQ4"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ4"
FT                   /protein_id="CBL43996.1"
FT                   /translation="MSCTVLDAVRALGISAFGLKPVAAGGEVVDGKLCNEDALALMRHS
FT                   FPVPAYDEVNPCLLASPIAPHIAAREEGRTLAVEPLLRHCRDQLAARDGFALVEGAGGW
FT                   RVPLNERECLSDLAIALRLPVLLVVPIQLGCLNHTLLTAEAIRRDGLTIAGWVANKVSP
FT                   VYSPSEQNILTLEDRLGLPCLARFPLLSASYTDLKEGDFNPLLPFLDVRPLLENSRIA"
FT   CDS_pept        complement(512388..513617)
FT                   /transl_table=11
FT                   /gene="serA"
FT                   /locus_tag="HDN1F_04140"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /note="silverDB:HdN1F526"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43997"
FT                   /db_xref="GOA:E1VGQ5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ5"
FT                   /protein_id="CBL43997.1"
FT                   /translation="MSKHSLDKSKIRILLLEGVSQLAVENFERNGYTNIEYHKAALPLE
FT                   DLKKSIAEAHFVGLRSRTKLTEEVFAAAQKLMAVGCFCIGTNQVDLNAATVRGIPVFNA
FT                   PYSNTRSVAELVLAEAILLLRGIPEKNAKAHRGEWDKSATNSFEIRGKTLGIIGYGNIG
FT                   SQLSVLAEALGMHVIFFDVVSKLPLGNASQVHTMDELFQRSDVVSLHVPDVPSTRNMIG
FT                   KAHFDLMKETAIFINASRGTVVDLDALAQAVRDKKMIGAAIDVFPVEPRNNQEEFVSPL
FT                   REFDNIILTPHIGGSTIEAQENIGLEVSEKFVKYSDNGTTISSVNFPEVSLAGHANVHR
FT                   LLHIHKNVPGVMSAINRVFSENNINIAGQYLRTNDKIGYVVIEVEAGSSEVALQKLREV
FT                   EGTIRTRVLF"
FT   CDS_pept        513804..515198
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04150"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="silverDB:HdN1F528"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43998"
FT                   /db_xref="GOA:E1VGQ6"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ6"
FT                   /protein_id="CBL43998.1"
FT                   /translation="MTDSSAVIQGLAALLDDGRLKTDADSLAFWGCDRTKMYTPAPLAV
FT                   VFPKTVEQVQAIVRYANEHRLALVPSGGRTGLSASAVACHGEVVVSFDLMNQILKFDAT
FT                   DRSVVCQAGVVTQQLQQFAEAQGLYYPVDFASAGSSQLGGNISTNAGGIKVIRYGMTRN
FT                   WVSGLKVVTGAGDLLELNRGLAKNATGYDLRQLFIGGEGTLGFVVEATMQLARTPKNLT
FT                   VMVLGVPAFAALMEVLGAFQAKMDLTAFEFFSDKAVDLVCAHSNVPRPFATATPYYALL
FT                   EFEATSAEVGETAMAVFEECVENGWALDGVISQSETQLKNLWRLREDISETISVFTPYK
FT                   NDISVVVSKVPHFLEDIDRIVSAEYPDFEIVWFGHIGDGNLHLNILKPKELAPSVFFER
FT                   CKTVNRWVFETVQKYAGSISAEHGVGMTKKPYLEYSRSAQEIAYMKAIKQVFDPNGVMN
FT                   PGKVFD"
FT   CDS_pept        515238..515915
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04160"
FT                   /product="4-hydroxyphenylacetate degradation bifunctional
FT                   isomerase/decarboxylase"
FT                   /note="silverDB:HdN1F529"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL43999"
FT                   /db_xref="GOA:E1VGQ7"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ7"
FT                   /protein_id="CBL43999.1"
FT                   /translation="MSECGSGHYRHVLNDAPCELPVGKVVCVGRNYAAHAKELNNPVPE
FT                   SPIIFIKPATSIQPLSEPIRWPGGLGSCHHELEISILIGARVTKQSASEVVGHIAGIGL
FT                   GLDLTLRDLQNQLKAKGQPWELAKAFDGACPLSGFVLPAEFRDLSNIQLALRINGELRQ
FT                   QGNSSDMLTPITELIAYISQYITLEAGDVVLTGTPAGVGPFQSGDQLTLILDERFQFGA
FT                   KVA"
FT   CDS_pept        515982..516719
FT                   /transl_table=11
FT                   /gene="cysH"
FT                   /locus_tag="HDN1F_04170"
FT                   /product="Phosphoadenosine phosphosulfate reductase"
FT                   /note="silverDB:HdN1F530"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44000"
FT                   /db_xref="GOA:E1VGQ8"
FT                   /db_xref="InterPro:IPR002500"
FT                   /db_xref="InterPro:IPR004511"
FT                   /db_xref="InterPro:IPR011798"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ8"
FT                   /protein_id="CBL44000.1"
FT                   /translation="MEFDMTITAADVQAWNESLKDASPRQILEFAFDKFDNYAISFSGA
FT                   EDVVLVDIAHRINKNVKVFTLDTGRLHVETYQYLETVRDHYGIGIEVMFPEPAAVESLV
FT                   NEKGLFSFYREGHKECCGIRKVQPLKRKLSTLDAWVTGQRHDQSPTRSDVPVVQLDTGL
FT                   AAPGQTLVKFNPLANWSSARVWNYIRTNEVPFNPLHERGFISIGCAPCTRPVLPNQHER
FT                   EGRWWWEDATKKECGLHAINIHD"
FT   CDS_pept        complement(516756..517700)
FT                   /transl_table=11
FT                   /gene="alkR"
FT                   /locus_tag="HDN1F_04180"
FT                   /product="Putative araC-like transcription regulator"
FT                   /note="silverDB:HdN1F531"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44001"
FT                   /db_xref="GOA:E1VGQ9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032783"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGQ9"
FT                   /protein_id="CBL44001.1"
FT                   /translation="MDALSHILDDIHLSGAEYIYVAGKGEWSVALKGQTTFHIVLKGPA
FT                   RLSLPGHGDHVLETGDIAFIPAGHEHHLTHLQSAPPTAYHWLAPEFRGHRNDPVVVGEG
FT                   LDTNLILSVRCLLDSDMGKPLLTSLPACMLIRQGLDGSGPEWLKLGLSFLSLEAEIFRA
FT                   GRDTLINRLIGMFLIECVRDYVEQIPDAANNWLSAVRDPYLSQSLSAIHADPARSWSVA
FT                   ELAELACLSRSAFHERFSDTIGMAPLTYLTEHRLRLAARHLSQRDLSINKIAERVGYGS
FT                   ETAFSQAFRRKYEMTPSQFRKNKLGATEIDNKR"
FT   CDS_pept        517998..519269
FT                   /transl_table=11
FT                   /gene="alkM"
FT                   /locus_tag="HDN1F_04190"
FT                   /product="alkane 1-monooxygenase"
FT                   /note="silverDB:HdN1F532"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44002"
FT                   /db_xref="GOA:E1VGR0"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR033885"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR0"
FT                   /protein_id="CBL44002.1"
FT                   /translation="MNAKTPDDVLNQTANEQRKSKWKDPKRYKWLLSPALPVIGIAALS
FT                   AYAIAPKKLRALAWTGPLLVHGVIPALDRMIGEDETNPPEDAIRELESDPYYNLISKAF
FT                   IPSQWVMTIIGAWLATRKNVPMMDRVGLTLSVGALNGIAIVTGHELGHKHERHNRVSAM
FT                   FALAPTFYTHFAVEHNFGHHRRVSTPEDPASSRMGESFWKFLPRTVIEGFKSAVEIETK
FT                   RLERKGKGFWTLENELLQGWAVTAGFVGLTTAICGPRAIPFLVAQGAYGASLLEVVNYV
FT                   EHYGLLRQKDENGKYERTSPEHSWNSNFVVTNLVLYQLQRHSDHHAFPTRSFQALRHFP
FT                   EAPQLPGGYASMLLPAYIPSWWFALMDQRVVDHYQGDITKANLDPERREELIKKWSKVS
FT                   EAQIVDSAEEGSPAEDSMEGAAVA"
FT   CDS_pept        519297..519569
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04200"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F534"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44003"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR1"
FT                   /protein_id="CBL44003.1"
FT                   /translation="MKASVSCNKPPLDRPISKGNPARYWATSELYLHIKLYDIPRIFAK
FT                   FVNALKSASSPTLHCRGKLLFSSTAGKKHEQALCAFPVHQGWLIT"
FT   CDS_pept        519641..519844
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04210"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F533"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44004"
FT                   /db_xref="GOA:E1VGR2"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR2"
FT                   /protein_id="CBL44004.1"
FT                   /translation="MPTLFVVFAVFIFVALILLWLGFYCCFSEVFLVIRNLLLLAFLVV
FT                   FYRVFLLAFFVVLVVLCLSYCF"
FT   CDS_pept        complement(520494..520775)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04220"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F535"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44005"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR3"
FT                   /protein_id="CBL44005.1"
FT                   /translation="MQRASRSLPSRHLPPSSLPQSDLTRHHDRQATVSWGKNRIFAPTL
FT                   HPYWPSCVANPEQTCYPKTGTIVPTCYRERYRVTGIQEHSATVQVTDS"
FT   CDS_pept        complement(520886..522322)
FT                   /transl_table=11
FT                   /gene="crbB"
FT                   /locus_tag="HDN1F_04230"
FT                   /product="two-component response regulator"
FT                   /note="silverDB:HdN1F537"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44006"
FT                   /db_xref="GOA:E1VGR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR4"
FT                   /protein_id="CBL44006.1"
FT                   /translation="MAHILIIEDESIIRHSLKRLLERNKYKVDEAGSVGDASSQFQLSN
FT                   FDLIITDLRLPGAPGTDIIPLAEGTPVLVMTSFASLKSAVDAMKMGAVDYISKPFDHDE
FT                   MLMSIERILKEKALERENTALRSTVNRDYPTSGMIGECAPMQELFRKISKVSPTDSTVL
FT                   IRGESGTGKELVARALHAQSLRANGPMISVNCAAIPETLIEAELFGHEKGAFTGATSAR
FT                   KGLVEAADGGTLFLDEIGELPLDAQARLLRLLQEKEIRRVGAVHAKNVDVRLIAATHRD
FT                   LKMLARARKFREDLYYRLHVVELYLPPLRERGDDIEKLARELLIRTTQRMNHGDMQLTD
FT                   ATIQAIRQYSWPGNVRELENAIERAVILCDSNTITPELLAIEPDRDSPLRNQAFNDPFT
FT                   QQDTQPLPPTSAVNGEPQEDVALEDYFQRFVLEHQHHMTETELAQKLGISRKCLWERRQ
FT                   RLGIPRRKMQLRGSNAASGA"
FT   CDS_pept        complement(522422..525343)
FT                   /transl_table=11
FT                   /gene="cbrA"
FT                   /locus_tag="HDN1F_04240"
FT                   /product="Two-component sensor"
FT                   /note="silverDB:HdN1F538"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44007"
FT                   /db_xref="GOA:E1VGR5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR5"
FT                   /protein_id="CBL44007.1"
FT                   /translation="MGVVYLAIFFLVAYITELGYLPSKLVRHPATYVLSLGVFASAWAI
FT                   YGSVGFAHQHGYNYLAYYLGISGAYMLAPVLLAPMMRLTRTYQLASLADLFAFRYRSPV
FT                   VGAVVTLCMFIGVIPLLALQIQAVADSAQVLNDSADTDTLAFLFCATIILFAILFGARH
FT                   ISLREKHEGLVVAMAFESIVKLSAMVALGLYVVFRIFDGPVGVNQWLDHHPEALTQLYS
FT                   PLQEGPWRSLIAAFFVAAVVMPHMFHMSFTENINPRALITASWALPLYLLALALFVPLI
FT                   VWGAQAINLETDTPDYLTLMIPLAEQQELLSVIVFMAGLSAASGLIIVCTLALSAMFLN
FT                   HLVLPLSPVNTQRNLYSWLIWARRILIAAIILSAFAFYFVVANRNSLSELGFLSFVATM
FT                   QFVPGLVGVLLWTRANHRGFLAGLTAGFGVWFFVLLLPVLFGFQIHINIPLLLDDHFPT
FT                   SENSYMVASFAIFLNALVFAIVSIANPSSPEEINAASACNVDTLRRPMRWELPVKNVNE
FT                   ITQRLSGPLGVATAEREVKLALVDLSMDTTEMRPYALRRLRDQLENNLSGLLGPSVAHD
FT                   IIEESLPYEIQPEDTSLKDIHFIESRLEDYQDKLTGLAAELDSLRRFHRRTLQDLPIGV
FT                   CSLGSDGEVVGWNKAIETLTEVDAAQIVGSHITSVTPPWGSLIVEFLNSDTTTQQIKIE
FT                   HRGLPRWLSCHKALIQVEGTTLQQSGWVVVLEDMTEMRLLEQKLTHSERLASIGRLAAG
FT                   VAHEIGNPVTGIACLAQNLREESEDHETLWAADQIIDQTKRISRIVHSLVSFSHSGPRQ
FT                   TEFEPVHLQVVVQEAIDLLYLNKENAEYRFQNDCDSAHWVTGDAQKLAQVFINLLGNAR
FT                   DASAPGTTIRIYSQISEHSVITHVEDHGSGIPPELVERIFEPFVTTKEPGKGTGLGMAL
FT                   VYTMVEEHFGQISIASPIHENGTGTRVTVTLPSSLLPVTQVTS"
FT   CDS_pept        complement(525363..525539)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04250"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F539"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44008"
FT                   /db_xref="GOA:E1VGR6"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR6"
FT                   /protein_id="CBL44008.1"
FT                   /translation="MYIDRLVLLFIIGAYVLSPALMQWWIDGGVVWYRPFLFWSMLIAI
FT                   TYWIARSRDLDGF"
FT   CDS_pept        complement(525614..526492)
FT                   /transl_table=11
FT                   /gene="gluRS"
FT                   /locus_tag="HDN1F_04260"
FT                   /product="Descriminating glutamyl-tRNA synthetase"
FT                   /note="silverDB:HdN1F540"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44009"
FT                   /db_xref="GOA:E1VGR7"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR022380"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR7"
FT                   /protein_id="CBL44009.1"
FT                   /translation="MPPSPYIGRFAPSPTGLLHLGSLLTAVASYCDARASQGKWLVRIE
FT                   DIDPLREVAGASSAILNTLEGFGLYWDDEVIFQSQRLSLYQDTIDTLLRQGRLFYCTCS
FT                   RKQLIGHVIYPGTCRPQKRPPEGIAWALKAEVPHREYSFIDPLQGRFGLRFGEDAGDFV
FT                   IQRKEGFIAYHLAVVLDDAAQNITHIVRGADLLDSTPYHLLLQDWLQLPTPHYMHLPVI
FT                   TNTFGQKLSKQTGAMALSTQQRSQQLVAVLAWLGQNPEAGLAQEPVSEVLAWAVAHWQS
FT                   KNIPHHPTLAR"
FT   CDS_pept        complement(526637..527089)
FT                   /transl_table=11
FT                   /gene="dksA"
FT                   /locus_tag="HDN1F_04270"
FT                   /product="DnaK suppressor protein, RNA polymerase-binding"
FT                   /note="silverDB:HdN1F541"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44010"
FT                   /db_xref="GOA:E1VGR8"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR8"
FT                   /protein_id="CBL44010.1"
FT                   /translation="MPTKKAKKKTVVELSRSSYTPYALTEGEEYMSNPQLEHFKAILLH
FT                   WRQQLMEEVDSTLQLMQDEIYNLPDAADRATQEEEFSLELRTRDRERKLIRKINQALER
FT                   IQKNDYGFCDSCGIEIGIRRLEARPTATLCIDCKTIEEIKEKQWGT"
FT   CDS_pept        527225..528397
FT                   /transl_table=11
FT                   /gene="dapC"
FT                   /locus_tag="HDN1F_04280"
FT                   /product="aminotransferase class-I"
FT                   /note="silverDB:HdN1F542"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44011"
FT                   /db_xref="GOA:E1VGR9"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGR9"
FT                   /protein_id="CBL44011.1"
FT                   /translation="MKIAHRVADIQPFHVMALLARARSLQEQGYDVIHLEVGEPDFDTP
FT                   APIVAAGVEALHRGKTHYTPATGLPILREVIAEYYSERFGVDVSPQRIVVTTGASGALS
FT                   LVTAALFNPTDRVMLADPGYPCNSHFLRLIGARSQWVATDAEARFQLSAAAAVEHWRDD
FT                   TAGILVATPSNPTGTLLSLAELHDLHEVVRERGGVLIVDEIYQGLTYGVESCTALSLPR
FT                   AEQDIVVINSFSKYFGMTGWRLGWIVAPQDLVPALDKLAQNFYLAPPTPSQYAALAAFT
FT                   PSTLAILDERRNELHKRRDYLLKALPALGFKIPVIPEGAFYLYCDISELGDDSFALCEA
FT                   LLEQAHVAVTPGKDFGFRDAARYLRIAYTAPIPRLQEAVARIARHLKVSV"
FT   CDS_pept        528526..529428
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04290"
FT                   /product="Transcriptional regulator, LysR family"
FT                   /note="silverDB:HdN1F543"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44012"
FT                   /db_xref="GOA:E1VGS0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS0"
FT                   /protein_id="CBL44012.1"
FT                   /translation="MIDYNEMAIFAKVVDAGSYTRAADKLDLPKSTVSRKITQLEERLG
FT                   VRLLHRTTRAIKPTEIGKTYYRHCAQMLAEAEEAQRSINQMQAEPSGLLRITAPISFGA
FT                   SFLAETIKEYLAMYPQVRVDIMLDNKILDLIDDEIDVAFRVGPMSDSSLVARTLGSIRL
FT                   ILCASPVYVQAHGAPRTISDLAGHNCVAHNNISWHLVGPNGPVDVELDARLFSNDMEMT
FT                   KRMLLAGYGIGLLPITLAYDEIQQGQLLQVLPEYHFPDRDVYLVYHSRRQLPTKVAAFI
FT                   DFVAERCKPVAPWEMHKLK"
FT   CDS_pept        529457..530371
FT                   /transl_table=11
FT                   /gene="hflC"
FT                   /locus_tag="HDN1F_04300"
FT                   /product="Membrane protease subunit, stomatin/prohibitin
FT                   homolog"
FT                   /note="silverDB:HdN1F544"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44013"
FT                   /db_xref="GOA:E1VGS1"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR018080"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS1"
FT                   /protein_id="CBL44013.1"
FT                   /translation="MLTASGITVLIALGMMAVLILKGIRAVPQGYQWTVERFGRYTHTL
FT                   QPGFNLIIPFVDDIGRKQNMMEQVLDVPPQVVISADNAQVTTDAVCFFQVLDAARASYE
FT                   VADLYDALRNLVMTNIRAVLGSMELDEMLSNRDRINLALLKKVDEATDPWGLKVTRIEI
FT                   RDISPPKDLVESMANQMKAEREKRAAILKAEGEREAAIKVAEGEKKAAVLRAEGEKEAA
FT                   FLDAEARERLAEAEARATDMVSKAIQEGNLQAVNYFVAQKYVDGLMQLAASPNSKVILM
FT                   PVEATSILGALEGIRDLVKKTTS"
FT   CDS_pept        530407..530859
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04310"
FT                   /product="protein of unknown function DUF107"
FT                   /note="silverDB:HdN1F545"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44014"
FT                   /db_xref="GOA:E1VGS2"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS2"
FT                   /protein_id="CBL44014.1"
FT                   /translation="MAEWLNDAGWYWISAGLVMIAAEALGASGFLLGAAVSALLVGVLA
FT                   FLMPAMGWQEQFVAFAIFAGFFTWVYWRRFRAFNEKTDKPKLNHRLLQMVGTTHVLDTP
FT                   IEEGVGKVQAGDTLWKVQCKQANLPAGTRVKVVAVNGMFLIVEALP"
FT   CDS_pept        530856..531611
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04320"
FT                   /product="oxidoreductase, short chain
FT                   dehydrogenase/reductase family"
FT                   /note="silverDB:HdN1F548"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44015"
FT                   /db_xref="GOA:E1VGS3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS3"
FT                   /protein_id="CBL44015.1"
FT                   /translation="MSAATSLESIAPADPARFALITGAGRRLGATLCRYWLAQGWQVIG
FT                   HYRTETAEVSALRALGATMLQADFERPDEVAGMVEQLTTQLPWLDLIVHNASSFSPDVD
FT                   DLERNLAAMDGFFQVHMKAPYAINLGLHDLLLATPRTSADIIHITDIFADRPDARYAAY
FT                   CASKAGLANLSLSFAKRFAPKIKVNAIQPGPIKFLDSHADENRVAILRETLLGREGGFE
FT                   PVVQMIAALVANPFVTGAAYKVDGGRSLS"
FT   CDS_pept        complement(531608..532117)
FT                   /transl_table=11
FT                   /gene="hppK"
FT                   /locus_tag="HDN1F_04330"
FT                   /product="7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase"
FT                   /note="silverDB:HdN1F549"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44016"
FT                   /db_xref="GOA:E1VGS4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS4"
FT                   /protein_id="CBL44016.1"
FT                   /translation="MGAFMFYFCSLGSNIDPPHNVALALQALASSLAEFTLSPLIQTKP
FT                   HGMESQQPFYNALFWFESTQSPESIKAWFNETEIKLGRDRNHPEKKLRDRPIDLDILYA
FT                   GERKPLAELAVKDPYLAPLTPVLQGKAPAVSAITLPFGGRRLGLGIFRIRSVAGQIQIE
FT                   RATAEN"
FT   CDS_pept        complement(532215..532961)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04340"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F550"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44017"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS5"
FT                   /protein_id="CBL44017.1"
FT                   /translation="MADHPFLQILGTGHSEAMEHWNTNAMIVSSGRRLLIDCGFTIKYA
FT                   LRDRGLGLPDIDAIFITHVHGDHVFGLERVGYESRFRYGKRVQLILHESLQEELWDQTL
FT                   KGSMGRASEGENTLADFFDVVLLRDDRFDWQGVHCKLFRTRHTPNKISYGLHINEQVIF
FT                   TSDTTPIPEQIATLPAHTIFHDVTLRDEHPVHAAVPALLSAYTPEMRKKMYLMSYEDYW
FT                   RDWEPQIQREFAGFAKQGQIVTIENL"
FT   CDS_pept        533225..534142
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04350"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F551"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44018"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS6"
FT                   /protein_id="CBL44018.1"
FT                   /translation="MKQMVWVAGAAVLLTGCGLGMNNGRQIPKEGVAAAIQVNLPKASQ
FT                   EAQVVATVYKDGVAQPLVGGDVIQARTAQSLSTLRAEKNLDGHYQGVLAVDHADTPIDV
FT                   AVNYDDKASSEQRWFASDTLTVSPGPGSLVGYEVTGMRLPPEIYLSAPMANTVYRDMSD
FT                   TVELHWDPLALGHQVRLTAAVSCVAAGLPFSYGLSFDLGKETDTTTGSYSLRMNKLVTA
FT                   VPVVVALRKVLDYLSLYASQQMLGQGNFLAILGSLPKSDNEINKCDVDLTLIREQENTL
FT                   PPAFSGGYAITSRSDTVRVQYVQQ"
FT   CDS_pept        534129..534833
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04360"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F552"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44019"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS7"
FT                   /protein_id="CBL44019.1"
FT                   /translation="MFNNKMFNNQQSKGVKQNKWGWMGATLVALSFGCVAAQADVGTAS
FT                   SASRVGAGDGWVGLQLGTSRLKSEGSDFRLSGNYGLSGGWWLNENIGLELGASALRKGD
FT                   ERGEDNRGTYVLSVDANDYHIGPRFSSGRHAVWQYSGSAGFLYSRAHMSLKEAFYGLKE
FT                   PGEATSRSTGNGYYVAGGVTFAPARSALGVNGAVSYSLWLRYRQRLDLISTYRGDQDLS
FT                   DLGVVASADFRF"
FT   CDS_pept        complement(534867..536255)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04370"
FT                   /product="response regulator with GGDEF domain"
FT                   /note="silverDB:HdN1F554"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44020"
FT                   /db_xref="GOA:E1VGS8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS8"
FT                   /protein_id="CBL44020.1"
FT                   /translation="MINFCARFLSKSLIQLAPSSDCRRVLESMPPATSLTSTAIKSALY
FT                   TSRGHKNAPNNGNTDAIKFTPALKSQIERTQKRRHYWLRFPSTIETLFSASYRQAGLTS
FT                   MRSFSLLIAVAYALFGVFVYTHYQQSDLHAFLPKYSAAGIGLVALLWLVRQSRFDHWFY
FT                   GYIGIIAMVGLTIVMQIPPSITDPQLKVLAYAIATNGIVLVYAMSKLRFTYVIFWGCLA
FT                   GLLHRILVLTFGQDEPLALFNAWFIPSSLVGMGLAYLNEYRERTVFLQSLLLEIDQHER
FT                   NALYHNLERLSREDALTELANRRHFGECLQHEWSRCQRDQKPLSIALLDVDFFKQYNDI
FT                   YGHQAGDRCLIAIAQALRKEASRPGELVGRYGGEEFILLYPNTQAEQFLAILERIQERI
FT                   RALALAHEGSRVAKTVTISIGAATVLPTRAAHTEKLIGLADTLLYRAKKNGRNRWQHGT
FT                   LHSI"
FT   CDS_pept        complement(536565..537269)
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="HDN1F_04380"
FT                   /product="Lipoate-protein ligase B"
FT                   /note="silverDB:HdN1F555"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44021"
FT                   /db_xref="GOA:E1VGS9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGS9"
FT                   /protein_id="CBL44021.1"
FT                   /translation="MSASSTLIIRHLGLRDYEEIWHAMQTFTDTRGEHATDELWCVQHP
FT                   PVFTQGQAGKAEHLLATGDIPVIAVDRGGQVTYHGPGQIVIYPLLDLRRMQIGVRELVT
FT                   RIEHAIVDTLQEIGVSAYPREDAPGVYVQHTQTQREYKIASLGLRIRKGCSFHGLALNV
FT                   DMDLEPFHRINPCGFIGLEMAQVRDFQPTADLSALESTLCKHLCHRFGYRHTLDEASLT
FT                   NDASLSSEASLT"
FT   CDS_pept        complement(537317..537598)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04390"
FT                   /product="Protein of unknown function DUF493"
FT                   /note="silverDB:HdN1F556"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44022"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT0"
FT                   /protein_id="CBL44022.1"
FT                   /translation="MSSPNNHLNQELWTFPCNHNLKVMGLSEHPLIEILTEIVRDQVPN
FT                   FTPVNIQTRPSRTGKYHSITVNVHVEAREQLECIYRALAARDEISWTL"
FT   CDS_pept        complement(537749..538906)
FT                   /transl_table=11
FT                   /gene="dacA"
FT                   /locus_tag="HDN1F_04400"
FT                   /product="Penicillin-binding protein 5 precursor
FT                   (D-ala-D-ala-carboxypeptidase)"
FT                   /note="silverDB:HdN1F557"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44023"
FT                   /db_xref="GOA:E1VGT1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT1"
FT                   /protein_id="CBL44023.1"
FT                   /translation="MIGFIANTLFIGALTASNASFAAETELPTPPQLAASSWILIEPSS
FT                   GQVLVEHNADEQLPPASLTKMMTSYVAADKIKEGLAGWDDEVLVSEKAWRMGGSKMFIR
FT                   VGTQVKIRDLMRGIIIQSGNDASVALAEHIAGSEESFADLMNQTAKRIGMTHTHYVNAT
FT                   GLPDPSHYTTARDLAILAQHVIFDHPEDYELYSEKEFLYNNIKQPNRNLLLWRDNSVDG
FT                   IKTGHTKEAGYCLVASAKRDGMRLVAVVMNTNSEKARASETMKLLTYGFRFYENVRSYS
FT                   AGEVLAAPEIWFGSTPTVKLGLDKDLVLTIPRGTQQDVKAELDYKPLELKAPIAKGQQL
FT                   GVIRVRVKDKVISETPLVALEPVEEAGFIKKLWHHLLLFVKGLFS"
FT   CDS_pept        complement(539096..540082)
FT                   /transl_table=11
FT                   /gene="rplA"
FT                   /locus_tag="HDN1F_04410"
FT                   /product="Rare lipoprotein A"
FT                   /note="silverDB:HdN1F558"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44024"
FT                   /db_xref="GOA:E1VGT2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT2"
FT                   /protein_id="CBL44024.1"
FT                   /translation="MTHSRILLLSILSGALTLSGCASQTQKGHYTPSSTTKPSTTNSSM
FT                   PSAASSAPWQRPTQDRAPLRAVQADTLRDATPEPVTLSRYGNKTPYDVLGKRYYLLPTA
FT                   AGYSEVGVGSWYGEKFHGQPTSTMEPYDLYEMTAAHKSLPIPTYARVTNLENNRSVIVR
FT                   INDRGPFVDDRIIDLSYAAAVKIGYAEKGTARVRVETLSVGPFPMVTQGETRTPQKYGS
FT                   ANRTALTSRTPPTQNTHITTESNQPNANQRNQAQIFLQVGAFSNSESAHLLQNRLSQLV
FT                   SAPVTVAQNDSSHFRVHVGPFNNEDNARRAEAQIRSKQLGNPLLIRR"
FT   CDS_pept        complement(540098..541285)
FT                   /transl_table=11
FT                   /gene="mltB"
FT                   /locus_tag="HDN1F_04420"
FT                   /product="Membrane-bound lytic murein transglycosylase B"
FT                   /note="silverDB:HdN1F559"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44025"
FT                   /db_xref="InterPro:IPR011757"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT3"
FT                   /protein_id="CBL44025.1"
FT                   /translation="MRLIPSLFRNSSSHKASNSHKASNSHKAAKRNTRRFQARSATSAI
FT                   VLGTLALPFISLSAITFADPISTPYADRSDVQAFISDAVKKDKLNRAELVTLFKSASRQ
FT                   QSIIDSISKPAERTLTWADYRRIFITEKRINGGVEFYRTYQKALERAAHQYGVPAEMIV
FT                   AIIGVETSYGANKGNYRVIDALSTLSFDYPARAPFFTRQLHEYLLLGREANIDLSTATG
FT                   SYAGAMGFPQFMPSSYRNYAVDFDGDHKIDLINNPVDAIGSVGNYLKGHGWKNGEGVAL
FT                   SATYSGKNHSNKNHSDKNAATGPQNGPSPQLKKLLNASNKPTVSANQLKSLGLISSSPL
FT                   ATSTLTNPMSMEGSDGTEYWIGLNNFYVITRYNNSSMYALAAWQLSQDVKRSLQN"
FT   CDS_pept        complement(541346..542485)
FT                   /transl_table=11
FT                   /gene="mrdB"
FT                   /locus_tag="HDN1F_04430"
FT                   /product="Rod shape-determining protein"
FT                   /note="silverDB:HdN1F560"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44026"
FT                   /db_xref="GOA:E1VGT4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT4"
FT                   /protein_id="CBL44026.1"
FT                   /translation="MNRSDYLRQLPPNELAARRNSFLQTIHIDGFLLMMLLILMGGGLI
FT                   VLYSASSASIDTVIRQALRMGLGLLVMCVAAQIPATTYRRWSLPLYGFGVLLLIATLIF
FT                   GSHAKGAQRWLDIPGLGRFQPSEIMKLLVPLSVAAIFATRSLPPRWSSLLMSTGIILVP
FT                   TLLIAKQPDLGTALLIASSGFITMFLAGLDWRILVTLAGSSVPAGWLLWELLHDYQRQR
FT                   ILTFLNPESDPWGTGWNIMQSKTAIGSGGFDGKGWLNGTQSHLDFLPESSTDFIIAALA
FT                   EEFGFTGVCLLLLVYLIILIRGGYIALQAGNNGDRLIAGTLTLTFFVYIFVNIGMVSGI
FT                   LPVVGVPLPMVSYGGTSVVTLLASFGILMSIHTHRQLLN"
FT   CDS_pept        complement(542485..544449)
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="HDN1F_04440"
FT                   /product="Penicillin-binding protein 2"
FT                   /note="silverDB:HdN1F561"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44027"
FT                   /db_xref="GOA:E1VGT5"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT5"
FT                   /protein_id="CBL44027.1"
FT                   /translation="MARNVTFHDKLREQGIFKHRLVVAFLGVLALVGVLLLRMYHLQIV
FT                   QYSTYETISDRNRIQIEPIAPTRGLILDRNGTILADNNPTFSVSIIKELVPNLSQTIAD
FT                   IRELIPLNDNDVQRFEKRLQQRRRPLTPIALRLNLTEEEIAILSVRAYDLPGVIIEANL
FT                   VRHYPQPELLSHTIGYVGRINEAELKQVDANNYGATEYIGKTGIEKFYEDRLHGTVGFQ
FT                   KVETDARGRTTRVLEKIDPTGGENLHLFLDLPTQQAALKAMNGRRGAVVAIEPDTGGVL
FT                   AFLSTPGFNSNLFVTGIDHKSYNDLQNDRWRPLFNRALQGQYPPGSTVKPMVGLAGLDG
FT                   GFIDWNYSIWDPGWYKINGDGRFFRDWKKWGHGFVTLDTAIVQSCDTYFYELAHRMGVD
FT                   RLHDFLSPFGFGHRTGIDMAGEVSGVLPSTEWKRRTRKERWYPGESLNFGIGQGYMLST
FT                   PLQLAVATAIIANHGTIIEPRMVEKISTKDTGIRPLEHAPLQHIKLRDPEQWRRMIASM
FT                   RNVVMTKKGTAYGAVGRRLTEYDMAGKTGTAQVVNIKQGETYQASKLKEWHRDHAWFMG
FT                   FAPTDHPRIAVAVLVENGGHGGTDAGPVAKQVIDAWFESDARSRSVTPEEQDASPATEA
FT                   LSTSQRMHTPPTGTEVAIH"
FT   CDS_pept        complement(544503..544970)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04450"
FT                   /product="Protein of unknown function DUF163"
FT                   /note="silverDB:HdN1F562"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44028"
FT                   /db_xref="GOA:E1VGT6"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT6"
FT                   /protein_id="CBL44028.1"
FT                   /translation="MRLRLIAVGTRMPDWVNSGVEEYRKRLIGGVTLEIVEIPAGKRVK
FT                   NADIARLTEREGEQMLAALHPSEHIIALDVKGKPHSTESMAARIAELMQAGKPVALLVG
FT                   GPEGLAPAALARAEEKWSLSPLTLPHPLVRVLFAEQLYRCWTLIKGHPYHR"
FT   CDS_pept        complement(544975..545415)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04460"
FT                   /product="Iojap-related protein"
FT                   /note="silverDB:HdN1F563"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44029"
FT                   /db_xref="GOA:E1VGT7"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT7"
FT                   /protein_id="CBL44029.1"
FT                   /translation="MTLKDSAPLNTISAEDIKNAALTALDDMKAKDVVCLDIKPLTSMA
FT                   DYMIVASGTSTRHVKASADKVEEAARTLGVRPLGVEGAQAAEWVLVDLNDVIVHVMTPD
FT                   TRRFYDLEKLWSITPEQSATASADSETNKTLKKATSSKNQKG"
FT   CDS_pept        complement(545412..546098)
FT                   /transl_table=11
FT                   /gene="nadD"
FT                   /locus_tag="HDN1F_04470"
FT                   /product="Cytidylyltransferase"
FT                   /EC_number="2.7.7.18"
FT                   /note="silverDB:HdN1F564"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44030"
FT                   /db_xref="GOA:E1VGT8"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005248"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT8"
FT                   /protein_id="CBL44030.1"
FT                   /translation="MATSAAEPGIGILGGTFDPIHYGHLRLAWEALQGLALDHVRLIPC
FT                   HVPPHRGDPAGAAHHRLAMVELACADTTGFVVDARELEKNSPSYSVETLQALRKQFGPE
FT                   RPLVFLMGMDAFCGFCNWHQWQEILELCHLWVGHRPGSQLPDIQHPAGLLLQERGATQG
FT                   SLAWTPSGRIHVQETVALDISATYLRQQMQHGQSPRFLLPESVHRYIQQQRLYAPHPPA
FT                   ETHPTL"
FT   CDS_pept        complement(546079..547353)
FT                   /transl_table=11
FT                   /gene="proA"
FT                   /locus_tag="HDN1F_04480"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /note="silverDB:HdN1F565"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44031"
FT                   /db_xref="GOA:E1VGT9"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR012134"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGT9"
FT                   /protein_id="CBL44031.1"
FT                   /translation="MQTPSITDITAYMERVGQNARNASRQIAKAGTQAKNAALLATANA
FT                   IQAQQAELLAANQRDLDQGRANGLDNAMLDRLALTPARIATMIEGLHQVAALPDPIGEI
FT                   SNMRYLPSGIQVGQMRVPLGVIGIIYESRPNVTIEAASLCLKSGNATVLRGGSEAIHSN
FT                   QALAQCIRAGLREAGLPESAVQVIETTDRAAVGAMITQPQYIDVIVPRGGKGLIERISA
FT                   DAKVPVIKHLDGICHVYIDDDADLEKAINVAVNAKTHRYGTCNTMETLLVAESIAAKVL
FT                   PPLCEKLRNHNVELRGCERTRAVISDAILATEADWACEYLAPILSIRVVDGLDAAIEHI
FT                   NRWSSQHTDAIITENYSKSRRFLLEVDSSSVMVNASTRFADGFEYGLGAEIGISTDKLH
FT                   ARGPVGLEGLTSCKYIVLGDGHIRR"
FT   CDS_pept        547617..547862
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04490"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F566"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44032"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU0"
FT                   /protein_id="CBL44032.1"
FT                   /translation="MEVVPLGCSTSGCITRRCLMEAIAVLSVVYLMNVMGVYATTDAVP
FT                   EASLASQQVAHTQTVDAPAPRPSLLGALVAVKGDAR"
FT   CDS_pept        548174..548698
FT                   /transl_table=11
FT                   /gene="fimT2"
FT                   /locus_tag="HDN1F_04500"
FT                   /product="probable fimbrial protein pilin"
FT                   /note="silverDB:HdN1F567"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44033"
FT                   /db_xref="GOA:E1VGU1"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU1"
FT                   /protein_id="CBL44033.1"
FT                   /translation="MAHTCRSSAIKSTTRGQSSGFTLVELMVTVMIVAIVITIAAPSFR
FT                   SFIDRTKLSSSANELGSLIQFARGMAAQRNATVVVCESNGEWTAHATDCNQDVIRSVAV
FT                   RPEIAVSVSANALPITFYSNGTVGNNLNIRLCRDNKIEDAYKITVTRAGSTRVWPRGMD
FT                   ENNAAITSCTA"
FT   CDS_pept        548708..549265
FT                   /transl_table=11
FT                   /gene="pilV"
FT                   /locus_tag="HDN1F_04510"
FT                   /product="Putative type IV fimbrial biogenesis protein,
FT                   involved in pilus assembly"
FT                   /note="silverDB:HdN1F570"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44034"
FT                   /db_xref="GOA:E1VGU2"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013362"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU2"
FT                   /protein_id="CBL44034.1"
FT                   /translation="MYQARLRVKVNALRGIAQGFSMIEVLITVLLISVGVLGMAGMQTR
FT                   TIGYTQDSVQRSNAAGVAGELMEMIRANPEGLPGSSGFYKAAGTAFPSVPASCVATSVE
FT                   ASEQLACWAARAARVLPGVTSTLLSSSFYVCRSSAPGSCTNDAGSAVEIQVAWSAKAGE
FT                   CMDGNATGTTCTYRLRSEVALQ"
FT   CDS_pept        549262..550101
FT                   /transl_table=11
FT                   /gene="pilW2"
FT                   /locus_tag="HDN1F_04520"
FT                   /product="Type IV fimbrial biogenesis protein PilW"
FT                   /note="silverDB:HdN1F571"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44035"
FT                   /db_xref="GOA:E1VGU3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR032092"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU3"
FT                   /protein_id="CBL44035.1"
FT                   /translation="MNEFFKVNPPVAKALLIRVSGLSLVELMIALALSSFLMIGVVQIF
FT                   SDNQRTQMFTQAQTDNQEESRYVLSFLRQEFAKAGYRRRPDEPFDGAFPAVNEAGCNMR
FT                   AGEVVKWLSVSTVCLRYQPRDNLERDCLGNVIDSSLTEPYSKVGNSSIATEKISFDSSK
FT                   GTVQCQRGSTSTSVIQGVRDVRFELGVGDATNPQTIRSYITADASATQPVLAVRYAVLH
FT                   SSSGANLRGSVSADDALANWKELTGINATQLGALKANDKGQLYQISQSTTTLRNAMP"
FT   CDS_pept        550098..550682
FT                   /transl_table=11
FT                   /gene="pilX"
FT                   /locus_tag="HDN1F_04530"
FT                   /product="Type IV fimbrial biogenesis protein PilX"
FT                   /note="silverDB:HdN1F572"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44036"
FT                   /db_xref="GOA:E1VGU4"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU4"
FT                   /protein_id="CBL44036.1"
FT                   /translation="MRILSKNPLQSPYAKQGGAVMLVGLMLLLGISFLAVSSVRQAALE
FT                   SRLVGNSIEQQNLAAAAEMGLRDGESKLMRPIKPPDPKADCANVGNKLCLLTLKDDKYS
FT                   YMPRFDDGGDYPAYSPTNDTEGNPGVDVEWYATLAPSGGTEAEAENPEYGSMLTGNATF
FT                   RYEVNSRSTNDSTSNERYERSTVAKLFDPGS"
FT   CDS_pept        550699..554805
FT                   /transl_table=11
FT                   /gene="pilY1"
FT                   /locus_tag="HDN1F_04540"
FT                   /product="Putative type IV fimbrial biogenesis protein
FT                   PilY1"
FT                   /note="silverDB:HdN1F573"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44037"
FT                   /db_xref="InterPro:IPR008707"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU5"
FT                   /protein_id="CBL44037.1"
FT                   /translation="MKSILLHSVGIRAGIGGFAALAMSTMGYAITLDPAQSPLILTESV
FT                   APNLLLTLDDSGSMRWAFVPDAINNTWGTRRSKSAFFNPMYYNPAVTYPVPVKYNADGT
FT                   RASTQYSTSFEAAYNNGYDTARGSVNLANSYRVTWAYDLLSGTSNYGYNSTSNRYATNP
FT                   SADFAGGTLSSTSTQGSPQAGTYSGNIASLSKGSGGEYTISGTVVKIIHKSGTSSCSAT
FT                   FKYGSGIVDSETTEEDVPNPGETTVTTESVKTTYPSDRTASCTYSKSQGYTVTAAVTRV
FT                   TTTTVSVTRAAEEKSPVPAYYYVYDATLNNCSNSDGDDNCYRRVWVTATSGQLRSDDTP
FT                   AGTDERKNFAVWYSFYRNRALSTLSAANIAFTGLPSSIRFAWQSLGNCTTIGSDSTYCN
FT                   KNWIRKFNGQHAGSFFNWLPLIPFNQSTPLASALKRAGAFFSSSDPWAYNPNPLAANGA
FT                   ALATVQIPEYACRASYHIMMTDGMWNGTTVEDVQPSSFRHDGTDATMPDGVGKYTQQRP
FT                   FVAKYSDDTKNLGDLAFHYWGTDLRTNLANDVKPVIVAPNAANPAAQYWDPRNDPATWQ
FT                   HMTTYTVGLGLGKALNFAGLQWAGGTYAGQAYQNLLNGTKTWPKASADSDNNVYDLWHA
FT                   AINSRGEFFSAESPDAIVQAFREIVSRISNRTTSAGAPGVVASIVEDQLTREVYETKFN
FT                   SEDWSGDLTKFKINEDGIRVAIWNAQAQLEGRTYSSRNIKMFDADASGKLKDFTWGNLS
FT                   DDQRAFLNQNYDTSSAPVDSRGESRVNYIRGDQSGESSGASSFRPRSGKLGDIVNSSPV
FT                   IVGTPKFVPYLADLIDGGRDADGNSVYEAFRNAHRSELEGTETAPPRRQMVYVGGNDGM
FT                   LHGFDASTGEERFAYVPSVAFENLARLTAQSYKGTGHRFFVDGTPVVSDVYYDNAWHTV
FT                   LVGTMRAGGRALFALDVTDPENITLLWEKTFSDADFTNLGYTFAQPVIARLHTGEWAVV
FT                   MGNGYGNQSSTNVDKASLMVIDVKTGDMVKELVVAGDAAKANGMSSPKLADNNSDGIAD
FT                   YAYAGDLQGNVWRFDLVTTSATPASPDPFKKSVVGTMLPSSFAVSYAGTPFYKTLDGRT
FT                   SGAAPQPIMAPPSLVRHPTGKGYIVVFGTGRYFETVDGNVNTTAAQTLYGIWDRETKGQ
FT                   STSARTSPKRINLQQQTIDKVTSDNPFADNSAVAGLRLISNNPVTWLDASGNTVKQGWF
FT                   LDLKVGSTNAGEMMISPMATRGQLLLVSTITPNSDPCKEGVESWLYGIDPATGGRTKFS
FT                   VFDLSDDKKVNVGDTYKENGVDTVVSAYKKSGSGGFTTNNGEIYTAPSQSSGMMYNAGP
FT                   LSQGRQSWRTLPEEAVHVETEEEAP"
FT   CDS_pept        554805..555224
FT                   /transl_table=11
FT                   /gene="pilE2"
FT                   /locus_tag="HDN1F_04550"
FT                   /product="Type IV fimbrial biogenesis protein"
FT                   /note="silverDB:HdN1F574"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44038"
FT                   /db_xref="GOA:E1VGU6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR031982"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU6"
FT                   /protein_id="CBL44038.1"
FT                   /translation="MKSPMIKLQRTAMQGFTLVELMVVVAVIAIIASIAYPSYQDSVLK
FT                   TNRTEGKAFLSEAAARQEKFFVQNNTYTASVAALGFSSANSPTSKYTLAISNVSGTTYT
FT                   LTATPARTDSKCGNLTLDQAGVRGKSGSGSVNDCW"
FT   CDS_pept        555308..557212
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04560"
FT                   /product="Sodium/hydrogen exchanger family protein"
FT                   /note="silverDB:HdN1F576"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44039"
FT                   /db_xref="GOA:E1VGU7"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU7"
FT                   /protein_id="CBL44039.1"
FT                   /translation="MQLSVSVQLMLIVVVGFACQWGAWRIKVPAILPLLLCGIALGPVL
FT                   HFLYPQMIFGEMLMPSVSIAVAIVLFEGSMTLKFSEIRGLAKPVQRLVTVGALITWVIL
FT                   TLTTWWITDLSIELSLLFGALVTVTGPTVIVPLLRSVRPVASVARILRWEGIVIDPIGA
FT                   LLAVMAYELVLATRTEAALPGAIALFIYTTGFGALAGFITAHAMGQALKRHWLPEYLRA
FT                   FMVLALVVGLFVLVNDVVKEAGLVAVTVCGITLTNLKGVDTTDILHFKENLTVLLISGL
FT                   FIVLASQLQLEHLSQLGMTAVIILAVAQLIARPLSVMISTAGSALGWRERALLSWVAPR
FT                   GIIAASVSALFAQRLAEQHIEGAELLVPLTFMMIIGTVLLQSITARPMARLLKVAEPEP
FT                   TGVLVISASPVACAIASILQSNGFSVTLIDSNWGNIKAARMQGLNTFYGHPVSSYADHA
FT                   LNLVGIGRMFGLSQYHELNTVAAMRYRMEFGTQNIYTLTETVGTDEKMTTNDRYKGRFL
FT                   FHDDMTYDLLAGPLARGAVLRQTNLTSEFGFDQYISQPSRIITPLFAIDPSHRLCIFTS
FT                   ENKFRPVAGWSVIGLVEDRKSSEGVAKGMSEPVMMGDIPLAPRIPTAPRAPIESRLPA"
FT   CDS_pept        complement(557230..557808)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04570"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F578"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44040"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU8"
FT                   /protein_id="CBL44040.1"
FT                   /translation="MKKALTTVLSILAFSTYANPLVASEPEAYNPLAALGNASSTIDAS
FT                   ESSASEVLASVLGAADTAKNSTALPTSAEEQVKLAMEYWHAEGDENLRKARELFALAAK
FT                   QGNSTAQANLGSLLEHGEGGPADPVEAIYWYKQAALQGDKNAQYALGHAYRKGIGVQVN
FT                   LEQALVWYRKSCDSGFALACSMVSIYGAQ"
FT   CDS_pept        complement(558012..558407)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04580"
FT                   /product="Predicted nucleic-acid-binding protein, contains
FT                   PIN domain"
FT                   /note="silverDB:HdN1F579"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44041"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGU9"
FT                   /protein_id="CBL44041.1"
FT                   /translation="MKVAVDTNVLVRAVVCDDPTQATVAAAVLADAELIAVALQCLCEF
FT                   VWVLLRVYGFAQADAANAIRALLAAANVEVNRPAVEVGLRVLDAGGDFADGVIAYEGSW
FT                   LGGETFVSFDKKAVALLTAQGQSTHLL"
FT   CDS_pept        complement(558404..558877)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04590"
FT                   /product="probable transriptional regulator"
FT                   /note="silverDB:HdN1F580"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44042"
FT                   /db_xref="GOA:E1VGV0"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV0"
FT                   /protein_id="CBL44042.1"
FT                   /translation="MRLYSAQRHAYTTTKVRKPPKTRHHWQRLALRHCQKRCQKSIVLR
FT                   RLIVRHFCITIKGPTCSITKAKQLRRQNIMTILTVTARGQVTFRKEVLQHLGIKLGDKI
FT                   ELDLLPDGRCVLKAARPAGTIASFVGLLAGKTQKVATIEEINEAAAQGWAGKE"
FT   CDS_pept        complement(558955..560667)
FT                   /transl_table=11
FT                   /gene="leuA1"
FT                   /locus_tag="HDN1F_04600"
FT                   /product="2-isopropylmalate synthase"
FT                   /EC_number="2.3.3.13"
FT                   /note="silverDB:HdN1F582"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44043"
FT                   /db_xref="GOA:E1VGV1"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV1"
FT                   /protein_id="CBL44043.1"
FT                   /translation="MNTGRHRLPESVTPKPGATPVMTPPARKYRAFPPIALADRQWPNR
FT                   TIEQAPIWMSTDLRDGNQALFEPMDRTRKMRMFKMLCEIGFQEIEVAFPSASQTDFDFV
FT                   RELIEGGHIPDNVTIEVLTQARPHLIERTVESLSGAKRAIVHVYNAISPVFRDVVFNMS
FT                   KADVIEMAVSSVRQIRELTAAQPQTEWILEYSPELFSSSELPFAKEVVDAVTAEWGATP
FT                   TRKVIINLPATVEMATPNVYADQIEWMHRNIKRRDAVVLSVHPHNDRGCAVAAAELAVM
FT                   AGADRIEGCLFGNGERTGNVDIVTLALNLYSQGIDPKLDFSNINEIARTAEACTQLPVH
FT                   PRHPYAGDLVFTAFSGSHQDAIKKGFSVRQPNDFWEIPYLPIDPEDLGRSYDSIIRVNS
FT                   QSGKGGIAYLLEQHYGIVMPRRMQVEFSGIVQKKMDQNGGEFSAEDLWELFNLSYTETA
FT                   TAKTRYQTHELHTSGNQQGIDITVAQNGHTHRVSGTGNGPIEATMNALQIPMRIISFEE
FT                   RSVGQGADANAIAIVEMQGEQSGKSVFGAGIHANIVTASIMAVIAAGGRGCVA"
FT   CDS_pept        560966..561427
FT                   /transl_table=11
FT                   /gene="lrp"
FT                   /locus_tag="HDN1F_04610"
FT                   /product="Bacterial regulatory protein, Lrp"
FT                   /note="silverDB:HdN1F584"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44044"
FT                   /db_xref="GOA:E1VGV2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV2"
FT                   /protein_id="CBL44044.1"
FT                   /translation="MELDRYDRHILSLLQEDGRLTNQELAERIGLSPSPCLRRVRALEE
FT                   SGLITGYRAVVDAKKLGYSLMALIHISMDQHTTERFENFERKIGELPEVLECLLITGQS
FT                   ADYQLKVIVRDMDAYHDLLLHRITHIEGVTGVHSSFVLRRVIEKAAVPV"
FT   CDS_pept        complement(561448..563001)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04620"
FT                   /product="Protein of unknown function DUF1703"
FT                   /note="silverDB:HdN1F585"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44045"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV3"
FT                   /protein_id="CBL44045.1"
FT                   /translation="MQRKRLPIGIQTFAKIREDDACYYVDKTPLALRLIAQGTHFFLSR
FT                   PRRFGKSLFLDTLKELFEGNEALFKGLYAEKHWDWSVKYPVVRISFGGGVTRSAQELED
FT                   QIDSHLRRFETANQLAVVDKTLAERFRSLILHLVQTHNQRVVVLIDEYDKPILDNIEQR
FT                   EIALETRETLKDFYSVIKDADAYIRFAFLTGVSKFSKVSLFSGLNNLQDITLDARYSTI
FT                   CGYTDQDVDSVFAAELEGLDRSEIKRWYNGYNWLGESVYNPFDLLLLFDHRTFRPWWFE
FT                   TGTPTFLVKLLTQRGFFTPDLANLQTGEQLISSFDVDAIKSEALLFQTGYLTIHDVQQP
FT                   ILGHWVYTLGYPNREVESSLNASLLEGLGVDSSKGFENRIKLITLLRQQNIPAMRDLFH
FT                   AFFASIPHDWYRNSPIAQYEGYWASIFYSHFAALGLDIKLEDATNHGRIDMTVCFEGHV
FT                   YLFEFKVVELVPEGKALQQLKDKRYADKYRADGPVHLIGVEFSKDTRNIVGFEVEEQVG
FT                   "
FT   CDS_pept        complement(563069..564619)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04630"
FT                   /product="Protein of unknown function DUF1703"
FT                   /note="silverDB:HdN1F588"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44046"
FT                   /db_xref="InterPro:IPR012547"
FT                   /db_xref="InterPro:IPR018631"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV4"
FT                   /protein_id="CBL44046.1"
FT                   /translation="MQRKRLPIGIQTLREIREDHCYYVDKTPLALRLVQQGKYFFLSRP
FT                   RRFGKSLFLDTLKELFEGNEALFKGLYAEKHWDWSVKYPVIRISFGGASLASAEDLGRS
FT                   LNEQLGTLEEAFGLPAEYPDARSRFRRLIIRIAERTGQRVVVLVDEYDKPILDRIEDRE
FT                   IALAMREALKDLYSVIKDNDAYIRFAFLTGVSKFSKVSLFSGLNNLQDITLDARYSTIC
FT                   GYTDQDVDSVFAAELEGLDRGEIKRWYNGYNWLGDSVYNPFDLLLLFDHRTFRPWWFET
FT                   GTPTFLVKLLTQRGFFTPDLANLQTGEQLISSFDVDAIKSEALLFQTGYLTIHDVQQPI
FT                   LGHWVYTLGYPNREVESSLNASLLEGLGVDSSKGFENRIKLITLLREQNIPAMRDLFHA
FT                   FFATIPHDWYRNSPIAQYEGYWASIFYSHFAALGLDIKLEDATNHGRIDMTVCFEGHVY
FT                   LFEFKVVELVPEGKALQQLRDRNYAEKYRNDGPVHLIGVEFSKDTRNIVGFEVEEQVG"
FT   CDS_pept        complement(564730..565887)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04640"
FT                   /product="Putative poly(R)-hydroxyalkanoic acid synthase
FT                   (Pha)"
FT                   /note="silverDB:HdN1F589"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44047"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV5"
FT                   /protein_id="CBL44047.1"
FT                   /translation="MGIQTARRQARQIARNARDRIFNPESLVRTGNTPFEVLHDNGLVK
FT                   LRYYSPVQTSPAQANAPTQTSNRALDASSAAPALEPAQPATPIPLVIVPPLAINMLVYD
FT                   LFPERSFVQYFTQLGFPVYLIDWGTPGLRQAHYTLSRYVKKLMPEFIGKVREHSGSDEL
FT                   SLQGWSMGGGIALAYTAYHHDHNIRNLLIMGTAIDGHANGPLGRNYQKLANWLEKRNLN
FT                   ARKLPASMAYSPAWMNIVGFKLSDPVGSLRGYRDLLKNLHDRDYVAQHATQAAFIDNLV
FT                   AYPGGVIRDWMASVWLENETARGQITLGREVTHLRTIKSNVLGIAGSTDTLANVNCCKA
FT                   LMNVVGSQDKQFHVAPGGHTGIMAGSRAREAVWEKASEWLLARSG"
FT   CDS_pept        complement(566052..566888)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04650"
FT                   /product="predicted O-Methyltransferase involved in
FT                   polyketide biosynthesis"
FT                   /note="silverDB:HdN1F590"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44048"
FT                   /db_xref="GOA:E1VGV6"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR016874"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV6"
FT                   /protein_id="CBL44048.1"
FT                   /translation="MDSSGISFTALYTGHVWYANQMSEHFFTSPLSHLMYRSFQPIESL
FT                   AESVAGISIRQTLLQRHVIMDHRLNDLIRNHGVNQVLEIACGLSPRGLHFTRRYPQLRY
FT                   VEADLPNMVARKRELLTQNVKLSAHHQIVECNFFENGTPAALDTVLQQHFDASQPLVIV
FT                   TEGLVNYFELPVISAVWSKIAHLTRTFPAAWYLTDVYPEAQGAIAPFVNAGRKTLGKMT
FT                   RAKTSLHFRSAKEAREGFLAAGFREVTVHKPEQFYDTLPIPRSRRRAQVYVVEAKA"
FT   CDS_pept        567008..567259
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04660"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F591"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44049"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV7"
FT                   /protein_id="CBL44049.1"
FT                   /translation="MRMRISIIWGVGGGRYHEASKYGPLSSLWIRVMQAPLQIGCVPAP
FT                   AAATHDSTSHPSSSALRSGFLGDKALYLRPVLPFDRGS"
FT   CDS_pept        567256..568308
FT                   /transl_table=11
FT                   /gene="hugC"
FT                   /locus_tag="HDN1F_04670"
FT                   /product="Putative hemin ABC transporter, permease protein"
FT                   /note="silverDB:HdN1F592"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44050"
FT                   /db_xref="GOA:E1VGV8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV8"
FT                   /protein_id="CBL44050.1"
FT                   /translation="MKRLSFQFEIFLVFALAVTFTLALVSGAVSLPVAALLPALSDASS
FT                   ADGMIVWELRLPRILLAMAVGAALAGSGALAQGLFRNPLADPGLLGVSSGAAVGAALVI
FT                   VLASAFSAWLADSGLAGSAVAASSGLSSSAIAVGACLGAALCTWCVYLSGRSQYGLHVT
FT                   RMLLVGVAINALVSAVMAFLSYFSNDQSLRNLTFWLLGSFNGAGWGGVGLVSLGLVVLI
FT                   FFGMRYASALNVLSLGESEARHLGIRVHRLQQGVILAVAVAVGLSVAVTGVIGFVGLVV
FT                   PHVVRMLCGPDHRRLIPASLLLGALVVLLADLAARTLLSPSELPVGIFTALVGAPFFVA
FT                   LVIRSRRDVW"
FT   CDS_pept        568353..569159
FT                   /transl_table=11
FT                   /gene="hugD"
FT                   /locus_tag="HDN1F_04680"
FT                   /product="ABC-type hemin transport system, ATPase
FT                   component"
FT                   /note="silverDB:HdN1F593"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44051"
FT                   /db_xref="GOA:E1VGV9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR015863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGV9"
FT                   /protein_id="CBL44051.1"
FT                   /translation="MLEVEGLGVRQGRRWLLRSASFKVQSGKIVMLVGPNGAGKSSLLK
FT                   TLAGEWLPSEGSILLRGRSLANWSPTELALSRAVLPQQPSLGLPFSVREVAAFGRTPHA
FT                   TGREIDRQIVEHLLQLCDVQALAEVPYTQLSGGERQRVHWARVLAQLEGAQLEGVQLEG
FT                   VQLHGTPAPLLLMDEPTSALDLSHQTGLMEALRVRANDGWAAVVAVHDLNLAARFGDQV
FT                   LVLNHGRITAFGAPWQVFTSALLEEVFRVKAQIVPHPHGDYPLMVV"
FT   CDS_pept        569304..571379
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04690"
FT                   /product="Putative diguanylate cyclase/phosphodiesterase
FT                   (GGDEF & EAL domains) precursor"
FT                   /note="silverDB:HdN1F594"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44052"
FT                   /db_xref="GOA:E1VGW0"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW0"
FT                   /protein_id="CBL44052.1"
FT                   /translation="MAGPNTSKSNHSLSLRLLRVVLLSALVVGGLLSLLQIAYNAEKTV
FT                   SAINEDGERLLAMFRDPSLQAIYNLDTEMGTQVVEGMFQHPAVRSAKIGDLGELVLAEK
FT                   NRPLVQAPYRWATDFVLGQEKGFTTQLIGREPFDDHYGELSLVLDTADYGHDLVLNSAV
FT                   IFVSGVLRALALALVLTLVYYWMLTKPLSKIIGDLSNIAVNHPGRYKLPKQPGHEHDEL
FT                   GRWIDTANQMLDSIEHHQRLHQEAQHNLQHLTQFDALTGLPNRQRLQSSLEQMLEGAGR
FT                   LQSRLAILCVGVDDFKGINERYSYQVGDQLLVALSERLRRYGGRSGTIARLGGDQFVLV
FT                   RADFDEPYQVAALAQNILDDLESTFPIDGFRVQLRATIGITMFPEDGKSTEVLLQKAEQ
FT                   TMTLAKSRSRNRYQFFVASIDNEIRHRRELDNDLRVALQRDEFFLVYQPQIDLKKYQVV
FT                   GMEALIRWQHPAYGLVPPDVFIPLAEQNNCILAIGDWVLDQACRQLRAWCDLGYGNLRV
FT                   AVNLSAVQLRRGDLPETVKNILRQHKLSPNQLELEVTETGLMEDIATAARHLNDLRDLG
FT                   VGLAIDDFGTGYSSLTYLENLPLDKIKIDKSFVHDLLEDEGDATIVRAIIQLGASLNMQ
FT                   VIAEGVETVEQEAYILAQGCDEGQGYLYSKPLQPEDFLKFLREEQHISRFSLVQQG"
FT   CDS_pept        complement(571454..572968)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04700"
FT                   /product="Cytochrome P450 hydroxylase"
FT                   /note="silverDB:HdN1F595"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44053"
FT                   /db_xref="GOA:E1VGW1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002403"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW1"
FT                   /protein_id="CBL44053.1"
FT                   /translation="MLSKLHANASQLPPGPSGLKFVNAMKMGMGAFDYLWENFSKYGDL
FT                   FTLQFPGMTPFVWMNRPDLVQKIFNLKPEQIDASKLPIPIDIGVRMTGFLNGAEHMLSR
FT                   KIVVPPLIAGRLQARAGIMHEIISEHINHLQVGEEFNTPRKIGDITMDIAIYTLMGLRG
FT                   GARAAAYKEVMLNWVGAATNNTMFTIGTLYGPYRWREYLNEKYLEEIAEGSTGTGKHRL
FT                   LPWMKSVDYKVELGNMFREDIRRTRAENDSKRTDMFSVMCRATYEDGTLLDEERIISEA
FT                   MGILVGGHETSAATSAWHMLWMLKRPDVYKKCREEVLACIQQHGGFNPLAICELPYCNA
FT                   VLNESMRLTPSAVGTLRYLTCDLEVDGYTLPAGTNVLAGAYVIHRRKDIWGADAEEFRP
FT                   ERWLEEGRFKPGPFEFFPFGGGRRACVGSNHAKQQLRILWAEFYRRVSFSSRYSNNDVW
FT                   PGQQQVSGQTEPTGGVPVRVTRILPANTGYPEIQTEAAAPKEVANA"
FT   CDS_pept        complement(573167..573724)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04710"
FT                   /product="Transcriptional regulator"
FT                   /note="silverDB:HdN1F596"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44054"
FT                   /db_xref="GOA:E1VGW2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW2"
FT                   /protein_id="CBL44054.1"
FT                   /translation="MRYPPEHKRAARARMIAAGAALAKKAGFAATGMDALAAAAEVTTG
FT                   ALYSHFRSKSALLRALVEHELGRTAKFFTGKSAPEMQMALTWYLSPQHIAHPEKGCALP
FT                   ALGAEIARADDETRERFQALLLEVVASLETGAGSRDKAWAVLAQSVGGVLLARALPEGA
FT                   AREDLLAAVLAASQKALQETLG"
FT   CDS_pept        573894..576218
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04720"
FT                   /product="Molybdopterin oxidoreductase family protein"
FT                   /note="silverDB:HdN1F597"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44055"
FT                   /db_xref="GOA:E1VGW3"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW3"
FT                   /protein_id="CBL44055.1"
FT                   /translation="MTTHATACILCSRNCGLLIDVDENGQFNKIRGDANHPVSQGYICQ
FT                   KAARLGHYQHHADRLGYPLRREPDGSFVQISWEQALTEIAERLVRIRDQHGGQAFATAG
FT                   GGGQGNHLGGAYSEQLRSAMQSRKSFGVTGLSPAIGSAIGLQTQSRNNYNSLGQEKTGD
FT                   FWVNGRLFGRQSCHTTEDIEHSDYILLIGCNPFQAHGIPNARDTLKEIQKDKQRTLVLI
FT                   DPRATETARYADIHLQLKPGTDAFLMAAMLAIILRENLHDQDFLARHCTGFEIIEPILR
FT                   AIPVEDYVARADVPLALVEKVARDFATARTACVRVDLGTQHTPNTTLNAWLEKLLYLIT
FT                   GNFGIKGGNNLHSTLLPVLGHTDERKPHVRRTAHTGMFPIAGVLPPAILPAEILNDGEN
FT                   RIRAVLVDSSNPLVSWPDTAAFEKAFKALELLVVVDVTMTETARLAHYVLPAASQFEKW
FT                   ECTGFNLDFPRNGFHLRHPIAPRYAESLPEPEIYTRLLEKMGVIPTGFPWLSRIARYEP
FT                   EASGQLAMLGAALGWLGLNKKYRPFSASILYRIAEAGMPDGSAAAASLLALATLFANEH
FT                   PEAVRRAGHKGNRLTLGANLFRAIMRERSGVIFSEHLQEDVWSLVKTHDKRIHLHIPEM
FT                   VEALNELPNQPEATCDEYPLILAGGERRSYNANQIYRNPAWRKVDPHGALRIHPNDASA
FT                   LGLNNGQSAACASRHGEIPVVIELDEAMRPGMVSLPHGYGMRYQDSAPIGPEINRLTSV
FT                   ADCEPFTWTPYHKHVAVRVGG"
FT   CDS_pept        complement(576234..577616)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04730"
FT                   /product="Iron-containing alcohol dehydrogenase"
FT                   /note="silverDB:HdN1F598"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44056"
FT                   /db_xref="GOA:E1VGW4"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW4"
FT                   /protein_id="CBL44056.1"
FT                   /translation="MTRGQHTQDGGHAQNFVGPNPSGTRARVSERGIFLQCKERHMNAI
FT                   TQAVPFPLQTVFYRGLTQSLKHVGKVIGLFVRPPEMFTGPGASLLLGDAIAGSGVKRLL
FT                   IVTDAQLAKLGLVQPLQDHLTELGVFVAVYDGVLPDPGVEQIEEGLRVLQQERCEAVLA
FT                   IGGGSAMDCAKLIATRATNPSKSVLEMAGFFKVPTAPLPIYCVPTTAGTGSEVSVGAVV
FT                   SDPAQQRKLPVIDHKLVPAMAALDGQLMLGLPPAITAATAMDALTHAVEAYISRIATPE
FT                   SDRYALEAVSLIMRHLPRVMKDGRDLNSRQLMAWAAYRAGLALSRGGLGYVHGIAHNFG
FT                   ALYHTPHGWANAIVLPYVLEYSKSDCIPRLAELARASGLASGTESDAELADKFIQRIHT
FT                   LKQECGIPAGLADLRAEDIPQIAAAALQEAHFTYAVPRYMDQKTCEGLVRRMLVRASSG
FT                   VR"
FT   CDS_pept        577865..578842
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04740"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F599"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44057"
FT                   /db_xref="GOA:E1VGW5"
FT                   /db_xref="InterPro:IPR032713"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW5"
FT                   /protein_id="CBL44057.1"
FT                   /translation="MAKTLFYGILAALFFSTTFLLNRVISLDGGHWVWTAVLRYGFVLA
FT                   FLAVGLLLTGHVRLILAAVRIFREHVWFWTFTGSIGVGVFYSTICFSAAYAPSWVIAAT
FT                   WQSTILITPLLLLAFGRKVPMTGFAFALLVFAGVLLINVEHASETSLEMALLGAIPALV
FT                   SAIAYPIGNQLVWEARMGERFKKFIPHIDDPELDNSFCKILVLTFGSVPFWLMLLLVTW
FT                   PPAPSDSQYMNTAVIALCSGVIAYSLFLLARQRARNSFEITAVDATQAFEAVFTLAGEL
FT                   LLAGGALPSAGGWLGVALIVVGVMSYSLRQRHTAPASSGAAAAE"
FT   CDS_pept        complement(578877..580028)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04750"
FT                   /product="Methyl-accepting chemotaxis protein"
FT                   /note="silverDB:HdN1F600"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44058"
FT                   /db_xref="GOA:E1VGW6"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW6"
FT                   /protein_id="CBL44058.1"
FT                   /translation="MKSLFLRMRTIHWLGMVLLAVNATWFTEHLLGMVVQYAVVVVLIV
FT                   HDIDEYRWGVRSLREVSRYLAHFRVKDLSTASNIDMHFNTEMQQMVTVIDEFREVIRGA
FT                   LAAAKANAKENLAVSEQLFAALERIQKRVEGSSRESSSASQRMQRVRDRSSELAAACSD
FT                   AHQRISESTSSLNAVHVGLSSITQASRQIQSGSQSLSESIHQLAEGANQVGHIMQTIGS
FT                   IAEQTNLLALNAAIEAARAGEAGRGFAVVADEVRGLAQRTQTSLAEVGRIVELVTQSAA
FT                   DVRSAVEARTSQIEGLSKQADETLPKLTHVSEKILAIQPMVDQTAATATLLNDEMTQTV
FT                   QAVEYLLSNLKQNREDLSHVHLLSSQNHSAIIGLDEKLQEFRT"
FT   CDS_pept        580277..580639
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04760"
FT                   /product="Protein of unknown function DUF454"
FT                   /note="silverDB:HdN1F601"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44059"
FT                   /db_xref="GOA:E1VGW7"
FT                   /db_xref="InterPro:IPR007401"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW7"
FT                   /protein_id="CBL44059.1"
FT                   /translation="MNPWTWLGTAFLLLGGIGLLLPLLPTTPFVLLAAACFARSSPRAH
FT                   RWLLENRWFGPLIQDWEQRRCIPLKVRNLSLTMMTGFGAVSILFLIHALWLKLLGVALI
FT                   AIGCTVVMRLPVCRDC"
FT   CDS_pept        580885..583146
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04770"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F602"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44060"
FT                   /db_xref="GOA:E1VGW8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW8"
FT                   /protein_id="CBL44060.1"
FT                   /translation="MGAVFNFFRAGGFNQVRFDKGSDLLALAELDQKLWVALACPVNGL
FT                   VFDKRTLQLIDTDHDGRIRAGELISAVQWAGRMLNDADDLMRAPMPLPLSAINTSHEEG
FT                   KQVLRAAKTLLRGLGKPDAAEIGVEDTSDAVRAFNALPHNGDGVITVASVDTPELKALL
FT                   EEMIATVGGVNDLSGEIGINEEKSAAFFEAANAWLQWYAKAQETPDLLPLGEESAKAHT
FT                   ALLGVRGKIDDYFLRCRLAAFDTRAVAALNREEKEYYALAAKDLVITNDEILGFPVAHV
FT                   DADRPLPLRRGINPAWTAAMNRFVQDTVTPLLGEIESLTESAWVELCGRFAAFEAWQQE
FT                   KAGAVVEALGAERLRAAIQPALVEQLNRAFASEKEEESTAEAIASVERLVYYVRDIYKL
FT                   ATNFVSFQQFYQRKAPAIFQVGTLYIDQRACELCVRVDDVGKHATMAPLSSAYLAYCEC
FT                   TRPASGEKMTIVAAVTNGSADNLMVGRNGIFYDRDGKDWDATIVRLVENPTSLHEAFWS
FT                   PYKKLVRFVEGMIAKRAEASDAASTNLLSGAATGVADAAATGKSAVPPKKFDVGTIAAM
FT                   GVAVGGITAALGALLQAFFGLGLWMPLGLVGLVLVISVPSMVLAWLKLRQRNIGPLLDA
FT                   SGWAVNANARINVPFGSSLTRLAALPKGSRLDSFDPFAEKKRPWKFYGVLAAIVVLAVC
FT                   WGSGRLDSWLPKPVRSDAVFAHISAASDSVAASANNAVDSAKAGVEKAAAPSPAPAAAP
FT                   "
FT   CDS_pept        complement(583235..583762)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04780"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F603"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44061"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGW9"
FT                   /protein_id="CBL44061.1"
FT                   /translation="MNFSTNPYAPTSSARTQNTATTFSSRAFIILCVLGLLLFSGRTHA
FT                   DSLLIITNSKSGVTELSKEQIARIFLGKTRVYPNETPVVPWILREKDPTRVRFQISVLD
FT                   RDPMQIKAYWTRLLFTGRGNPPSALESNTAILHKVIESPTAIGYISTAEVDEAELKRAI
FT                   KQKQLNIVYRID"
FT   CDS_pept        complement(583773..585158)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04790"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F605"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44062"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX0"
FT                   /protein_id="CBL44062.1"
FT                   /translation="MREFETAMPACVHTPTAKSAALKRSRAVAALLSCSVFASAALISA
FT                   PCLAEESDVAWNGFLNIVGGKFNHEPIVDFESPHQRPSYAGYEKDFAFNPQTSAGLQAT
FT                   KPLDERFSITLQLYAEGDVDHYKADMKWLYLTWQPNYHTRIRIGKLSTPLYYFSDYINV
FT                   GYAYHWVSPPEPTYPFDSTMTGINVIYQDTWRGFDWTSEFTVGSGDDYFPTLGARASSR
FT                   NGYGLSFTLSHGEWFTLRAMGLRAKEDLTVDVLDPDHLGPYVEKITRRTLVERGIPQEL
FT                   ITSLAPAYASSAMTRLQDDRLYETGVPITYGNLALRLESQRLLFMAELVAYRTDTFLYG
FT                   NYVSGYVTGGIRFGNTLYHLTAVKGRNGSEREVRADIANNTPVDTSPDAVGDVLASQIR
FT                   VRIAGIAMRRPEALSLGLRHDVSENIALKFELTRVRERPSFDGDFSGVGYNTLARAALN
FT                   LTF"
FT   CDS_pept        585439..585675
FT                   /transl_table=11
FT                   /gene="vagC"
FT                   /locus_tag="HDN1F_04800"
FT                   /product="probable virulence-associated protein"
FT                   /note="silverDB:HdN1F606"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44063"
FT                   /db_xref="GOA:E1VGX1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX1"
FT                   /protein_id="CBL44063.1"
FT                   /translation="MAMTRVFKSGNSQAVRIPVELQFERNDIEYEITREGDEIRIRPAR
FT                   RKLNQLADKFVAFTDDFMAGGRLDEENQERELL"
FT   CDS_pept        585672..586067
FT                   /transl_table=11
FT                   /gene="vapC3"
FT                   /locus_tag="HDN1F_04810"
FT                   /product="Predicted nucleic acid-binding protein, contains
FT                   PIN domain"
FT                   /note="silverDB:HdN1F607"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44064"
FT                   /db_xref="GOA:E1VGX2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX2"
FT                   /protein_id="CBL44064.1"
FT                   /translation="MKYLLDTNMCIYLMKNQPEEVKERFSACYYGDVVISAITLAELEY
FT                   GVEVSAHKMENEQALTRLLEDLVVVPFDQGAAKAYALIRAGTPKGKSDALDKLIASHAR
FT                   ALGITVVTNNIKDFQRYPGITLENWVE"
FT   CDS_pept        586254..587009
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04820"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F608"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44065"
FT                   /db_xref="InterPro:IPR018720"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX3"
FT                   /protein_id="CBL44065.1"
FT                   /translation="MTATYEMDEVLDVRVLVPIQRHEKLLKLFKDLPVGESFTFINDHD
FT                   PIPLYYEFRSIHGDVVGWEYLNRGGRDWKVKVTRTEASKGREFRGASTLMDLRKIEEAE
FT                   WKHVVLHRYAMMQEGDVMELVSAELPAEIYQQFTAKFAGRHDWQWKKQGPDEFIAHITK
FT                   KKASGLEGEGFALVAEYDLRPYPPAERHEMFYKAFADIKAGEAFEFLNDHDPKPLYYQM
FT                   EAESKDPFRWEYLEQGPEDWRVRVVKTGG"
FT   CDS_pept        587009..587269
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04830"
FT                   /product="predicted 4Fe-4S ferredoxin, iron-sulfur binding
FT                   protein"
FT                   /note="silverDB:HdN1F609"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44066"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX4"
FT                   /protein_id="CBL44066.1"
FT                   /translation="MQRLSSPANQPSSAKAVALPRINADACTGCGRCVAACPPHVLWLA
FT                   SAHPLGWGGKTAELFNEEGCTGCAKCYTACPFDAIRMEKQR"
FT   CDS_pept        587465..588289
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04840"
FT                   /product="Predicted metal-dependent hydrolase"
FT                   /note="silverDB:HdN1F610"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44067"
FT                   /db_xref="GOA:E1VGX5"
FT                   /db_xref="InterPro:IPR016516"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX5"
FT                   /protein_id="CBL44067.1"
FT                   /translation="MSKSPEAPKVRQPHFEFTEGGDLPRYWWDNDPAKTLLLAALSATF
FT                   PPGEKFFIDSVRHYQHQIKDLELLRAIKGFIGQEAHHSREHQLMNDLMQSRGIDLARFE
FT                   REIQHFMDVLRERLSPERQLAHTVAAEHFTAMMADALLLQNDALDEMDPRIAALWAWHA
FT                   IEETEHKAVAFDVFKAIGGSEWVRVSEMMVVSVMFPLFTTLHLIQLMKDDGQLGNLRSW
FT                   FGAANYMWGKPGIFRKLIPEYLRYYSPKFHPWNQDSRKQVEKAKKRWLGDWA"
FT   CDS_pept        588347..589837
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04850"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F611"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44068"
FT                   /db_xref="GOA:E1VGX6"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX6"
FT                   /protein_id="CBL44068.1"
FT                   /translation="MSGEARYARWDDGSFGCESAKTNKKGVLMRIPSLFSVGFAAFLSS
FT                   TPLVLADTVSDLSNQAADFFAEQAADSPAAPLDGEGVVVAAKPNLWLQNALQLQRHLDD
FT                   REPLATSSFLMTHNSANAAAYRTVFSYIDPNQKLSLGQQLGAGIRSIELDVHQFFSMRG
FT                   WPWQWKKRILLCHGQNNHLGCSPYDRVLSAGIDEVKDWLKKEENRQEVIVIYFEDHVDG
FT                   NYAELVDAVAARLGDSIYRPTSGANCEGIPMQVSKQDILAAGKQVLLMGGSEVCRSSHG
FT                   WNTWAFAGVGDRLNGYPTGDLAQVSDTNCQFDRSFYDRYWVRFYEDRTVISSLFAKPDR
FT                   FGAEDVERLQKCGVNLIGFDRFSPTDARTRAYVWSWDEGQPAAISDAACALSQVNGRFS
FT                   ANACSEVARYACRVSGTHEWRITESAGTWQEGKFLCAHETGGEAVFVTPTNGYDNQSLQ
FT                   NAKAQAGAENVWIGLSQQDGAQAWQTNAGSAASESMTQ"
FT   CDS_pept        589834..590592
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04860"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F613"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX7"
FT                   /protein_id="CBL44069.1"
FT                   /translation="MKAPKPQRAFAGFGRPLLIFCVAGAFGFVVWNVVWGVIAARLESP
FT                   KNVKPVAAVSSHGGSDAAIARAGAPEPEFKTALQPPTYSDQPLVEQARRYEIDLIALFD
FT                   AIRERCLPEWGRSACNHKARAFLAEKTQEAGRNLLLEIYDQNTRYEDYIATYRPLEGLE
FT                   VDAMYATLQKLREQFFAPEVRAWMFGPQDARMRYEAALQEWNKNKADHLSENELAQQKE
FT                   ALKKAALGEFYPLFHSMPEAVDAFPVIDTN"
FT   CDS_pept        complement(590654..591514)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04870"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F614"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44070"
FT                   /db_xref="InterPro:IPR013423"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX8"
FT                   /protein_id="CBL44070.1"
FT                   /translation="MNISSTSATASGRYAAPLQSETSNTPSHTVERGDTLSGIAKLYGV
FT                   SLSALIKANPQIRNPDLIYPGDQIHIPKAAANGESTQESTASSDAAANSSQYGVPQSDL
FT                   LQSYASPRIASQIRNLQNTSAVQNHQQSSADPSWLKTARAEIGQQESAEKTGRSNPRII
FT                   EYHNTTALKAQSDRTAWCASFVNWALKQNGISGTNSAAAKDWAKWGEPSMLKPGAVVVL
FT                   KYKNDKGEDKFHLGFYVKGTPGNLTLLGGNQSDQVKESTYGASFSVYAVRMPSGESNTK
FT                   SQASN"
FT   CDS_pept        591635..591829
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04880"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F615"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44071"
FT                   /db_xref="GOA:E1VGX9"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGX9"
FT                   /protein_id="CBL44071.1"
FT                   /translation="MVVHRNIMQFSPPILGGMLGLAMVMVAACVLTPSVYLALNSPAAL
FT                   IGTTPEQAAQVLRLRWRWT"
FT   CDS_pept        592082..593404
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04890"
FT                   /product="Transposase"
FT                   /note="silverDB:HdN1F618"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44072"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY0"
FT                   /protein_id="CBL44072.1"
FT                   /translation="MNNQIEALFTTALGLQPPWHVAKVELNTAKRRIDFEVEHTGKRAA
FT                   CPACGVEHQLIHDRVRRSWRHLDFFQFEAWLHAEVPRVQCSGCGKTTQLPVPWAREGSG
FT                   FTLLFEALGLSLCRELPVAQAANQMRVAPKRLWRRVRHYVEVARAKDDMSGVRHVGIDE
FT                   TSVKRGHQYITVVHDLAAKRLLFACPGRDHQTLGAFAEDMRVHGGDPAAIEHACIDMSA
FT                   AYAKGIEQSLPNAQISYDRFHVVALANAAMDEVRREEMRNSAEAVREAVGVHGKKTLRQ
FT                   LLWGMRKDSASWTRAQFEAMHWLQRSNLKSARAWRLKQALRLVYREARDSNSEAIALGA
FT                   LTKWMSWARRSRLEPFKRLAVTLKEHLGGVVRGMLDGRSNAYVEAMNSLLQKAKAAARG
FT                   FRDPENFIAIAYLRMSKLEHLPQSPLVPAIARDYGRYRHVC"
FT   CDS_pept        complement(593602..596067)
FT                   /transl_table=11
FT                   /gene="ctpC"
FT                   /locus_tag="HDN1F_04900"
FT                   /product="Putative cation transport ATPase, possible copper
FT                   transporter"
FT                   /note="silverDB:HdN1F620"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44073"
FT                   /db_xref="GOA:E1VGY1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY1"
FT                   /protein_id="CBL44073.1"
FT                   /translation="MTEKLQIDLPVLLPDIAHDADACVQRLLVELRAQQGIEEVHIRSG
FT                   VNNQAHEVCIHYASEAPSLARIRELVEAAGARITQRYGHLIWQVKGVTHQRLARTLTKR
FT                   LLSMPGVLEAEVSIGGVVRVELDREKISEDDIRDALAEVGVNRKPEDPPAGRDSDQLKD
FT                   GDGDAHRHAGVFGENSELIFSLLCGGLLATGFALDKWAPVADWLAIANYLGAYLFGGFY
FT                   TVKEAVQNLRLKRFEIDTLMLVAAAGAAALGAWAEGALLLFLFSLGHSLEHYAMGRAKR
FT                   AIEALAELAPETARVRRDGEVREIGVQELVLGDLVLVRPNERLPADGFVVSGETSINQA
FT                   PVTGESVPVDKRPVPDPAQANIRPDLLDAAHRVFAGTINGAGAIDIAVTKLASESALAR
FT                   VVKMVSEAETRQSPTQRLTDRFERVFVPAVLATSFLLLFAWVVVDEPFRDSFYRAMAVL
FT                   VAASPCALAIATPSAILSGVARAARGGVLIKGGAPLEKLGSLDALAFDKTGTLTEGRPR
FT                   ITDVLPAPGVNETELLATAVAVEALSDHPLARAIAQDGVERLGSTTLPVASGLRSLTGK
FT                   GVIAEIEGHAVEIGKAEMFGSDRIPALTEPVAEAVERLRIEGRTTMAVRRAGRDLGVIG
FT                   LMDTPRATARPALERLRAIGINRMIMISGDNQRVADAVAKHVGLDEAWGDLMPEDKVEA
FT                   IKKLRDTTEVAMVGDGVNDAPAMAHATVGIAMGAAGSDVALETADVALMADDLSHLPFA
FT                   VELSRRTRKIIRQNLFISLGVVAILVPATILGLGIGPAVAAHEGSTLVVVFNALRLLAY
FT                   KEREYKPEG"
FT   CDS_pept        complement(596168..599392)
FT                   /transl_table=11
FT                   /gene="acrB"
FT                   /locus_tag="HDN1F_04910"
FT                   /product="Cation/multidrug efflux pump"
FT                   /note="silverDB:HdN1F622"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44074"
FT                   /db_xref="GOA:E1VGY2"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004763"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY2"
FT                   /protein_id="CBL44074.1"
FT                   /translation="MFKMIIEKSVQFRWAVVFAATLVMAYGLFQLSRLPIDAVPDITNR
FT                   QVQINTVAPALAPAQIERQVTYPLETALAGIPGLTSTRSISRNGFSQVTAIFTDQTDIY
FT                   FARQQVGERMREVEEDLPEGVTPMMSPVTTGLGEVLMWTVDFTPFDPDKTASPGEPGWQ
FT                   ANEIYLTPEGERLTTAEERATYLRTVQDWIIAPLMRSAPGLAGVDTIGGYVKEYAVRPN
FT                   AEQLAAYGLGLGDLVLALERSNIQAGAGFIQRAGEGLIVRADALALTVDDLAQAPITRR
FT                   DGLVIRVADVASVGLGRAPRLGAATRNGHEAVLGTALMIAGGNSRTVAQAAAERLVEVN
FT                   RSLPPDIVAEPVLNRSELVNATIKTVAKNLTEGALLVIAVLFLLLGNLRAAAITALIIP
FT                   LSFLFAVIGMNRFGISGNLMSLGALDFGILVDGAVIVIEATLLMLGQRRAELGRVLSPV
FT                   ERLNVAAQAARKMVRPAAFGQVIILLVFAPILTLEGVEGKTFQPMAATLMLALVGAFIF
FT                   SFTFVPAMAALFVREPKMQGDEHGRSDDGEHETRLIRFVRAKVEPVIRRVVMRPRAVFA
FT                   GAVLMLAIGLTAFVSLGREFMPTLDEGNLAMQALRVPSTSLEQSLSMQLALERALANEP
FT                   EVKTIFSRTGTAEAAIDPMPTNISDSVIVLHPRAEWPDGSLDKEALIQRFESLVSDQIG
FT                   NAFEFSQPIELRFNELISGVRTDLAVMVFGDDFDILQRTADQIALKLRGIPGAADVRVE
FT                   QVSGLPTLTVQIDHAAAAQYGLSAADVSEAVATGIGGTSAGKIFEGDRRFDVVIRLEEV
FT                   ARNDPAQLAALPIVAADGTVVPLSSVARIDVREGPNQISRNNGSRRIVVQSNVRGRDLG
FT                   GFVQEAQTAVADVPLPAGVYLTWGGQFENLQRAEARLMMVVPVVFLLIGSLLYMALGTI
FT                   REAALVFVCVPLALVGGALALLLRGMPFSVSAAVGFIAVSGVATLNGLVLMQAIRERLT
FT                   AGDLPLEAAAAGASSRLRAVLTTALVAIVGFIPMAIATGSGAEVQKPLATVVIGGLITA
FT                   TVLTLMVLPTFAARAVKPEETGRGRA"
FT   CDS_pept        complement(599403..600611)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04920"
FT                   /product="HlyD family secretion protein"
FT                   /note="silverDB:HdN1F625"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44075"
FT                   /db_xref="GOA:E1VGY3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY3"
FT                   /protein_id="CBL44075.1"
FT                   /translation="MNSTKNRLLIGAALLIALGLGFGVAQFVPHAEHEAQAEDGDHASH
FT                   DAGHEEDGGHDDHDEHEGESTEEGVVALTEQQIKASGIGIVNVSRGGGNEYRLSGRVEP
FT                   AVDAKAIVAAVTSGRVEQILVATGASVEVGQSLAIIVSGEAATLRANADAAVAEAEAAR
FT                   LVYQRDLNLVAQGIVARQEMEASRARSLAADAAARAAQAQVAASGSPDTSGRLTINSPI
FT                   AGIVSAVNITPGGVVAAGGAVAEIADPARVELVFNAPPALASAVTTETRIQVTGTSRNF
FT                   DAVVVGVAANAREQSGATVIRARSTAGDLPPAGSPITAIVVTDTQEAGLTVPADAVQTV
FT                   EGQSVVFVVEDSGFRATPVLVGRRAGGFIEILNGLSGNERIAGTNAFLLKAELAKGEAE
FT                   HGH"
FT   CDS_pept        complement(600622..601860)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04930"
FT                   /product="predicted outer membrane efflux protein"
FT                   /note="silverDB:HdN1F626"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44076"
FT                   /db_xref="GOA:E1VGY4"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY4"
FT                   /protein_id="CBL44076.1"
FT                   /translation="MFTSFSRPQWAVGFAVAVTAVLFALPSRAEPAPPYEALIESLDRI
FT                   PITVEAEALLDAANARAQQARALPNPSVSVETENVYGRGPFSGYDAAESTFSINQPLEL
FT                   WGQRGARIGAAQAEAKVAALRRDQTQWTVAGSLALIYSEAEAASLQYELAVEALELTEA
FT                   DANAVMLLIEEGREPSLRGIQANSEVESARAAVDEARANRDAAFARLTAAAMLVQPVTA
FT                   IEPSLLNRSPDASFQAMGNPLTVQIAEAELEAANKSVSVERLRARPAVSASLGVRRFQE
FT                   YDTEAFTFGINVSLPLFDRNKGAISAARAEERAAAARLTTAKLQTQANRSAAQARLDAS
FT                   ITRIRAADKGVASAEEAYQLARAGFDAGRISQLELRSIRSALISARNTAVNARLARVRA
FT                   EVELAGLDGRAPF"
FT   CDS_pept        602602..603858
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04940"
FT                   /product="Transposase Tn3, fragment"
FT                   /note="silverDB:HdN1F627"
FT                   /db_xref="PSEUDO:CBL44077.1"
FT   CDS_pept        603979..604173
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04950"
FT                   /product="carbon starvation protein A (CstA), fragment"
FT                   /note="silverDB:HdN1F628"
FT                   /db_xref="PSEUDO:CBL44078.1"
FT   CDS_pept        complement(604166..604678)
FT                   /transl_table=11
FT                   /gene="sodC"
FT                   /locus_tag="HDN1F_04960"
FT                   /product="predicted Cu/Zn superoxide dismutase"
FT                   /note="silverDB:HdN1F630"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44079"
FT                   /db_xref="GOA:E1VGY7"
FT                   /db_xref="InterPro:IPR001424"
FT                   /db_xref="InterPro:IPR018152"
FT                   /db_xref="InterPro:IPR024134"
FT                   /db_xref="InterPro:IPR036423"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY7"
FT                   /protein_id="CBL44079.1"
FT                   /translation="MNKTIIFASILISSSAFASADVTMNTVNEKGVGASIGTVALSDSK
FT                   FGLVLTPKLHGLPPGLHGFHVHQNPSCAAQEKDGVMTPALAAGGHLDPSASNKHGEPWG
FT                   DGHLGDLPPIYVDASGNASQPVLAPRLKAADLVGHSLMIHAGGDNHADHPAPLGGGAGR
FT                   IACGVVK"
FT   CDS_pept        complement(604821..605651)
FT                   /transl_table=11
FT                   /gene="oxa9"
FT                   /locus_tag="HDN1F_04970"
FT                   /product="beta-lactamase class D (Penicillin-binding
FT                   protein) (OXA-9)"
FT                   /note="silverDB:HdN1F632"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44080"
FT                   /db_xref="GOA:E1VGY8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR002137"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY8"
FT                   /protein_id="CBL44080.1"
FT                   /translation="MVKPRSQLAFLLVVISVLFSANAVASEQAALLKCTLVVDAATGST
FT                   LYRNGDCTRRASPCSSFKIPLAIMGFESGILHSPESPTWELKPEYNPSKRDQMYPKVNP
FT                   VLWERDSVVWFSQHLTTRLGEAAFSDYIKKFQYGNQDGSGDSGKNNGLTRSWLMSSLAI
FT                   SPEEQVQFLHRFIARQLPISRNTYEMVRATIPQYQAKDGWVVHGKSGSGWLLDRDGKED
FT                   ESRPQGWFVGWAEKAGRQVIFARLEIGNVKSDVPGGTRAREEILSEIHALVSAK"
FT   CDS_pept        complement(605822..606871)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04980"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding protein"
FT                   /note="silverDB:HdN1F633"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44081"
FT                   /db_xref="GOA:E1VGY9"
FT                   /db_xref="InterPro:IPR004453"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR013542"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGY9"
FT                   /protein_id="CBL44081.1"
FT                   /translation="MTDSQLQRLVAQLHEWARELGFQALGITDTQLDLPADRLGAFLEQ
FT                   GRHGSMQWLENHQEKRRHPALLELGTFRVISVRMDYWTDSDAKANLQNQERAYISRYAL
FT                   GRDYHKMMRRRLAQLADKLRAEVESSTLGRAFVDSAPVMEKPLAEKAGIGWQGKHTLII
FT                   NKKAGSYFFLGEIYTDIPLPIDTPASNHCGTCTACITACPTAAIVAPYELDARRCITYQ
FT                   TIENKGAIDLELRPMMGNRVFGCDDCQLVCPWNKFAQFSENDDFKPRHSLDQSSLAELF
FT                   LWSENDFLDRTQGSAIRRAGYEGWLRNIAVGLGNGPFTPTVIQALEQRRGFSALLDEHI
FT                   DWALKRLLE"
FT   CDS_pept        complement(607056..607889)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_04990"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F635"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44082"
FT                   /db_xref="GOA:E1VGZ0"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ0"
FT                   /protein_id="CBL44082.1"
FT                   /translation="MPESSTKTRNKVMATNTATERKVYEKPTDWTLMSPIFSSHIKRIG
FT                   ILRTFAGGLPMYTCIPALVVLHLTACVLAYQWLITPLMRTKKVRFRDYVIIDRHRIEGM
FT                   NFFDKFNCMFCGYANGLTTLANVEIDNFSKVDLNALPLWRKVLASALIIPFVPLLAFFE
FT                   LNFQIIYNILVSTPLGMHRISMNEANQVLEKEQYAKQYPAFARIPTLMAKSVVFRFSMG
FT                   LEQIESSWCPLKHLERREGVVYPSHHSRFFGPHQLEEMRQVLSTKGTVSDRLPKY"
FT   CDS_pept        complement(608325..609377)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05000"
FT                   /product="probable RND type efflux pump involved in
FT                   aminoglycoside resistance"
FT                   /note="silverDB:HdN1F636"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44083"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ1"
FT                   /protein_id="CBL44083.1"
FT                   /translation="MEPDMKNIFSARALAASALLFASTATFFTPASTANAAELPERTFC
FT                   VFDLLGKAGPIGAFMEDYRLEATKWGINLKIKTFTDEKIVTEEFKARTCDGAAISGLRG
FT                   RSLNPFTGTIDSLGALPRYDQLHAALAKLATPAVAPLMINGSYEVVGILPAGGAHLMSS
FT                   DRDINTAAKVAGKRIAAMDFDKAQAAMAEYFGGSPITANMSNVGSLFNNGAVDIIGAPL
FT                   LAIQPLELYKGLGEKGGIADFAIVQLTGQLYVHHDRFPEAYGQKSREYVFSQYDRALAD
FT                   IQRHANDVDPKYWVKIPENDLKDYLELYRKVRISLREQGIYNGKMLSFLSRVRCSLEPF
FT                   LTECTAADRE"
FT   CDS_pept        complement(609588..610016)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05010"
FT                   /product="Molybdenum-pterin binding protein"
FT                   /note="silverDB:HdN1F639"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44084"
FT                   /db_xref="GOA:E1VGZ2"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ2"
FT                   /protein_id="CBL44084.1"
FT                   /translation="MQSSARNQLKGKVTKINHGSVNDTIKIELAGGDRLVATITSESTQ
FT                   TLGLSTGTSVIALIKAPWVMVATHAENVKVSARNQLNGVIEHLKTGAVNTEVGIRLKGG
FT                   TVITAMITNDSAEALQLHQGQSTTAIVKASHVILAVAN"
FT   CDS_pept        610205..610879
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05020"
FT                   /product="Transcriptional regulator"
FT                   /note="silverDB:HdN1F640"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44085"
FT                   /db_xref="GOA:E1VGZ3"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ3"
FT                   /protein_id="CBL44085.1"
FT                   /translation="MVVAKAARAKKTAERNYGGLSEADRVSARRKRLLDAGFEVFGTLG
FT                   IRGTTVRMVCKSAGLTERYFYESFADSDALFCAVYERELRVLQTLFVSHLPSLPITLNE
FT                   RIHAILTIVFNSMRDSRRVRIFYVEALAGSEQVQNMYHYSVRFQAQLSATFIRADNPAV
FT                   TASNDVLLQVGYAINGAFSSLLVQWMRGGYTTPIEIVVSSAEIFVHGVMRELLERSRAG
FT                   AS"
FT   CDS_pept        complement(610957..613038)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05030"
FT                   /product="Predicted acyl esterase"
FT                   /note="silverDB:HdN1F641"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44086"
FT                   /db_xref="GOA:E1VGZ4"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR005674"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013736"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ4"
FT                   /protein_id="CBL44086.1"
FT                   /translation="MKWTDKRFGRTCLALAISSLLIACSGGSSSNSSQTNDTQTGATDT
FT                   TAEENITVDTPETNQIDAQSRANLTATGGAIYRRDAEYRYAVSLPLRFVEASNGKKLAV
FT                   RVTLPANEKGVPAPGAFPVILTQGAYNGGLLSTMFMGIPGNLLLGVTDSFVVRRGYVQV
FT                   SVDAMGTGASEGGWELLGADEQQGFADIVDWVDEQPWSNGKLGVAGVSYMGISSLFAAE
FT                   SRPDKIDAVFASLPAGDVQRGIVGVGGMLNAVFMSEWMFITHTTSTQNVPNMLTSPRNM
FT                   AQLIRSTDEHVAQVDKYFLPLIDDALYGAPYVTYDSDFWRTRSPSTNINKIKAPTFILG
FT                   ALDDLFQRDQPLLFDALDKNGVDAKLVVFGGTHMANFIKPHVGSEVVPPIDFLMLQWFD
FT                   KHLRGMETGIEKSPKVVQFVKNYPSESTPEAFRNDSLITTSAWPHPEAQAERWYLHGDM
FT                   SLDQAAPTSTENSPLMTQPEHPKGEAHNSKGLLAFNVEINDGTKCSRSHLQWVLGLEMP
FT                   KNCQTNTNRTEQQRLVFDSAPMPEDYFINGPITAEVWIDSTVTDAAVSVSVEEVSKKRS
FT                   LPITDGQLLASVRAVDESRSRFLNGQMIQPYHYLTEEKAQALVPGQVVKMQIEIFSTAA
FT                   LIRKGNKLRIAISPSNQAQSMINYPRQDLMSGGVTTLHLSPEYPSSVVLPIVPLSAMN"
FT   CDS_pept        complement(613200..614900)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05040"
FT                   /product="probable von Willebrand factor, type A"
FT                   /note="silverDB:HdN1F642"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44087"
FT                   /db_xref="GOA:E1VGZ5"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ5"
FT                   /protein_id="CBL44087.1"
FT                   /translation="MMKRIARLNTERYAADDALISHAELTQLLKRHLPPGTVALFAKPK
FT                   EVPDTPFIEWQSELGGQPIALSELSDNEQAKVVRLLNERLDSIAQLANRLESKGAEGAR
FT                   QASLLRHAARYPGLESVYSLNGEPVLTFWGHRLASEPPPPVAPTVEPPPPIAPAPIPET
FT                   LSLTPTADPKKRNWWRWLLLALLLLLLLAVLCWFFKLDGKLPWATDTSTPAVVAPEPPA
FT                   EPEAAVKPETPIEPVAEPEPVIPAEPPVAEPVPEPTPPPPPPPPPPPPPPDPLDLLEKR
FT                   VAGMKDCVALQKILSKEPLLQKGDAKAQSIKQNINQYLEKNCRQKLITEAKNLCPSERP
FT                   KEIAPELILVFDASGSMDFSLLASPKEVSEAQSAQLLQNVFSAVSGVNLGTNSKVSRLF
FT                   REPKRITAARQAAVAVAQNLPSDVGVGLVLVDRCPAARSEGFFPPAKRGTLIQQLQSIR
FT                   PAEGTPLADGVARAGQLVDGVKRESIMLVISDGEESCGRDPCAIARELARTKPHLTINV
FT                   VDIMGTGAGNCLANLTGGKVFTARNAQDITLMTNQAAADVLGPANCKAR"
FT   CDS_pept        615152..616711
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05050"
FT                   /product="Hypothetical protein, similar to putative
FT                   virulence factor of Yersinia pseudotuberculosis IP 32953
FT                   (CAH21450)"
FT                   /note="silverDB:HdN1F645"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44088"
FT                   /db_xref="GOA:E1VGZ6"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ6"
FT                   /protein_id="CBL44088.1"
FT                   /translation="MTGALLRSGKLQEFKALGEDGQPVFAAALQLREAIRLKVGRDAAN
FT                   CLAVPQRNEAGDCADWYAPTEGDVVPWSSATDEERASAKAQLIEVQAKLRSVSATMKAD
FT                   EGRSTQIFGRLLDKVIYFPDDSHLYLVDGKPVLTFWGFVDPTGPVEDDPLGRLQPREPL
FT                   VAPAIAEAPVVAVSPVSPVIPPVPPVVVQTAVETTKKRRFPWWWLLLLLLLLLLLFWLL
FT                   RSCVPQPSIDISGPVAEVQDAQGSVQNSDDSYSRRSTSDSRYSGDHRSTTDSSFSSDTH
FT                   STTDSSYASDNSSTTDSSSTTDSSATTDSASTSDRGSTSENLGAEEGQTSDVAAQENPK
FT                   QNSGLENASNTKDEPNGTPANEGATNAPSSEPAGQNQSGDASSQKGENQEFPPQKALEI
FT                   PPDAVKGNDVSFLDGKWKAGSGIQDAKTGKPIQLNYDFKNGKGQVQMTSAGGVNCSGDV
FT                   DAAMGSGGLQIRNQGQLKCKDGSTYKLPDVQCVPGSSSAAKCTGTYENNVKLPIFMKQE
FT                   GG"
FT   CDS_pept        616868..619837
FT                   /transl_table=11
FT                   /gene="srfB"
FT                   /locus_tag="HDN1F_05060"
FT                   /product="Uncharacterized protein conserved in bacteria,
FT                   putative virulence factor"
FT                   /note="silverDB:HdN1F646"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44089"
FT                   /db_xref="InterPro:IPR009216"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ7"
FT                   /protein_id="CBL44089.1"
FT                   /translation="MLPELVQYESRMTLIMATGVQFLDFALKLDLRREPAGEFAPQQSN
FT                   LSLARLHYDERTDQYFHPAEPSRAVASKISVPVDQSINLLDGMWLPIPFFRMAPSRKFA
FT                   EGPGNWARARIVSLADGEDPDGYTHRVTLAFDTRVFHSRSDMAYLAPTSDDVKAGSSFG
FT                   FAYRSDEMGWFPELAWVDSWLQEVFAENAQQRLRMQREDIEDERKLLYHQAHYLNLLYV
FT                   LGSRLQLPEINVISNTASDLYKPIQVDMVLDVGNSRTCGILIEDHPQEGDGLRKRYELE
FT                   LRDLTMPEHIYPEPFESRVEFAQATFGKDHFSAQSGRSDAFLWPTIARVGRESARLASR
FT                   RRGTEGSTGLSSPKRYLWDEDSYEPGWRFNCAFVKSESEPFATAAPVANLINETGDALY
FT                   AIPWDQRMPVFHPHYSRSSLMTFMLSEVLVQALMQMNSPSQRLKQSHSRVPRHLRSIVL
FT                   TVPPSMPKPERELFVKRVKQALGLVWKSMGWHPEDDDIENEGAAKAWPPMPTTHVQWDE
FT                   ATCGQIVYLFTETQNNFGGRPEEFFAALARPDKEDRKSLTVASVDIGGGTTDLVITRYK
FT                   LDEGKGSNVFIVPEQRFRDGFKIAGDDILLEIIQNVVVPALSDALKKAGVSRPEALLSR
FT                   MIGNETVRVQDAVLRQQLVLQVLSPIGLRLLKEYEKYDPLDPGTLGTFSFKELLSAEEP
FT                   PTREVLEYVETAVRRYTDSSVAEFNLLDAFLTINLRKIHELFISNRMNICKSLKALSEI
FT                   IYLYQCDLLLLTGRPSRLPGVQAVFRSLMPVPPGRILPLHQYRTGGWYPFHKQGRIDDP
FT                   KTTAAVGAMLCLLGQNLRLPNFFFRSAALKPYSTVKYLGMIDNNNVVKDSNVYFHDINL
FT                   DDPDYQFPDTAFELRGSLRLGFRQLDAERWPAAPLYIITLISEKLTKTVGQDGSVLNVS
FT                   LKVDRKSRSAEGTESLTIASAESEAGTARKEALRMQLNTLADAGLGGTHYWLDSGSVYQ
FT                   "
FT   CDS_pept        619834..622587
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05070"
FT                   /product="similar to uncharacterized protein conserved in
FT                   bacteria, putative virulence factor (SrfC)"
FT                   /note="silverDB:HdN1F647"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44090"
FT                   /db_xref="InterPro:IPR017030"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ8"
FT                   /protein_id="CBL44090.1"
FT                   /translation="MSANGENQHGAEAERLAGHWQAIYRGAGDAIQWIGNVRASAPRLD
FT                   SEADHLVLKLRRVRNTAKRLGAVTPRPMTVGFFGLSQAGKSYLISVLAAGANGKLETIF
FT                   GGNRLDFIDHVNPPGGGKEATGLVTRFSRTATAGPSDYPIELRLFSELEIARILANSFF
FT                   KDFNVEKFQYEYSEAKIRQTIKELTKKSQHQPVSGVTEDDVVGLWDYLKDRFPSSLKML
FT                   DVCFWPEAVSLAPYLSLEDRGRLFSVLWGEIPEFTETYSMFARVLAQLGHPERVFAPLD
FT                   VLVSKTPQGGLSQADSIMNVDMLERLGRSIDKAVQVRPEVDSELQAPVSLSLAQLAALT
FT                   TELVFPLVERTSEPLFEEVDLLDFPGYRGRLKVESLEDVRRQVKSDEANPVAQLFLRGK
FT                   VAYLFERYTDSQEMNVLIVCTPSNYQSEVTEVGPVLTEWIARTQGATPEIRSRRSPGLL
FT                   WAITKFDLRIADLLPKTEDNLRIQWGAGGMMRMTMLERFNQYPWLQEWAPGRAFDNTFL
FT                   MRKPRVAVPFLKVEGGVETGVNTSVAPQLALMKKTFAEDEAVRTHIHDAEAAWDGMMAL
FT                   NDGGMARMASYLRKVASRKFKLERSREQMEELVHDLVEANLARWYQAEGAGEVEKKKKL
FT                   AQEIANSIRARALLFGDLLQRMQISDDTLRTLYLRVEEEVGEDASAAQEGNAASGGALN
FT                   LGGDLINFGGDFDLFGGGSAEGAHSAAPTKPVSATSEGSDARFARVAFREWIHHLRNLP
FT                   GDQRLMQYFGYPRAQIEALIDELVTAANRMNLQSHLLNVILGTEQAGTKRSQLVDRQVL
FT                   IVQAAISDFIAWLGFVQVPPGERPESLVNRGVPIFSPPATVEPNRLPQLPSQPINHSAF
FT                   YLYDWLVAFSRVAISNAGHSAGREITPEQNDALGKIIALLTSTRSE"
FT   CDS_pept        622591..623817
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05080"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F648"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44091"
FT                   /db_xref="GOA:E1VGZ9"
FT                   /db_xref="UniProtKB/TrEMBL:E1VGZ9"
FT                   /protein_id="CBL44091.1"
FT                   /translation="MTIRLELAPSNSGPGKAILSVYGWKGDLMRVSFIVQRNQDSHYLT
FT                   LRGAWGPRQEVRVLGRFTQEGDALTCEVGADLVDPLLSDPQSRYLFELYDQNGNRDRGV
FT                   LRMVGTLFSSQAAGNSLVEEIVGQPESSPPEPPRKSASVPAPMGAADHSAGAAPSEVNL
FT                   GMSDATLVAPTPTAPFRAAQLEPSAPDSKPPRTPDLTDVGTISREKLDISALDASPLTS
FT                   NVSTGGRGGSQNPAPPKRWPFVLLAVLLLALIGFGAAWYSGLLPGFGLSLPNVTSLSTG
FT                   TSSSPSPASGPCGVDAMKGGDDLQFIQSCMGSSPKPDDVLAIIASAKQAGRCNIMQRLY
FT                   AYNAQAGNVEVAVAYAREYDPETFQKNTCIDSADADTAAYWYEVALNKDPNHQVAKDRL
FT                   AKLTGQATP"
FT   CDS_pept        623874..625925
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05090"
FT                   /product="von Willebrand factor, type A"
FT                   /note="silverDB:HdN1F649"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44092"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH00"
FT                   /protein_id="CBL44092.1"
FT                   /translation="MIYRPISKVLILALSLATAFGIANASADTPLLQKGKKTLFERVLT
FT                   TPGCTLGAQPGEKGKLQPAFSRFYVYKHQSVGGADWLEVGPDSTGKRAGWLPSACTVEW
FT                   KMQLALSFTNPAGRDPLLFFKERNTLDKIFASADPNQLVKPIRENMKARGRDPAVVAQE
FT                   PNYAVDIQKNFYLLPILGAQEVMTEEGYNVRVLNVASVSAKAEAGKAGAESVAASGASG
FT                   GAQANQGKADAADAANRLKAFSAAVVFVIDSTISMDPYIERTREAVKKIYQRIEDENLL
FT                   SQVKFGLVAFRSSTKAVPGLEYVSKMYVDPATVKDGKDFLAKVSSLKQANVSSKAFQED
FT                   SLAGVMQALNEVDWSQYGGRYIVLITDAGAVTPDSGLSSTGLNPEQVRLEAATRGVAIY
FT                   SLHLKTPAGVKDYTNAEAQYSDLSNNAYLGKPLYYPIEAGDVGVFGRKMDTLAEALTTQ
FT                   VRMAYSGEMAAGSALGAAPSFAKKTENTPAKSAEDDSLLQDAALLGHAMQLAYLGDVSH
FT                   TKAPLVFKAWVSDRDLVDQKRATTEVRVLLTKSQLSDLNDVVKRISDAANEGLIAPSKM
FT                   FEQLQSIAATMGKDANQVRASQSTRLAEMGLLGEYLDDLPYKSAVLSLDEDTWKSWDGL
FT                   AQEKFIRDLNAKLKYYKHCNADTDRWVSLADGSAPGEYVYPVSIEMLP"
FT   CDS_pept        625935..626663
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05100"
FT                   /product="ABC transporter, atp-binding protein"
FT                   /note="silverDB:HdN1F650"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44093"
FT                   /db_xref="GOA:E1VH01"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH01"
FT                   /protein_id="CBL44093.1"
FT                   /translation="MLTIENMEIVRAGFQGKSQTGEAGYRVLLPQLKLAAGEVVAITGP
FT                   SGCGKSTLLEAVGLILAPKRVQKFCLAAADRLDIQALLDANDEAKLSQIRAEYLGFVLQ
FT                   TGGLLPFLNVSDNIALTQKLSGRQLAKQWLDEAVGCLGITHLQKKMPSQLSIGERQRVA
FT                   FVRAIAHQPSLLLADEPTAALDPMQARKLFALMVELVKQFQIAALVVTHDWELVRECGI
FT                   RNILGRPAQNAAECVFDERD"
FT   CDS_pept        626650..627915
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05110"
FT                   /product="abc transporter, permease protein"
FT                   /note="silverDB:HdN1F651"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44094"
FT                   /db_xref="GOA:E1VH02"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH02"
FT                   /protein_id="CBL44094.1"
FT                   /translation="MNATKQILGSSKQSQWTLLCKLAAQDLWFDRKVSLCIIAALVAVI
FT                   APLLLLFGLKYGIVSQLRSELLSDVRNLELRMLGNGDYDNVWVDRLRSQPLVGFTIPLT
FT                   RSLNTEADLIRDPRRFVESAEIIPSAEGDPLLQASITAPELLAPTALGDVVLSASAARK
FT                   LDAIVGDTLRLRVLRKRDGVDERGELTLTVKGILPESRFSRPAALVSLELLIALEDFRD
FT                   GRKVSALGFDTGDETASAARHYARARIYARNLDDVAPLAEWLKSQNVEVITRAREIESV
FT                   QAIDRVFSLVFSVIAWTAVIGGVASLIGAFLANIDRKRKDFALLRLLGLGKWAVGFYIL
FT                   IQAVLLTGFAFGIAGLAYFAGSTVFNHALGANLAEGNYVCRLELSHLVLAFALSLLAAC
FT                   LVSGIGGYRAIRIQPAESLREI"
FT   CDS_pept        627930..629507
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05120"
FT                   /product="Protein of unknown function DUF323"
FT                   /note="silverDB:HdN1F652"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44095"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH03"
FT                   /protein_id="CBL44095.1"
FT                   /translation="MRLKNIASIKRKCAWPICLGVFALPLALPVNAAWDERYYNPAPAE
FT                   GDVVLPMPCDGAMVFRQVRIPLTKPLDDYGVTIGQEGGEWGYVEQARPAWIAGSFTTQK
FT                   PEPSRYYLLAKYETTELQYQTVMDAKCPTAGMKMRLPQTSQSWFDALSFADRYNQWLRK
FT                   NALAKLPKEDGVAGFLRLPTEVEWEFAARGGLTVSPAEFRDARFPISGALSDYVWFAGS
FT                   QSANGKLQLAGLLKPNPLGLHDLLGNADEMMLDAFRINKLDRLHGQAGGYTVRGGNYLT
FT                   SQAEIRTSLRQEHAHYDNAAPSVSKTTGFRLAMVATTLTSRGRVQEIEKEWQALGGQAG
FT                   GQGSGASAPKNDPVQQLGKIASDSQDEATKRQLETLRSELRANIQARDEQRDQAIRANL
FT                   QLGAFLCTKLQDDGKFYDFRLKNYTETCKQGADQTPLCTSRKEDLDGRKKVLDFILGYY
FT                   ADTIVDAGTTYNAAQMKSQISVAAQQLTERGKNNLRDFLNTHWQNQQGYLSSGKIARTQ
FT                   WLDACKKI"
FT   CDS_pept        629507..630301
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05130"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F653"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44096"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH04"
FT                   /protein_id="CBL44096.1"
FT                   /translation="MKIQGAFMDTRWLDLLVKSLFACTLAIVLAGCGVYHMPGASAGAS
FT                   SPAAAGYPSTSAERGAGGVDPRLESDSAAFFSKSGLQACAGGALVGVAGCMLGNPSNRH
FT                   ACMLKAGLAGCGVGMGVNYYLDQRRSEYSNNEQRLNAILTDVRSDNAKLQNLTQTARSV
FT                   MDENRRQMEQINREIAQKTLDRSKAQKQLAEIDANTLYLKKTLAEVRAREKNWRDVAQA
FT                   ERNSGARVDALDAEISRLNQQASVLESEINDLYKQRSAIRLG"
FT   CDS_pept        630324..630839
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05140"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F654"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44097"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH05"
FT                   /protein_id="CBL44097.1"
FT                   /translation="MKKSNQTAPKAAIFSVLLVTSLVSGCAVNPEGCDPTHRDASIIEK
FT                   GRCNWSGAYQVRSDHLEKVVLDERKTNAMLTDVYNAIEQEKRQSASNLKKTRDQYATVT
FT                   RALNALLTEVGSKAKGNRAIEKEIADLSQQLEALKTQDSPSVLQKQAELDQLKTKVVGL
FT                   EQQLGLGE"
FT   CDS_pept        complement(630857..631723)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05150"
FT                   /product="Conserved hypothetical protein 255"
FT                   /note="silverDB:HdN1F655"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44098"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH06"
FT                   /protein_id="CBL44098.1"
FT                   /translation="MIRSMTAFSRKELSTENGTLSWEIRSVNQRFLEVIPRLPDHFRDL
FT                   EMPVRDRLRQRLSRGKVECTLKFKGDTGKTADLKLNETLVQQILASAKTLAEITGSSSS
FT                   ISPQTLLTWPGVVETPEADFKGLQALAMQLFDRALDDFIQVREREGAELRRLLEERLDA
FT                   ICGHVAVVREAIPGILQAQRERLQLRLQEFLANLDAERVEQEMVMLAHKSDVEEELDRL
FT                   STHADEVRRILAEGGAQGRRLDFLMQELNREANTLGSKSVHVSTTQIAVELKVLIEQMR
FT                   EQVQNIE"
FT   CDS_pept        631912..632628
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="HDN1F_05160"
FT                   /product="Ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="silverDB:HdN1F656"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44099"
FT                   /db_xref="GOA:E1VH07"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH07"
FT                   /protein_id="CBL44099.1"
FT                   /translation="MRPSGRKPEELRKINITRDYTCHAEGSVLVEFGNTKVICTASATE
FT                   GVPRFLKGTGRGWVTAEYGMLPRSTHDRMDREASRGKQGGRTLEIQRLIARSLRAAVDL
FT                   KLLGENTIYVDCDVIQADGGTRTASITGGCVALVDALSFLLKKGTIKQDPLQRLIASVS
FT                   VGIYKGVPVLDLDYPEDSKAETDMNVVMTQHGGLVEVQGTAEAEPFTREQMNAMMELAE
FT                   KGIGELFLLQQKALNW"
FT   CDS_pept        complement(632762..633595)
FT                   /transl_table=11
FT                   /gene="xthA"
FT                   /locus_tag="HDN1F_05170"
FT                   /product="Exodeoxyribonuclease III"
FT                   /EC_number="3.1.11.2"
FT                   /note="silverDB:HdN1F657"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44100"
FT                   /db_xref="GOA:E1VH08"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH08"
FT                   /protein_id="CBL44100.1"
FT                   /translation="MTASSTTESKNQPDSKHAPLLIVSANTNGIRSAASKGFLEWIQKR
FT                   QPDVVCIQETKAQLHQLDVFITDIPGYHSYFFDAQKKGYSGVAVYCKREPDRVVRGLGF
FT                   PIADDEGRYLQVDFGDLSVASLYLPSGSASDEAQEKKYRFLDTFLPMMKAWREDGRRYI
FT                   LCGDWNIAHKNIDIKNWRSNQKNSGFLPEERAWLDRVFDEQGWVDAFRAVNSEADQYTW
FT                   WSNRGQAWAKNVGWRIDYQIVSPELRDTISSTEIYKDERFSDHAPLLMSYDITLG"
FT   CDS_pept        633769..634431
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="HDN1F_05180"
FT                   /product="Orotate phosphoribosyltransferase"
FT                   /note="silverDB:HdN1F658"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44101"
FT                   /db_xref="GOA:E1VH09"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH09"
FT                   /protein_id="CBL44101.1"
FT                   /translation="MEAYQRAFIEAALARQVLKFGAFTLKSGRQSPYFFNAGLFNTGLA
FT                   LAELGRFYADAIVHSKVEFDLLFGPAYKGIPIASATVVALADQHHRDVPWCFNRKEAKD
FT                   HGEGGSLVGAPLQGRVLIIDDVITAGTAIREVMSIIQQSQATLGGVVVALDRQERGRGD
FT                   LSAIQEVERDFGVKVTSIIQLEHLIEYLAEQAGEVPHFPEHLAAIKKYRDQYGIHHV"
FT   CDS_pept        634484..635152
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05190"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F660"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44102"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH10"
FT                   /protein_id="CBL44102.1"
FT                   /translation="MVGIGALVLSLTVPALAAGPATGKKLYRYTNDKGVVVLGFSIPPD
FT                   QVYRGYSVLSPNGTVLEVVQPSMSPKEREEYQRRAPERLKEEEARKKQEDADRQLIAVF
FT                   ATAADVDRARDRKLEAIDLQISVSRSNASRLRTELNASEEQAANRERSGQAVPDFMVDK
FT                   IDSLQRQVSQLEDAIRKRKQEKERVRQEYAKDRERLEYLLSQPELLRSLQPGEKSAQPR
FT                   "
FT   CDS_pept        complement(635189..635824)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05200"
FT                   /product="Transcriptional regulator"
FT                   /note="silverDB:HdN1F661"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44103"
FT                   /db_xref="GOA:E1VH11"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH11"
FT                   /protein_id="CBL44103.1"
FT                   /translation="MPSAPPQSGRGSRKAQILQALADMLEAVPGGRITTAALAREVGVS
FT                   EAALYRHFPSKARMFEGLIGFIEESLFSRIAAIEQSESSPVSQCQQILLMTLVFCERNP
FT                   GVTRILTGDAITGENERLHQQVVQLFDRLETQIRATLRKVELQERLRTRIPVADAANLM
FT                   LAQLEGKISQFVRSGFKRLPTEYWESHWRLTMQQVFVEAISKEALAPV"
FT   CDS_pept        complement(635961..636872)
FT                   /transl_table=11
FT                   /gene="argB"
FT                   /locus_tag="HDN1F_05210"
FT                   /product="Acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="silverDB:HdN1F662"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44104"
FT                   /db_xref="GOA:E1VH12"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH12"
FT                   /protein_id="CBL44104.1"
FT                   /translation="MLNKDQAMHVAQVLSEALPYIQRFTGRTVVVKYGGNAMETDEIKN
FT                   SFARDIVLMKLVGLNPVVVHGGGPQIGDLLKRIGKESHFVEGMRVTDDETMDVVEMVLG
FT                   GLVNKDIVNLINNNGGKAVGLSGKDAQLIRAKKLQVTRMTPDMKAPEIIDIGRVGEVES
FT                   INTGIVDMLVKGDFIPVIAPIGVGEDGSSYNINADLVAGKMAEVLKAEKLILLTNISGL
FT                   LDKQGNTLTGLDTEQVNALIADGTIYGGMLPKIRCALEAVQGGANSAHIIDGRVPHAVL
FT                   LEIFTDAGVGTLISNKVNVSGA"
FT   CDS_pept        complement(636921..639623)
FT                   /transl_table=11
FT                   /gene="manB"
FT                   /locus_tag="HDN1F_05220"
FT                   /product="Phosphomannomutase"
FT                   /note="silverDB:HdN1F663"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44105"
FT                   /db_xref="GOA:E1VH13"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH13"
FT                   /protein_id="CBL44105.1"
FT                   /translation="MFQFGKKGKGPAENEQNDKLPSSQTDAPSAEKSKPKREGNSLGGL
FT                   AVGFLPAIAGSAVAVGIVGALLYLQLTANLSASAMTKMVNADGQQLVQAVVHQMDALQQ
FT                   NLNVLAREQQTVQAIQGSTPEAQEALEENYRAALGTATVVRITPLREGRKDRKTTPPIS
FT                   FAQLEMMKAAESGKAPAPEIHRDKEQLYISLAVPVSNDGQVVGTIYAAFDFAPIRKQLT
FT                   ALPENIGFFEWQQTFPGSPPLALVASGDTQAKTGAPIQLNWGVSHWGIQAWPAAHGGLL
FT                   DSIGQSVLIGFGIAALLVAALGGVSLFLVNRQLRNNATLFSGQLQAILSRSKSNPRYSI
FT                   PLFESLAQRVDRLFYEYDAQLRRHAAPAASTSAAGATASFAADDDPLDIHLHEDDQDLL
FT                   GATPIANPSAPLTSKLPSDDALDLDDLELSDEPFSTPSMPAADIGPIAPEIFRAYDIRG
FT                   VVNQELTPAVACAIGGAIGAMAKLAGQSKIVVARDGRLSSEALTQGLIEGLIGAGLRVV
FT                   DIGMVPTPVLYYATQTLDTQSGVVVTGSHNPPEYNGFKVVIAGVALAGSQIQELRKHIE
FT                   AGVPTNMSGTYERYEILKAYRNRITNDVVLAKPMRIVLDCGNGVAGVVAPEILDRIGCT
FT                   VTTLFGEVDGNFPNHHPDPSIEENLAALIAKVRETGADLGVALDGDGDRIGIVTKQGQI
FT                   IWPDRLLMLFARDLLSRNPGADVVYDVKCTRDVVDLVSSMGGRAILSATGHSLMKAKMR
FT                   ETGAVVGGELSGHIFFNDRWYGFDDGVYAAARLLEILSMEPFEADEIFAEFPVRASTPE
FT                   IKIALSDARKFAVMDALAERGEFEGGNMVKVDGIRVDYPDGWGLIRASNTTPCLIARFE
FT                   GHDDAALQRIMQIFRAQLQLVEPNLAVSF"
FT   CDS_pept        complement(639697..641001)
FT                   /transl_table=11
FT                   /gene="dfp"
FT                   /locus_tag="HDN1F_05230"
FT                   /product="Phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /note="silverDB:HdN1F664"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44106"
FT                   /db_xref="GOA:E1VH14"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH14"
FT                   /protein_id="CBL44106.1"
FT                   /translation="MSLSQRKILIGITGGIAAYKVPELVRRLRDHGAEVQIVMTEAAQS
FT                   FITTLTLQAVSGHPVHTSLLDPAAEAAMGHIELARWADLILVAPASADFMARLAHGHAN
FT                   DLLATLCVAARCPIAVAPAMNQAMWSAPATVANCQTLLQRGVYVWGPASGAQACGDVGA
FT                   GRMLEPEQLLLAVRQHFQGVLPDQRLRAETFTDYTASLNASPLQLPSPLPQILRDQRVV
FT                   ITAGPTREAIDPVRFISNYSSGKMGFALADAAARSGAIVTLITGPVSLATPNQVTRIDV
FT                   VSAQEMFDSARTACQDADLFIATAAVADYRPETTAGQKMKKQKGAPITLTLIENPDIVG
FT                   TIAGDTQNAKRPFIVGFAAETQNVLQYARDKLVRKHLDMIVANDVSQTEIGFNSDDNAV
FT                   TLVWAEGEKVLPRASKPTIALQIIEEVALRLAQKG"
FT   CDS_pept        641153..641827
FT                   /transl_table=11
FT                   /gene="radC"
FT                   /locus_tag="HDN1F_05240"
FT                   /product="DNA repair protein"
FT                   /note="silverDB:HdN1F665"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44107"
FT                   /db_xref="GOA:E1VH15"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH15"
FT                   /protein_id="CBL44107.1"
FT                   /translation="MSLREFPADERPREKMLEKGASALSDAELLAIFFRTGIVGMNAIE
FT                   LGREVLRHFGGLRPMLDASAEEFTDIKGIGAAKFVQLQAALELGKRYLEQSLIRDEAFT
FT                   SPERVGRYLQAQLRSHQREVFAALFLDSQHRLIQYRELFYGTLDSAAVYPREVVKEALR
FT                   CNAGALIFAHNHPSGVAEPSQADRSITLRLRDALSLVDIRVLDHLVVGDCEVVSLAARG
FT                   ML"
FT   CDS_pept        642021..642257
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="HDN1F_05250"
FT                   /product="50S ribosomal protein L28"
FT                   /note="silverDB:HdN1F667"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44108"
FT                   /db_xref="GOA:E1VH16"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH16"
FT                   /protein_id="CBL44108.1"
FT                   /translation="MAKVCQVTGKRPITGNNVSHANRKTRRRFEPNLHHHRIWVESEKR
FT                   FVRLRVSNHGLRIIDKVGIDQVLADLRVRGEKV"
FT   CDS_pept        642269..642424
FT                   /transl_table=11
FT                   /gene="rpmG"
FT                   /locus_tag="HDN1F_05260"
FT                   /product="50S ribosomal protein L33"
FT                   /note="silverDB:HdN1F666"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44109"
FT                   /db_xref="GOA:E1VH17"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH17"
FT                   /protein_id="CBL44109.1"
FT                   /translation="MREKIRLISSAGTGHFYTTDKNKRNMPEKMEIKKFDPVVRKHVIY
FT                   KEGKIK"
FT   CDS_pept        642545..643357
FT                   /transl_table=11
FT                   /gene="nei"
FT                   /locus_tag="HDN1F_05270"
FT                   /product="Formamidopyrimidine-DNA glycolase"
FT                   /note="silverDB:HdN1F668"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44110"
FT                   /db_xref="GOA:E1VH18"
FT                   /db_xref="InterPro:IPR000214"
FT                   /db_xref="InterPro:IPR010979"
FT                   /db_xref="InterPro:IPR012319"
FT                   /db_xref="InterPro:IPR015886"
FT                   /db_xref="InterPro:IPR015887"
FT                   /db_xref="InterPro:IPR020629"
FT                   /db_xref="InterPro:IPR035937"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH18"
FT                   /protein_id="CBL44110.1"
FT                   /translation="MPELPEVETTRRGILPHIQGLRVQQVIVRQPKLRWPVSPELVQLA
FT                   GEPLRDIARRGKYLLFSFDRGIVLAHLGMSGSLRILESEKPADAHDHLDWVFENGITLR
FT                   YHDPRRFGAWLWWDGESTGHPLLESLGPEPLEPDFTAQYLYRTSRGRKVPVKSFVMNSH
FT                   VVVGVGNIYANEALFSAGISPLRAAGRISLERYQRLVESIRKILEDSIRQGGTTLRDFV
FT                   GGDGKPGYFQQTLQVYGRAGAPCLKCGESLCEIRLGQRTTVFCKVCQT"
FT   CDS_pept        643425..643766
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05280"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F669"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44111"
FT                   /db_xref="GOA:E1VH19"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH19"
FT                   /protein_id="CBL44111.1"
FT                   /translation="MTRLNRVGGKAMVRKGLLTAFVALLVSMPGWANAAAVADRPSGLE
FT                   MTADLVLARPLLLVSTVAGAGLFVISAPFSALGGNIGEAGNTLVATPFKATFLRCLGCS
FT                   IRQTQDPMQ"
FT   CDS_pept        complement(643861..645681)
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="HDN1F_05290"
FT                   /product="Gamma-glutamyltranspeptidase precursor"
FT                   /EC_number="2.3.2.2"
FT                   /note="silverDB:HdN1F671"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44112"
FT                   /db_xref="GOA:E1VH20"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH20"
FT                   /protein_id="CBL44112.1"
FT                   /translation="MPTHPPRSNGARLASFLRFAQLRSARTEKWLGGVLLLFVLGACTQ
FT                   PEIAENSASITPSGYAISSAHPSATQAGQAVLEQGGNAFDAAIAVAAALAVVEPYSAGM
FT                   GGGGFWLLHNAQQNRDVMVDAREKAPLSASRDMYMDLATGKLREGASINGPFAAGIPGQ
FT                   AAAFAHIAQNYGRLPLERSLAPAIALAQNGFPANHIYLNLLEMRRDVLARYPESKRIFL
FT                   NDGHGVQLGTLIRQPELAETLKHLAHEGHDGFYRGPVAEQLVKGVNQNGGDWQLADLYG
FT                   YQVVERDPIRVSIQLRANQGAEPVKAHLITAPPPSSGGVALAEMFNMLNEFPWAGLNRA
FT                   DQTHLLIEVMRRAYRDRAEYLGDPDFVHIPLATLLSQAHASKLASSIQMQEATSSLALG
FT                   RRLELSSGTHTTHFSIIDAQGNSVAATLSINLPFGSAYTAEGTGVLLNNEMDDFSAHIG
FT                   VPNAYGLVGSEANAVAPGKRPLSSMTPSFLEFERDGQHYFAALGTPGGSRIISMVFLGL
FT                   LQALQGAPVQDWVNVPRFHHQYLPDEIQFEPDAFDAATLASLKARGHSLRSTKRAYGNM
FT                   QAVLWQRDTDRLTAAADRRGIGEAVVVEKR"
FT   CDS_pept        complement(645693..646184)
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="HDN1F_05300"
FT                   /product="Coenzyme A biosynthesis protein,
FT                   phosphopantetheine adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="silverDB:HdN1F672"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44113"
FT                   /db_xref="GOA:E1VH21"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH21"
FT                   /protein_id="CBL44113.1"
FT                   /translation="MATRVLYPGTFDPLTNGHLDLIERASRLFDHIIVAVADSRKKGPL
FT                   FSLEERVQLVEGVVSHLPNVEVAGFNTLLAIFCQQKGANVLLRGLRAVSDFEYEFQLAN
FT                   MNRAIDKNIETVFLTPSEHNSYISSSLVREISFFNGDIRPFVPPSIALALDKKHGRSTQ
FT                   "
FT   CDS_pept        complement(646361..647287)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05310"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F673"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44114"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH22"
FT                   /protein_id="CBL44114.1"
FT                   /translation="MGVTVFNDKYVRVTRAWNKEETQIYVPIKKSLKAALKEAEKIDRQ
FT                   LLEQQKAYLQEQELSGDRYFHEDGTIVGLRVVTRHRDGRRPSNEITLRIKVPNRNKPFF
FT                   SNVSIDKHGFEQAFTLAVEKICEWNKLDKSSPVRVKMLGSLALHQKSLGGSTARSPAKL
FT                   RLVSSKAAPQKSGAPKVSAPAKKAAAKPAARKVAAKKTASKATSVKAVATQAKVTKGKA
FT                   AKAKANASAAKKPAKSTKVSSAKPSAAKLTKAQPAAKKPSTKKPAKAKGATSKAKASKP
FT                   KTVAKLANKTSVSATATAAKKPAAKKK"
FT   CDS_pept        complement(647653..648213)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05320"
FT                   /product="predicted NUDIX hydrolase"
FT                   /note="silverDB:HdN1F675"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44115"
FT                   /db_xref="GOA:E1VH23"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH23"
FT                   /protein_id="CBL44115.1"
FT                   /translation="MATSPRKIPLGQFCNRSAVSIMSSNVNGIPHLLMIQRAKRKGDPW
FT                   SGQMAFPGGRQSDEDSDLLHTACREADEEVGIDPAPIATRVSTLSELITRSHQSWRPQI
FT                   VTPFLFELPYAPPLRINHEARSGLWIPSQIFSQPATQFPWAIGHFTLNLPCYYYQDKPI
FT                   WGLSLLMIRSLQKTHPNLFTPAG"
FT   CDS_pept        complement(648225..649673)
FT                   /transl_table=11
FT                   /gene="caldH"
FT                   /locus_tag="HDN1F_05330"
FT                   /product="putative coniferyl aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.68"
FT                   /note="silverDB:HdN1F677"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44116"
FT                   /db_xref="GOA:E1VH24"
FT                   /db_xref="InterPro:IPR012394"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH24"
FT                   /protein_id="CBL44116.1"
FT                   /translation="MTTKVSVLADHMPTRQTTQLQQIFENQRRAFHAHPMPDAAERIEH
FT                   IQRLRPALLKHMDRLIAAVSQDFGNRCASETKFAEMLTTMEAIKYHARNVRKWMRTEKR
FT                   SAGLLLAPAKVRVVYQPVGVVGIIVPWNYPLFLALGPLLSALSAGNRAMIKMSEYTPAT
FT                   ADAFKTMIQEIYPEDHVAVITGEADVGVAFSKLPFDHLLFTGSTAVGKHVMRAAADNLT
FT                   PVTLELGGKSPAIIHESFPMQEAAERIAFGKCLNAGQTCVAPDYVMVPRQRVDEFVTSF
FT                   SQVASTWYPTIRDNNDFTSIVNDRQFNRLQGYLQNAKEKGAKIIPINPKSEDLTGTRKI
FT                   PFTLVLDSTPEMQIEQDEIFGPLLIVKPYDTLEDAIAYINERPRPLALYYFDFNAERSR
FT                   HVTEHTHSGGMCINDTLSHVAADDLPFGGAGASGMGHYHGREGFLTFSKAKGVVEKGKF
FT                   NATRFMFPPWDRRIHKLLFGFFLK"
FT   CDS_pept        complement(649904..650335)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05340"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F678"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44117"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH25"
FT                   /protein_id="CBL44117.1"
FT                   /translation="MKLPILSFALLCPALQFASPSAANAEVFVIVSAQSGITELSKDHA
FT                   EKIFLGKMHNFPNGAQAVPLDLKKGPERDEFYKKVTGKSTAQVNSYWARQVFTGSGQPP
FT                   KEVDGQATMLELVEKNPNVIGYVTTAPSATGVKAVLQIP"
FT   CDS_pept        complement(650346..651665)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05350"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F679"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44118"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH26"
FT                   /protein_id="CBL44118.1"
FT                   /translation="MKTKTAKRIPKFEGALSHAFIVGASLIALVTPAQADDGPVRFSGF
FT                   GTVGIAHSNSDQADFRTAQDQRTGTARSDNYSTITDSKFAVQADATLAKGLTSTVQVLA
FT                   RQREDTTSSVDFEWLNLRYQIAPGFYARVGRVQTPMLMNSEYQNVGYSLTQLRAPQEVY
FT                   YVNSLTYLDGLDLGYQAPIGDATLTAKLLGGKRKMDVQSVTTNADGLSSTSTYKFEFDL
FT                   ALATIAAEISDNTFRAACAKFKINADVDVYTLMDNALDALSNGQVSQAGALRNHLKTDK
FT                   VDASFLTFGYAFDRDQYLVQAEYVISKADSNVYQDLDSWYFMAGYRIEEFTPYISYSKL
FT                   RVTENYHLPAIDVASVDPSLLIPALTVNAFASGFMKSVNENTITAGVRWDALPNVALKA
FT                   QGDYIRKPERSQGIFTNATPGFIAKKRNISVISASVDYIF"
FT   CDS_pept        652110..654647
FT                   /transl_table=11
FT                   /gene="nirB1"
FT                   /locus_tag="HDN1F_05360"
FT                   /product="Assimilatory nitrite reductase, large subunit"
FT                   /note="silverDB:HdN1F680"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44119"
FT                   /db_xref="GOA:E1VH27"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR007419"
FT                   /db_xref="InterPro:IPR012744"
FT                   /db_xref="InterPro:IPR017121"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041575"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH27"
FT                   /protein_id="CBL44119.1"
FT                   /translation="MNKLNLVVIGNGMVGHHFLEQLHEAGLTAQFNVTVIGEERHIAYD
FT                   RVHLSEYFQGKGAAELALGTAEQYATWGYRLLLGVKATAIDPESHTVSLADGSRLPWDK
FT                   LVLATGSFPFVPPIPGKDRPGCLVYRTLEDLDAIREAAASANTGVVVGGGLLGLEAANA
FT                   LRGLNLDTAVVEFAPRLMPAQVDNEGGELLREKIQALGVQVLTGRATQHIEDGENANHR
FT                   MVFQDGKMLETDLIVFSAGIRPRDELARACGLTLCERGGVDVDDFCRTSHPDILAIGEV
FT                   AAWRNCVFGLVAPGYQMAKVAVSTLGGGDKRFTGADMSTKLKLLGVDVGAIGDAQATQN
FT                   AGAKVYRYLDQIKQHYRKMVVSADGRRLLGAMLVGDNSTYDTLMQYYRNRMDLPEQAES
FT                   LILPASAGKAPALGMDALPDSAIICSCHNVSKGDIVGCIQGGCSSLAEVKDKTRAATGC
FT                   GGCASQLKSLVDHQMAAMGMAVSTAICEHFNHTRQELEHIIRAEGIRSFSELRDRHGKG
FT                   LGCDICKPTVGNILASAWNGYVLDEGRAALQDTNDAFLANMQKDGTFSVVPRIAGGEIT
FT                   PDKLIVIGEVARDFGLYTKLTGGQRIDLFGARLNQLPAIWKRLTDAGFETGQAYGKSVR
FT                   TVKSCVGSTWCRYGVGDSVKLAIDLENRYKGIRSPHKLKFAVSGCTRECAEAQSKDFGV
FT                   IATEKGWNLYVAGNGGMRPRHADLFAQDLDTETLIRTIDRLMIFYIRTADRLQRTARWL
FT                   ENLEGGLEYLRKVILNDSLGINADLDRQMEQLVASFHCEWQATLENPESLKRFRQTIND
FT                   DGDDPEILFVPERGQIRPASESERAGRIPLVAL"
FT   CDS_pept        654731..655108
FT                   /transl_table=11
FT                   /gene="nirD1"
FT                   /locus_tag="HDN1F_05370"
FT                   /product="Nitrite reductase [NAD(P)H], small subunit"
FT                   /note="silverDB:HdN1F682"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44120"
FT                   /db_xref="GOA:E1VH28"
FT                   /db_xref="InterPro:IPR012748"
FT                   /db_xref="InterPro:IPR017881"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH28"
FT                   /protein_id="CBL44120.1"
FT                   /translation="MDRIMSEHSSWISVGKRGDLVPGAGVGARVGQQQIAIFWLEESPE
FT                   QLYATANLCPFAGVNIIARGIVGDIGGEPVVASPLHKEHFSLLDGRCFEHPEVSLPIWQ
FT                   ARLQGDDLQVREPEIMQLLVS"
FT   CDS_pept        655353..656657
FT                   /transl_table=11
FT                   /gene="murA1"
FT                   /locus_tag="HDN1F_05380"
FT                   /product="Similar to UDP-N-acetylglucosamine enolpyruvyl
FT                   transferase"
FT                   /note="silverDB:HdN1F684"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44121"
FT                   /db_xref="GOA:E1VH29"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH29"
FT                   /protein_id="CBL44121.1"
FT                   /translation="MIDILKSRLDVLPSKLTIEGGQKVSGKVRVSGAKNAATRILAASM
FT                   LTTETVTLTNFPTQIVDAMHKMRFIRSLGVDIDINHEAEAIEINAEEVSKDVVESYNVP
FT                   IRTTYLLAAGQIARNGIARIPYPGGCKIGSRGYDLHIMVWEKLGCTVEEMPDYIEIRGK
FT                   FAGTAIDFPISTIGGTENALLCTAVASGQSEIRNAYISPEVQNLIEFLRRMGADIEVFG
FT                   NSLVRVRGMGGLLHGARMAIMPDRIEALTWISLAILTGGTLQIDDVPFGDMEIPLIHLQ
FT                   EAGIDLFRNNTSVLVSPSCLTSGHVQPFELACGTHPGVISDMQPFYVMLGLAAQGVSRV
FT                   YDYRYPQRIGYVSELQKFAPEAFEAESGKITIRGITQLRAAEANSTDLRGSMAMIMAGI
FT                   LAQGTSTIHGVEMALRGYNDLLGKLRQTGISIHAG"
FT   CDS_pept        656698..657630
FT                   /transl_table=11
FT                   /gene="murB1"
FT                   /locus_tag="HDN1F_05390"
FT                   /product="UDP-N-acetylmuramate dehydrogenase"
FT                   /EC_number="1.1.1.158"
FT                   /note="silverDB:HdN1F685"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44122"
FT                   /db_xref="GOA:E1VH30"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH30"
FT                   /protein_id="CBL44122.1"
FT                   /translation="MDLGIGKLYENADLRQCSRWRIGGRASLLVEPSSIDALASLKQFL
FT                   CAKQIPHLVIGDGANLLFDDAGVEGVVIRLGKSLSGIRVDGDLLSVDAGVWVPRLAHAS
FT                   LLAGLTGLEHIVGIPGTVGGLVCMNGGSQRRGIGDNVVDVTAVDGNGDVIRLDASECGF
FT                   AYRTSRFQSGLTVAACTLRLQPGDKKAIRREMLEILHSRRTRFPLKLPNCGSVFVSNPA
FT                   MYDLVGPPGKAIELVGLKGVRRGGARVSPQHANFIVNEGNASSTDVLTLIADIRSEVHK
FT                   QTGYWMESEVRYVAPNCSIFPAHCAKEMT"
FT   CDS_pept        657707..659005
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05400"
FT                   /product="Putative poly(R)-hydroxyalkanoic acid synthase
FT                   (Pha)"
FT                   /note="silverDB:HdN1F686"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44123"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH31"
FT                   /protein_id="CBL44123.1"
FT                   /translation="MSMSSRAVVQGQEQRQGDSVHAADANSASLTRNAILTSNGWRAAG
FT                   VRRGSSLLNRLAASDGQAGKTARFIRHAWERRVHKERFIDAGKTPYQRIAGDDIMEVRY
FT                   YPPQDSGAFQIDHDEVVPVQARHRVPVLLVPPLGVYGWVYDLMAERSWVRFLNALGFDV
FT                   YLVDWGAPQRAQASDLTLENYVNRWMVQAVGAVQEHSGEKEISLVGYCMGGLLCLLYTA
FT                   AHGDGQVKNLVTIASPIDFHANPGGGKVLQIVNSGANKLGIKKVARATRRVAPENFHVS
FT                   GEILSVLFKLTDPFSSVFSYFDLVRHLSDREYVKSHLTMYEWFNNMVDYPGATVQRLVF
FT                   DFGFGNELASGQVRLGDQLADLRKIRSNYLAFAGSSDLIVGVAAAHKGMELLGSEDKTF
FT                   RIVPGGHAGVFAGGRAKAHTWAQTAEWLADRSA"
FT   CDS_pept        659185..661032
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05410"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F687"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44124"
FT                   /db_xref="InterPro:IPR007311"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH32"
FT                   /protein_id="CBL44124.1"
FT                   /translation="MNLFKKLSTAETRRLAAFLESVASPQGTMSLMEARGFIFGVCCAP
FT                   VASLPSEWIREIFNQGEPNHATDEEAEFITAALVRLYNQQMIEINSGAPALPAQCKYRD
FT                   PCAENFEPGAPLHDWCQGFNEAHVFYFDAWEAGIGNDEEVMAAVGFMVLTLGFFDDRDE
FT                   SRHMLDVAFEVDLPLHEMAPIVRAQMPQVMKEYARLGRSMYDDLLEDDEQDSAKQSSAS
FT                   SAGNNILVFQAPHHVADADERRHQAEELALQAHQEPDLEKRVALARKALFVSEECPRAL
FT                   LILAADAASNLDEAVDYYRRAMEAARSLIGEEDFNTFSEDRVFWGAIETRPYMLAKLGY
FT                   ADSLWALKRQQEAISEYEDMVRLNRNDNQGVRYILAIRYLDVGEPQKTQALLREYDDYN
FT                   AWWAYTSALCAFILEGDSNDARDLLYSAIHANPHLMSFFNGRRRLPRELPDYYNLGSVE
FT                   EAVIYTHDARATWRAYPGAVGWLAEGVAESHRRFIESLSKNSSSAIGKKLGTKKPSAKK
FT                   PAAIKNAASSKNALATQKASADKKTSATKKASATKKASATQKASADKKASAAKKASVTK
FT                   QATSKTRAAKEATSAVSAVTQKSSPAGVGPEKPTRKKRT"
FT   CDS_pept        complement(661139..662419)
FT                   /transl_table=11
FT                   /gene="wbpO"
FT                   /locus_tag="HDN1F_05420"
FT                   /product="UDP-N-acetyl-D-galactosamine dehydrogenase"
FT                   /note="silverDB:HdN1F688"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44125"
FT                   /db_xref="GOA:E1VH33"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR014026"
FT                   /db_xref="InterPro:IPR014027"
FT                   /db_xref="InterPro:IPR017476"
FT                   /db_xref="InterPro:IPR028359"
FT                   /db_xref="InterPro:IPR036220"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH33"
FT                   /protein_id="CBL44125.1"
FT                   /translation="MPSLNDSSVAIIGLGYVGLPLAVAFGSKRKTVGFDVNQARIRDLA
FT                   AGIDATLEVSGDELASATQLSFSHDLNDLRACNVFIVTVPTPIDDHKRPDLTPLIKASE
FT                   TLGKVIKHGDVVVYESTVYPGATEEVCIPVIEKLSGLRFNQDFFAGYSPERINPGDKEH
FT                   RVHSIVKVTSGSTPEIADFVDALYRTIVLAGTHRASSIKVAEAAKVIENTQRDLNIALI
FT                   NELAIIFGKLGIDTLEVLEAAGSKWNFLPFRPGLVGGHCISVDPYYLTYKAQEIGYHPE
FT                   VILAGRRINDNMGQYVTDQVVKLMTRKRIHVVDANILILGLTFKENCPDLRNTRVVDIV
FT                   RELEEYHAKIDIFDPWANREEAHHEYGYTLLESLPEDKRYDAVILTVGHKQFREMGAEG
FT                   IKKLCAESHVIYDVKYILPKDAVDARL"
FT   CDS_pept        662748..664166
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05430"
FT                   /product="Bacterial sugar transferase"
FT                   /note="silverDB:HdN1F689"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44126"
FT                   /db_xref="GOA:E1VH34"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017464"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH34"
FT                   /protein_id="CBL44126.1"
FT                   /translation="MPHVRLFNHYINGHHLLLGVIEYVLLALAFHLGTYLRFWLGDNEA
FT                   GIPAASAILLNSQIFALCMIAMGVYPAKHREGLSGMALRTMVSLFLLGFLALSAVFYMV
FT                   PDSAYSVGRGVLVIATVAAFLLLQPVRIVFFRLFGTKASVRRVLVVGAGYHAAKLLKEF
FT                   GAHADLGVELYGFARADGAPLAVPESRVIPMPASLKKFVQENGIETVVVASDERRRSDI
FT                   AGAGFPLEQLLDCKLSGVTVLDSVAFIEREFGKIEPRNISPGWFVFSDGFYHSSVRDFV
FT                   QRGFDLLASSLLILVAWPLMLFTAIAIKIEEGLKAPILYSQERVGLNGKVFKVHKFRSM
FT                   RVDAEKFGAVWAQENDPRVTRVGKFIRNVRIDELPQVFNVFTGEMSFVGPRPERPQFVD
FT                   ALKKTIPFFDERHRVKPGITGWAQLCYPYGASEEDSEQKLKYDLYYVKNHSLLLDLVIL
FT                   IQTVEVVLIGKGVR"
FT   CDS_pept        664378..665019
FT                   /transl_table=11
FT                   /gene="wza"
FT                   /locus_tag="HDN1F_05440"
FT                   /product="Polysaccharide export protein"
FT                   /note="silverDB:HdN1F691"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44127"
FT                   /db_xref="GOA:E1VH35"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH35"
FT                   /protein_id="CBL44127.1"
FT                   /translation="MKSRSATMIKAAVSQVLFLLSALLIAGCAGNRPVSAPVQTQDYSE
FT                   QTYQIGVGDQLQISVWREPELSVAVPVRPDGKVSVPLAGDVLAAGETAESLAAKVAEKL
FT                   ANFVRQPQVTVIVSDPVSRDFQQRVRATGALQTPTSVPFRKGMTVLDLVLLSGGTTPFA
FT                   DANGTQLYRQTKDGVRVYPIRLDDILKKGRLTTNYPLAPSDVVTVPERSF"
FT   CDS_pept        665097..666608
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05450"
FT                   /product="Polysaccharide chain length determinant protein"
FT                   /note="silverDB:HdN1F692"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44128"
FT                   /db_xref="GOA:E1VH36"
FT                   /db_xref="InterPro:IPR014345"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH36"
FT                   /protein_id="CBL44128.1"
FT                   /translation="MIFQILRALLREIILHKTLIAIGFAIVSFAVLAAGFFWPKQYEVK
FT                   GVLYADEQNIIKPLLQSQAAVTSVDRAQAARDLLQTRRMAEIIAKRSGLVGPDDSPAIL
FT                   ERTARLLQATLGVEGFSPSGSAVTYVRISYTNPSKDTAFKVVSAAVDAFIRETSESKQR
FT                   ESRNAYQFISSQVKTYKQQLANAEDRLKVFNADNRDGNEQTVATSISMLQSEIQKLKLD
FT                   IDDARIRKASTESQLSRESQYLTKRFSTDVYRDKLREAQSKLDSMLLTYTPTHPDVVNL
FT                   KHQIEDFRQAMEESETSRRDDRSSAGNINPLYEQLRKTLSTVTLELESKQKRLTATQQL
FT                   LDQEYDRSRRIAGRKAEQADLTRDYDVTKKMYESLLESKERARISMTLDVEGQGVTYRI
FT                   QEAPLYPSVPKGLRFLHFALAGPFLGLLVPIGALVAYIQLDPRIRYQSVLEGLSVPVLA
FT                   VVPHMNTPFAKRMLRSDMILLSLFMTGAMIVYAIICFGRWSGWFG"
FT   CDS_pept        666605..667366
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05460"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /note="silverDB:HdN1F693"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH37"
FT                   /protein_id="CBL44129.1"
FT                   /translation="MSKFQESGAPDEDFGAASSQGSSPGRSAHQIRHMAEVRLLTPAEL
FT                   DERRIIHAFTSNREALNAFRELRVQLLQRAGRRNFVVLITTVAPEGGATFSALNLAASF
FT                   ALDSAKTALMVDCNFYSPSVEKLLFVEPEHGLTDFLEDHTLDVDDIIYASGIPRLRVIP
FT                   VGHQRATGTEYYSSTRMEMFVHGVRLRYPDRYIILDGPPVGMYPDSRILADLADYVVLI
FT                   VPYGKVNQEQVQMAIEALPEGKLLGVVFNHG"
FT   CDS_pept        667501..668922
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05470"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F696"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44130"
FT                   /db_xref="GOA:E1VH38"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH38"
FT                   /protein_id="CBL44130.1"
FT                   /translation="MDATQAGNQQSNSQGQRFKKRVAYAAIGLCAPAVCLLASNALAMD
FT                   WNARFGLGSAYTSNSLQTANDEQKDYAAQSQLGFDLVQKSTSFDLGANYDVGWTTWQDD
FT                   TQSDELAVNGQAAAHWFIIPSLLTWDFNQQNSRQKMQSARVDTSDTRANQSVFSTGPSS
FT                   ILRLSSRDHLKLSADAMRVSTSGKETNDYDSDRQLYSAALVHSTSAIQTLGVQVSQQRA
FT                   EYDVAGVPDTVFSQAALEWNRQYRLGRLQASLGKNRSKRESGAVHNGNYYQFFVDYNGV
FT                   GHVVSLAGMRTQTDSMLGLYSPGFATPLQPGSGANDSFSPNGTVSETIDVVDEQQIDFN
FT                   YSTVRVCERCNFSVRASYSDQDYLVELLDKRTASLQTGLEYLFSERWKTQVTLSGGRER
FT                   YPDINDRTDDYRNLNIALSYQTTPELLLTAQTGYTERDSDDPLFDYNEATALFGFVYQF
FT                   GNTKKAPVSGAAEPR"
FT   CDS_pept        complement(668919..670499)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05480"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F697"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44131"
FT                   /db_xref="GOA:E1VH39"
FT                   /db_xref="InterPro:IPR013426"
FT                   /db_xref="InterPro:IPR014263"
FT                   /db_xref="InterPro:IPR019127"
FT                   /db_xref="InterPro:IPR026392"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH39"
FT                   /protein_id="CBL44131.1"
FT                   /translation="MRLAGAYYKPTIDMHITEIFTRHRWAATWLGILTIALCYQATWAS
FT                   LGGRWNTRGEAYSHGWLLLAIALGLALQQRKAFLKQTYSFSGVALALLFASSLFWLIGD
FT                   LSEIGIFCQLTLPAIPFLWIASVNGWGAARTLWFPCAILYTVIPLWDFLLPALQDMTVW
FT                   VSGSMLHWVEVPAFISERFIELPAGVLEVAEGCAGLSYLLIGITLSAFYAHFAKLPIAR
FT                   TIAALVLGATLGLITNWVRVFAIALIAHQSNMQSSIVHDHEFFGWLVFAGSMVPYFYFL
FT                   RKLESTQAPSAGSNAGSADPSDEKLGSNASAARPHPLALLAPLTLLVSFPGPIISASFS
FT                   LQAIPVVTLSLPDVLAEARAIPTNTEANGRKNPIWAPDYQGADIIRQRSYRTLGGIATV
FT                   HAVIYTSQQQKKKLLGWGNQLVAEDAWIVQRRDHAQGLQVTEISARFGSVRYRIFSWYQ
FT                   LGERTAESAARARIDQLLARLQGRQDASLFAVAFQCRDSSCPSELSQAAWAMSVKNAHL
FT                   LRVEAQHSN"
FT   CDS_pept        670783..671658
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05490"
FT                   /product="Polysaccharide deacetylase family protein"
FT                   /note="silverDB:HdN1F698"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44132"
FT                   /db_xref="GOA:E1VH40"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014344"
FT                   /db_xref="InterPro:IPR022560"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH40"
FT                   /protein_id="CBL44132.1"
FT                   /translation="MRHAMTIDVEDYYQVSAMEASVARDQWEKMESRVVRNTQKILALF
FT                   AEHNVQATFFVLGWVAERNPALVREIVAQKHELASHGYSHRLVYNQTPEVFREETLRGK
FT                   ALLEDITGVPVRGYRAASYSITPRSSWALDTLIEAGFEYDSSIFPVRHDRYGMPGTPQA
FT                   PYQLIRPNGGKIVEFPLSAAHLLGYRLPAAGGGYFRLYPYWLTRLLLTSIERWQRIPFI
FT                   FYLHPWEVDPDQPRIPAGKLSTFRHYNNLDVCEERLRRLLKDFSFTTVDAVLRQQGFWG
FT                   ANQVPEAVIA"
FT   CDS_pept        672026..673063
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05500"
FT                   /product="Protein of unknown function, DUF482"
FT                   /note="silverDB:HdN1F700"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44133"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017469"
FT                   /db_xref="InterPro:IPR038740"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH41"
FT                   /protein_id="CBL44133.1"
FT                   /translation="MQGVVIRNYSEDMQAAWDAYVTQNPASSIYHLSAWKTVIETAFGH
FT                   ETAYLYAADAQGNLCGVLPLVRLKSPLFGDFVVSIPYFNYGGALGEHAEVESALMLQAS
FT                   QRFAGTTVGHIEWRDVVRRASYSVREDKAAMILALPETEEVLWSQLGTKLRAQIKKPQK
FT                   EAPMLLIGGEEYLEDFYAVFATNMRDLGTPVYAKSFFAIILRQLGKKARLVVIRHQGKP
FT                   VSAAFLLGFRGQLEIPWASTVREANSLSMNMLLYWEVLRFAIREGYHQFDFGRSTRDAG
FT                   TYKFKAQWGAQPKQLYWHYWLPEGKELPRLNPDNPKFKLAIAIWQRLPLWLTKLIGPPV
FT                   VKYLP"
FT   CDS_pept        complement(673130..674338)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05510"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F701"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44134"
FT                   /db_xref="GOA:E1VH42"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH42"
FT                   /protein_id="CBL44134.1"
FT                   /translation="MPLQYPHLLTHRGLVLVADILVLDAEQRSALAVTRALGQQNLRVV
FT                   TADCVSPTLAGSSKYSLANRVYPDPYETPLEFLDWFQSEVEQNSVRMVFPMTEVTTDLV
FT                   MRHRHRWPNVTLPFADITTIDALADKIRLHQRASELGIAIPPTHYLDSPEAAQALLPSL
FT                   QFPVVLKPYRSRIWLSDRWLATAVQIVHDESEYRRWIAVEPFKTHPYMVQGFIQGEGQG
FT                   VFALYNQGQPQFFFAHRRLRERPPSGGVSVWSESALPNPALQHAAETLLTDAKWHGVAM
FT                   VEFKVAPDGTPYLMEINTRFWGSLQLAIDAGANFPYALYQMASGQPVTPAQIKAGVRLR
FT                   WLLGDVDNLYLTLKERRYSFLHKLLVLLRFFKPDFFHTKHEIDRMNDLRPAWYELKRYF
FT                   SGN"
FT   CDS_pept        complement(674422..675510)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05520"
FT                   /product="putative polysaccharide deacetylase"
FT                   /note="silverDB:HdN1F703"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44135"
FT                   /db_xref="GOA:E1VH43"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH43"
FT                   /protein_id="CBL44135.1"
FT                   /translation="MGRKKVNSQEHFGGPCHLLSPANKPMPLNPLVKRHIKRSLEYIAA
FT                   HFGPHRWPSKEPKLWVLMYHRVLPADAPEMQDAEPGMVVTPETLDLHLKLLSQWAEPVF
FT                   LEDWLARSAAGESLPKRAVAITFDDGWVDNYQHAFPVLKAHNFPTSIFLVSDWIGTPQM
FT                   FWPERLARILRIASQLPKDDAWLNTVLGADFQHGKAPSRKQLAFIFARCKQWDDLAIHT
FT                   KLDDLSNRLQLPPPETTTLLNWEQVHEMQASGIIRFGSHTRRHIRLNEELSAELAHTEI
FT                   CASQSLLEQKLSRPVSLFCYPNGDHSPAAVQEVREHYLGAVTTKRGINDLHTPPHQLFR
FT                   VGVHNDVSSNAISFMAKLSCWL"
FT   CDS_pept        complement(675549..676196)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05530"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F704"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44136"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH44"
FT                   /protein_id="CBL44136.1"
FT                   /translation="MRILLSLLVLVLSSPALAIPTMYSFTGTTEKIGLSPFTGFEDYGY
FT                   GELSNDPSKAIVKGDGNVVFNGDTSVSGWFIIDTDETSPSARSHRPVPLAYGISTQGAY
FT                   YSFDNRDGKFGIFDQVTLGNDRFAWHVEGPNIKNSGGITSSVQQFSFLFGDTGFSGGDF
FT                   ALGGILGEGLIGGLSGSIHELRKVPEPHSQALLMIGLLGLFAVARSRRSCKA"
FT   CDS_pept        676583..677698
FT                   /transl_table=11
FT                   /gene="rfaG1"
FT                   /locus_tag="HDN1F_05540"
FT                   /product="Putative glycosyltransferase"
FT                   /note="silverDB:HdN1F705"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44137"
FT                   /db_xref="GOA:E1VH45"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH45"
FT                   /protein_id="CBL44137.1"
FT                   /translation="MRGLMKTVLHIIDTTGPGGAETVFAELATAAAESGRGSLALIRGP
FT                   GWVMDELQRRGIETIVLDCKGSLNIRFLLSLVSLIRRRKITLIHSHLLGSNVYASLAGW
FT                   LTRVPVISTFHGSVDVQGRERFLAAKFGSINLGSRVVVAVTERLSRDLRERTPISAKKL
FT                   QVIYNGIDTERFSLPKNRILRERLGLPDGALLVGALGNIRAAKDYMVAVQAIAILRQRG
FT                   VDVHLAIAGQGSGPLKDELDAFCLKEGITDRIHLLGFVDDAPMFLAGIDLFMLSSSSEG
FT                   HPLAITQAMSMALPIAATLCGVEEVLQAGEDALLVEPKSPEKLADALQTLAFDKGVCER
FT                   LGAQARESVLKRYSLKTMKAGYLGLYQKLEK"
FT   CDS_pept        677777..678865
FT                   /transl_table=11
FT                   /gene="nodX"
FT                   /locus_tag="HDN1F_05550"
FT                   /product="putative nodulation protein X"
FT                   /note="silverDB:HdN1F706"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44138"
FT                   /db_xref="GOA:E1VH46"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH46"
FT                   /protein_id="CBL44138.1"
FT                   /translation="MPSTKALSYNGFDLLRLCAATQVAFCHSVEFMSPSDMGHWWIRFL
FT                   ELFPGVPIFFFVSGFLISRSYEKNSRLAEYATNRVLRIYPALLLCLLVNILLVAYTGYF
FT                   SNAGAGPWDVFLLFVAKATIFQFYNPDFMRGFGDGVLNGSLWTICVELQFYIVVPIFYW
FT                   VFRKVAAHRQTFFLVAAIVFFVGVNRLLYWLQPEFSHTVAWKLFRVSFAPWLYMFLTGL
FT                   LFQRHYSVIRDALDKVPALPVFLVYAGYAFLMHLYGFRIDNGVGPLIYFPLAICVFRVA
FT                   FSGFAKASSWLNKNDVSYGIYIYHMPVANQMLFYGAAGSLWYPSIVLAVSAAIALASWM
FT                   LLEKPCLAIKRHPSNPIHAGSH"
FT   CDS_pept        complement(678984..679907)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05560"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F707"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44139"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH47"
FT                   /protein_id="CBL44139.1"
FT                   /translation="MTTPLRTAAKFTLASAIFFLPIAGHAWTKTEGCETGAAGTLPANS
FT                   ATSFWGKNTRIVTSPVAEGKQACEFSVKKGSEGWPSTGGPLEWGGIFSFPSNVTVGQEL
FT                   WVRFSLWMPENFPITSNSGMLKFIRLHARTSTSNEGCIDFLMGDPKIPLWDPVAKKDSY
FT                   PAFVSNYEGVPGLSFIGSNADRPVRGKWETYEVYVKVSPTPQSKGGASVLRAWKNNKLI
FT                   ANIPSQVTATNSTGFLDSLYLFTYWNGNAPSDAKVYFDNLIMTTDRPSNVDPNGYYYLG
FT                   GSTVGEDPTPTVAPPSAPSLQVTPAT"
FT   CDS_pept        680416..681765
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05570"
FT                   /product="O-antigen polymerase"
FT                   /note="silverDB:HdN1F708"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44140"
FT                   /db_xref="GOA:E1VH48"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH48"
FT                   /protein_id="CBL44140.1"
FT                   /translation="MKQRKLKLTSEKWHLDDGVLSLKPSILFAEYKSQHFAFLCICAYL
FT                   FFDYVKPDQQYAIFAILPFLMLSVAGALLGWYFDKSSKLQFSKMHFLLLLLLFHNFLTC
FT                   VLAYDQESAYTGFPLIRTSILLAFMITAIVNSERRLFLFVLVYFLANFRMSQFGFLSWV
FT                   KRGFSFADYGVTGAGWFRNSGELGMEMAMFFAYTVCFAFFLRDYWGKWIRRFMYFVPIT
FT                   ALGCVLASSSRGAIVAAVGALAYLAMFSNKKMKGLAGAVVVLGVAYYFLPAEFLARFQS
FT                   AGEDKTSLSRIYYWGKAREMMADHPFFGVGYYNWYPYFRDRYYDPEFSGNVELAHNTFL
FT                   QIGAETGYVGLAIFILLCVASFWINWRTEILCRRPGFEFLRSFAMGMNAAGVALIVASN
FT                   FLTATYIPSFWMHFTFTICVSQIARSKLRLLEVEEREKKRQASVTSPVSR"
FT   CDS_pept        complement(681790..682713)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05580"
FT                   /product="Glycosyl transferase, family 2"
FT                   /note="silverDB:HdN1F709"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44141"
FT                   /db_xref="GOA:E1VH49"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH49"
FT                   /protein_id="CBL44141.1"
FT                   /translation="MLVSFIIPAHNEESTIGALIGTIQQYVSLPFEILVIDNGSSDRTA
FT                   KIASALGVQLIQLEHKTSPSIVRNAGAKQARGDLLVFLDGDTRVTPEWAQTLQANAQGM
FT                   IDQPMILTGARVVTPDPQECSWIEKYWFAPMAQEPANYINGANIITTPQAFAAIGGMNE
FT                   TLATGEDYDFSQRAKASGVRLVPEARYRLIHDGYPKTIADFYRRERWHGKGDASDFRTI
FT                   LRSKVALLSLAFILTTSLCIVSLIFFSGKATLAWLALTLAMPAACALARFRNNGSRTLF
FT                   AAFALYSIYLAARGVTTITQPFKEST"
FT   CDS_pept        complement(682754..683830)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05590"
FT                   /product="predicted acyltransferase"
FT                   /note="silverDB:HdN1F710"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44142"
FT                   /db_xref="GOA:E1VH50"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH50"
FT                   /protein_id="CBL44142.1"
FT                   /translation="MKASATARLATIDALRGIAAFLVVLFHIRGALGDNLKSWMPDWIY
FT                   SFLSYGFVGVAVFFVISGFVIALSLSHKRATLGLTGRFAIRRSLRLDPPYWVAIALEIG
FT                   LIYLALQLFPETVKSVPPTWDKVVAHIFYMQDILEYGNIAAVFWTLCIELQFYLFYALM
FT                   LTLVQWRSAEFIDENGNFSKTASVWFGLSALLGIACMNKLITPPFPGLFIAYWPYFLSG
FT                   ALIALSYASRLSPKYFIGHTILLVISAVFKPTPYLVAALITIIFLFYVASRNLFSSMLS
FT                   FRPLIYLGTISYSLYLFHSIVGWRFVILVQTLHKGPLSPTMSITVFFCAVIVSLISADI
FT                   AFRIIETPSINLAKKIRY"
FT   CDS_pept        complement(683867..684445)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05600"
FT                   /product="probable low molecular weight
FT                   protein-tyrosine-phosphatase"
FT                   /note="silverDB:HdN1F711"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44143"
FT                   /db_xref="GOA:E1VH51"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH51"
FT                   /protein_id="CBL44143.1"
FT                   /translation="MLINYLRDNFGSLKGSLRYFFYRLAWFAGKFSTDRPTIDRSIKRL
FT                   VFICHGNICRSAFAEYFAKSQGIESISLGLSAGEGDPAFSRAITAAREFRIDLTPHRAT
FT                   RFDPSLLIPGDLVLAMEPAQLESIKDSSAKEIKFGLLGLYCEFPTPYLHDPYSCEQAYF
FT                   HICFQRIVDAVHAIAERRKANVTPQTNLG"
FT   CDS_pept        complement(684541..686337)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05610"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="silverDB:HdN1F712"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44144"
FT                   /db_xref="GOA:E1VH52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH52"
FT                   /protein_id="CBL44144.1"
FT                   /translation="MLDGIKKLYALLTKEQRRQYFLYQLVFVLNAALQTAGVASIAPFI
FT                   VLLTNQDYIQSNAILHWIYNYLEFTSSTTFLIFFACVVIATIVASNAVAALSTWLIFKF
FT                   SLGFGTSVQDSLFKYYASQDTVYHSRKNSAEIISAITQETPRMTYMVIQPILFLVGQLF
FT                   VVLLISSGLLYVDFWLAVSAALIIGGGYLFVYKITRDRLHMHGQKVWDANNYRIKILNE
FT                   CFGGFKEVKLIGNESAYQKRVHNENMKMLYSSSVIGLMADTPKFVIETIALCAIMVLAV
FT                   YLLYTTNSPEKVMTILSLYAMAGYKLLPAAQTVFKSMASIRGNILVVTELYPYATAGQK
FT                   ADLTHPTTQPLEVKNRAITLRNVSYAYPQTQRNALDCINLRFAPNTITAFVGTSGSGKS
FT                   TLADLLLGLLSASQGELLIGDQVVNDDNRRAWQLNLGYVPQNIFLSDETIAKNIAFGED
FT                   AGAIAKDRLIAAAKAASLHHFIQTLEHQYDNPVGERGGLLSGGQRQRVGIARALYRNAN
FT                   ILILDEATSALDNVTEHAIAETIQQLRAGKIIVMIAHRLTTIKNADQVVYMEGGKVVAA
FT                   GTYNELVKTCAEFRNLLAKGEA"
FT   CDS_pept        complement(686671..688995)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05620"
FT                   /product="Glycosyl transferase, group 1"
FT                   /note="silverDB:HdN1F713"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44145"
FT                   /db_xref="GOA:E1VH53"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH53"
FT                   /protein_id="CBL44145.1"
FT                   /translation="MRTVQATHPLLAPSKSELYQSGTAALAAAVLVAKSQLAANAPEVI
FT                   VPAYACPDLISAVIYAQCKPVLVDIEIGLPYLQLDALQNALTANTAAIIAPWFLGIPER
FT                   FDEIRACLAKANSKALLIEDSAQWFPEGDPSTDFCGDLVVLSFGKGKPVSLLGGGLLYD
FT                   HRGDLRELFFAPNMHSPSTFSTSEPQPNPTENKTPTLPNDKSVPNDKIGKNLSPLAVLR
FT                   VLAYNLLIHRLFFWVLELIPALNMGKTIYKPLAGLQAFPAEGYAILQANINKYLKRPRR
FT                   AENGLKQLINDLSLSQNALCTQAPTYHQQRMLRFPVLVSPECNRDALLARLQQEGVGAS
FT                   PFYPAPLNEIDQIPNIVAAQGPFPNAKDFASRLITLPTHRGCNSDILLKIRTELSPYQQ
FT                   AQRAPLKVLHIASGDLWAGAEVQLFTLARALQQRADVQVNVVLLNEGELAARLRDCGIP
FT                   VTVLPESRLGFAQLLTQALALARTQHPDVIHTHRTKENLIGSLIGLTLGIPSVRTVHGA
FT                   SEHVADWRKPHKRILQKLDQWLATFVQKKTIAVTNELAEKLTATLPPARITVIENGIDS
FT                   ANFTLVDTNKLDERFQRAKRRVGIIGRLVPVKRVDLFIKSAALLSAKPEFFDVEYFVIG
FT                   DGPLRADLEQIAQAHPTLTNKLHFLGHQAAIHSYLRELDALVMCSDHEGLPMTLLEAMS
FT                   LEVAVIGHDVGGIKLLLKEGTNGWLVEQQSADQFSHALAACLNDPDQRHRRTESAKQLV
FT                   QQRYSATENARATISVYQSLT"
FT   CDS_pept        complement(689040..690227)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05630"
FT                   /product="Glycosyl transferase, group 2"
FT                   /note="silverDB:HdN1F715"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44146"
FT                   /db_xref="GOA:E1VH54"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH54"
FT                   /protein_id="CBL44146.1"
FT                   /translation="MWICSYILPNLGTCSGTRPTMNLLLLLSALGVVYSYAFYPLILRL
FT                   FREGEPFVPSTPAAWPKASIIVTAHNEEHRIREKLENALAIDYPADQIEIIVASDCSTD
FT                   QTDAIVESFGGNIRLVRADQHLGKEYAQLCAIREARGEILIFSDVATQIPTDAIQKMVS
FT                   YFSDPRVGAVSSEDRFISDDGKVAGEGAYVKYEMWLRALESRRAGLVGLSGSFFACRKE
FT                   ICEGWDTQSPSDFNTALRTARAGLSAISCPDVLGYYKDIKDPNKEYQRKVRTVIRGITS
FT                   ISRHPDVLDIGEHGLFSFQVWSHKIMRWAVPWFMLLTSLFTLIGLGHSPLANLFALGQV
FT                   IFYGIAFVGWKIPSARDHTLVRLIFFFVQVNLSIADACIQFARGKRMTVWTPSKR"
FT   CDS_pept        690434..691000
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05640"
FT                   /product="Bacterial protein of unknown function (DUF882)"
FT                   /note="silverDB:HdN1F717"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44147"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH55"
FT                   /protein_id="CBL44147.1"
FT                   /translation="MKPVAAVQQTRRQVLSYMVGAAALPLLSLPELAEAAAKKNGRLLA
FT                   FDHLHTGEKLAVVYRVGGHYVPQAMHQLQHLTRDFRTGGIHRMDPNLYDLLWHLRQDIE
FT                   SDQPFEIISAYRSPQTNQALRARRGQRSGVATRSLHMDGQAMDIAVGGVALTALRDAAL
FT                   DLKAGGVGYYPEGFIHVDTGRVRRW"
FT   CDS_pept        complement(691076..692758)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05650"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F718"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44148"
FT                   /db_xref="GOA:E1VH56"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH56"
FT                   /protein_id="CBL44148.1"
FT                   /translation="MGGLLWGCATTTTQPPEIINRGSSQLGSAVDSKRSATASATIQDL
FT                   LAKARINALRHPDFQKYRDLLRSAYETRSFQPRWIESGNLNAQGTQLLQVLAQSYAEGL
FT                   EPHDYDTKWLQQQTSTLNSHDSAAIGTTDLAMSVALARLIHDVNVGRIPPREAGIKIDT
FT                   RAREAEAMSLVKQAFNGISPDQAFRNARPKFVLYDHLKNALAHYRELAAHRKGISLPSL
FT                   PKSLKPGDTWSGIPALADGLRYLGDFTGAPPKNNRYTHDLVAGVKHFQGGHGLGVDGII
FT                   GQSTWSALSVPFSVRVRQIELSMERMRWLSEQMADERAIVVNIPQFQLWAFPGKTQASS
FT                   LSMNVVVGKSVGNSTPILLNDVKSVVFNPYWNVPSSITRKEMLPKLRENPEYLVSQNLE
FT                   MVGNGEVIATAPTPEQIEAISKGIYRLRQRPGPGNALGRVKFEFPNSDAIYMHDTPNRG
FT                   AFSRSRRDFSHGCIRLSDPEKMADFLLTGQPGWDKKRVSEAMKSDERRTVTLRNPVPVL
FT                   IFYTTAMVDSTGRTVLLEDIYGYDSQLERALIASDERKQKQKN"
FT   CDS_pept        complement(692930..697744)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05660"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F719"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44149"
FT                   /db_xref="GOA:E1VH57"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001227"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR014043"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR016036"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020801"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR032821"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH57"
FT                   /protein_id="CBL44149.1"
FT                   /translation="MTRYSKLQASLRQLLQSASQRWPNVHAITDGKRTLTYQEAAAQVK
FT                   EIITHWRAAGLESGQRIAIAASREIETIISIIAAVEYGLAYVPLDLSYPADRLELMLED
FT                   AQVRAVIGSERALAELRGLVKTFPTLDNPPTGQTSPYLGDHDLIYILFTSGSTGRPKGV
FT                   AMGVSPLAHLIDWHAQHPRLGQAARTLQFAPLSFDVHFQEIFSTLATGGTLVLPTDSER
FT                   RDPARLHALLEREKVERLYLPYVALQMLAQADADAATQATGATASGKAQTLAIKDVISA
FT                   GEQLQITPDIRALFQRLQSATLHNHYGPTETHVVTAFELDGNPDHWPQIPPIGTALPHV
FT                   RCWIRPLENPIENNATIAANCAAGLTLSEGELLLGGETLAEGYLGRTDLTAERFLEDLI
FT                   GPDGQPARWYITGDLVRTDATGVITYLGRADQQLKVDGFRIEPGDIELALMAHPGIQDA
FT                   VVTAPQDPDGSRVLTAHVVLRDHASAADRTIASWRNWLHQRLPAYMVPVRFAILAQLPT
FT                   TPSGKIDRRSLPAVTVGTAASNETAGKPALHVDPSQIKELLRALWQELLGLEQLSDTAN
FT                   VFDLGARSLLVMRFANRAKELGIRVNVADIYDRPTVAGLAKLLEGSAQSGSSRTRTTSN
FT                   EPSVHEGMAIIGMAARVGSAENVETFWQQLLDNVESLRRFQPDELDPSVPASLREHPAF
FT                   VAARGVLENADGFDASFFGLSDREATLIDPQQRLFLELCWTALEHAGVDPSKWSGEAAG
FT                   RIGVYAGTANNSYLPAMRVEDPSLIAKAGEFAAMLGNEKDYVASRVAHKLNFNGPAVSV
FT                   HTACSTGLVAVTQAFRALAQGDCEIALAGGATVIVPQIGGYLHVEGGMESADGRCRPFD
FT                   AEASGTVFGSGGGVVVLKRLSQALQDGDTIFGVIEGVGLNNDGGDKASFTAPSVTGQAK
FT                   AIRMALDHANVSAREVSYVEAHGTGTALGDPIEVAALARAFGQDTDDTGYCTLGSAKGH
FT                   VGHLIAAAGVIGLIKATLSLHHGRIPGTLHFRQPNPQIDFASTPFQVSADIVHWPRSEK
FT                   PRRAGVSSFGVGGTNAHVIVAEAPAQAATATLAATTVAADTEALQILPISAQHPEALIA
FT                   RTTALANFLEQHPDIPLANVSATLMRGRQAMSLRRCYVAENREDAIRSLRAAIQKESSS
FT                   ASQSAATPAHTTPTKPRIVFVFSGQGSQHPGMARELATQFPAFQYAFDEVLSAAPADLA
FT                   QTLRTLLIDADPNNTNAAAQLAETYLAQPALFAVSCGLAAWLDSLGIRADALIGHSIGE
FT                   YAAACSAGVMSLKDGMKAVIERGAAMFAQPPGTMLSVRTNANALLPLPKGVEIAAINAP
FT                   ELTTLAGSHDALDAFAKDLEAKGIVASQLKVSHAFHSESMTGALPLIRTALAQIGLNAP
FT                   QTPLYSCISGKQLSAAEATNPGYWAAQVRAPVAFSPAVEAEISQGNCLFIEVGPGQALT
FT                   SLIRQHRDQGKKPQVVPLLSNAQAALPPARHALQALAQLWCAGVPIEWPVPVQTPRACL
FT                   PTYPFVRKPHWFKRQATSQPIEQALPSPTPAAPQHCPADAPNVTDPLLGLASDLQLEAL
FT                   IQQQMQIMQQQIAILSGLPIGPAES"
FT   CDS_pept        697932..700253
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05670"
FT                   /product="predicted aminotransferase class-III"
FT                   /note="silverDB:HdN1F722"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44150"
FT                   /db_xref="GOA:E1VH58"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH58"
FT                   /protein_id="CBL44150.1"
FT                   /translation="MQRIAYNRRGFIRISTPIGSKEMSSQFALISVLKDLFGESAGEDL
FT                   SAVNPQDSFLALGFDSLFLTQVALALKKRFKVDLAFRRLLSDLGSFELLAAWLAENAAS
FT                   GTLPTAQPVEQNAVAAAVPAVASAAVPAVAQMPIAQPVAAQLAPQPVIAQPVANSFSVN
FT                   PVMAVGVVAPALGGVEGLIQQQLQLMSMQLGMLAQYRGSHAGVVQAPVVAAPQVAALAP
FT                   VAQAGAPTAVAASAPAPTVPSTYPGKSDSSGAASQDAPPAAKPFGAQTKIDITGKDVFT
FT                   DEQFGHFRQLADEYLARTGKSREFTANNRAVLADPRVASGFRPAIKDVVYPIVVDRSKG
FT                   TRLWDLDGNEYIDTLCGYGSMYFGYQADWIVDAIQAQLALGMEIGPQHPLTAEVIQLLR
FT                   EIMPHERFAFCNTGSEAVLGAVRMARTRSGCNKIVMFTGDYHGINNEVIVRAGKGGKGF
FT                   PAAAGVMRESVSNVLVLDYGSDEALKVIREQADDIAAILVEPVQSRHPDFVPLEFLREL
FT                   RTLTKELNIALIFDEVITGFRAAPGGFQEYSGIQADICTYGKIIGGGISIGVIGGRAHY
FT                   LDTLDGGQWQYGDDSKPEVGVTYFAGTFVRHPLALAAARAVLLHMKANPRLQEEVNERA
FT                   ARFAGELNLHFKRVQAPMHIERFCSMMYFKFTEDLPWGEFLFTDMRIQGIHIWYGRPMF
FT                   VSAAHTDAELDTIIATFKRSLARMQAWGFIPGSSSDEAGRDLAPPVKGAVMGINGEGNP
FT                   AWFVTEPDGSNRQVGVAFEY"
FT   CDS_pept        700408..707805
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05680"
FT                   /product="Probable peptide synthetase protein"
FT                   /note="silverDB:HdN1F723"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44151"
FT                   /db_xref="GOA:E1VH59"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH59"
FT                   /protein_id="CBL44151.1"
FT                   /translation="MRRMISGNQSGGSQLMQQSPAALGKIATVMASTEPQREIFLAVHA
FT                   GGDAANLAYNESMLVPLNGEVNLEAFAWAYEQLLYRHDALRITFNRYGTQVLVHREVEP
FT                   NFRFVDLRNHSDSVAALEALRAEAVSTPFDLQQGPLVRGVLAHVENGRYAAILTFHHII
FT                   CDGWSLSLLLSDLAELYTARSQGRPAELPGVPSFVEYLHVLASDAYKYQAAQDEIWWMQ
FT                   QYSQGAPVLELPTDFVRPAVRTFHSKRIDHLLPVSLVSALKKTGIACQSSLVATVLTGF
FT                   ATFLHRLSGQTDFVIGMPAAGQSIENMEMLVGHCVNTLPIRCRIHPDHSFVQNLQGVRD
FT                   GLLDTYDHQRLTFGSLVARLGLARDPSRVPLVPILFNIDPGMKGLKFGDIASNAVSNPR
FT                   VSESFEWFLNATESRDPAGNKGALLLECQYNTDLYSESTVTHWLGVFEQLLQQITEHRD
FT                   VPVSLLKLTSAQDAALWREMNATQMPLPAHTSLHGWLKETAANRTDAFVQFGAERITHA
FT                   ELWQRAGRLARALHEQGVRAGDFVGLCMDRSLDMLVALLGILRAGAGYIPLDPSYPADR
FT                   LNHMITDSGLKTLVLRGALPAGLQTDALAAQIDMAAPAFLNPGNFSSQEDAEGCCVDVG
FT                   RQSPAYMIYTSGSTGLPKGVQVQHGAVVNFLASMAKAPGLTVADHLLAVTTISFDIAVL
FT                   ELWLPLVVGANLTIATREQSMDGYQLRTCLEQNGITLMQATPSSWRLLLAADWQGGAGF
FT                   KVLTGGEALPPSLANQLLARVGELWNLYGPTETTVWSTVSRVLPDTQITLGRPIANTQI
FT                   AIIDEHRNATPVGVAGELIIGGSGVTLGYWKRPELNQDRFIHWQGQRYYRTGDLARLTA
FT                   DGQLIYQGRSDFQVKLRGYRIELGEIEAQLNEAAGIAEAIVVVLGETEDDQRLVAFYRR
FT                   SASSSESVSNKAREGAFIASLRGHLAAHMPAFMIPQQWVEVQQMPLTPNGKVDRKALKL
FT                   PKDATDALSGLSVEAVASSADEEKNLSPSTAKILGMMRKFLQNPALRPTDDFFQNGGHS
FT                   LLGMRILAELNKVLPATFGLTDLFQAPSAGALGARWDLAHAGNVEAEVPALSIPVHVDR
FT                   SRFRMSLQQRRIWFLEQLDGGGIEYSLPASWRFHGALQRDALAGAVDQLVARHASLRTI
FT                   LLEDEGVLLQRVVPATAGNLKIYDVPGESEEARWAVVQTAFDERRQRPFRMGEETLFRA
FT                   DLFCMGAEDHTLCIVVHHAVFDGWSFDILLSDLSELYNAAVEMRKPSLPVLPVQYGDFS
FT                   EWMLDRAQNADRKALDYWLGSLAGELPVLELPTKAKRPELQSHAGAGLHFEIDAQTMAR
FT                   VSEFSRRQGVTLFMTMIAVFKLLMWRYSGQRDLIVGVPVSGRNYAEINALIGFFVNTIA
FT                   LRDSVNPDQSVADWLQAVRQTCLQGFAYQETPFEKIVEHLNPTRDLSRSAVFQVIFAYQ
FT                   DITNRQEAFHGLRREQVNIDRAGVQTDVDFWMKWTGSSMHAGFEYASDLFDANFIARLQ
FT                   RDFVALVTRVTDFAAKPVSALCDLPDPERDAALTRLNSTSMLLPTPLLVHAQFSLQAAR
FT                   TPNATATMYHCGASQDSNAKIEDSRFESLSYAQLESRSNRIAHWLVSAGVKSGDRVGVA
FT                   VSPSLWLQAVLLGVLKSGATYIPIDPKFPVERIRYMISNSSVGLLVHDGALTSELRGNL
FT                   AGARSVAMRELEGELDQQSDQRLDISLNPESGAYIIYTSGSTGLPKGVVISHRAMVNYL
FT                   AAVAQRPGFSAQDRILAATTLSFDIAVTELFLPLVTGGASVLVDRDLVVDVDQLHPVMA
FT                   AAGVTLYQATPSSWRLLLGTNWQGGQKMRAWVGGEALPSDLIEKLLPKVAEVWNVYGPT
FT                   ETTVWSTCHQVRSTQEAGIIGLPLGNTSCYVLGDQHTLKPLGVMGELYIGGKGVASGYF
FT                   NRADLTAERFIPNPFGDGLLYATGDQARLLAGGLLECGGRLDHQVKVRGYRIELAEIEL
FT                   ALLQHPQIAQAVAIAKAFGEGDARLVAYIVPRDGTALEFGALAEFLQAHVPVYMIPQHF
FT                   VVLDAIPMTPNQKVDRKALPSPEVEQKAAIVPPSSATELALHEIWAQAMRQDAISIDGE
FT                   FFALGGHSLLAVEIIRRVRQQFGVDMPLAVLFSHPTIRRMASFVDIHRPAEEVAPEVIN
FT                   QASAKPAAENEWSNLVALRAEGTHAPLFCFHPVGGNVLHYAALLPRIPEHWPVYGLQAT
FT                   GLNGIAPPLSDVEQMAKQYLNEIRKVQAHGPYWLSGGSSGGLLALEVARLLVEEGEQVA
FT                   RLMLFDTIGPQRATDEQSRIEGRKFKNPLKQIQHSIAVRLSDGIRVLRCRWANLFRQEI
FT                   EHELRYWWIQRHNYQAMTRYLQSARSRLPYEGAVDLFRLPSRERGVYSLPLIGWDDTLV
FT                   GKVRTYIVDGEHAHLIEAAEFGEQLSIAFASVSEYVQTRISESRERPQTASVERPKAKT
FT                   V"
FT   CDS_pept        707847..710444
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05690"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F724"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44152"
FT                   /db_xref="GOA:E1VH60"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001031"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020459"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH60"
FT                   /protein_id="CBL44152.1"
FT                   /translation="MQRATANEQSVFEAPLLHALFEQQVSRTPHESAVIYGDAKLSFSG
FT                   LEQRANQVSHWLATLSLEKNARVGIALSPSLWLHAVLLGVLKQGHSYIPIDPSFPAERI
FT                   GYMIDQSQLSLLIYDDSLDADVLEILPRSQSCSLDAVCAAAITLPETRLDTQVGGEDVA
FT                   YMIYTSGSTGKPKGVVIPHRAAHNFLLTMMDRPGFGAGDRILAVTTLSFDIAVTEMFLP
FT                   LVAGGCSVLVDREVAKDAELLRRAIEDFDITVYQATPSSWRMLLSTAWVGSAKLSAWMG
FT                   GEAMPAEVAAKALPKVAALWNCYGPTETTVYSTCQQISSVEEVKYIGTPVGNTVCRVLD
FT                   DALKPVPVGEIGELCIGGIGLALGYYRRPDLTQERFIQNPLNEENASILYRTGDLVRMH
FT                   ENGWLEYLGRSDFQISLRGFRIELGEIEAGLVKHPAVAQAVVVARNFGTENNRDMRLIA
FT                   YMVANSGFSLDMGALREHLQQFLTPYMIPQHYVQMDAMPMTPNQKVNRNALPMPEVESV
FT                   QAYVAPATPTEAAVQAIWEQVMKREHIGAEDDFFALGGHSMLAVQISNAIRKQFKVNLP
FT                   LASLFSHSTIRAMSTFLEEHIATPKKHHASDWSNLVALREKGAHAPFFFFHPVGGNVLH
FT                   YSALLSRIPKGWPVYGLQATGLDGLSAPEADYCQMARRYLSLVRSVQPKGPYWLGGGSS
FT                   GGLVAMEVARQLEEMGERVERVFLFDTVGPVAPALNGSRIEARRHKNLARQIQHSISVR
FT                   LEEFARRWFCEIANRLQIELSMDLRHWWIRHRNLEAMHRYLSSHRSRQRYSGSVELFRL
FT                   PEEERGRYSQPLIGWDGVLDGLVGVHLVEGDHATLIESPIFSAKFAEVMAKFS"
FT   CDS_pept        710478..711428
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05700"
FT                   /product="predicted Zinc/iron permease"
FT                   /note="silverDB:HdN1F725"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44153"
FT                   /db_xref="GOA:E1VH61"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH61"
FT                   /protein_id="CBL44153.1"
FT                   /translation="MPLSDSPVGVVRVSAEPWHVQLRAHVRRHRVVAFGLGLALVVVLA
FT                   LLVQSLVDVFSGSPPVGLRLAMLGGLAGFAATSAGAIPALVMRSIPQRVEDGLLGFAAG
FT                   MMLSAAAFSLLLPGIEAGGELLSNKALGAGVVVFGLTLGVLLMLGLDQFTPHEHEQSGA
FT                   QGPGHRAYERIWLFVFAIALHNLPEGMAIGVSFSQGDMSVGLPLTTAIALQDIPEGLAV
FT                   ALAIRAAGYTPLLAVLVAILSGVLEPVGALLGVGLSSGLALAYPVGLGLAGGAMLFVVS
FT                   HEVIPQTHRNGHQTTATIGLMVGFALMMVLDTTLG"
FT   CDS_pept        711597..712970
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05710"
FT                   /product="fumarate lyase"
FT                   /note="silverDB:HdN1F726"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44154"
FT                   /db_xref="GOA:E1VH62"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH62"
FT                   /protein_id="CBL44154.1"
FT                   /translation="MGELEVPINALYGAQTQRAINNFPVSGIPLPIAFIRALLKVKAAA
FT                   ARANASLDQISAEMADAICRSTETLLVDPELMKHFPLDVFQTGSGTSTNMNANEVIATL
FT                   ANRYRNDHGAAKDEKKINANDHVNCGQSSNDTIPSTIHVSAAIELAEHLLPALRHLQQV
FT                   ILKKAETLEGYVKTGRTHLMDAMPVRMSQSLQGWAAQVGQNVTRLQRLQPDLQALGQGG
FT                   TAVGTGINAHPEFAERFCQQLGESTGLLFTPAENLFARIGSQDVAVALSGQLKTVAVTL
FT                   MKIANDLRWMNSGPLAGLGEIELEALQPGSSIMPGKVNPVIPEAVTMVAAQVIGNDAAI
FT                   TIGGQSGNFELNVMLPLIAYNLLSSMEMLGNVSRLLADKAIASFKVNDAHLKEALSRNP
FT                   ILVTALNPVIGYMKAAEIAKLAYKEGRPVIDVAAEKTDLSREELAVLLDPAKLTRGGL"
FT   CDS_pept        complement(712935..715634)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05720"
FT                   /product="Putative GTP-binding protein"
FT                   /note="silverDB:HdN1F727"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44155"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH63"
FT                   /protein_id="CBL44155.1"
FT                   /translation="MKLLSLRIEQFRQFRTPIEISGLNAGINLFVGPNESGKSTLANAI
FT                   RAAFFERHKSNTVEDFRPWGDSSASPTVELSFEWNHERWHLQKRFLKTKRCDLAVNQAT
FT                   YSGDEAEEKLAALLGFQLPTRGSSKTEHWGIPGLLWIEQGSGQEVHTAVRNASNHLKSA
FT                   LGDALGEIASSSGDALLQRFEKERATLLTTTGRPTKEYLAAIEERDRIVAELAVLDDKI
FT                   TLWHEQVDRLNELNQQRREDAERPWETLRKQANEIQLQLNKVENLRHTLQREQKELEAN
FT                   LAREQTCSQQLTQIEERRNSLSQREKARDQATLKLLQLRENLPVITQQLKNTQRDYYNA
FT                   KLTLQNARQAEQQAQLANELAILKRQSEETRNALNESHSLHSELFNKRTQYSQIKINAE
FT                   SVKKLRVLYQNRREIEITQKSIATRIRYSLNPGKAIAIGNEILHDQGERHVSAATELTI
FT                   EGIGRISIEPGGKDLAEQNRQLAVLQEEIQNLQTRLQTTSLEEAEHRADQSRALENEIR
FT                   LQETLLRKLAPQGIEALQQHHQSLEQQTQALSTRITELSNAKGDASTSEASGDHSPPMI
FT                   GVSEAESYFESANNQLKAAEQTDTQFSQQIGLAQQAMEAAQQEWQRLHNDLHSAAKMQE
FT                   EQNLQQRVIELRTARRTLEASILQYQQKIEAERPDILQQDIARFTQSATVLEQAARTRE
FT                   HEHTRLQASLEVLGAQGLEEERANLHQKLEFTTRRHKELERKANALSLLIRLLQEKRQK
FT                   LTRQLQAPLQRHIQHYLQLLFPQAELRIDEDLLPQQLSRTTHRGEEHSDFDQLSFGARE
FT                   QMALISRLAYADLLKAANHPTLIILDDALVHSDKHRLQQMKRVLFDAAQRHQILLFSCH
FT                   PENWQDLGVAPREMNKLLQAASGQFGRI"
FT   CDS_pept        complement(715631..716848)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05730"
FT                   /product="predicted metallophosphoesterase"
FT                   /note="silverDB:HdN1F729"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44156"
FT                   /db_xref="GOA:E1VH64"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014577"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH64"
FT                   /protein_id="CBL44156.1"
FT                   /translation="MIRLLHTADWQMGRQYGRFEPEDAAALSEARFSAIERIAALANEL
FT                   QVDAVLVAGDVFDLQTLTDRTLRRTFNATQGFTGPWIMIPGNHDAALAENIWSRAKHIG
FT                   AIPENVHTLLLPEVREFPEIGIAILPAPLTQRHTHTDLTEWFDYAITSPALLRIGLAHG
FT                   SVQGILAAEIDSANPIAPDRAQRARLDYLALGDWHGMKSINERTWYSGTPEQERFKDNG
FT                   AGQALLVEFSDERVAAPKITPYPVGQYQWQQWESQLSVGSDLDLLLERLKSITKNTVLS
FT                   IKLSGQISLEDYKRLQEATDSAHANCRSLQLNQEQLHLVPSESDLADLHVDGYLNEVLA
FT                   ELKAMQETNRPNGSQSPSTLPNAVQPADSQVAGDALVLLTNAIIELGSIEKGSNQARSK
FT                   GNGGRS"
FT   CDS_pept        complement(716845..717546)
FT                   /transl_table=11
FT                   /gene="tpm"
FT                   /locus_tag="HDN1F_05740"
FT                   /product="Thiopurine S-methyltransferase"
FT                   /EC_number="2.1.1.67"
FT                   /note="silverDB:HdN1F730"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44157"
FT                   /db_xref="GOA:E1VH65"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR022474"
FT                   /db_xref="InterPro:IPR025835"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH65"
FT                   /protein_id="CBL44157.1"
FT                   /translation="MQADFWHEKWQKQEIGFHKTEINPLLQKYWSALDIATPAHILVPL
FT                   CGKTLDIVWLRQQGYQVTGIELSEIALDALAHELNTQLGLAMVKQRNDDPANGYYRLDY
FT                   QGEGVHLIGGDFFSTTAEEIGPVSAVYDRAALVALPKELRSPYTQHLRKISNDAAQLLI
FT                   TLDYEQAQMAGPPFAINEAEVFEHYTKTFECKRLHREELIHEEPRFQALGLQSFRQQVY
FT                   LLSPRARVTRS"
FT   CDS_pept        complement(717585..719348)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05750"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F732"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44158"
FT                   /db_xref="GOA:E1VH66"
FT                   /db_xref="InterPro:IPR006823"
FT                   /db_xref="InterPro:IPR031329"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH66"
FT                   /protein_id="CBL44158.1"
FT                   /translation="MHPTPAYRIGWHSKQIEIRAQGYAMHGYGNPNHVAYGEQDPLYAR
FT                   ALYIEDEAGGGLWFCCLDLGYVTHAMREGVCAALRSQQADFDEARLVLTCTHTHSGPGG
FT                   CTHDVLYNLVTPGFQPAHLDAVVSASVVALKQAQASAAPAGLTLHQEKIDEHIDVAWNR
FT                   SIEAYNRNPDVQAQTVAHTHRALDRNMSVLAIRQGDQVSALLSLFGVHATCLTNRLHRH
FT                   NGDNKGYASLHAEAELREKGSVTPVAIFAQGTAGDVSPHDQRLGITRAYARRQARKGEA
FT                   EYAYARHNGEIQSRFALAMTHNQTTLPINGKIDAILSYVDFTCQHADPAYANGNSDAWT
FT                   SEPCHGVAFFAGTPVDGRGMPWPLVQGAKLIARIVKKLRLGRLNQLESSERDYLARIYA
FT                   AQGPKDILMESGSRKRVLGREFSQLPVPGIVDPLVAELKRETNAGAVQHSQMIPTVLPL
FT                   QIVTIGPLAIVCCPGEFTTVAGKRIHDTVQSILSKRSEAIQKVLICTYCNEYMGYVTTF
FT                   EEYQQQNYEGGHTVFGQWTQAVFQTLFAQLAAQLNRPENERTHDRSTRPLPAPPEELAK
FT                   RSNQAARPYKK"
FT   CDS_pept        719540..721327
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05760"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F733"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44159"
FT                   /db_xref="GOA:E1VH67"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH67"
FT                   /protein_id="CBL44159.1"
FT                   /translation="MDCGSGNVRRFELASTVRYVALFLGFLVVYPIGWSHAETPPSSRV
FT                   DRPPEAFVDQWAESDAWLGLLYFQREGKSYRSDTQDPKFFLSPQGQRSPQTELLASLEE
FT                   MAKPQPQGNEHPQCRFPARFAWLRSLPSSPLAAAEVQECPGFSAFQHRIAARSVSMIFP
FT                   EPNMDDVSTLFGHSFLHFKRVPAGESELTEDYSADDYTLNFAARLAPGMKQSDLLKNWL
FT                   TGPLDGIFTMTPYGKKLQDYLQTESRDIWEYQLNLNQEETDQLVRHAWELRGTDFEYSF
FT                   FLENCAYRMLNFLDVARPGLNLHRKYALYAAPLDTIETVIAAGMVTRADYRPSELTQRL
FT                   AQGQPIKKPLEPGKVGHYSARVIVAGGAYEGNPIFSARIRASYHDFLDAPSGGPLAAIS
FT                   ALEVAARQIDGRSAQLTDFTAFSLTSIKPHGKDYAPWSWRFSAGITGLYWEPEDVKAQQ
FT                   ATQLKKQAAQRKKKDEPGDWVNPLYANLLIGPAWGGRNFAMYQLFGAEVQVDAVFRNNQ
FT                   APLAVWNPGIIARSRHWQAQLEAWVYQPLDGDRDAYGRVSASLSRGISAHSMLFLRATH
FT                   EQGQVFHEQGVQLGMGFYF"
FT   CDS_pept        721544..722098
FT                   /transl_table=11
FT                   /gene="cybB"
FT                   /locus_tag="HDN1F_05770"
FT                   /product="Cytochrome B561"
FT                   /note="silverDB:HdN1F734"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44160"
FT                   /db_xref="GOA:E1VH68"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH68"
FT                   /protein_id="CBL44160.1"
FT                   /translation="MSNLWRNSPNSYGLVAIGVHWLSAVLVIFLLATGIYMVTLSYYDT
FT                   LYHTLPQWHKLAGVAIALLTLVRLLSLLVNRSPALIPAPAWQLLAAHAAHHSLRVLLVV
FT                   MVVTGYIITTAEGQGIVLWGEVSIPALATFDADAVDATGFIHRWCGYAIGAIALGHAGA
FT                   ALFHHFIARDATLVRMLRPGG"
FT   CDS_pept        722193..722786
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05780"
FT                   /product="YceI like family protein"
FT                   /note="silverDB:HdN1F735"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44161"
FT                   /db_xref="InterPro:IPR007372"
FT                   /db_xref="InterPro:IPR036761"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH69"
FT                   /protein_id="CBL44161.1"
FT                   /translation="MSFAKRIAAAALLRLPLLSVTSVVQAAPEQYVMDTQNKHAFVQFK
FT                   ISHLGFSWVLGTFDNFTGNFTLDQDAPDKSSVSVDIDTNSVNTNYAERDKHLRAKDVFN
FT                   VAKFPKATFVSTKVEKTGDKTANVTGNMTIKGVTKPVTLAVTYIGGGKDPWGGYRQGFE
FT                   ATTDIRLKDFGIDLDLGPAAQVAHVFISVEGIRK"
FT   CDS_pept        complement(722894..723769)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05790"
FT                   /product="Protein of unknown function (DUF519)"
FT                   /note="silverDB:HdN1F736"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44162"
FT                   /db_xref="GOA:E1VH70"
FT                   /db_xref="InterPro:IPR007473"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH70"
FT                   /protein_id="CBL44162.1"
FT                   /translation="MLSYQHIYHAGNFADVHKHSALCLVLEHLTQKPKPFAYIDTHAGR
FT                   GFYDLQSSEAQKTDEAKGGIWGVDQDTAPAEVRRYFENIASCNPKGGRRFYPGSPKVAL
FT                   LNSREQDRVILIEKHPQEFQALSENFEREPRAILHRRDALEGLVALVPPDERRGMVLID
FT                   PSYEIKSEYADIANAVEKAYHRWPTGMYMIWYPLLPVAGHQRLLKALKQSGITRILISE
FT                   IALHAPQGLSGMYGSGIALINPPWQLEQGLARLGQWIVNSLSDASERRARVEWLVPEAK
FT                   KEGDRERNQG"
FT   CDS_pept        724014..724967
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05800"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F737"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44163"
FT                   /db_xref="GOA:E1VH71"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH71"
FT                   /protein_id="CBL44163.1"
FT                   /translation="MSTAPQNAPQDIDEEIVDIFVEEATEVLETLATDVPAWKEDSSNR
FT                   TLLTDIRRAFHTLKGSGRMAKALQVAEVAWQVEQALNRALDGSLSVSPSLIEMVAKARA
FT                   AIVPMIQALGERQACPLSERELAQLLAYIQAIAKGEEIPVLQSASPAAPVITPAPVDLG
FT                   PLQSELAECMRRIDEMAGHLEKGAARIQHLSAQLEGTAGRQQRLEESLPEDLPSRQDVD
FT                   SLQTQLQSVSGGVSDVKHLVKATIDRVAQQQLDVQDALNRRVSEESVALAKRNNELQEQ
FT                   MDALRSQQADARRWMMIGFGGLAALLAAVASLVLLP"
FT   CDS_pept        725192..726307
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05810"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F738"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44164"
FT                   /db_xref="GOA:E1VH72"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH72"
FT                   /protein_id="CBL44164.1"
FT                   /translation="MNQSAIISQLEEVKMTQHQDVRVSARSLFSRAFGGRMLGAASAAL
FT                   VASAFMVSAPLAQAAVSPEGLRIVGNANPVQVFVPTQNNSGLDISDFQLREDGSSQTLV
FT                   SAEPNSSLPFVTVFVMDYSPSVRNNETALKRMEEAAKGFVSLMQPKDKAAVIKFNDRVE
FT                   VMGAGLTSNHDTLNAAIDSIPPQRGYSKLYDAISKAIEVSNCNPKLVCSIIVLSDGDDV
FT                   GSALPLADLHNQLYQAGTAVFPIGYGDNINVNKLQELATNSGGAYYTSEDSSQFSAVYE
FT                   RIWARLSNEFMLTYHTAATDCKKHNVEVDVNDNGGTTTYKGTMNRCTPGEAASRAHKGG
FT                   GGSFGLWELAALFMTAGAGVALQRMRRRQAA"
FT   CDS_pept        complement(726318..729290)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05820"
FT                   /product="predicted helicase"
FT                   /note="silverDB:HdN1F739"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44165"
FT                   /db_xref="GOA:E1VH73"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH73"
FT                   /protein_id="CBL44165.1"
FT                   /translation="MPLRPSTRIRYTLGTHDGWPLRLWLSLKGAAGDAPLQPFAPSWAW
FT                   LQAQRSALSAADWRILRLLRELDAGWETRAQLDLKPSHLVELLPALAQSHRCFWQGASP
FT                   HTPFCLGASRPAQLHWKPLENGQQRLEISIPGVECFPGPEAFYIDIHLWEIGQADCGAT
FT                   PEALRWVERGVVVNPGEFELFLQRHGEALQRARLPLPTDFPTRLWHNPPTPCLLFYSIR
FT                   THLIARQSYRRPALIDAIRASFTYLGPMGRVEFLAEHHAAYQYRYFAGVLHKIERDLSE
FT                   EQRWLAMLEQSLLSLSPLEAIYQGAQFTDGVLPGDLCVRSAREWQQLLLTQAPIWREQG
FT                   WHISIANAFRHHFVASERWRVHLEKDHQGRFALGLSAEIEGEKQVLLPTLLQTLAATPE
FT                   LADIDFRDDAELGAGSRGEDHILGLNDGRRVVIPADLLALLLQHLPELFDQPRLDKQGC
FT                   LTLPASQAGRLALLAESFQRYWHDPQQLGATLPQTLEREAFSANAWEGLNAHLRDYQLQ
FT                   GVAWLRSLANRQLGGILADDMGLGKTLQMLAFLLHEKNVGHLQQPALVVAPTSVLQNWA
FT                   REAQKFTPTLRCFVVHGGDRMAQISSHAQTDLFITSYALSLRDFTFWQSIPLSYLVLDE
FT                   AHMIKNSSTKVAKALRQLESDHKFCMTGTPLENHLGELWSLFEFMMPGSLGSEARFKRV
FT                   YRIPIEKHHNETRAVGLLQRIQPHILRRKKSEVAKELPSKTEVLIPITMTEPQREFYDA
FT                   LHALTQREITDLLLADGHETTRISILDALLRLRQLCCDPRLLPLEDAKSLPSAKLDHLL
FT                   VMLEELVEEGRRILVFSQFTSMLALIREALQQRKIPHLLLTGATQNRQALVERFQAENE
FT                   PIFLISLKAGGVGLNLTAADTVIHFDPWWNPAAEEQATDRAYRIGQDKPVFVYKLICEG
FT                   TIEEKIVLLQERKRALQDAITGAAELLPAAPLSDEDLVFLLSQTVTQTGAGTTTQPSEA
FT                   R"
FT   CDS_pept        729424..729888
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05830"
FT                   /product="Rare lipoprotein A"
FT                   /note="silverDB:HdN1F740"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05830"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44166"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH74"
FT                   /protein_id="CBL44166.1"
FT                   /translation="MQDGGFFREIKMLRRLWIAAFLVLTLCILLPVTDVQAAQRHHYSH
FT                   TEIGKASHYRGNTGFGKSRQGRAIVRAKFSSSAHKNALARGYTAAHRTLPFGTRVKVTN
FT                   LASGKSVVVVINDRGPYIRGRVIDLSTTAFRHIANPRVGLVRVKIQVLRV"
FT   CDS_pept        730240..730623
FT                   /transl_table=11
FT                   /gene="sdhC"
FT                   /locus_tag="HDN1F_05840"
FT                   /product="Succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="silverDB:HdN1F741"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44167"
FT                   /db_xref="GOA:E1VH75"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH75"
FT                   /protein_id="CBL44167.1"
FT                   /translation="MMTVNNQRPVHLDLRTIKLPITAYTSILHRISGVILFGGLILMLW
FT                   ALDVSLASEQGFEQVKGVLDNFFVKLITWGLLSALLYHLAAGVRHMLMDIDIGETLQGG
FT                   RKGSKIVFIVSGVLILIAGIWVW"
FT   CDS_pept        730617..730985
FT                   /transl_table=11
FT                   /gene="sdhD"
FT                   /locus_tag="HDN1F_05850"
FT                   /product="Succinate dehydrogenase, membrane anchor subunit"
FT                   /note="silverDB:HdN1F742"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44168"
FT                   /db_xref="GOA:E1VH76"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH76"
FT                   /protein_id="CBL44168.1"
FT                   /translation="MVINITNFARSGLYDWMAQRVSAVVIAAYSLFLMGYLFFGATPDY
FT                   AAWHALFSQTWMRIFSLLALISIAVHAWVGMWTITTDYLTTRLLGPKGTALRFGAQVVC
FT                   GILNFVVFVWGVQVIWGF"
FT   CDS_pept        730989..732761
FT                   /transl_table=11
FT                   /gene="sdhA"
FT                   /locus_tag="HDN1F_05860"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="silverDB:HdN1F744"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44169"
FT                   /db_xref="GOA:E1VH77"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH77"
FT                   /protein_id="CBL44169.1"
FT                   /translation="MTSIRTMTYDAIIIGGGGAGMRAALQLSQSGYRTACITKVFPTRS
FT                   HTVSAQGGITCAIASNDPNDDWRWHMYDTVKGSDYIGDQDAIEYMCSVGPEAVFELEHM
FT                   GLPFSRTEAGRIYQRPFGGQSKGPDNPTQAARTCAAADRTGHALLHTLYQNNLKNKTTF
FT                   LIEWYAVDLVKNQDGAVVGVIAINIETGETVFIQSQATVLATGGAGRIFSSTTNALINT
FT                   GDGIGMALRAGFPVQDIEMWQFHPTGIAGAGVLVTEGCRGEGGYLINAQGERFMERYAP
FT                   NAKDLASRDVVARAMVKEILAGNGCGPEKDHVMLKLDHLGEEVLHKRLPGICELSKTFA
FT                   HVDPVTAPIPVVPTCHYMMGGVPTNIHGQAIAQDANGNDRIIDGLFAVGEVACVSVHGA
FT                   NRLGGNSLLDLVVFGRAAGLHLEHALKEGIEHRPASQSDLDASFSRLNSLNTRTKGEPV
FT                   AKLRKELQQCMQNYFGVFRTGEFMEKGIKVLADLRDRVENVAITDKSQAFNTDRIEALE
FT                   LQNLFEVAEATAIAADERKESRGAHAREDYEERDDKNWLCHSMYFPGEKRVSKRAVNFA
FT                   PKTVPTFEPKKRTY"
FT   CDS_pept        732773..733492
FT                   /transl_table=11
FT                   /gene="sdhB"
FT                   /locus_tag="HDN1F_05870"
FT                   /product="succinate dehydrogenase, iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="silverDB:HdN1F745"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44170"
FT                   /db_xref="GOA:E1VH78"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH78"
FT                   /protein_id="CBL44170.1"
FT                   /translation="MFLGKTLKVSVYRYNPEKDQAPYLQDFTVEINGKDMMVLDVLNLI
FT                   KEQDTSLAYRRSCREGVCGSDGMNMAGKNGLACITPISQAIRDNKLVIHPLPGLPVIRD
FT                   LVVDMNQFYTQYEKVKPWLQNDQPAPAIERLQTPEQREKLDELYECILCACCSSGCPSF
FT                   WWNPDKFLGPAALLQAYRFLSDSRDTHTAERLAALDDPFSLFRCRGIMNCTHVCPKGLN
FT                   PARAIGHIRTMLFDRGV"
FT   CDS_pept        733587..735140
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05880"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F747"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44171"
FT                   /db_xref="GOA:E1VH79"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH79"
FT                   /protein_id="CBL44171.1"
FT                   /translation="MCAQKPLGHDRLASRRTFVPKWIFAPKNGRRAPVFSTIFSPIFLC
FT                   MARSQCAFNGSCTLGIIKMTKSTDKTCLEPSPRFELSGRTKKLGFALAAGALAAALGGC
FT                   VMLLKWRVTTELVPKNFNQVLLDRDGNAAHVYMDGGVLHVAKYGDKGVALGVQDIAATI
FT                   TNTAPTLDLDKGRLLVRGATLGDSVLIDANLGTAGPLDAAQLPVGASTWALANAKPVLN
FT                   GKIALYGTRTGEEGGTHPWLMLWDLAAGSFTLVETPMLDTIDAVFAQQSLMVQGQAAGV
FT                   AQVVTLDATLNVLGQFAVPAGQKLIGDSLGRPVLYNDANLTLYTVNFDGTPVWTYKNET
FT                   YKWIRGQRVGPDGSVLLYGDHSNYSAVALRKDSAHFLRVTPEGALAYHYQTLSNDTARI
FT                   DYKNIRQFADGSMQISLQGLSGDVTGLLIFDGVVGVPYQTKKTVRHEFISAAGKESRYV
FT                   KEPIRVEVISQTKPLLIELLSSQGGHCASLDVYNVGKAGLLTLNELCGAEKPSVVLSRY
FT                   "
FT   CDS_pept        735238..735552
FT                   /transl_table=11
FT                   /gene="sugE"
FT                   /locus_tag="HDN1F_05890"
FT                   /product="SugE protein"
FT                   /note="silverDB:HdN1F749"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44172"
FT                   /db_xref="GOA:E1VH80"
FT                   /db_xref="InterPro:IPR000390"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH80"
FT                   /protein_id="CBL44172.1"
FT                   /translation="MAWFILLIAGLFEVGWAIGLKYTEGFTRLWPTVWTVVSMIIGLWL
FT                   LGIAMKSLPVGTAYAVWVGVGAVGTVILGIILFQEPTNAGRLVSVALIVSGIVGLKLST
FT                   "
FT   CDS_pept        735661..737499
FT                   /transl_table=11
FT                   /gene="xcysJ"
FT                   /locus_tag="HDN1F_05900"
FT                   /product="NADPH-sulfite reductase flavoprotein subunit"
FT                   /note="silverDB:HdN1F750"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44173"
FT                   /db_xref="GOA:E1VH81"
FT                   /db_xref="InterPro:IPR001094"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR001709"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR010199"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH81"
FT                   /protein_id="CBL44173.1"
FT                   /translation="MTTKSPFLLSEQQTSLLETLISEMEQPSLLWTSGYLAGLAMAQRR
FT                   VSLAVKPQEAAAATVAAAPVAKSTLTILYGSQTGNAKRLAQRFAAESEAAGLSVQLVDV
FT                   ADYAVRKLKSETHLFVVISTQGDGEPPDSAREFFEFLHGKKAPKLDTLQYAVLALGDSS
FT                   YPDFCGVGRKIDERLAALGAKRIHNRGDCDLDIETVAEPWWVDTLNLARTALAPAGSVA
FT                   APQQNANVIPLHPSASAWNRDKPFSAQVLENQRITARGTDKHIFHLELSLEGSGLHYQP
FT                   GDSLGVWHFNPPSLVDNVLATLGVSGDQTFTHKGETFTLRQWFSEKLELTRLTRAFLVE
FT                   HSSRVNAGVDQADLQAALAEGARDALAAFLGTHQLIDLLKRFPANWTAETLITSLRPLT
FT                   PRLYSISSSQTVAEDEVHLTVAKVAYDAHGEAHLGAASGFLAELPADGQLPIYIEENRH
FT                   FRLPKNADRDVIMVGPGTGVAPFRAFLQERIESGAAGRNWLFFGAQHFDTQFLYQTEWQ
FT                   DALKKKHLNRIDLAFSRDQQEKIYVQHLIEKQGAELYAWLQNGAHFYVCGSTDMEKDVK
FT                   AALLKAIAQHSGKGDEFANAWFAEAQKEGRYSRDVY"
FT   CDS_pept        737580..739265
FT                   /transl_table=11
FT                   /gene="cysI"
FT                   /locus_tag="HDN1F_05910"
FT                   /product="Sulfite reductase"
FT                   /note="silverDB:HdN1F751"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05910"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44174"
FT                   /db_xref="GOA:E1VH82"
FT                   /db_xref="InterPro:IPR005117"
FT                   /db_xref="InterPro:IPR006066"
FT                   /db_xref="InterPro:IPR006067"
FT                   /db_xref="InterPro:IPR011786"
FT                   /db_xref="InterPro:IPR036136"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH82"
FT                   /protein_id="CBL44174.1"
FT                   /translation="MPQEWNWKDIVEMTGKPSSVEVLKKDSDYLRGTLAECLQDPVTGS
FT                   ISHMDTRVIKFHGCYEQDDRDLREERRKQKLEPAFQYFIRTRLPGGVVTPSQWLALDEI
FT                   AQKFGRGTLKLTTRQTFQIHGIVKRKLKPAMQAMNAVMIDSIAACGDVNRNVLCATNPH
FT                   LSEVHRTVWQQALDVSAYMKPKTRAYYEVWLDEKKVSTTENQEPFYGDTYLPRKFKIAI
FT                   SVPPVNDVDAFANDIGLIAIIENGKLEGYTVAVGGGMGKTYGDAKTYPRAATVIGFIRP
FT                   DEVNHVCETIAGIQRDFGDRSERSQARMKYTIDHMGLDRFKEELNSRLGHALEAPRAFK
FT                   FDHNGDRYGWVEGEDGLWHLTLYIEAGRVVDDVLLGLREIAGVHKGEFRVTTNQNVIIA
FT                   RVAPEDRAQIDALVAKHGLDGYRGASGIRKNSMACVALPTCGLAMAESERYLPDLLLKL
FT                   EAILDRNGILDAPITLRISGCPNGCSRPFLAEIALTGRAIGRYSLNLGGNFTGERLNTV
FT                   YLENATEPEILAALEPMIANYAKNRLEDEKFGDFLYRTGVLSAA"
FT   CDS_pept        739500..742301
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05920"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /note="silverDB:HdN1F753"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44175"
FT                   /db_xref="GOA:E1VH83"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR010425"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH83"
FT                   /protein_id="CBL44175.1"
FT                   /translation="MIKTFPANFAPFALFARGDLLVSKSQPTASTFFRAILCGALAVCF
FT                   LAGAGQSRAITPSPAQIEQFRKLPLEQQRALAKQYGIDLDSLAGVGQASGPIGETDAVS
FT                   GVNTPSASGAAAPSQATTLRVPPAPPQSGQSTRFGVRKVSYVSCEPHGLWGAPMLRTTR
FT                   TGNVLGGEAGRSSAASMDVLEQPIDTADDDSQISDKRNCSPDNLASLQPFGYDLFSGST
FT                   LTFAPLANMPVPLDYVLGPGDTLVVQLYGKTNTNQEMVVDRDGAIQFPELGPITVAGLR
FT                   FEEVRAQILSAVSEKMIGVNGSVTMGALRSMQVLVLGEVVNPGTYVISSMSSITHALLA
FT                   GGGISEIGSLRNIQLKRRGQLISTLDLYDLLLKGDTQHDTRLQPGDVVFVPPAGKRVGI
FT                   GGEVRRPAIYEVKGAANMADLVKLAGGLLPTAYPTATRVDRINAKSEHTLLEVDLNARK
FT                   GQTLLVRDGDVIDVQPVLDDLKGIVQVSGYVNRPGGVAWHPGMRVTEAIRGFYDLQADP
FT                   DLEYALIKRRVLPARTIVVERLHLGDALRAPGSRADLVLRAEDEILVFPRAGEAREAMI
FT                   KPLLGVLQSQADGNKPAQIVSVSGNVRVPGEYPLTEGMTPQDLVTAAGGMLESAYGVEA
FT                   EITRALVDANEYQKTQRIPVSFSGEIPSGGASAHILLAAHDQLYIKRIPGWNEREYAEI
FT                   DGEVNFPGRYPIFRGDTVGMLIARAGGLTKYADPNSTIFLRENLRRREEQQLAKFQKKL
FT                   EADVAKMKLEAAKSKATSGDVERIGSSLLADLSTAQASGRLVIDVAAILNKKPNSDVTL
FT                   QSGDRLVLPIKPQEVSVIGEVQFPTSHLYKQGLDVQDYINISGGFTSKSDEKHVYVIAA
FT                   NGQVRAVKKGVFSLKGELGAGDTVVVPYDVESVSNMQYWLNTSQILFQLSTTAAALKTV
FT                   GVF"
FT   CDS_pept        742301..743296
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05930"
FT                   /product="Lipopolysaccharide biosynthesis protein"
FT                   /note="silverDB:HdN1F754"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44176"
FT                   /db_xref="GOA:E1VH84"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH84"
FT                   /protein_id="CBL44176.1"
FT                   /translation="METSVVNQSTRPVPPQAPMSDGYDDEISLLDLFNTLWPAKYWILG
FT                   AGVLAAALAVLISLQMPNVYRSEAVLSPIADSKGGGLAGLAGQFGGLANLAGISLGGGS
FT                   GVDKATVAIETLKSRAFLATFIERHQLRVPVIAAEGWDQEKKEWLIDPEIYDIQQQQWV
FT                   REVKPPKQQVPSDLEVIEQFRKVLTVSQDKKSMIVTLSVDSYSPEYSQKWAQALIKDVN
FT                   EYLRSKDVDEAKRSIEYLTREIETTPLTQIQAVLYQMIEEQKKTVMLASVRDGYVFQVI
FT                   DPPVVPELKAKPKRALIVVVSVFAAMFLALFTVLARSAFKNAVEKNNKGE"
FT   CDS_pept        743299..743772
FT                   /transl_table=11
FT                   /gene="rfaH"
FT                   /locus_tag="HDN1F_05940"
FT                   /product="Transcriptional activator RfaH"
FT                   /note="silverDB:HdN1F755"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44177"
FT                   /db_xref="GOA:E1VH85"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH85"
FT                   /protein_id="CBL44177.1"
FT                   /translation="MAWYLMQTRPHQETLAATNLLRQGYGCYQPIHQVEKLIAGKLCMK
FT                   DEALFPGYLFVEIAAQQSWCTIRSTYGVRSLVCFGGKALPVSELLISQLRARCETEQAQ
FT                   CRFTKGQSVEVKKGPFAGLNAVFQCKKAEDRVIVLIRLLQSVQAIELPVAALV"
FT   CDS_pept        complement(744022..744264)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05950"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="silverDB:HdN1F757"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44178"
FT                   /db_xref="GOA:E1VH86"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH86"
FT                   /protein_id="CBL44178.1"
FT                   /translation="MMIEPEWGAIMTATVTLSSKFQISVPKSVREEQRWEAGQEFVFIP
FT                   KGKGVLIMPVPELEQLAGIAKGARTDDYRDREDRY"
FT   CDS_pept        744556..744948
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05960"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F759"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44179"
FT                   /db_xref="InterPro:IPR026433"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH87"
FT                   /protein_id="CBL44179.1"
FT                   /translation="MLCRLKKTARSRAVAWEIALHRNIPSPMNETELNALKHAPVKTSQ
FT                   RRLAEALGVSIGKTNHILQGLIEKGYIKAERFINSNNKAAYRYVLTPSGIAERIRMTEV
FT                   FVRRKKLEYEEMVRDLEALRGGGERE"
FT   CDS_pept        744941..745219
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05970"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F760"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44180"
FT                   /db_xref="GOA:E1VH88"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH88"
FT                   /protein_id="CBL44180.1"
FT                   /translation="MSSGLEKRFTLLFTRAREHFENPTSQHRQIAVGFLWVSLFVFVGK
FT                   LAGAAKEMVIAWRYGVSQTPVCQPKPAPPIFEIIYISGRLGDDHAKT"
FT   CDS_pept        745241..745609
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05980"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F761"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_05980"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44181"
FT                   /db_xref="GOA:E1VH89"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH89"
FT                   /protein_id="CBL44181.1"
FT                   /translation="MPDPRLEKRTRRVFSAEYKLKILQQADACKHGELGALLRRESLYS
FT                   NQVAQWRREFAEQGVAGLAKSAPGPSAKKTPEQKRIEQLEKENQRLRRQITVKDSCLLL
FT                   QKKALALLDSLEGDESQA"
FT   CDS_pept        745621..746130
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_05990"
FT                   /product="putative integrase, fragment"
FT                   /note="silverDB:HdN1F763"
FT                   /db_xref="PSEUDO:CBL44182.1"
FT   CDS_pept        746230..746697
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06000"
FT                   /product="putative integrase, fragment"
FT                   /note="silverDB:HdN1F764"
FT                   /db_xref="PSEUDO:CBL44183.1"
FT   CDS_pept        746823..747572
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06010"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F765"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44184"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH92"
FT                   /protein_id="CBL44184.1"
FT                   /translation="MNPINRTCLQELLQCKLLRLDAEFGNASGFFSASKSGIDSFDANL
FT                   PTQTIEYEGRITGAQLKINDSITIAAQEFTRSTKFVAQQDSNLFDFVSRFVVLSNDRAA
FT                   SIASEKIEHRCRNIYHQHAVNSATVPIGNKGFLHFSDTNTTGHQLFERVFYVRDESIEP
FT                   NGMKRWIVHHRLIVKQETANLIVRCCYPRFEGPAPFQKIIPNTIKKKLFRIRETKNPNF
FT                   PFMAVGESLLSSNHQVFIGTKIKLIND"
FT   CDS_pept        747565..748467
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06020"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F766"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44185"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH93"
FT                   /protein_id="CBL44185.1"
FT                   /translation="MTNSRKICYQQSGERLLQHLDGLMHPDTGYPEEPSWGYAFTYLAS
FT                   LHGSDGGNTSLTQKSLNHLVQQDKSSPNYSWEFVVYALQAAKTSGTVQLPDRLNDYREK
FT                   GTRMFNWYLLRTLNKRLCGRYNAADHLKLFIASKIFQQSSGLILDEFQTRSLQYHAFCL
FT                   FILAELIEITPQNPWLKNWFLKGIEFSLQQILSDGTSLYLGRGQEQIFGYGALIYSLEY
FT                   CHTKLRPIDENKLNAVNTRVLNFQRPDGSFPLVLRHREAEVPNAKFSAEPPGGWYGYNT
FT                   LFDYQPFLAYCLLKASKLS"
FT   CDS_pept        748464..749129
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06030"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F767"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44186"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH94"
FT                   /protein_id="CBL44186.1"
FT                   /translation="MSGIQRRQLTNGTDVIWAVPLSGMGHTADEQPLPYLHWRGEELTP
FT                   RYGGEESLPGSSIKSLPLPYGFLASTWPWRQRIFNLPRRRINIYWRNIFRDATRKDRLF
FT                   HFIEQLKYSETEEGFIGNSPSLSYQRTFTLEENLIIVNDTIIFKDRLHFSELYLCPWAD
FT                   FQNDHHGPRCRIQPSLTPNHSNPIKSSTGSAQWHAHKLLNVEYDKGDQVGWNYTYSIE"
FT   CDS_pept        749126..750388
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06040"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F768"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44187"
FT                   /db_xref="GOA:E1VH95"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH95"
FT                   /protein_id="CBL44187.1"
FT                   /translation="MSLLKSALGFSAIESIGSRVFDFAILWVVLNSLPEADIAKFGLAT
FT                   ASIFFFNLVFFAPETALLRNQKKWATDGALPEYLSAFIQFSALKLLIHALLAALVVSAL
FT                   GSEHWFVYAIIFSAITQQIQLAEIARIYMRMDLQQKRVAKFEMVSKVALCGACLWLFKS
FT                   GSLGTYFGIYFAWSLVVAAAWLFQLNNQFRLSPVSIRTSTERVWVASTGFSLWSHFSGI
FT                   LTFYIYNANVLYLSALNAPTEDIALYTVISKIANLFFVIPMFFQSFVPVVLANSGTQSE
FT                   DRFKKLLLSNAGFSILQFAFFAILGWWLAPFFGVKDESRTLDFYYLGLIINGGLLALNL
FT                   TRPLSTYLLMKSAPQRVMLRVFVPSAVVASVLYAVGSYSAGMLGCAIGSGIAYCFMALL
FT                   LVTLYAQHKNSTKPANIGASF"
FT   CDS_pept        750397..751158
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06050"
FT                   /product="Glycosyl transferase, family 2"
FT                   /note="silverDB:HdN1F769"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44188"
FT                   /db_xref="GOA:E1VH96"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH96"
FT                   /protein_id="CBL44188.1"
FT                   /translation="MIPTYKRPDLLARLLESICQQTLQPSEVIVVDDASGMDQAYHICI
FT                   DRFKPRLPGLRFHGLAVNSGAPHARNTGIRLAKGEWIALVDDDDEWLPEKLAKQRLVAE
FT                   KAPQSVGLIYTWTQAQGFGDQASYTSKHYVRGDARRAILSTNFIMSASVMVRKPAIEQA
FT                   GLFDEALPSCQDWDMWTRIFLKGFRCEVVPEVLTIYHRHGGESIGLSPRAKLGYKLFLD
FT                   RHFAAIVRHTSLLNILKKAWLYFQVWRVSHG"
FT   CDS_pept        751151..752266
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06060"
FT                   /product="probable glycosyl transferase, group 1"
FT                   /note="silverDB:HdN1F771"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44189"
FT                   /db_xref="GOA:E1VH97"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH97"
FT                   /protein_id="CBL44189.1"
FT                   /translation="MAKTKLSILTNMVAPYRVPFFKALAADPTVQSLRVLTCVEREVDR
FT                   QWQVEKEAGYSVNVLPGFTLNLRRGTDAMRILHFRIGIFWELLRHRPDTLVIGDASWTS
FT                   FLAALACRVYGIRYVVWNEITTSSQVSKGLVARIRRWMYRGAHQLIASCGMAKDFLLQN
FT                   GVPAEKIHIVLNAVDNDYFLQQRALWEPQRDALRAELGVAPDAFCFIYVGQLISRKRVV
FT                   ETVELLAQVAPEQPVHLLIAGTGPLEGAMRSAAARHEFQAITFCGYAEPARLSQLYVAA
FT                   DALILLSEDEPWGMVVNECLLFGNGYFTSTSVAAGVELQSDASHLVKPYTDVKKFDLQK
FT                   LISACSGLKGKSPSTPPSECEMASAFLKYAK"
FT   CDS_pept        752263..753531
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06070"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F772"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44190"
FT                   /db_xref="GOA:E1VH98"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH98"
FT                   /protein_id="CBL44190.1"
FT                   /translation="MNAKTPSKLTDIATLTLLIATLILPESNNTFAIYAIGLIFLVVIR
FT                   FTFDPINPYFYLAPASLYLAGNLIYLFIINGSQHSIFFSCAYLGILTFSLASNVRPNRQ
FT                   EPPKITTKSKPLVSLFLISISISTAIYVAARLKITPQVAMAAHLAMSPVLTAVIFGSLI
FT                   AISSKKLILALGLSTIYLAQITLNNIFAEDSSRLSILDYTILIFLIAYFRRRKKAPLRK
FT                   NELKAINSSLGLALIASFAAIASTSNLESLGGDALIALNAVAAISAAKGHHEYLMPFFN
FT                   GGLILIPEIIWPFTKPIAYNSSSWYIENVLNMPANDYPWGVGITLFAASYLYGGLPGVA
FT                   LMFGGIGLFVRHLLRLSTNIFWIGFTCYFLMRLPLAFYRMDETFILGSAAPMLLTMAAF
FT                   IRIYKRKIDNCFLATENPRITRN"
FT   CDS_pept        753552..754622
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06080"
FT                   /product="Acetyltransferase"
FT                   /note="silverDB:HdN1F774"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44191"
FT                   /db_xref="GOA:E1VH99"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E1VH99"
FT                   /protein_id="CBL44191.1"
FT                   /translation="MQSSQIIVTPATKIDSLQALRAIAALLVVFHHSKDFAEKYGHENW
FT                   FTDFLGSGIGAFGVDIFFVLSGFIMFHTTRDATSGRIFLANRIARVAPMYWIVTSILAI
FT                   MLILAPGLFSTMRFELWHFLKSILFIPHNSPSGDYLPLLGVGWTLCFEMYFYLAFASLI
FT                   KVRSYALALLSGYFAIMVTIGLILPPHENRLLWTLTNTLNLEFTFGIALAHFYPKMPKA
FT                   PISGALLSATGFLAAFLLKDLGGPHALRGITWGLPAALIMCGFLMMSNIRFNRVFIGLG
FT                   DSSYSLYLIHMLSLPFLWKIAHLSNIQFEGSALIFTFALFSVAASFLAWKHIEIPASKA
FT                   AKQLLLHKIQPARTQE"
FT   CDS_pept        754746..755762
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06090"
FT                   /product="Glycosyltransferase, group 1 family protein"
FT                   /note="silverDB:HdN1F776"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44192"
FT                   /db_xref="GOA:E1VHA0"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA0"
FT                   /protein_id="CBL44192.1"
FT                   /translation="MNEMSVCVHIINYSNVFGGQERYIETLCTALEQRDINCFFSGGPL
FT                   RLTELHESAKVNGATNIQVEILNGNRALYLHACRPRAAAVRVYVQHSHVQDAQGHPVKQ
FT                   WVRKLLLSLLLTRMDVVVRVCDNALPDRYAPGKIHTIHNGVPLPELPDSPAADRPFTLL
FT                   MVGAVNENKNQRLALQLLAQMPDVHLVVVGDGPERSALEQWAVEHGVAKRVRWTGFLED
FT                   PSPCYLQADALLMLSAFEAFPYAVLEAMAHGLPVVGTRVGGVPEAITHEQDGLLLPARD
FT                   LESVSAAVRRLQADPAWRAKLGQRARQTVRERFTVDTMTDRLLSVIDQAARKKGLMS"
FT   CDS_pept        755786..756835
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06100"
FT                   /product="Mannosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="silverDB:HdN1F777"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44193"
FT                   /db_xref="GOA:E1VHA1"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA1"
FT                   /protein_id="CBL44193.1"
FT                   /translation="MVGNYRGMGRFARQLVAPVSNEVVALAPRGLSTTDWPCVSRGRGF
FT                   FPWWEQVELPRLCRSERLDFLLCPYNSGPLTDVGSTRVIAVIHDLIYLQPWSVLPPSIS
FT                   AYQTLGRLYRRQVVPAFARRADTILTVSHFTKGELVHRLGLAEDDVYVIPNAIADNWFE
FT                   PPLPLQHRKPYLFTVAGEPPSKNVRGLLQGFAAAVPALGPEAHLKIAGVKPAYHAAFMR
FT                   LASTLGVADRVQLLGYVSVEELRQHYREARVFVFASLFEGFGIPLLEAMASGTPVACSN
FT                   TTSMPEVVGDCGLMFDPRSTEDMAHKLCLAWEDTPERAARSLAAVERARGFSETAVSQQ
FT                   MAAFWKGMA"
FT   CDS_pept        756832..758022
FT                   /transl_table=11
FT                   /gene="rfaG2"
FT                   /locus_tag="HDN1F_06110"
FT                   /product="Putative glycosyltransferase"
FT                   /note="silverDB:HdN1F778"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44194"
FT                   /db_xref="GOA:E1VHA2"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA2"
FT                   /protein_id="CBL44194.1"
FT                   /translation="MSQQKKRLLILTPRFPYPVVGGDRLRIYQVCKALSERFSLTLLSL
FT                   CETDAEMTMPLPADGVFDRVERVFLSRSRSYLNTLLALGSTTPLQVAYYRSSDFAKAVD
FT                   RLMPEHDGVLSHLIRCAEYVKESDKPRILEMTDAISLNYERVRQLKNAGGLKAQIYRLE
FT                   SRRLLAYERRIVDAFDLTVLVSETDKVHLVGAQHDKVMVCSNGVALEHLPFRERHDSQP
FT                   VIVYIGNMASVQNMDACLYFARDVMPLVTQRVRATFRVVGRISDGDAERLRAFPNVEVT
FT                   GAVDGVAEAVEDARLGVCPVRLGAGVQNKVLEYMALGLPVVTSSIGLEGFEAQPERDLL
FT                   VADTPKEYAEAISRIWDNDAMKEQLAINGHAYVNTHHCWLSRLAPMVDRIADVVVK"
FT   CDS_pept        complement(758152..759732)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06120"
FT                   /product="Transposase IS66"
FT                   /note="silverDB:HdN1F779"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44195"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA3"
FT                   /protein_id="CBL44195.1"
FT                   /translation="MKTTENTTLPDDVERLKALVLALQNKNSALQKEAAKEAAEAKRFE
FT                   KLYYETWEKWQLALRSRFASKSEAYDGQVDLFNEIEQTLEPTVEEIAEADAEKETITYT
FT                   RKKARAPRIAPELPREDVLHDLADKDKVCGCCGHDLHRMGEEVSEKLEFIPAHVKVLRH
FT                   IRPKYSCRQCEQQAIRTEIKIAPVPASVLPKSIASASLLTQIICAKFVYGLPLYRQEAL
FT                   FKSFGIEINRQTMSRWLIKVSEQLRPLYKYFHRRLLEQPAIWSDDTRIKVIETDNAQCA
FT                   MWVYGCGMETPLPGGAPPIVLYDYRDGRAGRYITDFLQGYSGLLQVDGYQAYQQTHATL
FT                   IGCWAHARRKFKEAKDVQPKGKTGRADVALSLIQKLYAIEKSLPEKTIEERLAIRQQQS
FT                   APILQQIKEYLEKTAFEVPPKTAIGLAVHYSLNQWNKLTAYLGYGETSIDNNRAERAIK
FT                   PFVIGRKNWLFANTRTGATASAILYSIVETAKANGLRPEQYLQALLEQLPTTQAEEIEL
FT                   LTPWNITLS"
FT   CDS_pept        complement(759800..760156)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06130"
FT                   /product="transposase, IS66 family (orf2)"
FT                   /note="silverDB:HdN1F780"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44196"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA4"
FT                   /protein_id="CBL44196.1"
FT                   /translation="MKMFVDPSAIYLHRHPVDFRKSINGLSVIVDEQMAMSSLSGALFV
FT                   FCNKQRDKLKVLYWDQTGFCLWYKRLEKDRFVWPKRFSGSSIELSERQWQWLLEGFDIE
FT                   KIKGHQAVNCRAIW"
FT   CDS_pept        760520..760849
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06140"
FT                   /product="conserved hypothetical protein, fragment"
FT                   /note="silverDB:HdN1F782"
FT                   /db_xref="PSEUDO:CBL44197.1"
FT   CDS_pept        complement(760930..762378)
FT                   /transl_table=11
FT                   /gene="gatB"
FT                   /locus_tag="HDN1F_06150"
FT                   /product="Aspartyl/glutamyl-tRNA (Asn/Gln)
FT                   amidotransferase, subunit B"
FT                   /note="silverDB:HdN1F785"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44198"
FT                   /db_xref="GOA:E1VHA6"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA6"
FT                   /protein_id="CBL44198.1"
FT                   /translation="MEWETVIGLEVHVQLSTRSKIFSGSDTTFGAEPNTQASLIDLGMP
FT                   GTLPVLNAEAITKAVRFGLGIQAEIGHTSVFDRKNYFYPDLPKGYQISQFSRPIVGKGS
FT                   LEISLEDGRKKTIGITRAHLEEDAGKSLHEDFRGMTGIDLNRAGTPLLEIVSEPEIRSA
FT                   EEAVAYLKTLHSIIRYLDISDGNMAEGSMRCDVNISLRPRGQEAFGTRAEIKNVNSFRF
FT                   VEKAIQHEMERQADLLESGGKVVQETRLYDANKNETRSMRSKEEANDYRYFPDPDLLPV
FT                   VLTSEFIEQVRATLPELPTQKIQRFQAEYGLSEYDARILAASRDLADYFESVTEHSGAG
FT                   PKVSANWVSGDLLGALNKADLDIKQSPISALQLAALLKRIHDNTISGKIAKQIFEILWA
FT                   EGGEVDAIIEAKGLKQETDTGAIEAIVDQIIQGNPDQVAQYLAADENKRKKLIGFFVGQ
FT                   IMKASKGKANPQIVNDLLGAKLGG"
FT   CDS_pept        complement(762398..763852)
FT                   /transl_table=11
FT                   /gene="gatA"
FT                   /locus_tag="HDN1F_06160"
FT                   /product="Aspartyl/glutamyl-tRNA (Asp/Gln)
FT                   amidotransferase, subunit A"
FT                   /note="silverDB:HdN1F786"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44199"
FT                   /db_xref="GOA:E1VHA7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA7"
FT                   /protein_id="CBL44199.1"
FT                   /translation="MHKQTLAELSRALSSGAISSVALTEHFLARIQKYDPLLNSLITTT
FT                   AEQALSQAKMADERRKQGKATALTGIPIVHKDLFCTQGVRTSCASKMLDNFISPYESTV
FT                   TQKLADAGMVMLGKTNMDEFAMGSTSETSFYGPTKNPWDLEHVPGGSSGGSAAAVAARL
FT                   APIATGSDTGGSIRQPASLCGITGLKPTYGRISRFGMIAFASSLDQGGPMAQTAEDAAL
FT                   LLEGMAGFDPKDSTSADLPVPRYSDTLNHDLKGLRIGLPREFFAEGLDAGVASLIQAAV
FT                   KELEKLGASVKEVTLPSTSLAVPAYYVIAPAEASSNLSRFDGVRFGYRCAQPKDLEDLY
FT                   KRSRGEGFGAEVKRRIMIGTYALSAGYYDAYYLQAQKVRRLIRQDYDNAFHEVDVLIGP
FT                   TTPSTGFRLGESARDPLAMYLSDIYTIGVNLAGLPAMSLPAGFINGLPVGLQLIGPHFS
FT                   EAKLLNIGHQYQTVTDWHRQQPAQFA"
FT   CDS_pept        complement(764006..764311)
FT                   /transl_table=11
FT                   /gene="gatC"
FT                   /locus_tag="HDN1F_06170"
FT                   /product="Aspartyl/glutamyl-tRNA (Asn/Gln)
FT                   amidotransferase, subunit C"
FT                   /note="silverDB:HdN1F787"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44200"
FT                   /db_xref="GOA:E1VHA8"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA8"
FT                   /protein_id="CBL44200.1"
FT                   /translation="MSPAQTSTLTPEQVRKIAHLARLGISDDQLGEYAQRLGGVLDLVA
FT                   KLQDAPVGDLAPMAHPLDATQRLRADAVTETNQRKALQNVAPETEDGLYLVPKVIE"
FT   CDS_pept        764751..765794
FT                   /transl_table=11
FT                   /gene="mreB"
FT                   /locus_tag="HDN1F_06180"
FT                   /product="Rod shape-determining protein"
FT                   /note="silverDB:HdN1F788"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44201"
FT                   /db_xref="GOA:E1VHA9"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHA9"
FT                   /protein_id="CBL44201.1"
FT                   /translation="MLKRLRGLFSTDLSIDLGTANTLIYVKGRGIVLNEPSVVAIRNHQ
FT                   GQKSVAAVGLEAKRMLGRTPGNITAIRPMKDGVIADFQVTEKMLQAFIHKVHEHSFIGL
FT                   SPSPRVLVCVPCQSTQVEKKAIKESALGAGAREVYLIEEPMAAAIGAGLPVEEASGSMV
FT                   VDIGGGTTEIAIISLNGVVYSDSVRMGGDKFDEAIITYVRRNYGSLIGEATAERIKNEI
FT                   GCAYPGEEMMEIDVRGRNLAEGVPRSFTLNSNEILEALQEPLSQIVSAVRSALEQSPPE
FT                   LASDIAERGLVLTGGGALLRDLDRLLAEETGLPVIVAEDPLTCVARGGGKAMELMDRKG
FT                   FDLFTTE"
FT   CDS_pept        765821..766723
FT                   /transl_table=11
FT                   /gene="mreC"
FT                   /locus_tag="HDN1F_06190"
FT                   /product="Rod shape-determining protein"
FT                   /note="silverDB:HdN1F789"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44202"
FT                   /db_xref="GOA:E1VHB0"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB0"
FT                   /protein_id="CBL44202.1"
FT                   /translation="MKPIFARDSAARNRLAFSLLISLAVIAADHLTDSLRPAHFVLSTL
FT                   TAPVHWVADLPMQMSEWSASGFQRSREIKAENRSLRTEVMLLKRRVQKLASTVAENSQL
FT                   KELLGAYNLSEERISVAEIISVDPDPFRHEVIINKGTEQKAYVGQTVLDAEGVMGQLVQ
FT                   TGPFTSRLLLITDVSHGVPVYVNRNGVRAVAVGSGELDKLKLLHVPDTADILEGDLLVT
FT                   SGLGGRFPKGYPVGVVTSVRHDPGQPFAVVEARPMAHLDRSRHVLLVFQDPKAKPERPP
FT                   ISDPAASVPDAAEGTDGKK"
FT   CDS_pept        766710..767189
FT                   /transl_table=11
FT                   /gene="mreD"
FT                   /locus_tag="HDN1F_06200"
FT                   /product="Rod shape-determining transmembrane protein"
FT                   /note="silverDB:HdN1F790"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44203"
FT                   /db_xref="GOA:E1VHB1"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB1"
FT                   /protein_id="CBL44203.1"
FT                   /translation="MEKNNLGLIYVTLFFGMVLTVVPLPPTYMMWRPAWVPLLLIYWVM
FT                   MMPHSVGIFTAWCVGLLLDDLEGGVLGQNALALSFVAFFTYALHLRMRVFLVWQQMIAV
FT                   LVLVGVYQLIHVVIERAISQAAWDMSYWLSSLSSAAIWPALVLLLGQSRQRSLVE"
FT   CDS_pept        767221..767847
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06210"
FT                   /product="Nucleotide-binding protein implicated in
FT                   inhibition of septum formation"
FT                   /note="silverDB:HdN1F791"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44204"
FT                   /db_xref="GOA:E1VHB2"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB2"
FT                   /protein_id="CBL44204.1"
FT                   /translation="MPSLVAAAPDVADLYLASASPRRGELLGQIGVRFAVLSAGVDEQH
FT                   FAGESPEAYVCRLAASKAQAGLQRALAEGKPCRPVLGADTTVVVSGQILGKPISEADAC
FT                   GMLVRLSDGAHTVLTAVSIATENSVETRLSSSLVVFRRLARAEMRAYWRSGEPSDKAGG
FT                   YGIQGLAAVFVKSIQGSYSGIMGLPLAETAELLKLYRVPIWQPSR"
FT   CDS_pept        767844..769322
FT                   /transl_table=11
FT                   /gene="cafA"
FT                   /locus_tag="HDN1F_06220"
FT                   /product="Ribonuclease G (RNase G)"
FT                   /note="silverDB:HdN1F792"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44205"
FT                   /db_xref="GOA:E1VHB3"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB3"
FT                   /protein_id="CBL44205.1"
FT                   /translation="MNEEILINVTPMETRAAIVENGVVQEIFVERSVKRGLVGSIFKGK
FT                   VVRVLPGMQAAFVDIGLERAAFLHAKDIWVKDRPENSEGGEAVGNIGELVYEGHSIVVQ
FT                   VTKDMIGTKGARLTTYLSIPSRYLVYMPHTDHIGVSQRIEQEEERERLRSTMEHVLEGV
FT                   EDVDKKGFILRTAAEGADEDSLRHDVEFLCRLWRSIRARIHMATPVSIVHSDLPLSLRI
FT                   LRDEVCPTVDKIRIDSRETHVRALEFTRDFMPHVESLIEHYPGERPIFDLYGVENEIQK
FT                   ALGRQVQLKSGGYLIIDQTEAMTTIDVNTGAFVGHRNLEETIFKTNLEAAQAIARQLRL
FT                   RNLGGIIIIDFIDMEEVDHQHQVLRIFEKMLERDHAKTKITQVSELGLVEMTRKRTRES
FT                   LERVLCEPCPTCQGRGTVKTAETLCYEIFREILRQSRAYEAESFLVIASQAVVDRLVDE
FT                   ESANVADLEQFIGRTIRFQVESFYSPEHFDVVLV"
FT   CDS_pept        769332..773549
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06230"
FT                   /product="Hypothetical protein"
FT                   /note="silverDB:HdN1F793"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44206"
FT                   /db_xref="GOA:E1VHB4"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB4"
FT                   /protein_id="CBL44206.1"
FT                   /translation="MTPSIYPRVTNIYQRTASLLHRLARHLAWWLACLFVLIAVVVGVG
FT                   RELVGGIEYFHPALEKRLSEQTGLDVRFENVSGKWLRMSPELRFSNVVLTRPVPANPVP
FT                   ANLGAANVERPKVSPITIKRLSIRVSLGASLRSGKLRFRIHTRGANLHVASCGSSFCLL
FT                   GQPIVDTGQDAKNARDHSLREHSWVQALPTVLVHRTHVIVDGLLETRAEADVSLLRLTW
FT                   NGDQALLEGDFRLRARSEVHGRIHGRFQAEDILSQPTERGSVAAELIASEPSDSVIYLN
FT                   LQHDALSDWLPVAIASKLPARLRGGEGHTEVWLRLANGRLASSTLRFDWNDISSIRNGI
FT                   ERRLADQFSGVLRWQEIVKANRVSENNDGPSSEKKSWQLDAPKLVWQLDDHYWQPGGIQ
FT                   LQVAEDQAVAGGHAKGWNYALRIADISFDTRFDALASWVPQRAAWRKALLTLQPSGRLR
FT                   DFDLKVHYQPEGWTLQQASGQLSEYRQSPLHFIPGLENIGAAFRVEAQQAWVQLDERDL
FT                   VLDYPAVFRDPIPIQSAQGSLGIDWRSDAIVLRSSPLHLITESGDTVTRLSLSLPKPSQ
FT                   NAAKPAEPPVLALQSTLRDVNGAHASRYLPAGVLHGGLIGWLDSAIQGGNLHRGDLVFN
FT                   GPLGHHEYHDAWTVLLGFQVEAGRLRFLPDWVEPVTDLYGDVIVENGIVDAKVDRANYF
FT                   GIAIQQAQVQTQHQDDHFNLSVNVRGQGDAAAGLRLLRESPLGNTVGDALSDLSLQGPL
FT                   QVGFQLSTPLIMHPVLQGLADIQLGNSELHWPAQRLEAKNLQARFLYDLQKGIRTEGLQ
FT                   GSLLGGNAKGKLYHATDSSGRWLQLDLQGDATTQSLQTWLSVPQLALASGALLYDMKLK
FT                   IAPYGSANQNSLSVTSQLNGVAIDLPAPFGKKAGSQRLFTVERHWYAHDPHDSHPQSMP
FT                   YDASTRITYDELVDAIWQTKNGQAIRGAFALGGAKPRFAKLSPWAVQGWLTRFAWEEWA
FT                   PYLKRLGGTASAKNDPTTSAFSGNKLRWLGELGDTSLTIASLPLADREFGPLQIDVNTA
FT                   NDAALLVLAGDHLRGQVSLPKSFLNTPSARSRGVPVSATLQLLKIPAAQDTVIFDAEAP
FT                   DVAIAGKNARSAPDTGANDSSIPSIDPRLLPEMDLRIDRLIVSDREMGSWWIPMRATPK
FT                   GLLAENANFHLNQADFVGALRWEKGANGSLTAFQGKGEAGDIADVSRAWGYTPALDSKT
FT                   ASLEADLQWPGAPWQFSMALAQGQFKARLMDGHFLKVGNSTTGRYLGLLNFQTWLSRLQ
FT                   LRFKDLSDSEMPFDKITGRFALANQQIQVSRLKIDSPTVKMKLNGNLDLAQDQLAMQWD
FT                   VTLPVTRNLILPAAVVGGLPGAATAFVLDKVLSSQLDKLTTLTYDVTGEFNNPKTALRI
FT                   PLP"
FT   CDS_pept        773608..774492
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06240"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="silverDB:HdN1F794"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44207"
FT                   /db_xref="GOA:E1VHB5"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB5"
FT                   /protein_id="CBL44207.1"
FT                   /translation="MKLMVAAIQMNSGLDIEANLAQAEHWISKAAAAGAKLLVLPENFA
FT                   VFSAAALFDAGEEERESQRFSQTLKAWSKRYQVWLVAGTLPFRTRLNNVANAEPEALVH
FT                   GRRVRTRCSVYSPEGLCVAAYDKLHLFDVQVADSQGAYSESSAIEPGEIAVVADLNGYR
FT                   LGLTICYDLRFPELFTHLAQLGASIITVPSAFTYVTGEAHWLPLLRARAIENQCFVIGA
FT                   NQTGEHPQQDPAKPPRQTWGHSCVISPWGEVLAMLEHEPGIACAEIDLDQIAELRRKMP
FT                   LLSHKRFTVAPKR"
FT   CDS_pept        complement(774489..775121)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06250"
FT                   /product="Protein of unknown function DUF615"
FT                   /note="silverDB:HdN1F795"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44208"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB6"
FT                   /protein_id="CBL44208.1"
FT                   /translation="MSRKRSPQDDNYWADTPLTDPSTDNDHSESLSSYHPDYDGPSKSL
FT                   LKRQSAHMQELGEKLSKLDASHWDRLPLSDSLRAALVEAQRISSHEGLRRHRQYIGKLM
FT                   RNEAIEPIEAYFKTLEDHRELNTRAFHELENLRERLITGDHHVIGEVIAKYPGVDSPQL
FT                   RQLVRNAKKEHERNTSDTHSGKVGVEHSRKLFRYLRDLEEAQAGAAG"
FT   CDS_pept        complement(775191..775463)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06260"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F796"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44209"
FT                   /db_xref="GOA:E1VHB7"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB7"
FT                   /protein_id="CBL44209.1"
FT                   /translation="MPTSDCFFVDCFCRRLFFVDVFFGGWFFSTLYFLYGERSMRSPFF
FT                   LRCEKRVRDRSMRVEAWARHAPRIVQCGLRHGHGAPCPYGDGGME"
FT   CDS_pept        complement(775815..776399)
FT                   /transl_table=11
FT                   /gene="sodB"
FT                   /locus_tag="HDN1F_06270"
FT                   /product="Superoxide dismutase [Fe]"
FT                   /note="silverDB:HdN1F799"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44210"
FT                   /db_xref="GOA:E1VHB8"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB8"
FT                   /protein_id="CBL44210.1"
FT                   /translation="MSFELPALPYAKNALAPHISEETLEFHYGKHHNAYVTNLNNLVKG
FT                   TEFEGKSLEEVVRKSSGGIFNNAAQVWNHTFYWNSLSPKGGGAATGAVAEGINKAFGSF
FT                   DKFKEEFSKSAAGNFGSGWTWLVKKADGSLAIVNTSNAATPITEAGVTPLITVDVWEHA
FT                   YYIDYRNLRPKYLEAFWALVNWDFANANLAK"
FT   CDS_pept        complement(776653..776931)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06280"
FT                   /product="Phosphoryl transfer system, HPr"
FT                   /note="silverDB:HdN1F802"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44211"
FT                   /db_xref="GOA:E1VHB9"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHB9"
FT                   /protein_id="CBL44211.1"
FT                   /translation="MTTQGKTQITIINKLGLHARAASKLVAMANRYESRIILFKGAQQA
FT                   DAKNIMAVLLLAASKNTTLEITADGRDWEKALEEITALINNRFGEAE"
FT   CDS_pept        complement(776984..777889)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06290"
FT                   /product="Uncharacterized P-loop ATPase protein UPF0042"
FT                   /note="silverDB:HdN1F803"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44212"
FT                   /db_xref="GOA:E1VHC0"
FT                   /db_xref="InterPro:IPR005337"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC0"
FT                   /protein_id="CBL44212.1"
FT                   /translation="MQPDNGTHPEPASHKNKNKNIVIISGRSGSGKSTALHVLEDVGYY
FT                   CVDNLPVRLMSGLIKELAERKSAPVRKIAIGIDARNSLEQLEAFPTSIEALRAQDTDIK
FT                   IMYLDADDNTLLQRFSETRRKHPVSTRSLSLSEAIERESVLLKPVAFLADINIDTSRMT
FT                   LHSLRDLVKKQVGTDDDYMTVVILSFGFKHGIPSDADFIFDVRCLTNPHWVPGLRVQTG
FT                   LDEGVQTFLSADKDVNRMFDDIRVFLEHWLPQFSASNRSYMTIAIGCTGGQHRSVYMVE
FT                   RLKDHFETNNFHILARHRDL"
FT   CDS_pept        complement(778064..778369)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06300"
FT                   /product="Sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="silverDB:HdN1F804"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44213"
FT                   /db_xref="GOA:E1VHC1"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC1"
FT                   /protein_id="CBL44213.1"
FT                   /translation="MQIAISGHHVELTDSLKDYTSEKLSKLYRQVDDILSIQVVLTVEK
FT                   SVQKAEATVRMKGADYFANAESEDMYTAIDLLSDKLSRQVVKHKEKLTARHQGMGR"
FT   CDS_pept        complement(778449..780098)
FT                   /transl_table=11
FT                   /gene="rpoN"
FT                   /locus_tag="HDN1F_06310"
FT                   /product="DNA-directed RNA polymerase specialized sigma
FT                   subunit, sigma54 homolog"
FT                   /note="silverDB:HdN1F806"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44214"
FT                   /db_xref="GOA:E1VHC2"
FT                   /db_xref="InterPro:IPR000394"
FT                   /db_xref="InterPro:IPR007046"
FT                   /db_xref="InterPro:IPR007634"
FT                   /db_xref="InterPro:IPR038709"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC2"
FT                   /protein_id="CBL44214.1"
FT                   /translation="MKPSLQLKIGQHLTMTPQLQQAIRLLQLSSLDLQQEVQEALDANP
FT                   LLEMDEARNDDGIETNQSLSDDAPYSTDDRSSLTDSHSSLERNESINSQSELDSGPLST
FT                   RSEETAVDFTDTTMPDELPVDTHWDDVFDGALSSAGSSAADDDDYNLDARNSQPESLQD
FT                   TLMWQLNLTPMSPLDQVIAISIIEAIDERGYLRQTVEEIRDGILQQQDVVTDIIALQHQ
FT                   ELLEIGIDPASLTVEGEAAITLEEVLAVLHRIQQFDPPGVGARDLKECLLIQLNQLAPD
FT                   TPFLANAKEVVAKYLDALASRDFALLLRKTKLSEFGLKEVIKLIRTLKPHPGAGVGDDN
FT                   TEYVIPDVIVRKFNGRWQVELNPEATPRLRINGQYAGLVQRGNSSDDNTFLRNHLQEAR
FT                   WFIKSLLSRNETLLKVASKIVEYQIEFFEEGEEFMKPLVLHDIAEAVGMHESTISRVTT
FT                   QKFMHTPRGVFELKYFFSSHVNTQSGGEASSTAIRAIIKKLIAEENPRKPLSDSKITEM
FT                   LAERDIVVARRTIAKYREALAIPPSNERKRLV"
FT   CDS_pept        complement(780436..781161)
FT                   /transl_table=11
FT                   /gene="livF"
FT                   /locus_tag="HDN1F_06320"
FT                   /product="Putative leucine/isoleucine/valine transport
FT                   system, ATP-binding protein"
FT                   /note="silverDB:HdN1F807"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44215"
FT                   /db_xref="GOA:E1VHC3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030921"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC3"
FT                   /protein_id="CBL44215.1"
FT                   /translation="MSRLCAMHLAKSYKGRRVVEDVSLAIDSGQIVGLLGPNGAGKTTC
FT                   FYMIVGIVPQDKGHILIDDQDITYLPMHGRASRGIGYLPQEASIFRKLTVRENLLAILE
FT                   TRKSLSRSQRISKMEELLDEFHVGHIANSLGMALSGGERRRVEIARALAADPQFILLDE
FT                   PFAGVDPISVNDIKEIIRHLKQRGIGVLITDHNVRETLDICEKAYIVSEGHILAEGPPE
FT                   KVIANPQVREVYLGKQFQL"
FT   CDS_pept        complement(781158..781775)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06330"
FT                   /product="OstA-like protein"
FT                   /note="silverDB:HdN1F810"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44216"
FT                   /db_xref="GOA:E1VHC4"
FT                   /db_xref="InterPro:IPR005653"
FT                   /db_xref="InterPro:IPR014340"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC4"
FT                   /protein_id="CBL44216.1"
FT                   /translation="MPYPFSKQIHPFLLTRRLTALCAWCLCLGFTLYGDTALALESDRQ
FT                   QPIEIIADQAELDEGQGVAHYTGKVVLTQGSLIINADDLYIRADNNKQVQQVTAKGSPA
FT                   VFTQTPEPDQPPVTAKAKTIDYYVSDEKLILQLDAIVVQNESTFQGTRIQYDIRTRRMQ
FT                   ATGGDAKNAVKGGNQRVKMVLPPSQPDDKQGKSKAPKSGAKP"
FT   CDS_pept        complement(781866..782435)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06340"
FT                   /product="Protein of unknown function DUF1239"
FT                   /note="silverDB:HdN1F811"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44217"
FT                   /db_xref="GOA:E1VHC5"
FT                   /db_xref="InterPro:IPR010664"
FT                   /db_xref="InterPro:IPR026265"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC5"
FT                   /protein_id="CBL44217.1"
FT                   /translation="MDARNLFWSILLLAVLSSLGINGYLSWKTAPPANTAQADSLPDII
FT                   LDRINQMNFDDQGDKHYQLLAETATHFTKQEVTEFQGPNLVFFDKDERSWNATSNTGIT
FT                   RDAGETLHLNGDVVIRKLDDKAQPVELRTQSMHVSPKAETAETDDEVDITQGGHHTHAK
FT                   GLRVEMQTGKLTLQSKVISRYSPPSS"
FT   CDS_pept        complement(782445..783419)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06350"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F812"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06350"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44218"
FT                   /db_xref="GOA:E1VHC6"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC6"
FT                   /protein_id="CBL44218.1"
FT                   /translation="MNASHDFIGSAHRVIDIEVQATEALRPRIDASFVRACQLILACKG
FT                   RVIVTGMGKSGHIGSKIAATLSSTGTPAFFVHPGEARHGDLGTITGEDLVIAISNSGNT
FT                   EEVVSILPVIKRKGSLLITLTGNPHSTLATQADVNLDVSVAQEACPLGLAPTASTTVTL
FT                   VMGDALAVALLEARGFTANDFALSHPGGALGRKLLLLVENVMQTGDRIPTVTADISISK
FT                   ALLEISSKGLGMTGIVDDQGILIGVYTDGDLRRTLDQGLDIHKTLLREVMSTKCKVTHP
FT                   KVLAVEALAIMEKSKINGLMVVDDDRRPVGALNMHDLLRAGVM"
FT   CDS_pept        783668..784480
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06360"
FT                   /product="Toluene tolerance ABC efflux transporter,
FT                   ATP-binding protein"
FT                   /note="silverDB:HdN1F814"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44219"
FT                   /db_xref="GOA:E1VHC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030296"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC7"
FT                   /protein_id="CBL44219.1"
FT                   /translation="MIASDNFIEVKGMSFYRGTRPIFKGVDISIPRGKITAIMGPSGTG
FT                   KTTLLRLIGGQLRPDTGQVLVEGRDIFKLNRKELFDTRSRMGMLFQSGALFTDLSVYEN
FT                   VAFPLRVHTQLPEDMIRDLVLMKLQAVGLRGARDLMPSELSGGMARRAALARAIALDPD
FT                   LVMYDEPFAGQDPIAMGVVVELVRLLSSALGHTSIVVSHDVQETARIADYIYVIADGIV
FT                   IGHGSRDEIMDSDLPRVRQFIRGLPDGPVPFHFPANPLAEDILARGAR"
FT   CDS_pept        784477..785259
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06370"
FT                   /product="Toluene tolerance ABC efflux transporter,
FT                   permease"
FT                   /note="silverDB:HdN1F815"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44220"
FT                   /db_xref="GOA:E1VHC8"
FT                   /db_xref="InterPro:IPR003453"
FT                   /db_xref="InterPro:IPR030802"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC8"
FT                   /protein_id="CBL44220.1"
FT                   /translation="MIEWLRRIGADGLGTLRTIGAAGIFLFNALWALPNPRSGTPLLVK
FT                   QIYSIGVLSLVIIVVSGVFIGMVLALQGYHILTQFGSEEALGQLVALSLLRELGPVVAA
FT                   LLFAGRAGSALTAEIGLMKATEQLASFEMIGVDPLRRIIAPRFWAGFICMPTLAVIFSA
FT                   VGVIGAYLVGVKWLGVYDGSFWANMQNSVEWGEDVVNGVIKSFAFGAVVTWIAVFQGYD
FT                   CIPTSEGISRATTRTVVFSSLAVLGLDFILTAVMFGDL"
FT   CDS_pept        785262..785732
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06380"
FT                   /product="toluene tolerance ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /note="silverDB:HdN1F816"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44221"
FT                   /db_xref="GOA:E1VHC9"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="InterPro:IPR030970"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHC9"
FT                   /protein_id="CBL44221.1"
FT                   /translation="MRMRNLEIMVGAFMVAGFAALVFLALRVSGLAMDSREATYRLSGH
FT                   FENIGGLTVRAKVTMAGVAIGRVSRIYFDDKNFTAVVEMDINKSVSNISTDATASILTS
FT                   GLLGEKYIGIVEGAEDEVMKEGDVFQVTNSALVLEDLVGKFLFNKVTEDPKP"
FT   CDS_pept        785729..786046
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06390"
FT                   /product="STAS domain protein"
FT                   /note="silverDB:HdN1F817"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44222"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD0"
FT                   /protein_id="CBL44222.1"
FT                   /translation="MKAALEKLSDSAWTLRGDIKYANAVEIREQGERLLESSAQSVGVD
FT                   LSGMTSATSVAISVLLCWLRAAQKRGKSLSFNHLPQNLLDVARVSGLDKLLDQAVVQAA
FT                   P"
FT   CDS_pept        786309..786563
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06400"
FT                   /product="Predicted transcriptional regulator, BolA
FT                   superfamily"
FT                   /note="silverDB:HdN1F819"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44223"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD1"
FT                   /protein_id="CBL44223.1"
FT                   /translation="MDENLIKSRLQTGFPDAEVHVDLMGNKAQVVVVSDAFAGKRVVQK
FT                   QQMVYQQLNDLLASGELHAVSMQTLTPDEWAQKKKFGFL"
FT   CDS_pept        786630..787904
FT                   /transl_table=11
FT                   /gene="murA2"
FT                   /locus_tag="HDN1F_06410"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="silverDB:HdN1F821"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44224"
FT                   /db_xref="GOA:E1VHD2"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD2"
FT                   /protein_id="CBL44224.1"
FT                   /translation="MDKLLISGGNALSGEVRISGSKNSSLPILAGTLLVDGKAKVSNIP
FT                   HLHDVTTMIELLGQMGVDVVVDDHMVLEVDPRGLKDCTAPYELVKTMRASILVLGPLVA
FT                   RFGEAIVSLPGGCAIGSRPVDLHLKGLEAMGANINVANGYIHATVKGRLKGAHLMLDTV
FT                   TVTGTENLMMAASLANGRTIIENAAREPEIVDLANFINAMGGNVQGAGSDTLVIEGVER
FT                   LQSCEHTVIADRIETGTFLVAGAITSGLVKCRNTDPRMLDTTLIKLEEAGANISTGADW
FT                   IEIDMRNRRPRAVNIRTMPHPGFPTDMQAQFMALNTIAEGTSTITETIFENRFMHVSEL
FT                   ARMGADIHVEGNTAVVRGVESLTAAPVMATDLRASASLVIAALVAKGETLVDRIYHIDR
FT                   GYECIEEKLQSLGAKIHRIPSKRGS"
FT   CDS_pept        787915..788565
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="HDN1F_06420"
FT                   /product="ATP-phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="silverDB:HdN1F822"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44225"
FT                   /db_xref="GOA:E1VHD3"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD3"
FT                   /protein_id="CBL44225.1"
FT                   /translation="MSEKLTLALSKGRILKDTMPLLDAAGIRLLEDPERSRKLIFDTSH
FT                   PNVQIVIIRASDVPTFVEHGAADIGVAGKDVLMEHGAQGLYELLDLEIARCKLMVAAPV
FT                   NPPEVRGRLKVATKFLNITRDYYAAKGEQVELVKLYGSMELAPLVGLAHRIVDVVDTGN
FT                   TLRANGLEPIELIGHVTSRLVVNKASMKMKHSIIRPLIDQLGEAVAARRKGAA"
FT   CDS_pept        788583..789887
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="HDN1F_06430"
FT                   /product="Histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="silverDB:HdN1F824"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44226"
FT                   /db_xref="GOA:E1VHD4"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD4"
FT                   /protein_id="CBL44226.1"
FT                   /translation="MLNIARLDTRQADFNAKLSALLDWESVSDDRVQAAVSEIVKDVRK
FT                   RGDAALLEYTRRYDRVSADRVEDLTLMPSDLRPYVEQLPRQEREALEAAAARVREYHEH
FT                   QKAQSWRYTDSDGNVLGQQITPLDRVGIYVPGGKASYPSSVLMNAIPAKVAGVREIIMV
FT                   VPTPDGEKNAMVLAAAAIAGVDRVVTVGGAQAVAALAYGTDSVPQVDKIVGPGNIYVAT
FT                   AKRMVFGQVGIDMIAGPSEILVVCDGKTQADWIAMDLFSQAEHDEQAQAILISSDASFL
FT                   DEVHAAMERLLPSLERESIARISLEGRGALIQAHSQEEVIELINRIAPEHLELSIADPE
FT                   ALLPSIRHAGAIFMGRYTPEAIGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSLIAC
FT                   SAQGGQKLGRIASVLARGEQLTAHARSAEMRLKDV"
FT   CDS_pept        789954..791042
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="HDN1F_06440"
FT                   /product="Histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="silverDB:HdN1F825"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44227"
FT                   /db_xref="GOA:E1VHD5"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD5"
FT                   /protein_id="CBL44227.1"
FT                   /translation="MKTVKDWVKDLVRPEVMALSAYHVPETGRLLKLDAMENPWALPDA
FT                   LRAQWLQVLESVQINRYPNPAAPTVKAGLRKMMGLSSQYELLLGNGSDELIQLVAMALA
FT                   KPGASVLSVEPSFVMYKMIAQFLGLQYHGVALTEDFALDRETLLAAIKTHQPALVFLAQ
FT                   PNNPTGNLFDATIVEEIIAVTPGLVVVDEAYLAFTDSDALPLLDRHPNVLIMRTLSKVG
FT                   LAGLRLGILAGAPEWIREIDKLRLPYNINVLTQASAAFLLDHYDTFREQTARLRAARTD
FT                   LIQALRVLPLERVWPSEANFVLVRAPAGEARAVFEALKKSGVLIKCLDGAHPLLKDCLR
FT                   ITVGTPQENQQMLAALEKSLID"
FT   CDS_pept        complement(791055..792197)
FT                   /transl_table=11
FT                   /gene="algW"
FT                   /locus_tag="HDN1F_06450"
FT                   /product="HtrA-like protease AlgW"
FT                   /note="silverDB:HdN1F826"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44228"
FT                   /db_xref="GOA:E1VHD6"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD6"
FT                   /protein_id="CBL44228.1"
FT                   /translation="MNTFVRFLLPSVGVGLLVAALIIGLMKIGVIDSGGIVIFENAKPT
FT                   SDTSYAPRVSFADAVERAQPAVVNIYTSKIITRSAHPLYDDPIFRRFFGLNQAPQRRRM
FT                   QSSLGSGVIMSEAGYVLTNNHVIEGADEIRVALHDGRELLASVVGTDPETDLAVLSIES
FT                   RDLPSITMASSREVRVGDVVLAIGNPFGVGQTVTEGIVSALGRNQSNISNFVDFIQTDA
FT                   AINPGNSGGALVNAHGDLIGINTAIYSQTGASNGIGFAIPIDLAKTILMAIVKDGQVVR
FT                   GWLGIEPQIMTAALAELMHVEFTPGLLVAGVFRDGPAFRAGVRPGDIITQINGTEVTAP
FT                   RTAMNMISSLKPGEHVKLQAQRSNQTVQFSATVEARPDPN"
FT   CDS_pept        792259..793017
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06460"
FT                   /product="Protein of unknown function DUF34"
FT                   /note="silverDB:HdN1F827"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44229"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD7"
FT                   /protein_id="CBL44229.1"
FT                   /translation="MVQRAELEGELRRLLEPEQFKDYCPNGLQVEGRDEIEKIVTGVTA
FT                   CRDLILAAREKGADAILVHHGYFWRNENPCLTGMKYERIRLLMESQINLFAYHLPLDAH
FT                   PELGNNAQLAKRLGVQVEGGLEPRNERSVGNVGRLASPIKGQDFARIIEQRLKRKPLHI
FT                   AGTDKLIRRVAWCTGGAQNYIDLALDAGVDAFITGEASEQTVHIAREAGIHFFAAGHHA
FT                   TERYGVQAIGNYLAEKFHIRHEYIDIPNPV"
FT   CDS_pept        793136..794353
FT                   /transl_table=11
FT                   /gene="sat"
FT                   /locus_tag="HDN1F_06470"
FT                   /product="Sulfate adenylyltransferase"
FT                   /EC_number="2.7.7.4"
FT                   /note="silverDB:HdN1F829"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44230"
FT                   /db_xref="GOA:E1VHD8"
FT                   /db_xref="InterPro:IPR002650"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020792"
FT                   /db_xref="InterPro:IPR024951"
FT                   /db_xref="InterPro:IPR025980"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD8"
FT                   /protein_id="CBL44230.1"
FT                   /translation="MSSLVKPHGSDTLKILLLEGGALEQAQAHAKSLPQINLSSRETGD
FT                   LIMLGIGGFTPLDGFMGKADWQGVCDRMTLANGVFWPIPITKSVSQQEADKIALGSEIA
FT                   LVDGETGELMGSMLVTEKYGIDKAHECQSVFKTTSDEHPGVKMVMAQGDINLAGPVKVF
FT                   SQGEFPTKYAGIYKTPTETRALFESKGWKTVAAFQTRNPMHRSHEYLAKIAIEICDGVM
FT                   VHSLLGKLKPGDIPAEVRQKAIGTLIDKYFVKNTVVQSGYPLDMRYAGPREALLHALFR
FT                   QNYGCTHLIVGRDHAGVGDFYGPFDAHHIFDQIKPDALITKPLKIDWTFWCNKCGTMAS
FT                   TRTCPHDAEDRVLVSGTKLRKALSENQEVVPNFSRPEVLEVLREYYAGLADDEKVEIKL
FT                   TGHSAK"
FT   CDS_pept        complement(794452..794868)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06480"
FT                   /product="Heat shock protein, Hsp20 family"
FT                   /note="silverDB:HdN1F831"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44231"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHD9"
FT                   /protein_id="CBL44231.1"
FT                   /translation="MSIASMNPWQVLDQLQNEALRYYDNSARRWHPAVDIVDTEVGYQL
FT                   LLDLPGIDANDITIDVEKGVLRIQGQRQRNAEDQAKLRYKERAFGQFNRSFKLPEDADH
FT                   SAVSAHYEKGVLTVDIARKATAAPRKISIDVRGG"
FT   CDS_pept        complement(795092..795550)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06490"
FT                   /product="Protein of unknown function DUF1043"
FT                   /note="silverDB:HdN1F832"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44232"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE0"
FT                   /protein_id="CBL44232.1"
FT                   /translation="MLEVVLFLIGVAVGAGSCFAVMRRGRNGNPIEQQLRDLQEEFTAY
FT                   RENVNQHFNHTAELVNNLTANYVKVQKHLESASVSFAEPPKSFKLETSTSLAAPAQQFI
FT                   AIETREPPSRDASFEDEHVQPPLDYAPKKGSRDKGTLAEDFGLGHTQK"
FT   CDS_pept        795859..796524
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06500"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F833"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44233"
FT                   /db_xref="GOA:E1VHE1"
FT                   /db_xref="InterPro:IPR000383"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE1"
FT                   /protein_id="CBL44233.1"
FT                   /translation="MSLIPGSATSASGEARALIEGPAGAIDAIVMQPKEGEAAALAVIC
FT                   HPHPLMGGSMTNKVVHTIARAHRDAGHVAVRFNFRGVGRSQGEFDEGRGEALDLLAVVR
FT                   WARALYPRGALYIAGFSFGAWVSASAMPLLDAANLGVKRLLLVAPPVHYAGFDPIHRFS
FT                   CPLTVIMGDADEVVAPVGVFGWFERVETDKKLRKMSEATHFFHGRLQELKEWVEQDMA"
FT   CDS_pept        796603..797697
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06510"
FT                   /product="predicted AFG1-like ATPase"
FT                   /note="silverDB:HdN1F834"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44234"
FT                   /db_xref="GOA:E1VHE2"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030870"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE2"
FT                   /protein_id="CBL44234.1"
FT                   /translation="MGPLEHYRQDLQKPGFRYDPAQEGAVKHLQRLYDDLLMRRNQPAP
FT                   TRWERLRGKVERVPVKGVYFWGGVGRGKTYLVDTFYETLPFARKMRVHFHRFMRRVHSE
FT                   LKLLQGEKNPLEKVAQKLAAEAEVICFDEFFVTDITDAMILGGLFEKLFGLGVTLVATS
FT                   NIVPDELYKDGLQRSRFIPAIEQLKRHTEVVNVDSGVDYRLRSLTQAAVFHTPLSADTD
FT                   QCMLACFDRLAQGHSRQQYCNIEINGRPIAARIVADGILWCDFDALCDGPRSQYDYIEI
FT                   ACRYPAVLVSLVPIMRAGGDDQARRFINMVDEFYDRNVKLILSAEAPIESLYESGRLQF
FT                   EFARTRSRLLEMQSQEYLGREHRP"
FT   CDS_pept        798001..798432
FT                   /transl_table=11
FT                   /gene="rplM"
FT                   /locus_tag="HDN1F_06520"
FT                   /product="ribosomal protein L13"
FT                   /note="silverDB:HdN1F837"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44235"
FT                   /db_xref="GOA:E1VHE3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE3"
FT                   /protein_id="CBL44235.1"
FT                   /translation="MKTTVSAKPATVQRDWYVVDAAGKTLGRIATEIALRLRGKHKPIY
FT                   TPHVDTGDFIIVINAEKVDVTGKKREGKVYFHHTLYPGGLKSISFDKLIQKKPEQVIER
FT                   AVKGMLPHNVLGREMFRKLKVYAGSEHPHAAQQPKVLEL"
FT   CDS_pept        798513..798899
FT                   /transl_table=11
FT                   /gene="rpsI"
FT                   /locus_tag="HDN1F_06530"
FT                   /product="30S ribosomal protein S9"
FT                   /note="silverDB:HdN1F838"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44236"
FT                   /db_xref="GOA:E1VHE4"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE4"
FT                   /protein_id="CBL44236.1"
FT                   /translation="MENNYGTGRRKTSSARVFLRPGTGNININGRAIDQYFGRETARMV
FT                   VRQPLQLVELGDKFDVLVTVSGGGISGQAGAIRHGIARALIEYDETLRLPLRRAGFVTR
FT                   DARAVERKKVGLRKARRRPQYSKR"
FT   CDS_pept        799139..799747
FT                   /transl_table=11
FT                   /gene="petA"
FT                   /locus_tag="HDN1F_06540"
FT                   /product="ubiquinol-cytochrome C reductase iron-sulfur
FT                   subunit"
FT                   /note="silverDB:HdN1F839"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44237"
FT                   /db_xref="GOA:E1VHE5"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE5"
FT                   /protein_id="CBL44237.1"
FT                   /translation="MSTEGVNQGRRLFLVGATSVVGAAGAVGAAVPFVQSWWPSAKAKS
FT                   AGAPVVADISKLEMGQRMIVEWRGRPIWILRRTPEAMASLKAIAAEGALRDPESQETSQ
FT                   QPAYAENETRSRKEHPEIAVIIGICTHLGCSPLYRPDVAPADLGADWKGGFFCPCHGSK
FT                   FDLAGRVFKSVPAPTNLQIPPFYFMSDNVIKIGEDGAAA"
FT   CDS_pept        799753..800997
FT                   /transl_table=11
FT                   /gene="petB"
FT                   /locus_tag="HDN1F_06550"
FT                   /product="ubiquinol-cytochrome c reductase, cytochrome b"
FT                   /note="silverDB:HdN1F840"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44238"
FT                   /db_xref="GOA:E1VHE6"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE6"
FT                   /protein_id="CBL44238.1"
FT                   /translation="MLQNLMGWVDARFPATKMFEDHMSKYYAPKNFNFWYFFGSLAMLV
FT                   LVNQLATGIWLTMSYNPSAEGAFDSVEYIMRDVEWGWLLRYMHSTGASAFFVVVYLHMF
FT                   RGMMYGSYRKPRELVWIFGMTIYLALMAEGFMGYLLPWGQMSYWGAQVIISLFGAIPVI
FT                   GDPLMEWIRGDFLLSGITLNRFFALHVCAIPIVLLALVVLHIIALHEVGSNNPDGIEIK
FT                   KKKDANGIPLDGIPFHPYYSIHDLVGVVVFLFVFCLIIFFFPDGGGYFLEKPNFEPANN
FT                   LKTPAHIAPVWYYTPFYAILRAIPNKLGGVIAMGGAIAVLFVLPWLDRSPVKSIRYKGW
FT                   MSKVALALFVVSFILLGICGVKSPDLHVEFLPFLQYRDLGQICTVIYFGYFFLMPVFTS
FT                   IEKTKPEPERVRMSH"
FT   CDS_pept        800997..801653
FT                   /transl_table=11
FT                   /gene="petC"
FT                   /locus_tag="HDN1F_06560"
FT                   /product="ubiquinol-cytochrome c reductase cytochrome c1
FT                   subunit"
FT                   /note="silverDB:HdN1F841"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44239"
FT                   /db_xref="GOA:E1VHE7"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE7"
FT                   /protein_id="CBL44239.1"
FT                   /translation="MKKLIALMAALLLLPVVAFAISAELKLEPAPINLDDKVSLQRGVQ
FT                   LFVNNCMGCHSAKYVRYERMADDLGIPHDVALKNLVFTTDKIGDPMLAAMPHDLAKKWF
FT                   GTAPPDLSLAARVRGADWVYGYLTGFYADEKRPFKFNNHVFPDVGMPHVLQHLEASVSK
FT                   EEFKSQMADLTNFMVYMAEPIRAERERLGFWVLGFIIILGIPVYFLNREYWKDVH"
FT   CDS_pept        801870..802361
FT                   /transl_table=11
FT                   /gene="sspB"
FT                   /locus_tag="HDN1F_06570"
FT                   /product="Stringent starvation protein B"
FT                   /note="silverDB:HdN1F844"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44240"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE8"
FT                   /protein_id="CBL44240.1"
FT                   /translation="MTSMRPYFVRAIYEWILDNQFTPYLLVNAMLPSVQVPTEHVRDGR
FT                   IILNLAPSAIRGLVMDNDRVEFSARFGGVARTLYLPISAVLAIYAKENGRGMFFDENEM
FT                   SSEGVEPSAVPAKMDDKPHGVLAPVAHTEAPHGSDVPPSDTPTKGGKGAKKRPSLKVVK
FT                   "
FT   CDS_pept        complement(802368..802922)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06580"
FT                   /product="Transport-associated protein"
FT                   /note="silverDB:HdN1F845"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44241"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHE9"
FT                   /protein_id="CBL44241.1"
FT                   /translation="MASWSGPGVTDEDPGTRTVGMVVEDTNIETKVSGNLLKVDPRFRE
FT                   NPIQVTSYNGIVLLTGRVPDQETSDRAASIAKRMRGVRGVHNMLEVAPPIRWQNETNDN
FT                   WILSKVKAVLYSTLDFPASRVKVVTENGTVYLMGLVTESEGEDTVNLIRNVKGIQRIVK
FT                   IFEYIPQRPQSAAAETYPGTI"
FT   CDS_pept        complement(803024..803617)
FT                   /transl_table=11
FT                   /gene="gmhA"
FT                   /locus_tag="HDN1F_06590"
FT                   /product="Phosphoheptose isomerase"
FT                   /note="silverDB:HdN1F847"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44242"
FT                   /db_xref="GOA:E1VHF0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF0"
FT                   /protein_id="CBL44242.1"
FT                   /translation="MNIVERVLAQFDAGIENLTQTRDALAVSVAMASETLVNTLLNNGK
FT                   ILCCGNGAGAGIVQHFAACMLNRYERERPALPVIALSADTTTITAIACDFGYSEIFSKQ
FT                   IRALGHAGDTLLVISASGQTGNIVQAVQAAHDREMNVIALTGGDGGDITRLLLDDDVEL
FT                   RVPSETLAAIQEMHLFAIHLLCDLIDNQLFGMAD"
FT   CDS_pept        803852..804961
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06600"
FT                   /product="hypothetical protein"
FT                   /note="silverDB:HdN1F849"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44243"
FT                   /db_xref="GOA:E1VHF1"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF1"
FT                   /protein_id="CBL44243.1"
FT                   /translation="MWFLLGIVSLTGFALFFVRWRAANRWKGTQRQLLGQVYESALLKS
FT                   KNRTKGVLIGLTCNTALEFCLKQETFVDRIFKRLGLSQEQQLNHLHFDEKVYIVSDNPR
FT                   LGALLKGQPDLPAVLENLFEPNRFKLGVVCKLWCQQRRLWVQCKTDEDFDVGDIEALAK
FT                   EVLPVLVKVHDALLATSEVNERGQDYFIPKALVLLGVSSALLVNGVIQSVRVLLLKFPV
FT                   QLESLALLKMALMLGGIMTAALILWCVIWLGRTSRTHLVLMEILLVGSFGSVLTAATEL
FT                   RDYNIEFDHSRVRYESVQVVQYYTTRCGKRNRSTCYNVKLAPFVGKAGGLKLSLSYDAY
FT                   NQLKNHPFLVLPVHEGALGVPWIEAPRAP"
FT   CDS_pept        complement(805034..805435)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06610"
FT                   /product="conserved hypothetical protein"
FT                   /note="silverDB:HdN1F851"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44244"
FT                   /db_xref="GOA:E1VHF2"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF2"
FT                   /protein_id="CBL44244.1"
FT                   /translation="MSTPTAPARRTSVKRSPKQAAGHHAEVLAYRYLKAHGLSFIRANY
FT                   SCKSGEIDLIMAHGDTVVFVEVKARTNSTHGSAIETITPSKQRRLTRAAQHFIQRHDPR
FT                   LQHAYRFDVVAIQGSPNDNPEIQWIVSAF"
FT   CDS_pept        complement(805486..807279)
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06620"
FT                   /product="LppC putative lipoprotein"
FT                   /note="silverDB:HdN1F852"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44245"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF3"
FT                   /protein_id="CBL44245.1"
FT                   /translation="MSAAAQTAADARKLTSPERELQLIAAIHLYLQDNDVNSAQNLLKE
FT                   ISLANLPASTRAEAGIASAEISARKGRHQAVLSILSNKRYGIGSHLLELPVSSQNRVGI
FT                   LRAEAFENLGDYLTAANERIFVGPMLPTAAHAANNDQIWADLAQYPPETLTKLAQETRS
FT                   PDTAGWLSLISIYKQHQDDIDEQITALQNWTKRHPSHPASLSEPRALTQLKQLAARQPR
FT                   QVALLLPRSGPWQAVAEAIERGFMTAYFQALKTRKNKTTATEIKIYDEASGDDFDAAYQ
FT                   QAVSDGADMIVGPLSKENVRRLYQRGDQLPVPTLTLNTSDLLLKAPNQLYQFGLSPEDD
FT                   ARSVALFAAAKGYQNAAILLQDSGEWGLRIQRAFTQQWEELGKTVLDTAQFKQVTEIES
FT                   AVTTLLKPEGSLQRARQLAEATQETFISEPTPRTDLDFVFLITPGAQAQQVKPWFNFLH
FT                   ATQLPLLGGSYLYSGIDNREANQNLNGITFCDIPWVLGSPSPTRRIFSQNWPQANPRMT
FT                   RLNALGVDAFRLATRLQVMSELPDTRLFGATGVIQLNANGQITRKLNWARFEGGQAIPL
FT                   NDLPLSQHPAPPNAQLLSQAP"
FT   CDS_pept        807559..808404
FT                   /transl_table=11
FT                   /locus_tag="HDN1F_06630"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="silverDB:HdN1F853"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44246"
FT                   /db_xref="GOA:E1VHF4"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF4"
FT                   /protein_id="CBL44246.1"
FT                   /translation="MATPIGNLDDSTIRAIEVLKQVDLVAAEDTRHSQYLLSHFGIRKP
FT                   MLSLHDHNEEARIVVVCAALAEGRSIALISDAGTPLISDPGFRVVRAVRAAGFRVVPIP
FT                   GACAAIVALSSSGLPSDRFLFVGFAPARSQARKTLFEEYVRRPETLIFYESPRRVADFF
FT                   EDAEAVFGGQRRACIAKELTKLHERIVDGTLSEIKRLLMEPAMQRGEFVIVMGGYEKPA
FT                   RDGVDEALGAAAGLVDLDQALRTVNRYLPPKQACALVADLYAVDKKALYQRWVDRNSGA
FT                   "
FT   CDS_pept        809312..809770
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="HDN1F_06640"
FT                   /product="Protein mraZ"
FT                   /note="silverDB:HdN1F856"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44247"
FT                   /db_xref="GOA:E1VHF5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF5"
FT                   /protein_id="CBL44247.1"
FT                   /translation="MFRGLTSINMDPKGRMALPTRYRDAVVERCSGGMIATIDTEEKCL
FT                   LLYPLPDWQEIERKIEALPSFNKAARRVQRLLIGHASEVELDSAGRIMIPQVLREYAGL
FT                   DKRILLVGQGKKFEIWSEDAWNAKRDEWLDEESQADEGLPEMMQNLSL"
FT   CDS_pept        809818..810750
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="HDN1F_06650"
FT                   /product="Methyltransferase involved in cell envelope
FT                   biogenesis"
FT                   /EC_number="2.1.1.-"
FT                   /note="silverDB:HdN1F858"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44248"
FT                   /db_xref="GOA:E1VHF6"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF6"
FT                   /protein_id="CBL44248.1"
FT                   /translation="MLEVSHRPVLLQEVIENLLTDTAGIYVDGTFGRGGHARALLARLS
FT                   ADARLVGFDKDPEAIAVGLQLAAEDARFSIVHGSFAEIGTRPELAGLQGTVSGVLLDLG
FT                   VSSPQLDDASRGFSFMNDGPLDMRMNNDAGESAADWLNHEDAKQIEWVLRELGEERFAG
FT                   RIARAIVAQREMSPLCTTKQLADLIYKAVPVREKHKHPATRSFQAVRIWVNRELQDLEV
FT                   GLAASLELVKVGGRIAVISFHSLEDRIVKQFFEKHVKGEQLPRGLPVTGAALGIRLRHV
FT                   AKKVRPSDDEVAVNVRSRSATLRVVEKIA"
FT   CDS_pept        810747..811043
FT                   /transl_table=11
FT                   /gene="ftsL"
FT                   /locus_tag="HDN1F_06660"
FT                   /product="Cell division protein"
FT                   /note="silverDB:HdN1F859"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44249"
FT                   /db_xref="GOA:E1VHF7"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF7"
FT                   /protein_id="CBL44249.1"
FT                   /translation="MSVFRPVSVGREILYLLVVPALLVVCSALGVIYSSFMTRQLVTEF
FT                   QQLHEQRNAFQDEWGQLLLEQSTLGAFSRVEQLARKDLKMSVPSPEQTVMIDL"
FT   CDS_pept        811067..812779
FT                   /transl_table=11
FT                   /gene="ftsI"
FT                   /locus_tag="HDN1F_06670"
FT                   /product="Cell division protein FtsI/penicillin-binding
FT                   protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="silverDB:HdN1F861"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44250"
FT                   /db_xref="GOA:E1VHF8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF8"
FT                   /protein_id="CBL44250.1"
FT                   /translation="MRDYRWRFYVAALLLCTLSTSVFFRIAYLQLWNRDFLQDEGAKRV
FT                   VRTATIPAYRGMIQDRNGEPLAVSTPVTTIWANPKQLWDERDRWPELAKALGEKSSSLS
FT                   KHLTAMKDKQFMYLKRHMNPVKAAAVLNMDISGVYGLSEYRRFYPAGEVTSHIVGFNNI
FT                   DDQGQEGIELAFEDTLRGEPGKKRVIKDLKGRIVKDIGLIENAKPGRDVMLSIDLRAQY
FT                   IAYRELLAAVHAYQATAGVAVAVDVRTGEIVAMANQPSFNPNNRKPKDQDGFRNRAITD
FT                   VFEPGSTMKVFTAAAGLESGRWKPSSLIDTTPGALRIGRKTIRDTHNYGLIDLTHMITK
FT                   SSNVGATKVALSLKDGTLPTMLHRVGFGEKTGVGIQGEVSGVLPLRPSYGKERWGELET
FT                   ATMSYGYGVSVTAAQLARAYAILGAHGIKRPLSIVKTSGDVKGERVFSEGVAENVIKMM
FT                   ETVVSKEGTAQRAAVDGYRVGGKTGTVHKAAGGKYEARRYLGLFAGVAPAEDPRLALVI
FT                   MIDDPKGKEYYGGQVAGPVFSRIMAGMLRIKNVPPDLPVQEWANIVPKGNGKS"
FT   CDS_pept        812776..815700
FT                   /transl_table=11
FT                   /gene="murE"
FT                   /locus_tag="HDN1F_06680"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate
FT                   ligase"
FT                   /EC_number="6.3.2.13"
FT                   /note="silverDB:HdN1F862"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44251"
FT                   /db_xref="GOA:E1VHF9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHF9"
FT                   /protein_id="CBL44251.1"
FT                   /translation="MSARSREKRLGDLLAVEAEFADVMVSGLQQDSRKVQHGDLFVALK
FT                   GHHVDGRDYIKDALKRGASAVLADRVGVSAEQVVNAHGNVIWRDDLRSELGDIASRFYD
FT                   EPSKQMRVIAVTGTNGKTTVSHLLVRLLMRLGESAKTIGTLGYGHPDHLIPLANTTPDA
FT                   IQLHEILAACREDGARFVAMEASSHGLDQGRLGCVEISTAVFTNITRDHLDYHQTMQAY
FT                   WEAKAKLASWHGLRNLVLNADDAGVAKMAAVAEHGVKIVWFSLRADANVDVALVRCLYH
FT                   PRGMSLDIRVKDEVYSFDTRLMGEFNVANILAVLAALVSEGFSASLVVDALKEIAPVKG
FT                   RMDCLPHTSGAQLPAVVIDYAHTPDALQQALNALRHHCTTGKLWCVFGCGGDRDKGKRP
FT                   LMGKIAASSADRVVVTSDNPRSEVPDVIIAEIRGGMEATDQVRLVTDRGEAIRDAIFLA
FT                   APEDVILIAGKGHEDYQEVRGVRSHFSDHEVAAAALLQRAQLSDSLPKGCGSVSERNQQ
FT                   ECTLASLAERLGGELRGEDLPFAGVSTDTRALKSMDVFFALVGEKFDAHDFLQQAKVAG
FT                   ACGAVVSRWVDVDLPQIKVEDTRLALGAWAGMFRDRFHPRVVAVTGSSGKTSVKEMLAA
FT                   IFSEEGRVLATSGNLNNDIGVPLTLLRLDDSYQFAVIELGANHVGEIAYTVGLVRPDAA
FT                   LITNVGEAHLEGFGSRNNIAKAKSEIYTGLVPKGVAVVNLDDDYSQDFLTLNASRNVLT
FT                   FSIENTRANCFAKSWSLDPVGRPRIEVSINGELIQLSLNLIGKHQIANALAAAAAARAA
FT                   GASLTSIRDGLNKLQPFKGRMFPKSLGRWHWIDDTYNANPSSMRAAIDALARLDEPKVL
FT                   ILGRMGELGEQSAKLHADIGAYAARAGIRRLFISRDDAGDYARGYRSVTNDGQLFVGDG
FT                   PEAIAKQLIESMPEGVVLVKGSRSAAMEKVFDEAQKRLLHEENH"
FT   CDS_pept        815700..816782
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="HDN1F_06690"
FT                   /product="Phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="silverDB:HdN1F863"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44252"
FT                   /db_xref="GOA:E1VHG0"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHG0"
FT                   /protein_id="CBL44252.1"
FT                   /translation="MLVWLAQLLGQHFTFFNVFQYLTLRAILGVLTALGIALWLGPKMI
FT                   RSLSLHQIGQAVRDDGPKSHLSKSGTPTMGGALILVAIAIATLLWSDLSNRYVWVVLII
FT                   TLSFGAVGWVDDYRKVVQKNSRGLPARWKYFWQSLVGIVAAIYLYASASSPSETQLLLP
FT                   FFKNVQVEIGVLYIALAYFVIVGTSNAVNLTDGLDGLAILPTILVGAALGVFAYVTGNV
FT                   KFASYLQFPYIAGTGELIVLCGALFGAGLGFLWFNTYPAQVFMGDVGALALGGTLGALA
FT                   VITRQEIVLFIMGGVFVMETVSVILQVASFKLTGRRIFRMAPIHHHFELKGWAEPKVIV
FT                   RFWIITVVLVLLGLATLKLR"
FT   CDS_pept        816792..818120
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="HDN1F_06700"
FT                   /product="UDP-N-acetylmuramoylalanine-D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="silverDB:HdN1F864"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44253"
FT                   /db_xref="GOA:E1VHG1"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHG1"
FT                   /protein_id="CBL44253.1"
FT                   /translation="MRIVVGLGKTGLSCIRSLHAAGERVCVMDTRDEPPGLDQVLDQFP
FT                   DVRLSLGGLDEDLLCGAEEIIVSPGISTATAPLQKAVARGIPVVGDIELFCREVKTPIL
FT                   AITGSNAKSTVTTLMGEMVKGSGRSVVVGGNIGVPVLDVLQEAQSAEFCVLELSSFQLE
FT                   TTYSLRAHVATILNISPDHLDRYPSMKEYTAAKHRIYRNARHTVANADDSATLPHPMFT
FT                   EHDWRFTTRSPSARTFGLQLNESASWLGVANEALMPVSELRIKGRHNQANALAALAIGS
FT                   AAGLEMQHMLNTLREFRGLAHRCEWIRERDGVQWYNDSKGTNVGATVAAIDGIGSEISG
FT                   KIVLVAGGDGKGADFVELQKPVEKYVKAAVLLGQDAAKMERVLAPHCTIKRVSSLQDAV
FT                   GAAAELALAGDAVLLSPACASLDMFKNYEDRGNQFADLARALS"
FT   CDS_pept        818117..819319
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="HDN1F_06710"
FT                   /product="Cell division protein FtsW"
FT                   /note="silverDB:HdN1F865"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44254"
FT                   /db_xref="GOA:E1VHG2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHG2"
FT                   /protein_id="CBL44254.1"
FT                   /translation="MTLETILNPERQPVSPGYMRIVLLATLFLASTGFVIVSSASMDVA
FT                   LRTYGTEFYFVLRHLSYLGLATLFGALFFQIRMETWQRYGGVLLVFSYVLLVLVLLPGI
FT                   GRTVNGSTRWIPLGIISVQVSEIAKIGVLCYVAGYLVRRNDEVRTTFVGFIKPVAVLSL
FT                   MVMLLLAEPDFGAVVVIMGTVFVLLFLAGVRFLQFALVLAGSGGMAALMIFSSEYRMKR
FT                   MLAYVNPWDRATDDGYQLVQSLIAFGRGEIFGVGLGNSVQKLFYLPEAHTDFVFAILAE
FT                   EFGLVGCTVVILAFLALVLSGMFIGRRAERMGQTFSAYLAYGISIMLGLQSCINIGVVS
FT                   GMLPTKGLTLPLISYGGSSLIVSGILVALLLRVDYEMRNLLTTDPAVRRKLSGMEKKNG
FT                   R"
FT   CDS_pept        819330..820427
FT                   /transl_table=11
FT                   /gene="murG"
FT                   /locus_tag="HDN1F_06720"
FT                   /product="UDP-N-acetylglucosamine-N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number="2.4.1.227"
FT                   /note="silverDB:HdN1F866"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44255"
FT                   /db_xref="GOA:E1VHG3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHG3"
FT                   /protein_id="CBL44255.1"
FT                   /translation="MEEIGKAGIARVLIMAGGTGGHVFPALAAARYLEKQGATVQWLGT
FT                   RAGIESRVVPEAGIAIHYLDVAGVRGQGVVRLLKAPFKILRAVLSVMGILRKFRPDFVL
FT                   GLGGFVTGPGGVAARLAGTPLFIHEQNAIPGFTNRMLSKISSRTFQAFPNAFSENVRAV
FT                   TTGNPVRAEIAAIADPELRWQGRTGPIRLLVVGGSQGAVALNQLLPRAFPLLAHQDFEI
FT                   FHQAGQHNAEATEMLYREAGVQATVVPFINDMAERYAWADFVICRSGALTVSEIAAVGI
FT                   GALLIPYPFAVDDHQTKNAEFLVNGHAAHLAQQNVLTPALLAELITKHFSSRAALKTMA
FT                   IASRKLAKPEATQELIDACKEALRG"
FT   CDS_pept        820420..821862
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="HDN1F_06730"
FT                   /product="UDP-N-acetylmuramate-L-alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="silverDB:HdN1F869"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44256"
FT                   /db_xref="GOA:E1VHG4"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHG4"
FT                   /protein_id="CBL44256.1"
FT                   /translation="MAESKRRSRTIEIPEMRRIRRIHFVGIGGAGMCGIAEVLLNQGYL
FT                   ISGSDQKVSANTERLKAQGAVIHIGHAAKNVDGTDVIVVSTAIDSANPELDAARERRIP
FT                   VVPRAEMLGELMRYRYGIAVAGTHGKTTTTSLIASILAEGGSDPTFVIGGRLNSAGTNA
FT                   KLGTGRFLVAEADESDASFLHLQPMVSVVTNIDFDHMSTYNGDFNRLKETFLRFLHNLP
FT                   FYGLAVLCVDDPTIREILPQISRPVVTYGIDHEADIQAVDIQNVGLQSTYRVLRRDAES
FT                   LSITLNIPGRHNVLNSLAAIAVASDENIAGDAIARALEKFQGVGRRFQIQGEIPIMGGT
FT                   VTLVDDYGHHPREVAATIAAVRQSWPSRRLVMIYQPHRYSRTRDLYEDFVQVLSDVDVL
FT                   LLMEVYSAGEEPIAGADSRSLCRSIRMRGAVEPIFIEEPSVLPSVLEKHLLNGDVVLTQ
FT                   GAGNVGAISLQLAKSQFKEIGS"
FT   CDS_pept        822320..823132
FT                   /transl_table=11
FT                   /gene="ftsQ"
FT                   /locus_tag="HDN1F_06740"
FT                   /product="Cell division protein FtsQ"
FT                   /note="silverDB:HdN1F871"
FT                   /db_xref="EnsemblGenomes-Gn:HDN1F_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBL44257"
FT                   /db_xref="GOA:E1VHG5"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E1VHG5"
FT                   /protein_id="CBL44257.1"
FT                   /translation="MRQREKYRVRPQATRQLPPDQETVKTPAPLWRWIKMTSITVAVTG
FT                   AALLGGLKGYDALQQVGEEYPIRTVKVYGDFVHIQPDHLKALLKPALFENFFQLDLAQV
FT                   RADVQAMPWVEKAFLRKEWPDILVVKIDERTPVAHWDDHRLLGSDLSLFDQGEVHDLPD
FT                   LPKLRGVERDIPVVWSRYQKLSEMLAPLSLTISEVIMAERYSWRVLLSDGMELVVDEKD
FT                   WDQKMARFIKFYKKIPESERALLVRADLRYDNGLAVKWKKKDDNPSAA"
FT   CDS_pept        823164..824429
FT                   /transl_table=11
FT