(data stored in SCRATCH9089 zone)

EMBL: FQ670178

ID   FQ670178; SV 1; circular; genomic DNA; STD; PRO; 1985832 BP.
XX
AC   FQ670178;
XX
PR   Project:PRJNA50729;
XX
DT   16-DEC-2010 (Rel. 107, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 7)
XX
DE   Haemophilus influenzae F3031 complete genome
XX
KW   complete genome.
XX
OS   Haemophilus influenzae F3031
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Haemophilus.
XX
RN   [1]
RX   DOI; 10.3201/eid1803.110728.
RX   PUBMED; 22377449.
RA   Strouts F.R., Power P., Croucher N.J., Corton N., van Tonder A.,
RA   Quail M.A., Langford P.R., Hudson M.J., Parkhill J., Kroll J.S.,
RA   Bentley S.D.;
RT   "Lineage-specific Virulence Determinants of Haemophilus influenzae Biogroup
RT   aegyptius";
RL   Emerg. Infect. Dis. 18(3):449-457(2012).
XX
RN   [2]
RA   Aslett M.;
RT   ;
RL   Submitted (14-DEC-2010) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; efdb9829c4dbfc3ee39b0c79e4e73ccf.
DR   BioSample; SAMEA3138342.
DR   EuropePMC; PMC3309571; 22377449.
DR   EuropePMC; PMC4323322; 25763053.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00632; sxy.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; FQ670178.
DR   SILVA-SSU; FQ670178.
XX
CC   Data release policy http://www.sanger.ac.uk/legal/#t_2
CC   DNA source: unknown
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1985832
FT                   /organism="Haemophilus influenzae F3031"
FT                   /strain="F3031"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:866630"
FT   CDS_pept        2..1021
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00010"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="GOA:E7A7P3"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7P3"
FT                   /protein_id="CBY80271.1"
FT                   /translation="MAIKIGINGFGRIGRIVFRAAQHRDDIEVVGINDLIDVEYMAYML
FT                   KYDSTHGRFDGTVEVKDGNLVVNGKTIRVTAERDPANLNWGAIGVDIAVEATGLFLTDE
FT                   TARKHITAGAKKVVLTGPSKDATPMFVRGVNFNAYAGQDIVSNASCTTNCLAPLARVVH
FT                   ETFGIKDGLMTTVHATTATQKTVDAPSAKDWRGGRGASQNIIPSSTGAAKAVGKVLPAL
FT                   NGKLTGMAFRVPTPNVSVVDLTVNLEKPASYDAIKQAIKDAAEGKTFNGELKGVLGYTE
FT                   DAVVSTDFNGCALTSVFDADAGIALTDSFVKLVSWYDNETGYSNKVLDLVAHIYNYKG"
FT   CDS_pept        1215..3014
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00020"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="GOA:E7A7P4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7P4"
FT                   /protein_id="CBY80272.1"
FT                   /translation="MNLDLHFVHRIQQQAKTRANMTALRYKEHGLWRDISWKNFQEQLN
FT                   QLSRALLAHNIDVQDKIAIFAHNMERWTIADIAILQIRAITVPIYATNTAQQAEFILNH
FT                   ADVKILFVGDQEQYDQALEIAHHCPKLQKIVAMKSTIQLQQDPLSCTWESFIKTGSNAQ
FT                   QDELTQRLNQKQLSDLFTIIYTSGTTGKPKGVMLDYANLAHQLETHDLSLNVTDQDISL
FT                   SFLPFSHIFERAWAAYILHRGAILCYLEDTNQVRSALTEIRPTLMCAVPRFYEKIYAAV
FT                   LDKVQKAPKLRQIMFHWAISVGQKHFDLRANNKAIPFLLKKQFALADKLVLSKLRQLLG
FT                   GRIKMMPCGGAKLEPAIGLFFHAIGINIKLGYGMTETTATVSCWHDFQFNPNSIGTLMP
FT                   KAEVKIGENNEILVRGGMVMKGYYKKPEETAQAFTEDGFLKTGDAGEFDEQGNLFITDR
FT                   IKELMKTSNGKYIAPQYIESKIGKDKFIEQIAIIADAKKYVSALIVPCFDSLEEYAKQL
FT                   NIKYHDRLELLKNSDILKMFEQRINAVQKELAHFEQVKKFTLLSQAFSIKLGEITPTLK
FT                   LRRKVILERYRKQIEAMYHSQEA"
FT   CDS_pept        complement(3050..3835)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00030"
FT                   /product="predicted hydrolase"
FT                   /db_xref="GOA:E7A7P5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7P5"
FT                   /protein_id="CBY80273.1"
FT                   /translation="MYKAVFSDFDGTLLTSQHTISPRTVAVIKRLTANGIPFVPISARS
FT                   PLGILPYWKQLETNNVLVAFSGALILNQHLEPIYSVQIEPKDILEINTVLAEHPLLGVN
FT                   YYTNNDCHARDVENKWVIYECSVTKIEIHPFDEVATSSPHKIQIIGEAEEIIEIEVLLK
FT                   KKFPHLSICRSHANFLEVMHKSATKGSAVRFLEDYFGVQTNEVIAFGDNFNDLDMLEHA
FT                   GLGVAMGNAPDEIKQAANVVTTTNNEDGLALILEEKFPE"
FT   CDS_pept        complement(3854..4318)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00040"
FT                   /product="conserved protein"
FT                   /db_xref="GOA:E7A7P6"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7P6"
FT                   /protein_id="CBY80274.1"
FT                   /translation="MGSVLVDLQIATENIEGLPTEEQIVQWATGAVQPEGNEVEMTVRI
FT                   VDEAESHELNLTYRGKDRPTNVLSFPFECPDEVELPLLGDLVICRQVVEREAAEQEKPL
FT                   MAHWAHMVVHGSLHLLGYDHIEDDEAEEMESLETQIMQGLGFDDPYLAEK"
FT   CDS_pept        complement(4579..5391)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00050"
FT                   /product="formate dehydrogenase formation protein"
FT                   /db_xref="GOA:E7A7P7"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7P7"
FT                   /protein_id="CBY80275.1"
FT                   /translation="MQCWIRQTINFFRKTKNTEKLTALLQQKEDILAVEIPVSLVYNGI
FT                   SHAVMMCSPNNLEDFALGFSLTEGIINKPEDIYGIDVVEVCNGIEVQIELSSRKFMALK
FT                   EHRRNLTGRTGCGICGTEQLNQVYKTFPKLDCTFQFDLNLLDSCLIDLQKNQLLGCKTG
FT                   ATHACAFFDLYGSMLAIYEDVGRHVALDKLLGWHAKSGKPRGFILASSRASYEMVQKTV
FT                   ACGVEMLVTISAATDLAVTMAEKHNLTLIGFAREGKGNIYSGHLRLHN"
FT   CDS_pept        5662..9011
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00060"
FT                   /product="formate dehydrogenase-N, alpha
FT                   subunit,nitrate-inducible"
FT   repeat_region   8816..8825
FT                   /note="AT x5"
FT   CDS_pept        join(9082..9279,9282..9986)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00080"
FT                   /product="Formate dehydrogenase accessory protein FdhE"
FT   CDS_pept        complement(10028..10468)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00100"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="GOA:E7A7P8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7P8"
FT                   /protein_id="CBY80278.1"
FT                   /translation="MSIISQIEACDFERLYEIEQQAHLVPWSLGTLKNNQGERYLNLKL
FT                   IENNQIIGFAICQTVLDEATLFNIAILPTYQGCGFGKLLLGKLIFQLKEKGVQTLWLEV
FT                   RESNPARFLYEKIGFNEVDIRKNYYPKPSGGRENAVVMACYL"
FT   CDS_pept        complement(10471..10875)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00110"
FT                   /product="DNA polymerase III, psi subunit"
FT                   /db_xref="GOA:E7A7P9"
FT                   /db_xref="InterPro:IPR004615"
FT                   /db_xref="InterPro:IPR018382"
FT                   /db_xref="InterPro:IPR036654"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7P9"
FT                   /protein_id="CBY80279.1"
FT                   /translation="MNRRDLLLQEMGISQWELYRPEVLQGSVGISVAENIRFITVSDEN
FT                   ISSSPLLADVLLSLNLKKENCLCLNYDQIQHMECKQPIRYWLLSENSDQIDRTLPFCKQ
FT                   AEQVYRSPSWQQFQSNHQAKRALWQQIQQP"
FT   CDS_pept        10981..11973
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00120"
FT                   /product="ribosomal RNA small subunit methyltransferase C"
FT                   /db_xref="GOA:E7A7Q0"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR013675"
FT                   /db_xref="InterPro:IPR023543"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q0"
FT                   /protein_id="CBY80280.1"
FT                   /translation="MISLESQVLERHISFFDGKSVLFAGGISDSFPQTLASKCSSIQIW
FT                   SCYFDYARTQSAVNFSVEFQGQADLIVYYWTKNKQEVNFQLIQLLAQASIGQEILIIGE
FT                   NRCGVRSVEKTLEPYGEIAKIDSARRCGLYHFSLQNKPHFELKNFWKTYQHSTLENLTI
FT                   YSLPGVFSAAESDTGTELLLSTIDNKIKGKVLDLGCGAGVIGSMIKKRAPNAQITMTDI
FT                   HAMALESARKTLSENQLQGEVYASDVFSDIEGKFDLIISNPPFHDGIDTAYRTVKELIT
FT                   QAKWHLNQGGELRIVANAFLPYPELLRQHFNDYQVLAQTGKFKVYSVKN"
FT   CDS_pept        complement(12038..12946)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00130"
FT                   /product="GTP-binding protein era homolog"
FT                   /db_xref="GOA:E7A7Q1"
FT                   /db_xref="InterPro:IPR004044"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005662"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030388"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q1"
FT                   /protein_id="CBY80281.1"
FT                   /translation="MTEQFDKTYCGFIAIVGRPNVGKSTLLNKILGQKISITSRKAQTT
FT                   RHRIVGIKTEGAYQEIYVDTPGLHIEEKRAINRLMNRAASSAIGDVDLIIFVVDGTHWN
FT                   ADDEMVLNKLRNAKAPVVLAINKVDNIKNKDDLLPFITDLSSKFNFAHIVPISAQRGNN
FT                   VQELEKIVRQSLREGVHHFPEDYVTDRSQRFMASEIIREKLMRFTGEELPYSVTVEIEQ
FT                   FKVNERGTYEINGLILVEREGQKKMVIGAGGQKIKTIGMEARADMERLFDNKVHLELWV
FT                   KVKSGWADDERALRSLGYMDE"
FT   CDS_pept        complement(12943..13626)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00140"
FT                   /product="Ribonuclease III"
FT                   /db_xref="GOA:E7A7Q2"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="InterPro:IPR011907"
FT                   /db_xref="InterPro:IPR014720"
FT                   /db_xref="InterPro:IPR036389"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q2"
FT                   /protein_id="CBY80282.1"
FT                   /translation="MNHLDRLERKIGYCFNDIVLLKQALTHRSAATQHNERLEFLGDSI
FT                   LNFTIAEALYHQFPRCNEGELSRMRATLVRESTLAILARQFELGDYMSLGSGELKNGGF
FT                   RRESILADCVEAIIGAMSLDQGLAVTTQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQ
FT                   GKHLPLPTYEVVNIQGEAHCQIFTVECKVKSAGKIDRTFVAKGSSRRKAEQAAAEQILK
FT                   ELDIK"
FT   CDS_pept        complement(13628..14677)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00150"
FT                   /product="Signal peptidase I"
FT                   /db_xref="GOA:E7A7Q3"
FT                   /db_xref="InterPro:IPR000223"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR019533"
FT                   /db_xref="InterPro:IPR019756"
FT                   /db_xref="InterPro:IPR019757"
FT                   /db_xref="InterPro:IPR019758"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q3"
FT                   /protein_id="CBY80283.1"
FT                   /translation="MSNLFFVILLAVGFGVWKVLDYFQLPNTFSILLLILTALSGVLWC
FT                   YHRFVVLPKRHRQVARAEQRSGKTLSEEEKAKIEPISEASEFLSSLFPVLAVVFLVRSF
FT                   LFEPFQIPSGSMESTLRVGDFLVVNKYAYGVKDPIFQNTIIAGEKPQRGDVIVFKAPQQ
FT                   ALIRTGLGATRAAFAENLALSSKDNMSGVDYIKRIVGKGGDRVIFDMEQKTLKVVYGKE
FT                   GKPCEVDCETKVFEYTQNPTNPAFPNELELTEKGDVTHNVLISEYRRYSGLEFFPQEGM
FT                   QTAEWLVPEGQYFVMGDHRDHSDDSRFWGFVPEKNIVGKATYIWMSLEKEANEWPTGFR
FT                   FERFFTAIK"
FT   CDS_pept        complement(14686..16482)
FT                   /transl_table=11
FT                   /gene="lepA"
FT                   /locus_tag="HIBPF_00160"
FT                   /product="GTP-binding membrane protein LepA"
FT                   /db_xref="GOA:E7A7Q4"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q4"
FT                   /protein_id="CBY80284.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDSMD
FT                   LERERGITIKAQSVTLNYKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDA
FT                   GQGVEAQTLANCYTAIEMDLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSA
FT                   KTGVGIEDVLEEIVAKIPAPEGDPNAPLQALIIDSWFDNYLGVVSLVRIKNGVLRKGDK
FT                   IKVMSTGQTYNVDRLGIFTPKQEDTTVLECGEVGWVVCAIKDILGAPVGDTLTHQHNSA
FT                   TEVLPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPETSTALGFGFRC
FT                   GFLGLLHMEIIQERLEREYDLDLITTAPTVIYEVQLTNGEVVYVDSPAKLPPLNNIAEI
FT                   REPIAECNMLVPQEYLGNVITLCVEKRGVQTNMVYHGNQIALTYEIPMGEVVLDFFDRL
FT                   KSTSRGYASLDYGFKRFQAADMVRVDIMINSERVDALALIVHKDNSQYRGRELVEKMRE
FT                   LIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKRMK
FT                   SLGNVEVPQEAFLAILHVGKDK"
FT   repeat_region   16667..16677
FT                   /note="Tx10"
FT   repeat_region   complement(16667..16677)
FT                   /note="A x10"
FT   CDS_pept        16790..17395
FT                   /transl_table=11
FT                   /gene="aef1A"
FT                   /locus_tag="HIBPF_00170"
FT                   /product="Fimbrial protein"
FT                   /db_xref="GOA:E7A7Q5"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="InterPro:IPR039458"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q5"
FT                   /protein_id="CBY80285.1"
FT                   /translation="MKKLTLAAGLLFSLGGISSAFGAADGTITFNGRVVDQTCTVTNGG
FT                   NTGNFDVKLPTVNKTQLATAGAVAGLTRFNIELTGCKQATAGGTNGVRAYFLPNSQYVD
FT                   PTTHNLINVAQVTGGETKADNVQIQLTHADTRQVIAVGENVDVQENAPYNSWFAFENDA
FT                   AGTAKAKLTYYAQYVAVGGGAATAGVIQSKVEYNIIYK"
FT   CDS_pept        17464..18159
FT                   /transl_table=11
FT                   /gene="aef1B"
FT                   /locus_tag="HIBPF_00180"
FT                   /product="putative fimbrial chaperone protein"
FT                   /db_xref="GOA:E7A7Q6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q6"
FT                   /protein_id="CBY80286.1"
FT                   /translation="MLKKIFLFLTTLPFFAQANVVITGTRIIYPAEQKNISIQLSNVGD
FT                   SPALVQSWLDKGDINSSPNSTKVPFVIAPPIVRVEGNSGQSLRVNFTGTEALPQDRESI
FT                   FYFNLLDIPPKPKAESLAINPNYLQLAIRSRLKFFYRPTGLAISINDAYQKVNFSTDGS
FT                   SLRVDNPTPYFITYDQIKINGKSVKNVDMVAPYSQQTYPFKGAHANETVQWTVVNDYGG
FT                   DQKGESILH"
FT   CDS_pept        18215..20725
FT                   /transl_table=11
FT                   /gene="aef1C"
FT                   /locus_tag="HIBPF_00190"
FT                   /product="Fimbrial usher protein"
FT                   /db_xref="GOA:E7A7Q7"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q7"
FT                   /protein_id="CBY80287.1"
FT                   /translation="MRKLIMLQKYQLHPIYYGLALCFSLPFHVHADDEFDAGFLRQSEN
FT                   APVVDIRRFNEKNAVLAGHYPAEIFVNNINKGHLQLRFDDTENGISLCLTPELAEILDL
FT                   QPKAFLQSPSNAICVPVNTAISQVKTEFDTGLLRLNVEIPQALTVQRPRGYISPSRWQD
FT                   GEPAVFLNYNANHYRYKNGNNTLAQSYLGIRAGANIGSWALRHSGSKNWQKSVDQNQNS
FT                   HYESTETYLQKDFAAIRGLVTLGDFYTSGELMEGMSLRGLKVASDDRMLPSSMRGYAPI
FT                   VQGVANSNANVTIRQNGSIIYQISVPAGAFTITDLYPSGYSGDLVVEITESNGQIRTFT
FT                   VPFANIAPLIRMGQFRYQTAYGRYRYGSEIYPDNVLQSTLQYGLLNNFTINSGITLHKN
FT                   YRAELLGASLNTPIGAFSADATFAQSIFDETREKKNGYSLHASYSVNVLSTKTNVTLAA
FT                   YRYYSKDFYTLRDVIWAKNNDYNLANEALRNSLFSRPKNQYQLSINQNLGEKWGVLYLI
FT                   GSTYSYWGKSGVRNEYQLSYSNNWKRLNYQIGFSQSVDQERKTRDNSLYLSFSIPLGEQ
FT                   YVSSTFTHNRRYNNAQSSVSGSTGQYNQFNYALSAASNNQNNRSVSANVGYRADVGDYQ
FT                   FSVGQDNQHNRQVSMTASGSVVAHSYGVTLGQTVGDNFAIIHAKGAKGALVTATGMGQT
FT                   LDYFGNAIVPYTSPYSINYIGIDPTHLPINIEFDSTEQQIVPRANSINLVNFDTKKTTM
FT                   VLFNVATPKGVILPMATEAKDDKGNLVGYVGQGGVLFANNLTKAKGTLAVSWGLGKNEQ
FT                   CYFDYQVNLDNESETMQIYDVKCK"
FT   CDS_pept        20740..21864
FT                   /transl_table=11
FT                   /gene="aef1D"
FT                   /locus_tag="HIBPF_00200"
FT                   /product="Fimbrial adhesin"
FT                   /db_xref="GOA:E7A7Q8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR015303"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q8"
FT                   /protein_id="CBY80288.1"
FT                   /translation="MWKKIIFLTGLCCYSLSSLSFERRPNGDGYHYRGSSMEYDIVAPF
FT                   ELGAKMADGTIPLYSRHYSADDLPRKFDNFGNAFFANDSEKYKFVRGHNNGDNFCTELY
FT                   AISNLPVIGTIDNQSIYDIGNEYIGILVYAGDTNKPVPVNGNSWQKVFNGWCTTSSQGA
FT                   SAKVIPVLLKQPPAGEYTIPRTEIGEIEPRRRSDSRYGEYTGNKITKFILNTFRFRVTP
FT                   HTCVLTTPKDITLKLPTISQRSIATQGDEVYGGKFEISLRCDNSSRSGLWGGIRVYSTL
FT                   TDKSNVSNRSDVLSLTADSSAKGIGIKLYNNWNTPALKYGPESSAKGTENQWAFSSGVQ
FT                   DNPSVLFRAYYVNTNGNVKPGTVKAIATYTFSYQ"
FT   CDS_pept        complement(21946..22329)
FT                   /transl_table=11
FT                   /gene="grcA"
FT                   /locus_tag="HIBPF_00210"
FT                   /product="conserved hypothetical acid-induced glycyl
FT                   radical enzyme"
FT                   /db_xref="GOA:E7A7Q9"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR011140"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Q9"
FT                   /protein_id="CBY80289.1"
FT                   /translation="MIKGIQITQAANDNLLNSFWLLDNEKNEARCLCAKGEFAEDQVVA
FT                   VSQLGQIEYRELPVNVAPTVKVEGGQHLNVNVLRRETLEDAVNNPDKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVITRTFTESL"
FT   CDS_pept        22578..23237
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00220"
FT                   /product="uracil-DNA-glycosylase"
FT                   /db_xref="GOA:E7A7R0"
FT                   /db_xref="InterPro:IPR002043"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR018085"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R0"
FT                   /protein_id="CBY80290.1"
FT                   /translation="MKTWTDVIGKEKEQPYFQHTLQQVHLARASGKTIYPPKEDVFNAF
FT                   KYTAFEDVKVVILGQDPYHGANQAHGLAFSVKPEVAIPPSLLNMYKELTQDISGFQMPS
FT                   HGYLVKWAEQGVLLLNTVLTVERGMAHSHANLGWETFTDRVIAALNKHREKLVFLLWGS
FT                   HAQKKGQIIDRTRHLVLTAPHPSPLSAHRGFFGCHHFSKTNSYLESNGMKPIDWQI"
FT   CDS_pept        complement(23306..24730)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00230"
FT                   /product="isopentenyl-adenosine A37 tRNA methylthiolase"
FT                   /db_xref="GOA:E7A7R1"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R1"
FT                   /protein_id="CBY80291.1"
FT                   /translation="MTQKLHIKTWGCQMNEYDSSKMADLLLSTHGLELTEAPEEADVLL
FT                   LNTCSIREKAQEKVFHQLGRWKELKKNNPNLVIGVGGCVASQEGEHIRHRAPYVDIIFG
FT                   PQTLHRLPEMINQIRGGKSSVVDVSFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTF
FT                   CVVPYTRGEEVSRPVDDVLFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGQICSFAELL
FT                   RLVASIDGIDRLRFTTSHPIEFTDDIIDVYRDTPELVSFLHLPVQAGSDRVLTMMKRAH
FT                   TALEYKSIIRKLRAVRPDIQISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFVYSA
FT                   RPGTPAADMPDDVTEDEKKQRLYVLQERINQQAAQFSRRMLGTEQRVLVEGPSKKDIME
FT                   LTGRTETNRIVNFQGSPEMIGKFVDVKITDVYTNSLRGEVVRTEDEMGLRIAQSPQEVM
FT                   NRTRKEDELGVGRYHG"
FT   CDS_pept        complement(25148..26587)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00240"
FT                   /product="predicted transporter"
FT                   /db_xref="GOA:E7A7R2"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R2"
FT                   /protein_id="CBY80292.1"
FT                   /translation="MALSKNTKLVILMAIPLITFLLPAPDGLSLIAWRLLGVYIATIVG
FT                   LVLKPYGEPVILLAAIAVSGVIIGNTEGAKELVKVGNMLDGYKSGTTWLIFTAFTLSSA
FT                   FVITGLGKRIAYHMIGAMGSTTLRLGYVTMFLDLLLSPATPSNTARSGGIIFPIINSVV
FT                   VALGSDPEKSPKKAGRYLMMNVYMVVKTTSYIFLTAMAPNALALSLMAPILGFETTWIK
FT                   WFLAASVPGLLCLFLIPLICYWVSPPELKKVDNKAIAKKGLEELGPMSFREKALSVLFV
FT                   IALFGWIFSNSLHINATIVAIIVMVLCIVLSIVTWDDILKSKGAWNTLVWYGGIIGMSG
FT                   LLEKSGFFKWLANTLSTILQFEGHGMMALIVILTLSVSVRYLFASGGAYVAAMVPVFAT
FT                   VGHVTGAPTELLALGLVFANSYGGSVTHYGGGPGPIAFGAGYNDIKSWWITGAIIAFGS
FT                   LIIHLTIGMAWWKLLMSLGWL"
FT   CDS_pept        complement(26589..27986)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00250"
FT                   /product="CitXG"
FT                   /db_xref="GOA:E7A7R3"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR005551"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R3"
FT                   /protein_id="CBY80293.1"
FT                   /translation="MQHFFTTFSTAGSKISLEALLNAREERAILQQQLITQYGQTLLCI
FT                   TLTAVGGVKKNALLDYVFTKALENLTALFTQLNITAVKEIVRPLETGHEAYFVLPIDAR
FT                   TLKVLMIELEESIPLARLWDLDVFNAKGNLLSRTDFDLSPRTCLVCGENAKICARTRKH
FT                   EIDEIVDKIQSLAQNHDFAEYIGEQVYLALIQEARLSPKPGLVDAINNGSHKDMNLHTF
FT                   EQSAISLKPFFTQFVLKGMMTAHLSENQILSEIRPLGLLAEKAMFKVTDGVNTHKGAIF
FT                   SFGLVCTAIGRLLAQKSLVQSAVDFDVKLICSLVAQFTQGLTDELKNYPEHLPSTAGVR
FT                   LFQKYGLTGVRGEAENGFNLIQTLLPQFDEYHQLEWEHRLLILLLKLMAINSDTNVVHR
FT                   GGLAGLHFIQQTAQDLLTDQHLVTDKIALTQALMKFDTACIERNLSSGGSADLLALTIF
FT                   FLSFRGN"
FT   CDS_pept        complement(28167..29669)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00260"
FT                   /product="citrate lyase alpha chain"
FT                   /db_xref="GOA:E7A7R4"
FT                   /db_xref="InterPro:IPR006472"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R4"
FT                   /protein_id="CBY80294.1"
FT                   /translation="MTTREQRIEKYHADRSVYQAVPKSESLSRTAKDRKLCTSLEEAIK
FT                   RSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLIDSHFPIVEHIKNG
FT                   VVTKIYSSGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTF
FT                   GNANGFTGKSKCGSLGYARVDAEYADKVVLLTEEFVEYPHHPISIAQDQVDLIVQVEAV
FT                   GDPKKIGGGATRMTTNPRELLIARKCAEVIFASGYFKDGFSLQTGSGGAALAVTRFLEE
FT                   KMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLARNPNHIEVSANQ
FT                   YANYSSKGASVERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAII
FT                   VAPLVRGRIPTVVENVITCVTPGENVDILVTDHGVAVNPKRPDLIEALSKTDIPLFTIE
FT                   QLCERAYSITGKPKEIEFTNKPVAVVRYRDGSVIDTVYQVKD"
FT   CDS_pept        complement(29684..30559)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00270"
FT                   /product="citrate lyase beta chain"
FT                   /db_xref="GOA:E7A7R5"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR006475"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R5"
FT                   /protein_id="CBY80295.1"
FT                   /translation="MKLRRSMLFVPGSNTAMLSNSFIYKPDSIMFDLEDAVALKEKDSA
FT                   RLLVAHALQHPLYKEIETVVRVNPLDSEFGLLDLNSVVRAGVDVVRMPKTESAQDVLDM
FT                   DHAITEIEKACGREAGSTKMLAAIESPLGITQANQIAFASKRLIGIALGAEDYVRNLKT
FT                   ERSPEGIELLFARCSILQAARAAGIQAFDTVYSNANNEEGFLKEAALIKQLGFDGKSLI
FT                   NPRQIELLHNLFAPTQKDVEQAKRIIEAAVEAERQGAGVVSLNGKMIDAPIIDRAKLVL
FT                   ERAKSGIREE"
FT   CDS_pept        complement(30556..30843)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00280"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /db_xref="GOA:E7A7R6"
FT                   /db_xref="InterPro:IPR006495"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R6"
FT                   /protein_id="CBY80296.1"
FT                   /translation="MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEA
FT                   TVREVLAKLGITAAQVIVEDKGALDCVLQARVKAAAMRATDEAINWEAVL"
FT   CDS_pept        complement(30881..31888)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00290"
FT                   /product="[citrate [pro-3S]-lyase] ligase"
FT                   /db_xref="GOA:E7A7R7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR005216"
FT                   /db_xref="InterPro:IPR013166"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R7"
FT                   /protein_id="CBY80297.1"
FT                   /translation="MQFERISTEQKKLSLIQTFLHQNALKLDEQIEYFVVGYNDNEQIV
FT                   VCGGLAGNIIKCVAIDESLRGSGVALQLITELVDLAYTLKRPHLFIYTKPEYATLFKSC
FT                   GFYIISDANPYVVLLENSATRLQKQCSLWEKMRVDGNRIGSIVMNANPFTLGHRYLIEQ
FT                   ALQQCDHLHLFIVGEDASQFSYTERFEMIQQGIFDLSNITLHSGSDYIISRATFPNYFL
FT                   KDQLITDESYFEIDLKLFRLHIAQALGITHRFVGTELNCPVTAEYNRQMHYWLMDAEMN
FT                   APKINVIEIPRKTASNHIISASTVRKHLAEKNWAQLAEFVPMTTLNYLQKCGRF"
FT   CDS_pept        complement(32139..33101)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00300"
FT                   /product="Lipoic acid synthetase"
FT                   /db_xref="GOA:E7A7R8"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R8"
FT                   /protein_id="CBY80298.1"
FT                   /translation="MSTPFKMERGVKYRDAAKTSIIPVKNIDPNQELLKKPEWMKIKLP
FT                   ASSAKIESIKNGMRRHGLHSVCEEASCPNLHECFNHGTATFMILGAICTRRCPFCDVAH
FT                   GKPLPPDPEEPQKLAETIQDMKLKYVVITSVDRDDLPDRGAGHFSECVKAVRELNPNIK
FT                   IEILVPDFRGRITQALEKLKDNPPDVFNHNLENVPRLYKEIRPGADYEWSLKLLREFKE
FT                   IFPNIPTKSGLMVGLGETNEEILQVMQDLRDNGVTMLTLGQYLQPSRHHLPVARYVPPT
FT                   EFDEFRDKANEMGFEHAACGPFVRSSYHADLQASGGLVK"
FT   CDS_pept        complement(33155..33793)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00310"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="GOA:E7A7R9"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7R9"
FT                   /protein_id="CBY80299.1"
FT                   /translation="MNNSLIVRQLGLQDYQEIWHKMQDFTDTRNAETQDEIWLVQHYPV
FT                   FTQGQAGKPEHLLQRSEIPVVQSDRGGQITYHAPGQQVMYVLIDIKRHKNLNVRQLVTA
FT                   LEQTVVKTLAEYGIESYPKPDAPGVYVDGKKICSLGLRIRHGCSFHGLALNINMDLNPF
FT                   HYINPCGYAGLEMCQLADFVNQDEADCDNVSAKLIKHFADLLGYNITTL"
FT   CDS_pept        complement(33795..34073)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S0"
FT                   /protein_id="CBY80300.1"
FT                   /translation="MTIENDYAKLKELMEFPAKMTFKVAGINREGLAQDLIQVVQKYIK
FT                   GDYIPKEKRSSKGTYNSVSIDIIAENFDQVETLYKELAKVEGVKMVI"
FT   CDS_pept        complement(34129..35310)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00330"
FT                   /product="D-alanyl-D-alanine carboxypeptidase
FT                   (penicillin-binding protein 5)"
FT                   /db_xref="GOA:E7A7S1"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S1"
FT                   /protein_id="CBY80301.1"
FT                   /translation="MLKRTTKIAFLSSFVALSAFSVSAEDMQFGVTPPQITAQTYVLMD
FT                   YNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVTIGESAWGRNFPDS
FT                   SKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETMNKYVQQFGLKNT
FT                   NFTTPHGLDDPNQYSSARDMAIIGAHIIRDLPEEYKIYSEKDFTFNKIKQPNRNGLLWD
FT                   KTINVDGMKTGHTSRAGYNLVASATTSNNMRLISVVMGVPTYKGREVESKKLLQWGFAN
FT                   FETFKTLEAGKEISEQRVYYGDKNSVKLGALMDHFITIPKGKQSEVKARYELADKNLQA
FT                   PLAKGQVIGKVVYQLDGKDIANANLQVMNDVGEAGIFGKLWDWLVLTVKGLFS"
FT   CDS_pept        complement(35326..36189)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00340"
FT                   /product="RlpA-like protein"
FT                   /db_xref="GOA:E7A7S2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S2"
FT                   /protein_id="CBY80302.1"
FT                   /translation="MKLKTGLNLTALLLFMISVAFPVQADTQKMYGIRGDNLSIATQMP
FT                   APRTYSVKGQTYTTKSGNEAKSYIKEGLASYYHLKFDGRKTASGDVYNSKQFTAAHKTL
FT                   PINSYALVTNLHNNRKVIVRINDRGPFSDKRLIDLSHAAAKEIGLISRGIGQVRIEALH
FT                   VAKNGNLSGAATKTLAKQAKTQEAADRLVLKSNTLFDNASKSINALKGTEFYRLKMLEL
FT                   TSRSQANKLITQLALANIQTEVNRSGNKYEIYIGPFDDKTKMAQVRTKLQKMANNKPLI
FT                   VYTYKN"
FT   CDS_pept        complement(36242..37357)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00350"
FT                   /product="Rod shape-determining protein RodA"
FT                   /db_xref="GOA:E7A7S3"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S3"
FT                   /protein_id="CBY80303.1"
FT                   /translation="MEDKIPFWLRVWQRLHIDFWLFIGLLAITAYGMLVLYSASGASET
FT                   MFNSRIIQVLLGFIVMLLMAQFPPRFYQRIAPYLYLIGFVLLILVDVIGTTSKGAQRWL
FT                   ALGFIRFQPSEIVKLAVPLMVAVYLGNRPLPPKLSETFIAIAMILLPTLLVAIQPDLGT
FT                   SILVSASGLFVVFLAGMSWWLILAAVIGLAGFIPIMWLYLMHDYQRTRVLTLLDPEKDP
FT                   LGAGYHILQSKIAIGSGGLSGKGWMQGTQSQLEFLPEPHTDFIFAVMGEEHGMIGFLIL
FT                   MAIYLFIIVRGLMIAVNAQTSFGRILAGATTLIFFVYVFVNIGMVSGILPVVGVPLPLF
FT                   SYGGTSYVAIMASFGLLMSIHTHKSQFMKRS"
FT   CDS_pept        complement(37347..39302)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00360"
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="GOA:E7A7S4"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S4"
FT                   /protein_id="CBY80304.1"
FT                   /translation="MNLKKFFNTPTHEPFRDKKAERNLFARRTLVAFLGILLLTGVLFT
FT                   NIYQLQIVNFDTYQTRSDGNRIKLLPLPPTRGLIYDRYGKLLAENLTFFGLYIVPEKTE
FT                   NLDRTLDELRYIVGLTDNDIENFKKERRRGTRYTPILLKPNLTEEQISRFAVNGYQYPS
FT                   LEVRPYFKRHYLYGETMAHILGYVGKMNDKDVERLKREDKFANYAGTNDIGKLGIERYY
FT                   EDILQGTTGFEEVEINNRGKVIRTLRSRPAVAGKSIHLTIDLALQRYITELLSGLKGAV
FT                   VVLDPKDSSVLAMVSTPSYDNNLFVDGISSEDYKRLLNDPARPLYSRATQGAYPPASTV
FT                   KPFIAVAAQTGNVITPNTTIFDPGYWVLPNSTKRFRDWKKTGHGDTDLNKAITESSDTY
FT                   FYQVAYNMGIDRLSNWMKDFGFGMPTGIEIQEETAANMPTREWKQKRYKRPWVQGDTIS
FT                   VGIGQGYWTATPLQVAKATTILVNNGKVNTPHLMKAIEGAVLEPYEDPLLYPDINTPKV
FT                   AAWEAAKRGMYNVVNAANGTGRKAFADANYRVAGKSGTAQVFSLKENEKYNTAGLKKEL
FT                   HDHAWFTAYAPYDNPKLVVTVILENAGGGSSNAAPLARKVMDYYLNQRLPQVEKYNVPI
FT                   QQKKDLSQESEQINGR"
FT   CDS_pept        complement(39324..39791)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A7S5"
FT                   /db_xref="InterPro:IPR003742"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S5"
FT                   /protein_id="CBY80305.1"
FT                   /translation="MKITLIAVGTKMPSWVTTGFEEYQRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILEQEGKAMLAACGKGKVVTLDIPGKPWTTPQLAEQLEAWKNDGRDVCLLIGG
FT                   PEGLSPECKAAAEQSWSLSPLTLPHPLVRVVVAESLYRAWSLTTNHPYHRE"
FT   CDS_pept        complement(39845..40153)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A7S6"
FT                   /db_xref="InterPro:IPR004394"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S6"
FT                   /protein_id="CBY80306.1"
FT                   /translation="MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQV
FT                   SAMADNLITECKKAGFETFGEEGKNTADWIVVDLGQAIVHIMQPDAREMYQLEKLWA"
FT   CDS_pept        complement(40278..41933)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00390"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="GOA:E7A7S7"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR006512"
FT                   /db_xref="InterPro:IPR023018"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S7"
FT                   /protein_id="CBY80307.1"
FT                   /translation="MSDIAITISLLALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAH
FT                   FTNQYGLKLDAHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRKSGLKLNAFAILIIVLG
FT                   SIAVVLVHKIADVPLDIALGIYSGAVTNTPALGAGQQILAELGVPQTTVTMGVSYAMAY
FT                   PFGICGILLAMWLIRLFFNVKVDDEAARFNAESSQDKESLHNISLKVTNQNLDGLTLIQ
FT                   IPGFSDEEVVCSRLKRDDMEIVPKASTEIRTNDILQLVGDDNSLAKMRLIIGHEVDAPT
FT                   VAYSGEIRSERVVVTNEKVLGKKIRALGIHQKYGVVISRLNRAGIELVPTGNTTLQFGD
FT                   VLHMVGRSDVLNQAISVIGNAQQKLLQVQMLPVFIGIGLGVLVGSIPFYIPGFPVALKL
FT                   GLAGGPLVVALILARIGTIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGSFFDTLV
FT                   NGSGLEWMGYGIFITFVPLIIVGTIARLYGKLNYLTICGLLAGSMTDPPALAFANEIKE
FT                   DNGAAALSYATVYPLVMFLRIMSPQLLAVLLWAA"
FT   CDS_pept        42046..43917
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00400"
FT                   /product="conserved hypothetical ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="GOA:E7A7S8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S8"
FT                   /protein_id="CBY80308.1"
FT                   /translation="MSIDSTIPKIFDPFTKSAVIFHRTFISDGIFMDYSQEAITSLIWI
FT                   LQTLAITSVVFSFGIFLLVRFTQWGKQFWMFAGGYLSPKRSIKPILFFLLIVAMTLLSV
FT                   RISLVHSEWYKNMYTSLQEFNEHVFWQQMGLFCVIAASSVSAALVSYYLEQRFVINWIE
FT                   WLNEQLVDKWMAHRTYYKTQYLSENLDNPDQRIQQDVQSYVKTTLSLSTGVIDAVTSMI
FT                   SYTILLWGLAGPMMVLGVEIPHMMVFLVFGYVIFTTLIAFWLGRPLISLNFINERLNAN
FT                   YRYSLIRIKEYAESIAFYAGEKVEKNQLYQQFNAVIHNMWVIVFRTLKFSGFNLVISQI
FT                   SVVFPLLIQVGRYFEKQIKLGDLMQTLQVFGQLHANLSFFRNTYDNFASYKATLDRLTG
FT                   FSYAIEKVNNKSQTQIHNHPTDVIFKNLSIQNPLGHTLIKHLNITLPQGTSLLIQGKSG
FT                   AGKTTLLRTIAGLWSYAEGEINYPTHNQLFLSQKPYVPQGNLMSALAYPNNPDNISHTQ
FT                   AVEILNKVQLGHLAEQLEKEQDWMRILSLGEQQRLAFARLILHKPAVAFLDEATASMDE
FT                   GLEFSMYQLLQQELPQTTIISVGHRSTLKTLHQQQLILQDKGQWQVL"
FT   CDS_pept        44049..45104
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00410"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="GOA:E7A7S9"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7S9"
FT                   /protein_id="CBY80309.1"
FT                   /translation="MLFKKIRGLFSNDLSIDLGTANTLIYVKRQGIVLDEPSVVAIRQD
FT                   RVGKLKSIAAVGKEAKLMLGRTPKSIVAIRPMKDGVIADFFVTEKMLQYFIKQVHSGNF
FT                   MRPSPRVLVCVPAGATQVERRAIKESAIGAGAREVYLIEEPMAAAIGAKLPVSTAVGSM
FT                   VIDIGGGTTEVAVISLNGIVYSSSVRIGGDRFDEAIISYVRRTFGSVIGEPTAERIKQE
FT                   IGSAYIQEGDEIKEMEVHGHNLAEGAPRSFTLTSRDLLEALQQPLNGIVAAVRTALEEC
FT                   QPEHAADIFERGMVLTGGGALLRNIDILLSKESGVPVIIAEDPLTCVARGGGEALEMID
FT                   MHGGDIFSDEI"
FT   CDS_pept        45184..46239
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00420"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="GOA:E7A7T0"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T0"
FT                   /protein_id="CBY80310.1"
FT                   /translation="MKPIFGKAPPLGIRLLIAIFASIALILADGRNSSITKARSAMETA
FT                   IGGLYYLANSPRSILDGISENLVDTNKLQIENKVLRQQLLEKNADLLLLDQLKVENQRL
FT                   RLLLNSPLRTDEYKKIAEVLTAETDIYRQQIVINQGKKDGAYVGQPVIDEKGVIGQIIS
FT                   VSENTSRVLLLTDVTHSIPVQVLRNDVRVIASGTGYTDELSLDNVPRSIDIEKGDLLVT
FT                   SGLGGRFLEGYPVAVVQSVSRDSSNYFAIVKAKPLSLLERLRYVLLLWPSNLDISKVKS
FT                   MSPEEVRNLVQKRLESQANEANYRVKKTPLTEKDFPENEEKTIIEPDIPTDFLQNEEDL
FT                   PIEQQEERIED"
FT   CDS_pept        46239..46727
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00430"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="GOA:E7A7T1"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T1"
FT                   /protein_id="CBY80311.1"
FT                   /translation="MQTRFILQWFTILSFFVIAFVLELAPWPVGFQMLKPAWLVLVLLY
FT                   WVLAIPNKVSIGWSFLLGLTWDLILGSTLGVHALVLSTSMYIIAKNYLILRNLSLWFQS
FT                   LLVVLFVFIIRLLIFLVEFSLHTAFFHWQAILGAFASGLLWPWVFLLMRKIRRKVKLH"
FT   CDS_pept        complement(46778..47554)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00440"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006506"
FT                   /db_xref="InterPro:IPR009671"
FT                   /db_xref="InterPro:IPR016097"
FT                   /db_xref="InterPro:IPR036701"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T2"
FT                   /protein_id="CBY80312.1"
FT                   /translation="MDMANWQNYRSTVNGMPAVFTANIEDVEKYHGKGLDKIVQFTIDY
FT                   QADDETGLPSEVEYDKLINRVFKILTQLTALPNVFFAGHFICNSQIKIHFYCKHENLIV
FT                   ETLQQIDFVKDINVQKDLIWDTYFDFLLASPLEIKLNATEELLDLLKSKGRNLSDTYLV
FT                   EHSFHFDEEQKMFPFMDELSLGDYSFTTLQYSAQAIQFNEDDEPYFLVKLEQEISLENG
FT                   EIFEQVERFEKLAEQFSGEYIGWECDSLLDSNKPLN"
FT   CDS_pept        complement(47564..48367)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00450"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="GOA:E7A7T3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="InterPro:IPR037493"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T3"
FT                   /protein_id="CBY80313.1"
FT                   /translation="MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYE
FT                   ITENLGYHVFHHGQKGHYGVALLTKQEPKVVRRGFPTDNEGAQKRIIMADLETEFGLLT
FT                   VINGYFPQGESRAHETKFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGI
FT                   GDENRKRWLRTGKCSFLPEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDD
FT                   NRGLRIDHILVSRKLAERCVDVGIALDIRAMEKPSDHAPIWAEFK"
FT   CDS_pept        complement(48415..49089)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00460"
FT                   /product="conserved hypothetical pseudouridine synthase"
FT                   /db_xref="GOA:E7A7T4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T4"
FT                   /protein_id="CBY80314.1"
FT                   /translation="MEIEVVYQHSDFIIINKSEGISVHKDQEEQGLTELVAKQLNVPKV
FT                   WLVHRLDKVTSGLLILALNAESAAEFSRLFSEHKIHKTYLALSNQKPKKKQGLIIGDMK
FT                   KAREGAWKLCQTKENPAITRFESVSCEPNLRLFILKPQTGKTHQLRVAMKSLGSPILGD
FT                   GLYGKNTEKIDRTYLHATQLEFDYLNDFISVTCLPSQGQFWIKHTVFEQIQVYLTKPFL
FT                   SK"
FT   CDS_pept        complement(49089..50153)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00470"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="GOA:E7A7T5"
FT                   /db_xref="InterPro:IPR006507"
FT                   /db_xref="InterPro:IPR021147"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T5"
FT                   /protein_id="CBY80315.1"
FT                   /translation="MEKQIFEHSVNVEEEHYQPKQEFHNMEAKLDEVLDGELLDAQLEQ
FT                   VLKPKSSFRKTLLKFTALLFGLATVAQSVQWIWDSYQQHQWIYLAFALVSLIIILLGIK
FT                   EIICEWRRLVRLKKREQWQQQSQQIWLESAVKNGDVFSVHNAEKSKILCLDIAKSLGLE
FT                   NDSPAVIQWQHQLNEAYSAQEIAHLFSRHVLSSFDAQAKKLISKMAAESAVIVAISPLA
FT                   VVDMFFIAWRNLRLMNKIAEIYGIELGYFSRIRLLRMVLVNIAFAGATEVAQDIGMDWL
FT                   SQDVTAKLSTRIAQGIGVGLLTARLGVKAMELCRPLAFQLNEKPKLSHIQQELLSSVKD
FT                   IVLGKNKIYKKEQI"
FT   CDS_pept        complement(50213..50875)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00480"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="GOA:E7A7T6"
FT                   /db_xref="InterPro:IPR006213"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T6"
FT                   /protein_id="CBY80316.1"
FT                   /translation="MQSRLIVDAQKESLLSTHKVLRNTYFLLGLTMAFSAVVAFISMSL
FT                   NLPYPNIIVLLVGFYGLLFLTNKLADRPAGILAAFAFTGFMGYTIGPILNMYVARGMED
FT                   LIMLAFAGTAIVFFACSAYVLTTKKDMSFLSSAMFALFIVLLLGMVASFFFQIPALSVA
FT                   ISALFVVFSTMTILYETSNIIHGGETNYIRATVNIYVSIYNLFLSLLRLLSIFSSDE"
FT   tRNA            51056..51142
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:51090..51092,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 57.52"
FT   CDS_pept        complement(51202..51756)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006513"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T7"
FT                   /protein_id="CBY80317.1"
FT                   /translation="MKKQILALVCGVMFSSPIWAHNLQLEQSLPAVQVTEYGEIVLSGK
FT                   DTAFQPWSSAELAGKVRVVHHLAGRTAAKEKNQSMIDAIKASHFNPVKYQITTIINADD
FT                   AIVGTGMFVKNSAQKGKQENPHSQVVLDDKSAVKNAWGLNPKDSAIIVLDKTGKVKFVK
FT                   EGKLSDSDIQTVISLVNGLTK"
FT   CDS_pept        51860..52210
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00510"
FT                   /product="PhnA homologue"
FT                   /db_xref="InterPro:IPR004624"
FT                   /db_xref="InterPro:IPR013987"
FT                   /db_xref="InterPro:IPR013988"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T8"
FT                   /protein_id="CBY80318.1"
FT                   /translation="MDQMPNCPKCQSEYVYHDSINFVCPDCGNEWDNNEIQESDDDQLI
FT                   VKDSNGNLLADGDNVLLIKDLKLKGSSEVLKKGTKFKNIRLVNGDHNVDCGKIMLKSEF
FT                   LKKSLIEKMQSK"
FT   CDS_pept        complement(52225..52938)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00530"
FT                   /product="putative membrane protein TerC"
FT                   /db_xref="GOA:E7A7T9"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7T9"
FT                   /protein_id="CBY80319.1"
FT                   /translation="MFEWIADPEAWVSLATLAALEIVLGVDNIIFISILVGRLPESQRQ
FT                   SGRIVGLGLAMLTRILLLMSLAWMMKLTAPLFTVFNQEISGRDLILLIGGLFLIVKSSG
FT                   EIKEAINHQGHHESERKNKVSYLGVLIQIAVLDIVFSLDSVITAVGMASHLPVMILAII
FT                   IAVSVMMFAAKPIGDFVDTHPTLKILALAFLVLVGISLIAESLDIHIPKGYIYFAMGFS
FT                   VVVEMINIRMRRLMK"
FT   CDS_pept        complement(53036..54865)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00540"
FT                   /product="UvrABC system protein C"
FT                   /db_xref="GOA:E7A7U0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U0"
FT                   /protein_id="CBY80320.1"
FT                   /translation="MFNYKKFLADVSHEPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFR
FT                   KNLSSKKTEALVASIHHIDTMLTSSETEALLLEHNFIKLYQPRYNVLLRDDKSYPFILL
FT                   TKERHPRITSYRGSKKFAGEYFGPYPHAGAVRETLSLLQKLFPVRQCENSVYSNRSRPC
FT                   LQYQIGRCSAPCVQGYVSDEEYNQQVELARLFLQGKDQQVLDYLIGKMEQASRNLGFEQ
FT                   AARYRDQIQAVRSVIEKQFVSNERLDDMDIMSIAYQHGLACVQVMFIRQGKVLGNRSYF
FT                   PKVPANTDLSELTETFVGQFYLQGHQGRSIPNSIIVDRQLAEKSELEQLLSEQAGRKVT
FT                   IQESVKGDKSKYLQLAQVNAKAALNVQFKQSSRMSARYQALCDLLNLPEIKRMECFDIS
FT                   HTMGNQTVASCVVFNQEGPLKSDYRRFNIEGITGGDDYAAMEQALQKRYERNLEEDKIP
FT                   DIIFIDGGKGQLNRALNVFQHLQVKWDKNRPHLIGVAKGVARRAGQEVLIISKQDREIH
FT                   LPDDSLALHLIQHIRDESHNHAISGHRKKRQKAFTQSGLETIEGVGAKRRQALLKYLGG
FT                   LQGVKKATLDEIASVPGISPKLAERIFETLKND"
FT   CDS_pept        complement(55002..55766)
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="HIBPF_00550"
FT                   /product="3-deoxy-D-manno-octulosonic acid
FT                   cytidylyltransferase"
FT                   /db_xref="GOA:E7A7U1"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U1"
FT                   /protein_id="CBY80321.1"
FT                   /translation="MSFTVIIPARFASSRLPGKPLADIAGKPMIQHVFEKALQSGANRV
FT                   IIATDNENVADVAKNFGAEVCMTSVNHNSGTERLAEVVEKLAIPDNEIIVNIQGDEPLI
FT                   PPVIVRQVADNLAKFNVNMASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYD
FT                   RDQFMNLQDVQKVQLADAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNG
FT                   ERIHVELAKEVPTVGVDTAEDLEKVRLILAKD"
FT   CDS_pept        complement(55837..56835)
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="HIBPF_00560"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="GOA:E7A7U2"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U2"
FT                   /protein_id="CBY80322.1"
FT                   /translation="MPFWYSNSKLIWLLSPFSLLFWLISQLRRTLFSLGIKSSYRALKP
FT                   VIIVGNLSVGGNGKTPVVVWLVEELKKRGLRVGVISRGYGSKSKTYPLFVTENTNPIEG
FT                   GDEPVLIAKRTNVPVVIFPNRQQAIELLLSQAECDIIVSDDGLQHYKLQRDLEIVVMDA
FT                   ERALGNGFVLPAGPLRELPSRLKSVDFVITNGGKNQYSDAVMYLVPHFAINLKTNEKRQ
FT                   LKEFQSGVAIAGIGNPQRFFTMLEKLGIQLERTQAFQDHQHFEASQLEKLAENQPLFMT
FT                   EKDAVKCQSFANDNWWYVPVDAEIIEAEKQCENLPHFWDKIDKLVAQYRNG"
FT   CDS_pept        complement(56908..58671)
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="HIBPF_00570"
FT                   /product="lipid A export ATP-binding protein MsbA"
FT                   /db_xref="GOA:E7A7U3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR011917"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U3"
FT                   /protein_id="CBY80323.1"
FT                   /translation="MQEQKLQENDFSTLQTFKRLWPMIKPFKAGLIASGIALVFNALAD
FT                   SGLIYLLKPLLDDGFGKANHSFLKIMAFVVVGMIILRGVTNFISNYCLAWVSGKVVMTM
FT                   RRRLFKHLMFMPVSFFDRNSTGKLLSRITYDSEMIASSSSGSLITIVREGAYIISLLAV
FT                   MFYTSWELTLVLFVIGPIIAVLITIVSKIFRKLSKNLQDSMGELTATTEQMLKGHKVVI
FT                   SFGGQFVEEERFNKVSNNMRRKGMKMVTADSISDPVVQIIASFALVAVLFLATTPLIAE
FT                   DNLSAGSFTVVFSSMLAMMRPLKSLTNVNSQFQRGMAACQTLFAILDLEPEKDNGTYKA
FT                   EPAKGELEFKNVSFAYQGKEELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYD
FT                   IEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAA
FT                   AKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATSALD
FT                   TESERAIQSALDELKKDRTVIVIAHRLSTIENADEILVIDHGEIRERGNHKALLEQNGA
FT                   YKQLYSMQFSG"
FT   CDS_pept        complement(58712..61078)
FT                   /transl_table=11
FT                   /gene="rec-2"
FT                   /locus_tag="HIBPF_00580"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="GOA:E7A7U4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR004477"
FT                   /db_xref="InterPro:IPR004797"
FT                   /db_xref="InterPro:IPR025405"
FT                   /db_xref="InterPro:IPR035681"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U4"
FT                   /protein_id="CBY80324.1"
FT                   /translation="MKLNLITLAVLLIVADLTLLFLPQPLLLPWQVALVIALVLIFLFI
FT                   FLRRNFLVSLAFFVASLGYFHYSALSLLQQAQNITAQKQVVTFKIQEILHQQDYQTLIA
FT                   TATLANNLQEQRIFLNWKAKEVPQLSEIWQAEISLRPLSARLNFGGFDRQQWYFSKGIT
FT                   AFGTVKSAVKIANVSSLRAEKLQQVRKQTEGLSLQGLLIALAFGERAWLDKTTWSIYQQ
FT                   SNTAHLIAISGLHIGLAMGIGFCLARVVQVFCPTRFIHPYFPLVFSVLFALIYAYLAGF
FT                   SVPTFRAISALVFVLFIQIMRRHYSPIQLFTVVVGFLLFCDPLMPLSVSFWLSCGAVGC
FT                   LILWYRYVPFSLFQWKNRPFSPKVRWIFSLFHLQFGLLLFFTPLQLFLFNGLSLSGFLA
FT                   NLMAVPIYSFLLVPLILFAVFTNGTMFSWQLANKLAEGITGLISVFQGNWFNVSFNLAL
FT                   VLTALCAGIFMLIIWRIYREPEISSSNWQIKRAKFFTLNLSKPLLKNERINVLLCSFGI
FT                   ILLCFMILLFKQFSKPTWQVDTLDVGQGLATLIVKNGKGILYDTGSSWRGGSMAELEIL
FT                   PYLQREGIVLEKLILSHDDNDHAGGAATILKAYPNVELITPSRKNYGENYRTFCTAGRD
FT                   WHWQGLHFQILFPHNVATRADNPHSCVILVYDGKHSVLLTGDAEAKNEQIFARTLGKID
FT                   VLQVGHHGSKTSTSEYLLSQVRPDVAIISSGRWNPWKFPHYSVMERLHRYKSAVENTAV
FT                   SGQVRVNFFQDRLEIQQARTTFSPWYARVIGLSKE"
FT   CDS_pept        61337..61774
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00610"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="GOA:E7A7U5"
FT                   /db_xref="InterPro:IPR000962"
FT                   /db_xref="InterPro:IPR012784"
FT                   /db_xref="InterPro:IPR020458"
FT                   /db_xref="InterPro:IPR037187"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U5"
FT                   /protein_id="CBY80325.1"
FT                   /translation="MSRASLSLLDLAGVKPYQMKKDEEYMNEEQILHFRKILNAWHEQI
FT                   VEEASRTVAHMQDEVTNFPDPADRATQEEEFSLELRNRDRERKLMKKIEATLKKLDTDD
FT                   FGYCDCCGEEIGIRRLEARPTADLCIDCKTLAEIREKQVAG"
FT   CDS_pept        62021..63379
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00620"
FT                   /product="probable poly polymerase"
FT                   /db_xref="GOA:E7A7U6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR010206"
FT                   /db_xref="InterPro:IPR025866"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U6"
FT                   /protein_id="CBY80326.1"
FT                   /translation="MPKARAKKSEQTRRYDKNVIKAAQFDISPRDFSRNALNVVEKLQR
FT                   QGFEAYIVGGCIRDLLLGKKPKDFDVATNARPEQIQNIFQRQCRLVGRRFRLAHIMFGR
FT                   DIIEVATFRANHSDARNENQAKQSNEGMLLRDNVYGTIEQDAARRDFTVNALYYNPQDN
FT                   TLRDYFEGIKDLKAGKLRLIGDPVTRYQEDPVRMLRSIRFMAKLDMFLEKPSEQPIREL
FT                   APLLKNIPPARLFDESLKLLQAGQGVKTYRLLRQYGLFEQLFPALSSYFTEKEDSFAER
FT                   MIVTALSSTDERVADKLRINPAFLFAAFFWYPLREKVEILKNEGGLNNHDAYALAGNEV
FT                   LDLFCRALAAPRRHTAVIRDIWFLQLQLLKRTGSAPMRTMEHPKFRAGFDLLAMRAEIE
FT                   GGETIELAKWWHEYQLSNGEQREQLIQEQQRLHPKPKKKYYRPRRRKITRSAE"
FT   CDS_pept        63388..63870
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00630"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /db_xref="GOA:E7A7U7"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U7"
FT                   /protein_id="CBY80327.1"
FT                   /translation="MITAYIALGSNLNTPVEQLHAALKAISQLPNTHLVTTSSFYKSKP
FT                   LGPQDQPDYVNAVAKIETELSPLKLLDELQRIENEQGRVRLRLWGERTLDLDILLYGNE
FT                   IIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP"
FT   CDS_pept        63946..64422
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00640"
FT                   /product="conserved hypothetical protein, ATPase"
FT                   /db_xref="GOA:E7A7U8"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U8"
FT                   /protein_id="CBY80328.1"
FT                   /translation="MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAG
FT                   KTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYF
FT                   NTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAKTNLGKNIIKAFSN"
FT   CDS_pept        64430..65728
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00650"
FT                   /product="probable N-acetylmuramoyl-L-alanine amidase AmiB
FT                   precursor"
FT                   /db_xref="GOA:E7A7U9"
FT                   /db_xref="InterPro:IPR002508"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7U9"
FT                   /protein_id="CBY80329.1"
FT                   /translation="MKTKILFFLFFSTFSFSIFAAPITIAIDPGHGGKDPGAIGRNLGI
FT                   YEKNVTLSIAKELKALLDKDPHFRGVLTRKSDYYISVPERSEIARKFKANYLISIHADS
FT                   SESPDRRGASVWVLSNRRANDEMGQWLEDDEKRSELLGGAGKVLSHNNDKYLDQTVLDL
FT                   QFGHSQRTGYVLGEHILHHFAKVTTLSRSTPQHASLGVLRSPDIPSVLVETGFLSNSEE
FT                   EKKLNSQTYRRRIAYMIYEGLVAFHSGKTNTLVKDNLVQNIKQNDIKKSGKNNRTSEQN
FT                   INEDNIKDSGIRHIVKKGESLGSLSNKYHVKVSDIIKLNQLKRKTLWLNESIKIPDNVE
FT                   IKNKSLTIKENDFHKKQNSSVNNTNKDLKKEKNTQTNNQKNIIPLYHKVTKNQTLYAIS
FT                   REYNIPVNILLSLNPHLKNGKVITGQKIKLREK"
FT   CDS_pept        65729..>67063
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00660"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="GOA:E7A7V0"
FT                   /db_xref="InterPro:IPR002099"
FT                   /db_xref="InterPro:IPR013507"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR014762"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020667"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038973"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V0"
FT                   /protein_id="CBY80330.1"
FT                   /translation="MPIKILSPQLANQIAAGEVVERPASVVKELVENSLDAGANKIQID
FT                   IENGGANLIRIRDNGCGIPKEELSLALARHATSKITDLDDLEAILSLGFRGEALASISS
FT                   VSRLTLTSRTEEQTEAWQVYAQGRDMETTIKPASHPVGTTVEVANLFFNTPARRKFLRT
FT                   DKTEFSHIDEVIRRIALTKFNTAFTLTHNGKIIRQYRPAEELTQQLKRVAAICGDDFVK
FT                   NALRIDWKHDDLHLSGWVATPNFSRTQNDLSYCYINGRMVRDKVISHAIRQAYAKYLPT
FT                   DVYPAFVLFIDLNPHDVDVNVHPTKHEVRFHQQRLIHDFIYEGVSHALNNQEQLNWHTD
FT                   QSAVENHEENTVREPQPNYSIRPNRAAAGQNSFAPQYHEKPQQNQPHFSNTPVLPNHVS
FT                   TGYRDYRSDAPSKTEQRLYAELLRTLPPTAQKDISDTAQQNISDTA"
FT   CDS_pept        67626..68561
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00670"
FT                   /product="tRNA delta-isopentenylpyrophosphate transferase"
FT                   /db_xref="GOA:E7A7V1"
FT                   /db_xref="InterPro:IPR018022"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039657"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V1"
FT                   /protein_id="CBY80331.1"
FT                   /translation="MKPTAIFLMGPTASGKTDLAIQLRSQLPVEVISVDSALIYKGMDI
FT                   GTAKPSKEELALAPHRLIDILDPSESYSAMNFRDDALREMADITAQGKIPLLVGGTMLY
FT                   YKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPISAARINPSDSQRINR
FT                   ALEVFYITGKSLTELTEEKGEALPYDFVQFAIAPQDRHVLHERIEQRFHKMIELGFQAE
FT                   VEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMIFRGICATRQLAKRQLTWLRG
FT                   WKTPIQWLDSLQPQQAKETVLRHLDSYQKG"
FT   CDS_pept        68567..71512
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00680"
FT                   /product="glutamate-ammonia ligase adenylyltransferase"
FT                   /db_xref="GOA:E7A7V2"
FT                   /db_xref="InterPro:IPR005190"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="InterPro:IPR023057"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V2"
FT                   /protein_id="CBY80332.1"
FT                   /translation="MTALSTLIEQKLQSLGTILCQSFPELSPEKIHEAIQQNSNHPELP
FT                   VYQLGYAIAMSDFVEKVLQKYPHLVKQWWEKSPCFADCTAYIERLNRELANVHDETALY
FT                   QTLRQFRNIEMAKLSFCQSLNLATVEEIFVQLSQLAESLIIAARDWLYHQACAEIGTPM
FT                   DEQGNQQQLYILGMGKLGGFELNFSSDIDLIFTYPSQGETSVENTNARRSVDNTKFFTR
FT                   LGQRLISALDEFTSDGFVYRTDMRLRPFGDSGGLVLSFAAMEQYYQDQGRDWERYAMIK
FT                   GRVLGVQTKDPNVSKLQKMLRPFVYRRYIDFSVIQSLREMKGKIEREVRRRGLKDNIKL
FT                   GAGGIREVEFIVQVFQLIRGGREINLQQHSLLKILPEITKLGLITEQQFHDLRESYIFL
FT                   RRVENILQAINDQQTQTLPTDEIDQIRLVKACKTFTCLNENNQTIEKHYPIENWDDFYR
FT                   TLQQKQEKVRAVFTQLIGDEQDEPSQTDSQWQDFLEADFEDIEQTLLESGVSENNIDEV
FT                   LEKLAQFKNGLNHRVIGSRGRDVLSHLMPTVLALIFEQENYRTLLPRILNIIEKISSRT
FT                   TYLELLLENPRALQQVIELCAQSQLISEQLARHPILLDELLNTEALRHPLPFTQYPAEL
FT                   HQYLLRLPPDDEEQLIDALRQFKQATLLKVAAADILGALPVMKVSDHLTYLAEAIIEVV
FT                   VNLTWKQVSSRFGVPEHLQNNEKGFLVIGYGKLGGIELGYKSDLDLVFLYDAVESQTTG
FT                   GKKVIDSNQFYLRLAQKIVSIFSINTSAGVLYEADMRLRPSGDAGLIGCSLSAFSHYQL
FT                   NDAWTWEKQALVRARPVFGESSLKAKFEHIRQQVLSASRDIEQLKQDVIEMRKKMFTHL
FT                   SHSKHSEFNLKTDRGGITDIEFIAQYLMLANAPKKPQLTKWSDNVRIFDDMAEAKIISQ
FT                   TDCDTLKQCYVDLRNAIHHLNLIGKSPVVDETEFVKERSFIQAFWDRLFVS"
FT   CDS_pept        complement(71597..73273)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00690"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="GOA:E7A7V3"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V3"
FT                   /protein_id="CBY80333.1"
FT                   /translation="MLTQLTINNFAIVRQLDIEFAKGMSVITGETGAGKSIAIDALGLC
FT                   FGQRVETSMVREGQERAEICATFQLESQNPAYHWLSEQELQDPDNPTECILRRIINADG
FT                   RSKAFINSTPVSASQLKEIAQYLVHINGQHASQLLLKNDYQLQLVDNFAAHPELLVKMR
FT                   EDYQTWKNLQNQVKTFQQKVAENEARKQLLQYQVDELDEFNLRPNEYLELEDEQRRLSS
FT                   SEQLTQLSQSALQILSENDTVNIDSLLYRATQYIDELAELDPQYAEVQNMLNDALIQVQ
FT                   EATSEVQNLSSNIEQDPRLLQEIEQRISQALQLARKHQVKPEDLVEQHKKLKAELTALL
FT                   DFSESEEMLIEQEKLAFEQMQATATALTASRQQSATRLAQNVTQSIKQLAMENAEFYVE
FT                   LNTDLDKVSANGADNVIFTLRSNLGQQPQPLAKIASGGELSRISLAIQVLTSDQSAIPT
FT                   LIFDEVDVGISGKTASVVGKLLRQLSERCQVLCVTHLPQVACHGHHQFNVEKFTVDNKT
FT                   ETKMTALSQAERVPALARLLGGSEITELALANAQEMLDLVH"
FT   CDS_pept        complement(73385..74275)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00700"
FT                   /product="probable inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="GOA:E7A7V4"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V4"
FT                   /protein_id="CBY80334.1"
FT                   /translation="MNHLYRSFKTIALVGKPRNDINLQMHKNLFHWLMERGYQVLVEKE
FT                   VAITLELPFEHLATLEEIGRRAQLAIVIGGDGNMLGRARVLAKYDIPLIGINRGNLGFL
FT                   TDIDPKNAYSQLEACLERGEFFVEERFLLEAKIERASEIVLTSNAVNEAVIHPAKIAHM
FT                   IDFHVYINDKFAFSQRSDGLIVSTPTGSTAYSLSAGGPILTPNLNAIALVPMFPHTLTS
FT                   RPLVIDGDSKISIRFAEHNTSQLEVGCDSQITLPFIPDDVVHIQKSEHKLRLLHLKNYN
FT                   YYNVLSSKLGWLKSF"
FT   CDS_pept        74267..74971
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00710"
FT                   /product="GrpE nucleotide exchange factor"
FT                   /db_xref="GOA:E7A7V5"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V5"
FT                   /protein_id="CBY80335.1"
FT                   /translation="MIHKMTALEFNIFVIISFFATLCPITINQFCFTEKKMSEQEQKVK
FT                   NPEVENQEEVVVEEAQQADPSQEFDPLEEAIARVQELEEQLKTQIEEAANKEQDILLRS
FT                   RAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALATPANKEDESVKALFDGV
FT                   ELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQISVVLQKGYTLNG
FT                   RVIRPAMVMVAT"
FT   CDS_pept        complement(74984..75328)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A7V6"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V6"
FT                   /protein_id="CBY80336.1"
FT                   /translation="MTSFAQLDIKSEELAIVKTILQQFVPDYTVWAFGSRVKGKAKKYS
FT                   DLDLAIISEEPLDFLARDRLKEAFSESDLPWRVDLLDWATTSEDFREIIRKVYVVIQEK
FT                   EKTVEKPTAL"
FT   CDS_pept        complement(75321..75761)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010235"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V7"
FT                   /protein_id="CBY80337.1"
FT                   /translation="MMTDKLNLNVLDAAFYSLEQTVVQISDRNWFDMQPSIVQDTLIAG
FT                   AIQKFEFVYELSLKMMKRQLQQDAINTDDIGAYGFKDILREALRFGLIEDMSKWVAYRD
FT                   MRNITSHTYDQEKAMAVYAQIDDFLIESRFLLEQLRQRNQYD"
FT   CDS_pept        76042..78165
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00740"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="GOA:E7A7V8"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR012833"
FT                   /db_xref="InterPro:IPR019777"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V8"
FT                   /protein_id="CBY80338.1"
FT                   /translation="MSNFGVIKRDGSRAEFEIQRIINAIKKAASAVNISDEFYCHQIGQ
FT                   EVGNEIFTRHQGEIDINQIQKIVEDKLMASHYPEIARAYIEYRHDRDLAREKRSQLTKE
FT                   IEGLIEQSNVELLNENANKDAKVIPTQRDLLAGIVAKHYAKHHILPRDVVEAHEKGEIH
FT                   YHDLDYAPFFPMFNCMLVDLEGMLSRGFKMGNAEIEPPKSIGTATAVTAQIIAQVASHI
FT                   YGGTTINRIDEVLSPYVQISYEKHLKHAQEWNVPDVEGYAKALIEKECFDAFQSLEYEV
FT                   NTLHTSNGQTPFVTFGFGLGTSWQSRLIQQAILKNRIRGLGKNHKTPVFPKLVFTIKKG
FT                   LNQTKGDPNYDIKQLALECASKRMYPDILNYDQVVKVTGSFKAPMGCRSFLGAYEENSH
FT                   EIHDGRNNLGVVSLNLPRIALESKNEEDFYRTLDERLAIAKKALMTRVARLENTKARVA
FT                   PILYMEGACGVRLKADENVAQIFKNGRASISLGYIGIHETINALYKKGHIFDDEQLREK
FT                   GIAIVRHLSEAVKRWQKETGYAFSLYSTPSENLCDRFCRLDTKKFGVIEGITDKGYYTN
FT                   SYHLDVEKKVNPYDKLDFEMSYPPLASGGFICYGEYPNIQHNLKALEDVWDYSYDRVPY
FT                   YGTNTPIDECYECGFTGEFECTSKGFVCPKCGNHDSTKVSVTRRVCGYLGSPDARPFNA
FT                   GKQEEVKRRVKHL"
FT   CDS_pept        78284..79144
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00770"
FT                   /product="acyl-CoA thioesterase II"
FT                   /db_xref="GOA:E7A7V9"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR025652"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7V9"
FT                   /protein_id="CBY80339.1"
FT                   /translation="MSDILNNLIHLLKLEKIDDLIFRGESQDLGFRQVFGGQVVAQALS
FT                   AAMQVAPEDRILHSCHAYFLAPGDSQYPIIYDVETLREGRNFSALRVKAIQHKNTICHV
FT                   TTSFQVLEKGFEHQNSMPNVGAPEDFTDENVMLQKVAQTLPEPLNEKFAAERPFEVRTK
FT                   YLNNPFNGTKLPAEQYSWFKTNGETPLDIKIQQCLLAYFSDFHCILTALHPHEKGFLQK
FT                   GMKVATIDHSIWFHRPFDLNHWHLHAIESNNAFGGRGLARGQIFSQDGQLIATTQQEGL
FT                   IRFNE"
FT   CDS_pept        complement(79305..80684)
FT                   /transl_table=11
FT                   /gene="cysS"
FT                   /locus_tag="HIBPF_00780"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A7W0"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W0"
FT                   /protein_id="CBY80340.1"
FT                   /translation="MLKIFNTLTREKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFV
FT                   CFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALN
FT                   VLRPDFEPRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQL
FT                   QAGARIEINEIKKNPMDFVLWKMSKENEPSWASPWGAGRPGWHIECSAMNCKQLGEHFD
FT                   IHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVL
FT                   NHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTALRGTDQSAVVFGGENFVE
FT                   TFREAMDDDFNTPNALSVLFEMAREINKLKTEDAEKANGLAARLRELGAILGLLQQDPE
FT                   KFLQAGSDDDEVAKIEALIKQRNEARAAKDWATADAARNELIAMGIVLEDGPNGTTWRK
FT                   Q"
FT   CDS_pept        80787..81296
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00790"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="GOA:E7A7W1"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W1"
FT                   /protein_id="CBY80341.1"
FT                   /translation="MVTLHTNFGDIKIKLDFDKAPVTAENFLNYCKEGFYNNTIFHRVI
FT                   DGFMIQGGGMESGMHEKATKAPIQNEANNRLSNKRGTIAMARTSDPHSATAQFFINVAD
FT                   NDFLNYRSKEMFGREVVQEWGYAVFGEVVEGMDVVDKIKKVKTGNKGFHQDVPTEDVVI
FT                   TLVSVK"
FT   CDS_pept        81351..82139
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00800"
FT                   /product="putative deoxyribonuclease"
FT                   /db_xref="GOA:E7A7W2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W2"
FT                   /protein_id="CBY80342.1"
FT                   /translation="MPFFDTHTHLDYLQQFTGEPLSQLIDNAKQADVQKILVVAVKEAD
FT                   FKTIQNMTALFPDNLYYGLGLHPLYIQEHAENDLILLEQALKNRDANCTAVAEIGLERA
FT                   IPDLLTDELWAKQCHFFESQLYLAKQFNLPVNIHSRKTHDQIFTFLKRIPLSKLGVVHG
FT                   FSGSYDQAKRFVDLGYKIGVGGTITYERANKTRQAIAKLPLDALVLETDSPDMPVFGFQ
FT                   GQPNRPERIVESFKALCTLRNEPAELIKKLTWENACQIFS"
FT   CDS_pept        82469..82741
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00810"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W3"
FT                   /protein_id="CBY80343.1"
FT                   /translation="MRGPYTSLVDLFESALPDILMLEFSTPRAGELSSLLASEILRQKC
FT                   ILGLGVINPRSDEVETVAQIVQLAEKALNYLPPEQISKFQTKKPH"
FT   CDS_pept        complement(82791..83114)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00820"
FT                   /product="thioredoxin"
FT                   /db_xref="GOA:E7A7W4"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W4"
FT                   /protein_id="CBY80344.1"
FT                   /translation="MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDEL
FT                   VSEFAGKVKIVKMNVDDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALAKTQLANFIN
FT                   QHI"
FT   CDS_pept        complement(83234..84229)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00830"
FT                   /product="fermentative D-lactate
FT                   dehydrogenase,NAD-dependent"
FT                   /db_xref="GOA:E7A7W5"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W5"
FT                   /protein_id="CBY80345.1"
FT                   /translation="MKIAIYSTKSYDRKYIELINAKYNFDLEFFDFMLNESTVRLAEHC
FT                   EVVCIFVNDNGSRKVLEKLAALGVKIVALRCAGFNNVDLKAAQDLGIQVVRVPAYSPEA
FT                   VAEHTIGLMMTLNRRIHRAYQRTREANFSLEGLIGFNMYGRTVGVIGTGKIGIAVMRIL
FT                   KGFGMNILAYDPFKNPVVEELGGQYVELDELYAKSHVITLHCPATPENYHLLNREAFAK
FT                   MKDGVMIVNTSRGSLIDTQAAIDALKQRKIGALGMDVYENERDLFFEDKSNEVIQDDIF
FT                   RRLSSCHNVLLTGHQAFLTEEALTNIADVTLSNIYKLKSGKVCENIVLPS"
FT   CDS_pept        complement(84242..85351)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00840"
FT                   /product="cystathionine gamma-synthase, PLP-dependent"
FT                   /db_xref="GOA:E7A7W6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W6"
FT                   /protein_id="CBY80346.1"
FT                   /translation="MTQQYAIDTLLAQAGNRSDERTGAVSAPIFLSTAYGHCGIGESTG
FT                   FDYTRTKNPTRTVLEETIAKLENGDRGFAFSSGMAAIQVLMTLFTAPDEWIVSSDVYGG
FT                   TYRLLDFSYKNNNSVKPVYVNTASASEIEAAINPNTKAIFIETPSNPLMEECDVVEIAK
FT                   LAKKHNLMLIVDNTFLTPVLSRPLDLGADVVIHSGTKYIAGHNDALVGLIVAKGQALCD
FT                   RIAYIQNGAGAVLSPFDSWLTIRGMKTLSLRMKRHQENAQAIAEFLRAQPQVESVLYPN
FT                   KGGMLSFRLQDEAWVNTFLKSIKLITFAESLGGTESFITYPATQTHMDIPEPERVARGI
FT                   TNTLLRFSVGIEDVEDIKADLLQAFANLK"
FT   tRNA            85598..85670
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:85631..85633,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 69.72"
FT   tRNA            85598..85673
FT                   /product="tRNA-Gly"
FT                   /note="codon recognized: GGC"
FT   gene            85680..85753
FT                   /note="tRNA-Cys-1"
FT   tRNA            85680..85750
FT                   /product="transfer RNA-Cys"
FT                   /anticodon="(pos:85712..85714,aa:Cys)"
FT                   /note="tRNA Cys anticodon GCA, Cove score 41.52"
FT   gene            85781..85867
FT                   /note="tRNA-Leu-1"
FT   tRNA            85781..85864
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:85815..85817,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 52.82"
FT   tRNA            85919..85991
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:85952..85954,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 84.38"
FT   tRNA            85919..85994
FT                   /product="tRNA-Lys"
FT                   /note="codon recognized: AAA"
FT   CDS_pept        complement(86542..88143)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00860"
FT                   /product="phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W7"
FT                   /protein_id="CBY80347.1"
FT                   /translation="MKIIKTCIIDDEELELADELIVLELNNTGRGFVTVRTEKDCIGKS
FT                   AVFEMGEYDHYYKWFDGIVEREQSAENGYKKLFIREKVAVFEKPLNCSHRHITLRDLCA
FT                   WITSQTKIPVKVPQADYADTPISLFTHNGSGYQLLANIGRQYQIADYMWQQSPDGSLFV
FT                   GSHKDSRWAGKNIELDESITLTSGSNDMTIPITAAIRPGAIINGNKIQKVELSGDDYVL
FT                   SWENLGKDGKPEQKSPERRQMEKTFPELAGGYHLPKYAKVIGVADPSSGGDISDPFRPK
FT                   YAVELQLLDENGNEDKTVPVYPAVPLPVTSTGSQGGDFAFPEVGTMVEVGFAYGRSDQP
FT                   FVRTMLAQGKTVPSVAPGEQLKQQRPEVYERTDAAGNKIRETDQKITDKSFERHIETDS
FT                   EVKQIGTSTKTVDSDSTQTIGGNKTVSVLGSINDTTASNRTVGTGGTLQEKIVGLAQRV
FT                   SDEKNKFVAPLSYMGTESQNIFRLLEDTIQLLGEVASAVATHTHRGSPPPDQASTFNQQ
FT                   ANKAKTIKSKLTPIIE"
FT   CDS_pept        complement(88144..88704)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00870"
FT                   /product="phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W8"
FT                   /protein_id="CBY80348.1"
FT                   /translation="MQKRNPSVQLALNGTPIYLNNILMSVSVKREEKDMSGQKSSTKKS
FT                   DKGVKAKELSVTGFIPYNRKEWLTQLFNLAEAETGKGEQTKYRVSCTVAEAVNMREVQF
FT                   SGEVSATEQNGQLGWSISFRLREVNSVAEKKDQRKKKPKVKTQGENAPVAKSAGENSGK
FT                   SGEENKSDERKGLLKDVDDWIGS"
FT   CDS_pept        complement(88691..89467)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00880"
FT                   /product="phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7W9"
FT                   /protein_id="CBY80349.1"
FT                   /translation="MLNMWKQQKLKLSPQAKTTLQNAQKGIISPFSLSVSGTKLGVHNW
FT                   SHGIKEKSNHYLSPENAVKALAAKLVDYADPNRPKGVQDVVVIMVTSSNIDQFIAELEK
FT                   VRELLPEPTFKQALDYAKSSKDLQETKMIKTPTMASPSFSNSADITPGSARTMQSILRN
FT                   ATSAAVAAQTKDPMTMIEALKAAKKERDKANNEKVEKMLNTSANVYAFVVSDYLEIAES
FT                   KMKVNVPKSSNVFTTCVMFIGADLTNIRGMLQNAET"
FT   CDS_pept        complement(89477..89746)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00881"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X0"
FT                   /protein_id="CBY80350.1"
FT                   /translation="MDIKRKLTRYGYHVIIAIDQLFNAITGGAADETLSSRTYRGAILA
FT                   ENPKKRWRVLYRVINGIFFDRNHCKTAYESELNRKQYSEDFIIN"
FT   CDS_pept        complement(89725..90339)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00890"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X1"
FT                   /protein_id="CBY80351.1"
FT                   /translation="MTIYYKNGFFDDTDGGFVPESAVEISQETYLELLNGQAQGKQIIT
FT                   DKTGYPVLIDPQPSAAHELNLDTLTWEISAEKQTALFAQQKEGLLNKLADKADQLKNGL
FT                   LAGYPQTEIESFYRQEKEALAWQADHNTATPMLTQIAQNRGVPFEILVEKVIEKSAQFA
FT                   VSIGIIIGQRQAFEDRLLALKTPEELTALEQEINEWTLNAN"
FT   CDS_pept        90418..90696
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00900"
FT                   /product="plasmid maintenance system killer"
FT                   /db_xref="InterPro:IPR007711"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X2"
FT                   /protein_id="CBY80352.1"
FT                   /translation="MILSFKHKGLELFFKTGSTSGIQTKHASKLNLLLTALDAAQTPLD
FT                   MAVPSWNLHPLKGNLAEHWSVKVNGNWRLTFRFNEGNVEIVDYQDYH"
FT   CDS_pept        90707..91024
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00910"
FT                   /product="plasmid maintenance system antidote protein"
FT                   /db_xref="GOA:E7A7X3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR013430"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X3"
FT                   /protein_id="CBY80353.1"
FT                   /translation="MRMHNPAHPGIILREYLNGASITDVAKRLGISRVALSRIVNAQAS
FT                   ITPEMAVRLSQLLNNTSPNFWLNMQANYDLWQIKQHKTFNITPLFPEASLSSMKATVTW
FT                   A"
FT   CDS_pept        complement(91070..93751)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00920"
FT                   /product="tail fiber protein"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X4"
FT                   /protein_id="CBY80354.1"
FT                   /translation="MASLITPQFERYVAEQTIARGTVQFDEFIFANIPGLNEHNLAQYL
FT                   TMPTSAQIVHRQAVSQSGVINENAVVYSVTIGTEVGDFDFNFIGLINRSKNLLAVAVQT
FT                   DTVKKIRNKNAVQGNSITRNILLEFSGAKALTGINVNANTWQIDFTVRLHGLDEKIRLT
FT                   NRDLYGRAVFFDDSFLVKRKTGHQFTIQPGTAYVEGVRMDLGAEHHLTANSLPCSIYAD
FT                   VVHHCTVTGEYQTEIKYLTQSKADYVDTVNRQHYVQILADIDSQGNVTDRRLLSPFLGM
FT                   NPLTLDDTTENNKDKQGHTHKLPIASLVKKGIVKLFSGYDSDAEDMAATSKAVKIAYDK
FT                   AVEAKTTADGKVGLNGNESINGEKSFENRIVAKRNIRISDNPIYASRGDYLNIGANDGD
FT                   CWFEYKSSNREIGTLRMHANGDLTYKRQKIYHAGAKPQFNTDIEGKPNTLAGYGIGNFK
FT                   VEEFRGNLNTLKTDGIYAITQASRSQNLPVSTSCHIQVIAGGDGAWCRQLAYVAYSTDM
FT                   YERHQTSYQTDSWSAWKKLNTDGIPIGAVVSFPRAVTNPVGFLKANGATFNQQTFPDLY
FT                   RVLGNSNQLPDLTRSDVGMTAYFAVDNIPTGWIAFDEIATQVTEQRYPELYRHLVGKYG
FT                   SINRVPKVADRFVRNAGNGLSVGQTQEDELKRHVHKHIENNTATNPLFYNDKTFDYSSR
FT                   DSTDRESLDIATAVIDNNNDNWWITPNINSNFATGGNENRPKSLILKLCIKAINSFDDV
FT                   VFWIKSHGEVTNAGALDAGRLAQGLQDKADRNHTHTVSQITDFNPSVREIVTQSITQGF
FT                   SQNLAETGWCKLPNGMILQWGKVRDGVVTYFPIAFPVRCCAVTLGQIMNVYSYDAALYF
FT                   YNKTNFRAYIQRGEAVYIAIGY"
FT   CDS_pept        complement(93778..94302)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00930"
FT                   /product="phage protein"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X5"
FT                   /protein_id="CBY80355.1"
FT                   /translation="MKIKLPFWMDKGELNKVAVLFGKWWDYVLSAVKFPFNILDEEHCS
FT                   ERILNLIAYQRDVERFEGEPLELFRKRVKYAFLNAKDAGSKAGFIRIFERLGIGYVEIE
FT                   ERFDRENWDVIKIRISDSQLAKKTALLNLIIRKYSRTCRRYTFEVITKETVSIYHGEFN
FT                   HDHQSFYVKVN"
FT   CDS_pept        complement(94312..95481)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00940"
FT                   /product="phage protein"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X6"
FT                   /protein_id="CBY80356.1"
FT                   /translation="MSENFKQMLAESGLPTEETQIRQEFERLTAEEGLITNTSRMSPFW
FT                   RLITAIAVKPVKWLTDHLIAEILPNLFVKTAKDSWLQLQAWTVGLDFKAATKAEGVVHF
FT                   TKESDVTDLTIKAGTVIQTERINDVIFRLIVTKDTIIPKGVLRAPVPVIAEQAGANFNL
FT                   ATGYYRILPESIAGISAVENLGDWLTSPGADRETNDELRERYRTQFSSVGQHHIDSVYK
FT                   GMIAKVAALSVDRIYFKHDAPRGPGTANAYLLLDTGVTSQPFIDKVNRHVRDEGFHGHG
FT                   DDLLCFAMPETRHNVTCTIYFHSTIFVGDVRRQEILSQVENMIRAAFRENNNYNVTKTY
FT                   PFRRFSWSKLGEEIHDSIGEIASIVWGQADIQSELSIPRIQQLSVTVQK"
FT   CDS_pept        complement(95474..95809)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00950"
FT                   /product="phage protein"
FT                   /db_xref="InterPro:IPR019697"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X7"
FT                   /protein_id="CBY80357.1"
FT                   /translation="MEKLYLDLLITGEDMTRDSGNQPLICDNRISIAQDIKHAILESGL
FT                   ATQLIAERSRIFRRDIILQMVLLVEEDARLIPGTVSISEARLGQLFITAETYEFGRLDE
FT                   LELRLNE"
FT   CDS_pept        complement(95813..98089)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00960"
FT                   /product="phage protein"
FT                   /db_xref="GOA:E7A7X8"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X8"
FT                   /protein_id="CBY80358.1"
FT                   /translation="MSAVQGLEYIISLTDQLSAPLKGVMKSIDDLGKRGEAAMKKIGLG
FT                   VAGIVGAGFALKSALDPAIELNRAIGEVRSLGVADDALEKLSKTALNFSSQYGESAVDF
FT                   VRSSYDIQSAIAGLNGNELAEFTKTSNLLAKGTKASAATITNYMGTMYGIFAEDATKLG
FT                   NANWVNKIAGQTALAVKMFKTSGDGMSAAFKSLGAAAKSAKIDVAEQVGVLGNLQASMS
FT                   GSEAGTKYKAFLAGVGATQKELGLSFVDTNGDMLDMVTILNKIKGKFGDTLDVAQATKL
FT                   KKAFGSDQAVDLIKFLLPKTKELKNNIADIAKVSDTKALAQMARSMVDPWSRLSQIITG
FT                   VKTAIGGEILKKLDPIMHKVADLGQEFIDWLKTYKNIARWIGYIIGASIGFAAVAATIS
FT                   LVSGAMGLLKVGAIAAFAPIRGLLSLMSLLGKPLVLIRSAIMLIFAGFKTLISVVWAVI
FT                   NPLKMLRLVFAFAFSPLSILLLAGLAIYKFRHQLKDLWNGVKQGFGSLESHLAPLYRAF
FT                   DIVKSAGQKVSNAIGRIAGLFSANAESAMLFQNVGVAVGQAIGFAFDVVLFVIELIARQ
FT                   IEAVATIFSNVADVIIATWHNVIDDWESKSAWDIFKGLATGIGQIFTTILKGIKDQFIN
FT                   TINWIIDKVNIVSGKIGFELPKIPNTWLSDHAQVTTVTAASNISSLGLNAAVDNASWKK
FT                   SPSIDLPNNLKPQLNSMPQGSVTKTLTQNRTEQRTINYGGLAFYGYDKREITQELRNKE
FT                   QLAAG"
FT   CDS_pept        complement(98276..98584)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00970"
FT                   /product="phage protein"
FT                   /db_xref="InterPro:IPR024406"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7X9"
FT                   /protein_id="CBY80359.1"
FT                   /translation="MEKTQAQTLLEKLTGNLKDSVTLNIAGVDFTFIRDNAAYDQMLND
FT                   IESNNKVTPIKDYLLAIVAREQKEALLEIIHVPTLAAQLAAKVNEVFVPEIQITVKN"
FT   CDS_pept        complement(98765..99112)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00980"
FT                   /product="phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y0"
FT                   /protein_id="CBY80360.1"
FT                   /translation="MFGGIMEFKALFMGVFLMVFVGCIGSTLHYKKQAETTALLLKQNE
FT                   QTIEQNKVMLQRYERQHAKLTYQLNHANKKAEQRSQQLKDVLNNAENKNWTNERVPNDV
FT                   AGVLNQRTTTK"
FT   CDS_pept        complement(99097..99657)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_00990"
FT                   /product="lysozyme precursor phage protein"
FT                   /db_xref="GOA:E7A7Y1"
FT                   /db_xref="InterPro:IPR002196"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y1"
FT                   /protein_id="CBY80361.1"
FT                   /translation="MSKKLGAMILCSAAAVVTAFFAQQKDLPAQQQNQVSLKAVSMIVN
FT                   LEGCVRNPYKCPADVWTNGVGNTHNVDKTKILTIDEVAVDLRQNIKQAENCINADFNGR
FT                   KMNQDQYDAMISLAFNVGCGNIKTYYSKTQGKRVATTLYRAAQAENWILMCNRIEDFNK
FT                   SAGRVLKGLQIRRAKEKALCLGE"
FT   CDS_pept        complement(99973..100425)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01000"
FT                   /product="phage protein"
FT                   /db_xref="InterPro:IPR019708"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y2"
FT                   /protein_id="CBY80362.1"
FT                   /translation="MERISGMSFDFYLFGLPIHAESISLSITDNSAVVQTRGIPDGWAS
FT                   GDVTAEGEIELDAKNFSKLSAAAAAAGSYRSLPETDFTFFAQRGGIRDKVETFGNKIIL
FT                   TDVLSIDPKGGAKSTKKLKYFVTSPDFVRINGVPYLSDEDTRDLLG"
FT   CDS_pept        complement(100429..101559)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01010"
FT                   /product="tail sheath phage protein"
FT                   /db_xref="InterPro:IPR019694"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y3"
FT                   /protein_id="CBY80363.1"
FT                   /translation="MFPSVQINALNQLSGETKEIERHALFVGIGTTNQGKLLALTPDSD
FT                   FDKVFGETDTDLKKQVRAAMLNAGQNWFAHVYIAQEDGYDFVECVKKANQTASFEYCVN
FT                   TRYLGVDKASIGKLQECYAELLAKFGRRTFFIQAVQGINRNTSDGETWDQYVQKLTTLQ
FT                   QTLVADHVCLVPLLFGNEAGVLAGRLANRAVTVADSPARVQTGALVSLGSANKPLDKDG
FT                   NELTLAHLKSLETARYSVPMWYPDYDGYYWADGRTLDVEGGDYQVIENVRVVDKVARKV
FT                   RLLAIAKIADRSFNSTISSTEYHKNYFAKPLRDMSKSATINGKDFPGECMPPKDDAITI
FT                   VWQSKTKVTIYIKVRPYDCPKEITANIFLDLDSLGE"
FT   CDS_pept        complement(101821..102546)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01020"
FT                   /product="phage protein"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y4"
FT                   /protein_id="CBY80364.1"
FT                   /translation="MSILMGLKPGTVEKLKHTLLYLRLTPKMRNQVMQKVLWRLKKNAE
FT                   KNVSHQQSPDGKTWTPRKKKLKGGVRKNKLLKESATNLNSKLEQQGERGKLFYKNPHWA
FT                   KVRAIHQYGLEVPVEQTEKDKKALAKLLAQNNQPATPQQARRLRELGYQVRNGKTKTGK
FT                   QKYKKVRLKSIRQTMSRGQAGLIIRMMEKQKGINIRRGLASYKMAKREFLDENPKRNAD
FT                   IITEELLKGFEKAGYHLQP"
FT   CDS_pept        complement(102543..103025)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01030"
FT                   /product="phage protein"
FT                   /db_xref="InterPro:IPR009678"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y5"
FT                   /protein_id="CBY80365.1"
FT                   /translation="MATVKKMRYQQLTAFLLTKLPKRYHGNFYSWIEDGKLLNEGRQVT
FT                   ENGIEVCHLSYNGVFHFEALPFNEISPAYLMAHIQVWVNENDPMRDVLDESEIPFDLDI
FT                   IDDNTADLIFTIAFREPLTAMEDSEGELKIEGVNYRLDDIDVFTAEYIDVVVTVEQ"
FT   CDS_pept        complement(103013..103465)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01040"
FT                   /product="phage protein"
FT                   /db_xref="GOA:E7A7Y6"
FT                   /db_xref="InterPro:IPR009225"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y6"
FT                   /protein_id="CBY80366.1"
FT                   /translation="MFNGRTQDYDDTVITNNGFWSDIYVEEFQKQRAIPLQIPVEMVKT
FT                   ALIAAMQGVNLDLAEVEENHRKSAVNSVTEISSSLINGENYAETLYKKAVFARAKAELL
FT                   PEFNTLSGREIHQNRDYVTEQKSLLAEATHAIRTLKGKKRGSVWLL"
FT   CDS_pept        complement(103458..104276)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01050"
FT                   /product="phage small terminase protein"
FT                   /db_xref="GOA:E7A7Y7"
FT                   /db_xref="InterPro:IPR010270"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y7"
FT                   /protein_id="CBY80367.1"
FT                   /translation="MQALAEINQVSESNTQQSAVATHGNDYAVLEIALQNDVNAVRAFQ
FT                   TRAEKLDYKRNRFLPKWLPFVNEYLDKGAIYQNDYLVYCIVYLFDIADFDRALSLAEKA
FT                   IEQNQSMPQGWQTTLPNFVADQIYNWTDKTAAAGQSVEPYFTQTFKNVATQWKLHEIVT
FT                   AKWLKLAAALLLRSPQGKVQASGIDDAETLVLAIQLCNRAFQLNQKAGVKNMIERCVMR
FT                   LNALAKSGDYDPNRLPQVAGLSLEPSQIDFDLVIKKLTARPLQNSEEGNV"
FT   CDS_pept        complement(104317..105327)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01060"
FT                   /product="phage major capsid protein"
FT                   /db_xref="InterPro:IPR006441"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y8"
FT                   /protein_id="CBY80368.1"
FT                   /translation="MNKQAYYALVAALAKHFNQPMDSILRGESFSLKAPEAALLGENIQ
FT                   QRSDFLKQINMVQVAHIKGQKLFGATEKGITGRKQTGRNLANLDHTQNGFELSETDSGI
FT                   IVPWALFDSFAIFKDRLVELYSEYFQNQVALDILQIGWNGQSVANNTTKTDLSDVNKGW
FT                   LKLLQEQRAANFMTESTKSSGKITIFGDNADYANLDDLAFDLKQGLDFRHQNRNDLVFL
FT                   VGADLVSKETKLIQKKHGLTPTEKAALGSHNLMGSFGGMNAITPPNFPARAAAVTTLKN
FT                   LSVYTEAESVRRSLRNDEDKKGVVTSYYRQEGYVVEDLGLMTAIDHTKVKLNGEA"
FT   CDS_pept        complement(105331..106218)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01070"
FT                   /product="phage capsid scaffolding protein"
FT                   /db_xref="GOA:E7A7Y9"
FT                   /db_xref="InterPro:IPR009228"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Y9"
FT                   /protein_id="CBY80369.1"
FT                   /translation="MNKSKLKTDFICIATSGYTVDGRQITAQELHEMAETYDPEHYTAN
FT                   LWPEHRRYFSCGEVLEVKAEEQENGEVKLFAKIAPNQQLIDFNRDGQKLFTSVEIAGNF
FT                   RNSGKAYLSGLGVTDSPASVGTTKLDFFNHQDKVQCSEFINIDFTEQKNDEEKMTRSFF
FT                   NAIKQFFSSSEQQEEQSTPHNNNNKEDDAMNDKQFEQLIEAVNGLGAKIDNHFSAKVET
FT                   KEPKNKPEEKKDEQPQSVTAEQFNQLLTTVQALDKKFNELSQEQTTVPSGVPTVESENV
FT                   YSLNGYNIDLSKGF"
FT   CDS_pept        106422..108092
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01080"
FT                   /product="Probable phage terminase ATPase subunit protein"
FT                   /db_xref="GOA:E7A7Z0"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR010332"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z0"
FT                   /protein_id="CBY80370.1"
FT                   /translation="MTESKLRKRKTKRYDDEVIYAAKFLYLKKYTPKEIAEELGLNSTR
FT                   PIYYWAEKYNWRNLISESGIEELIALRIITLTERENKSDQEIKELEALIDKDIQYKKQR
FT                   VATVAKVTAKSAVNSADVSGNERAFADSGDGDERKKKKRVKNDISHVTPEMCQPFIDSL
FT                   FDYQKHIRANKHHDVRNILKSRQIGATYYFSFEALEDAIFSGDNQIFLSASKRQAEIFK
FT                   NYIVKMAREYFGVELTGNPIILSNGAELHFLSTNKNTSQGNSGHVYGDEYAWIRDFQRF
FT                   NDVASAMATHEKWRETYFSTPSSKFHESYSFWSGDNWRDGDPKRKNVSFPTFAELRDGG
FT                   RLCPDGQWRYVVTIEDALKGGAGTLFNIEKLKQRYSKYAFNQLYMCVWIDDADSIFTVH
FT                   QLLKCGVDISKWKDFNPKADRPFGDREVWGGFDPAHSGDGASFVIIAPPALPSEKYRVL
FT                   ARYQWQGLSYVYQANQIRALYEKYNMTYIGIDATGVGYGVYELVKEFARRAATAIIYNP
FT                   ESKTGMVLKVHDLVEHGQIEWSEKELDILSTNQQNLAIR"
FT   CDS_pept        108216..109250
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01090"
FT                   /product="phage portal protein"
FT                   /db_xref="InterPro:IPR006430"
FT                   /db_xref="InterPro:IPR006944"
FT                   /db_xref="InterPro:IPR030935"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z1"
FT                   /protein_id="CBY80371.1"
FT                   /translation="MKTNVTDNKKGIVIAPINDRTFSLNEISASPALDYVGIGFDENYN
FT                   CYLPPVNRHALAKLPHQNAQHGGILHSRANMVSALYEGGKALSRMDMRALCLNLIQFGD
FT                   VGLLKVRNGFGQVVRLVPLSSLYLRVRKDGGYSYLMKKSLYDTAQEIYRYDAKDIIFIK
FT                   LYDPMQQVYGSPDYVGGIQSALLNSDATVFRRRYFSNGGHMGFILYSTDPDLTEEMEEE
FT                   IAKKISESKGVGNFRSMFVNIAGGHPDGLKVIPIGDTGTKDEFANIKNISAQDVLTAHR
FT                   FPAGLSGIIPTNTGGLGDPLKYREVYHYDEVMPLQEIIAETINQDPEIKNLLKIKFREQ
FT                   NFAK"
FT   CDS_pept        109332..109592
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01100"
FT                   /product="phage transcriptional activator"
FT                   /db_xref="InterPro:IPR007684"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z2"
FT                   /protein_id="CBY80372.1"
FT                   /translation="MAKTTNIYCRICNSKAVIEKSEPMNNEFTRYYCACKNPLCGHRFV
FT                   MNMEFSHTTRSSKLTKDKLLELVLSKLSIEEKAHLRKILEG"
FT   CDS_pept        complement(109623..110030)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01110"
FT                   /product="protein of unknown function"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z3"
FT                   /protein_id="CBY80373.1"
FT                   /translation="MLYPIGIEMGDENHTYGVVVPDVPGCFSAGDTLEEAFINAKEAIT
FT                   FHIEGLLEDGEEIPQPTSLQEHVKNPEYEGFTFSFVDVDLTHLMGKAEKINVTLPSLLI
FT                   KRIDSFVATHPEYKNRSNFLAQVVTNKLLAA"
FT   CDS_pept        complement(110353..110871)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01120"
FT                   /product="phage DNA methylase"
FT                   /db_xref="GOA:E7A7Z4"
FT                   /db_xref="InterPro:IPR008593"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z4"
FT                   /protein_id="CBY80374.1"
FT                   /translation="MNKSNTKKSDKDLWATPWWVFYYAEQYFNIKFDLDACAMEHNTKV
FT                   KNFISPEQDTLTADWQGRYCWMNPPYSNPLPFVLRAISQSVLHNKTVVMLLNVDGSTKW
FT                   FDMCVRNAKEIVYITNSRIPFINNETGEETDQNNKPQMLVLFEPKAPYGSLKSSYVSLH
FT                   TMKESNNKK"
FT   CDS_pept        complement(110881..111186)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01160"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A7Z5"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z5"
FT                   /protein_id="CBY80375.1"
FT                   /translation="MNKRKQKQLRRIMAAKRAEKCGQIDLKNLQAQVWDLAVQSQQTAS
FT                   WVKTQGETHRLLYRYFSKEIARLEKRRTPELILLAMASGFLGGAVVGYVLWLLAIL"
FT   CDS_pept        complement(111198..113537)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01220"
FT                   /product="bacteriophage replication gene A"
FT                   /db_xref="GOA:E7A7Z6"
FT                   /db_xref="InterPro:IPR008766"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z6"
FT                   /protein_id="CBY80376.1"
FT                   /translation="MQSMWEQQRDNTVSAKKAHMAVVACERYQAAENGHKFDRTSLPFD
FT                   ERYYTPLQLELFATNPVDFEFIEQKLENLPRQRQREYFRKLYIKAYRSVKDDGSIVFAL
FT                   GNKQRRYANDYLRNVLDVRLQKVFSQYNVNVDFLQTFINTPQWLLSVKDEMQQAVQFST
FT                   VPTREELSKHYNELHYSGFHFQLFGIQQKQKQLPFYLITERKLKKMAYEMAAAFIRFQC
FT                   DCSHFLKNGIEKDNEGDIQGYFYQLYKWCGEIALSAGFKIPHWEKIENDKRIKGEYIDS
FT                   TLLRLTCEKWWFKQMRDIQKRMVEHIAIACGEVRANAASYISNQSFQEWQLQQRKNHDY
FT                   LRAMIIENIDNPEEQVELFDMFLKSSSNPALRRNEMMVRLRGLEEWAEENNNEALFLTL
FT                   TAPSSFHAGNGNKKWSGVNPRDTQNYLNKVWQQFRALLSKRNIKFYGMRVAEPHKDGTP
FT                   HWHALFYVQAEHKEEVIRLFKQKALELDGNEKGAAEHRCKVEECDKTKGSATAYIAKYI
FT                   AKNIDGFALAGEVSDEDPTLSLHDNALRVRAWASRWGIRQFQFYGGASISVWRELRRLI
FT                   SGQADDEIINKAQAAAGIANDYAAYMEIQGGALAKRTDQPIKLDYETKPANKYGEQRKA
FT                   IIGLANRFSLKQVISRTKKWQIKKRPQDFAQRAESMVEHSSTASNSARSAPWTWTWTCV
FT                   SNCNRSILEQKIKLLIQSICAPLSAQKLDYLFKYKRLIIDKYTAIELTENDVQLVKRNQ
FT                   NMMTSLSPVPRNIQKLKDFHKNNRIQ"
FT   CDS_pept        complement(113598..113933)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01230"
FT                   /product="phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z7"
FT                   /protein_id="CBY80377.1"
FT                   /translation="MYVSENESVVEKWYRENGIPMSKARNSEETLHEMGLSKYPTERAF
FT                   NHISDEQKGMLKALADIEPFEDYILPDLTGDKLWHYNEKGIDKLTKAFHAMSALRTPFP
FT                   RALTRRD"
FT   CDS_pept        complement(113952..114455)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01240"
FT                   /product="phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z8"
FT                   /protein_id="CBY80378.1"
FT                   /translation="MTKSSFTFFFQEYCEKHNLTNEEIQERFAILQYQAEVERDTTQAH
FT                   QQLSAIFAKCREGYPRKQANNDETTSQYTGAEHQVIRDLFASLKQSAREAHSLHHQSHQ
FT                   GDVQVHAKSNPSRVLEVPAVTEVDKSVLAYLEAFFASDRSSSEILKLSNRLFNLGQAYN
FT                   KSGK"
FT   CDS_pept        115138..115512
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01250"
FT                   /product="putative bacteriophage CI repressor protein"
FT                   /db_xref="GOA:E7A7Z9"
FT                   /db_xref="InterPro:IPR010744"
FT                   /db_xref="UniProtKB/TrEMBL:E7A7Z9"
FT                   /protein_id="CBY80379.1"
FT                   /translation="MENRIDLNSYEIIERMKKICNVHTDKELATVIGIQPPSVNKWKVR
FT                   NLVPLGPLLIISNQFSVSLDWLIFGCASNDLSTHEKLALIAFNDLDDHKKLEAIAFMTG
FT                   LKTSSSQTGAITQHVSGSKK"
FT   CDS_pept        116548..116859
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01260"
FT                   /product="putative plasmid stabilisation system"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E7A800"
FT                   /protein_id="CBY80380.1"
FT                   /translation="MPWAQIMARRLFVNALAGDDLQLIFDYGVERFGQIQAALFLDKFY
FT                   DAFSLLCEFDVGVACFDIQPNLYRYVVQGYVIFFERTSSALNVLRVLHGSQDVETQFS"
FT   CDS_pept        116862..117875
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01270"
FT                   /product="phage integrase"
FT                   /db_xref="GOA:E7A801"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E7A801"
FT                   /protein_id="CBY80381.1"
FT                   /translation="MAVRKDTKNGKWLAEVYVNGKRSRKWFLTKGDALRFYNQAKEGAQ
FT                   SAVDSVTVLASDDLPVLSFYVQEWFDVHGKTLSDCEARLAKLKNLCANLGDPPANEFNA
FT                   EIFADYRKRRLDGEFSVNKNKPPKEATVNREHAYLRAVFNELKSLRKWTAENPLDGVRL
FT                   FKERETELAFLYERDIYRLLVECDNSRNADLGLIVRICLATGARWSEAETLTQSQVMPY
FT                   KITFTNTKSKKNRTVPISKELFDMLPKKRGRLFNDAYESFENAVLRAEIELPKGQLTHV
FT                   LRHTFASHFMMNGGNILVLKEILGHSTIEMTMRYAHFAPSHLESAVKFNPLSNPAQ"
FT   tRNA            118141..118213
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:118174..118176,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 84.38"
FT   CDS_pept        complement(118424..119701)
FT                   /transl_table=11
FT                   /gene="thrC"
FT                   /locus_tag="HIBPF_01290"
FT                   /product="threonine synthase"
FT                   /db_xref="GOA:E7A802"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:E7A802"
FT                   /protein_id="CBY80382.1"
FT                   /translation="MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPKLNNINELL
FT                   ELPLVERSQKILGALIDGELPQATLDAMVKNAFTFTAPLEKVEDNIYALELFHGPTLAF
FT                   KDFGGRFMAQALAAVRGDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPL
FT                   QEKLFCTLGGNIRTVAINADFDACQALVKQAFDDVELRQTIRLNSANSINISRLLAQVC
FT                   YYFEAVAQLPKEKHDNVVVSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYL
FT                   KSGNWEPKTTVATLSNAMDVSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDSLKA
FT                   MQSKGYLCEPHGAIAYQVLKDQLKASETGIFLCTAHPAKFKESVERILGIQLPLPETLD
FT                   KHNQLPLLSDEMDNDFAQLRAYLLKS"
FT   CDS_pept        complement(119744..120688)
FT                   /transl_table=11
FT                   /gene="thrB"
FT                   /locus_tag="HIBPF_01300"
FT                   /product="homoserine kinase"
FT                   /db_xref="GOA:E7A803"
FT                   /db_xref="InterPro:IPR000870"
FT                   /db_xref="InterPro:IPR006203"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:E7A803"
FT                   /protein_id="CBY80383.1"
FT                   /translation="MLRIYAPASSANISVGFDTLGAAISPIDGSLLGDVVQIESISTGF
FT                   ELESAGYFVRKLPKEPQKNIVYQAYVLFSEQLKLRGANVKPLRLTLEKNMPIGSGLGSS
FT                   ACSIVAALVALNQFHNEPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGVQFMVQSL
FT                   GNICQKLPFFDNWYWVLAYPGIEVSTAEARAILPKSYTRQNVIAHGRHLGGFVHACHTH
FT                   QENLAAIMMKDVIAEPYRESLLPNFAEVKQATRDLGALATGISGSGPTIFSIAPDLQTA
FT                   IKLSSYLESHYLQNNEGFVHVCKVDNEGTREIK"
FT   CDS_pept        complement(120701..123148)
FT                   /transl_table=11
FT                   /gene="thrA"
FT                   /locus_tag="HIBPF_01310"
FT                   /product="aspartokinase/homoserine dehydrogenase"
FT                   /db_xref="GOA:E7A804"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:E7A804"
FT                   /protein_id="CBY80384.1"
FT                   /translation="MRVLKFGGTSLANPERFSQAAKLIEQAHLEEQAAGVLSAPAKITN
FT                   HLVALSEKAALNQSTDTHFNEAIEIFYNIINGLHTENNQFDLNGTKALIDAEFVQIKGL
FT                   LEEIRQAGKVEDAVKATIDCRGEKLSIAMMKAWFEARGYRVHIVDPVKQLLAKGGYLES
FT                   SVEIEESTKRVDAANIAKDKVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASV
FT                   CEIWTDVDGVYTCDPRLVPDARLLPTLSYREAMELSYFGAKVIHPRTIGPLLPQNIPCV
FT                   IKNTGNPSAPGSIIDGNVKSESLQVKGITNLDNLAMFNVSGPGMQGMVGMASRIFSAMS
FT                   GAGISVILITQSSSEYSISFCVPVKSAEVAKTVLETEFANELNEHQLEPIEVIKDLSII
FT                   SVVGDGMKQAKGIAARFFSALAQANISIVAIAQGSSERSISAVVPQNKAIEAVKATHQA
FT                   LFNNKKVVDMFLVGVGGIGGELIEQVKRQKEYLAKKNVEIRVCAIANSNRMLLDENGLN
FT                   LEDWKNDLENATQPSDFDVLLSFIKLHHVVNPVFVDCTSAESVAGLYARALKEGFHVVT
FT                   PNKKANTRELVYYNELRQNAQASQHKFLYETNVGAGLPVIENLQNLLAAGDELEYFEGI
FT                   LSGSLSFIFGKLEEGLSLSEVTALAREKGFTEPDPRDDLSGQDVARKLLILAREAGIEL
FT                   ELSDVEVEGVLPKGFSDGKSADEFMAMLPQLDEEFKTRVATAKAEGKVLRYVGKISEGK
FT                   CKVSIVAVDLNNPLYKVKDGENALAFYTRYYQPIPLLLRGYGAGNAVTAAGIFADILRT
FT                   LQH"
FT   CDS_pept        123462..124163
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01320"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A805"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:E7A805"
FT                   /protein_id="CBY80385.1"
FT                   /translation="MNIQHNLNLIQQKIETACKEENRNQNTVKLLAVSKTKPISEILSA
FT                   YQAGQTAFGENYVQEGVEKIQYFESQNINLEWHFIGPLQSNKTRLVAEYFDWMQTLDRA
FT                   KIADRLNEQRPTNKAPLNVLIQINISDEESKSGIQPEEMLTLAKHIENLPHLCLRGLMA
FT                   IPAPTDKIPEQEAVFRKMSDLFEQLKQALPNQQIDTLSMGMTDDMPSAIKCGSTMVRIG
FT                   TAIFGARDYSK"
FT   CDS_pept        complement(124237..124992)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E7A806"
FT                   /protein_id="CBY80386.1"
FT                   /translation="MAKDEVGHNFLARLGKTRLRPGGKKATDWLITNGDFSQDKKVLEV
FT                   ACNMGTTAIGLAKQFGCHIEGVDLDENALAKARVNIEANGLQEKIHVQRANAMKLPFED
FT                   ESFDIVINEAMLTMLPVEAKKKAIAEYFRVLKPNGLLLTHDVMLVGNDHQTILENMRKA
FT                   INVTVTPLTKDGWKGIFQESGFRNVDAFSGEMTLLSPKGMIYDEGIFGTLKIIRNAMKA
FT                   ENRKQFKRMFKTFNDPEHKLHFIAVCSQK"
FT   CDS_pept        complement(125101..125880)
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tabA8"
FT                   /locus_tag="HIBPF_01360"
FT                   /product="putative trimeric autotransporter adhesin"
FT   repeat_region   complement(125855..125866)
FT   CDS_pept        126230..127786
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01361"
FT                   /product="unknown protein"
FT                   /db_xref="InterPro:IPR018773"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A807"
FT                   /protein_id="CBY80388.1"
FT                   /translation="MANQSNQHNPYDELGYYSKPFSYTSIVLLEGNATFWGLKPPALKG
FT                   AKVLELGSSFGGNLISQAVYYPDTEFIGVDLADSQITQGNEIIQSMGLTNVRLETKNIL
FT                   DITPEFGMFDYILVHGIYSWVPDNVKDKILEICRENLTPNGIAYISYNTYPGWKSREVA
FT                   RDIMLYANKYTQDLPLAEQTRRGKAVVQLFSDAIKSIDSEKIKNHSRVDNFDSIQTDSD
FT                   HYIAHEYLAYHNHPIYLHQFVDSVNQHQLAYIGDTSFQLSYISWMPYHLREMIDQLSET
FT                   DYVVREQCLDYLYDVAFRRSLLCHQHLQESINRTENVEKHLLDKFTFINTNYTNNLSHQ
FT                   FNNQALVRLLEYFIYQVGSFTIQSLTQHIEENKEFANITENELYSAVLSLVILGYVYVY
FT                   LTPYPIYSFEDNKTYIPKRFTQYVKTLVEGANQYIGTGDMYNGSVEDLNKLHLYIMSQM
FT                   EKPTTKAELKSALQGYLIQNEYQDMNNNDKLIDETYDCTELFNALCDVLTRLGYIQPVN
FT                   L"
FT   CDS_pept        127938..128936
FT                   /transl_table=11
FT                   /gene="hitA"
FT                   /locus_tag="HIBPF_01380"
FT                   /product="iron-utilization periplasmic protein hFbpA"
FT                   /db_xref="GOA:E7A808"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006061"
FT                   /db_xref="InterPro:IPR026045"
FT                   /db_xref="UniProtKB/TrEMBL:E7A808"
FT                   /protein_id="CBY80389.1"
FT                   /translation="MQFKHFKLATLAAALAFSANSFADITVYNGQHKEAATAVAKAFEQ
FT                   ETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFADLSEAGLLAPISEQTIKQ
FT                   TAQKGVPLAPKKDWIALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSG
FT                   AFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYN
FT                   LAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEAL
FT                   VAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK"
FT   CDS_pept        129054..130574
FT                   /transl_table=11
FT                   /gene="hitB"
FT                   /locus_tag="HIBPF_01390"
FT                   /product="iron(III)-transport system permease protein
FT                   hFbpB"
FT                   /db_xref="GOA:E7A809"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A809"
FT                   /protein_id="CBY80390.1"
FT                   /translation="MPRRPPFWLTLLIILIGLPLCLPFLYVIFRATEVGLTRSVELLFR
FT                   PRMAELLSNTMLLMVCVTIGAISLGTLCAFLLERYRFFGKAFFEVAMTLPLCIPAFVSC
FT                   FTWISLTFRVEGFWGTIGIMTLSSFPLAYLPVSAILKRLDRSLEEVSLSLGKSPVYTFW
FT                   YAIFPQLKPAIGSSILLIALHMLVEFGAVSILNYQTFTTAIFQEYEMSFNNSTAALLSA
FT                   VLMAICILIVFGEIFFRGKQTLYHSGKGVTRPYLVKTLSFGKQCLTFGFFSSIFILSIG
FT                   VPVIMLIYWLIVGTSLESAGDFSEFLSAFSNSFIISGLGALLTVMCALPLVWAAVRYRS
FT                   YLTIWIDRLPYLLHAVPGLVIALSLVYFSIHYANDLYQTFFVIIIAYFMLYLPMAQTTL
FT                   RASLEQLSDQIEKVGQSLGRNPFYIFRTLTLPAILPGVAAAFALVFLNLMKELTATLLL
FT                   TSNDIKTLSIAVWEHTSDAQYAAATPYALMLVLFSGIPVFLLKKYAFK"
FT   CDS_pept        130561..131631
FT                   /transl_table=11
FT                   /gene="hitC"
FT                   /locus_tag="HIBPF_01400"
FT                   /product="iron-utilization ATP-binding protein hFbpC"
FT                   /db_xref="GOA:E7A810"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR015853"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030287"
FT                   /db_xref="UniProtKB/TrEMBL:E7A810"
FT                   /protein_id="CBY80391.1"
FT                   /translation="MRLNKMINNPLLTVKNLNKFFNEQQVLHDISFSLRRGEILFLLGS
FT                   SGCGKTTLLRAIAGFEQPSNGEIWLKERLIFGENFNLPTQQRHLGYVVQEGVLFPHLNV
FT                   YRNIAYGLGNGKGKNSEEKTRIEQIMQLTGIFELADRFPHQLSGGQQQRVALARALAPN
FT                   PELILLDEPFSALDEHLRQKIRHEMLQALRQSGSSAIFVTHDRDEALRYADKIAIVQQG
FT                   KILQIDTPRTLYWSPNHLETAKFMGESIVLPANLIDENNAQCQLGNIPVKNNSISQKQG
FT                   KILLRPEQFSLFKTSENPTALFNGQIKQIEFKGKITSIQIEINGYTIWIENVISPDLSI
FT                   GDNLPVYLHRKGLFYA"
FT   CDS_pept        complement(131666..132346)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01410"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="GOA:E7A811"
FT                   /db_xref="InterPro:IPR003709"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:E7A811"
FT                   /protein_id="CBY80392.1"
FT                   /translation="MKLTPEMLTGKSREHLVNLPAIHSSNHFLQTQAVQAFQGLQQSAA
FT                   KNGFNLQPASSFRDFERQQLIWNSKFKGERKVHDDAGKALDLSQLDDWQKCQAILRWSA
FT                   LPGASRHHWGTEVDIFDPDLLPQGQSLQLEPWEYEKGGYFFELSEFLTENLPHFDFALP
FT                   FMNMQSNKKVGREPWHISYLPLAELASQQFSPDILQQAWKEENILGADCLISHLEQIFS
FT                   EYIV"
FT   CDS_pept        complement(132348..133481)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01420"
FT                   /product="putative succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="GOA:E7A812"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E7A812"
FT                   /protein_id="CBY80393.1"
FT                   /translation="MKEKVVSLAQDLIRRPSISPNDEGCQQIIAEGLEKLGFQIEWMPF
FT                   NDTLNLWAKHGTSEPVIAFVGHTDVVPTGDENQWSSPPFSAEIIDGILYGRGAADMKGS
FT                   LAAMIVAAEEYVKANPNHKGTIALLITSDEEAAAKDGTIRVVETLMTRDEKITYCMVGE
FT                   PSSAKNLGDVVKNGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDK
FT                   GNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLAKHNL
FT                   KYRIEWNLSGKPFLTKPGKLLDSITSAIEEITGITPKAETGGGTSDGRFIALMGAEVVE
FT                   FGPLNSSIHKVNECVSVEDLGKCGEIYHKMLVNLLDS"
FT   CDS_pept        complement(133509..133853)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006504"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A813"
FT                   /protein_id="CBY80394.1"
FT                   /translation="MITVYGIKNCDTVKKALKWLADHNIEYKLHDYRIDGLDLNFLTQA
FT                   ETQFGWDVLVNKRSTTWRNLDEQVKNSLDKTTALSVLAENPTLIKRPIILQDGKALIGF
FT                   NEKEYQAAFA"
FT   CDS_pept        complement(133932..135812)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01440"
FT                   /product="chaperone protein HtpG"
FT                   /db_xref="GOA:E7A814"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR019805"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:E7A814"
FT                   /protein_id="CBY80395.1"
FT                   /translation="MSQNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAAD
FT                   KLRFKALSNPALYEGDGDLRVRVSFDVDKGTITISDNGIGMTREQVIDHLGTIAKSGTK
FT                   EFLTALGQDQAKNSQLIGQFGVGFYSAFIVADKVTVKTRAAGEEAHKAVLWESAGEGEY
FT                   SVADIEKKSRGTDVILHLREDEKEFLNEWRLREIIGKYSDHIGLPVEMLTKEYDDEGKE
FT                   CGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFVDPVTWAHNKVEGNQAYTSLL
FT                   YVPAKAPWDLFNREHKHGLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNGLPLNVSRE
FT                   ILQDNKITAALRKALTKRSLQMLEKLAKDDAEKYLQFWKEFGLVLKEGPAEDFANKETV
FT                   AKLLRFASTHNDGSEQAVSLEDYILRMKEGQKAIYYITADSYVAAKNSPHLELFNKKGI
FT                   EVLLLSDRIDEWMLSYLTEFDGKQLQSITKADLDLGDLADKESETQKQQDEAFGSFIER
FT                   VKNLLGERVKTVRLTHNLTDTPAVVSTDNDQMTTQMAKLFAAAGQPVPEVKYTFELNPE
FT                   HHLVKKVADIADETEFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG"
FT   CDS_pept        136128..136883
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01450"
FT                   /product="conserved hypothetical NIF3-like protein"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:E7A815"
FT                   /protein_id="CBY80396.1"
FT                   /translation="MNNLELEQLINQKLSSDKINDYAPNGLQVEGKTEIKKIITGVTAS
FT                   QALIDYAISQNADAILVHHGYFWKNENPCIRGMKGKRIKALLVNDINLYGYHLPLDVHP
FT                   ELGNNAQLAKLLDIENLQPLEKGSVSIPVWGELKEPMTGKDFAEKIEKVLNQKPLICIE
FT                   NGPHLIRKIGICTGGGQGYIDLAAEQGCDAFITGEVSEQTIHSAREQGLHFFSAGHHAT
FT                   ERYGIKALGEWLAKEYGFDVEFKDIDNPA"
FT   CDS_pept        137059..139431
FT                   /transl_table=11
FT                   /gene="hsdM1"
FT                   /locus_tag="HIBPF_01460"
FT                   /product="putative type I restriction-modification
FT                   system,methyltransferase subunit"
FT                   /db_xref="GOA:E7A816"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A816"
FT                   /protein_id="CBY80397.1"
FT                   /translation="MDHSVHNKLVSFIWSIADDCLRDVYVRGKYRDVILPMFVLRRLDT
FT                   LLEPSKDAVLEEMRFQKEELAFTELDDLPLKKITGHVFYNTSKWTLKSLYQTASNTPQY
FT                   MLANFEEYLDGFSTNVHEIINCFKLREQIRHMSHKNVLLSVLEKFVSPYINLTPKEQQD
FT                   PEGNKLPALTNLGMGYVFEELIRKFNEENNEEAGEHFTPREVIELMTHLVFDPLKDQIP
FT                   AIITIYDPACGSGGMLTESQNFIEQKYPLSESQGERSIFLFGKETNDETYAICKSDMMI
FT                   KGDNPENIKVGSTLATDSFQGNHFDFMLSNPPYGKSWSKDQAYIKDGNEVIDSRFKVTL
FT                   PDYWGNVETLDATPRSSDGQLLFLMEMVNKMKSPKNNKIGSRVASVHNGSSLFTGDAGS
FT                   GESNIRRHIIEKDLLEAIVQLPNNLFYNTGITTYIWLLSNNKSEARKGKVQLIDASLLF
FT                   RKLRKNLGDKNCEFVPEHISEITQNYLDFTAKARETDSQNEAVGLASQIFDNQDFGYYK
FT                   VTIERPDRRSAQFTVENIASLRFDKALFEPMQYLYRQYGGQVYNARFLAKTEQEITAWC
FT                   EAQGIALNNKNKAKLLDVKTWEKAAALFQTASKLLEHFGEQQFHDFNQFKQAVEGRLKT
FT                   EKIPLSATEKKAVFNAVSWYDENSAKVIAKTLKLKPNELDALCQRYQCQADELADFGYY
FT                   ATGKAGEYILYETSSDLRDSESIPLKQNIHDYFKAEVQAHISEAWLNMESVKIGYEISF
FT                   NKYFYRHKPLRSLAEVAQDILALEKQADGLISEILEA"
FT   CDS_pept        139560..141023
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01470"
FT                   /product="predicted transcriptional regulator containing an
FT                   HTH domain"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR025831"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:E7A817"
FT                   /protein_id="CBY80398.1"
FT                   /translation="MTEPLSKINGIITKNYLEMQPENQYFERKGLGEKDIKPTKIAEEL
FT                   VGMLNADGGVLAFGVADNGEIQDLNSLGDKLDDYRKLVFDFIAPPCRIGLEEILVDGKL
FT                   VFLFHVEQDLERIYCRKDNENVFLRVADSNRGPLTREQIKNLEYDKNIRLFEDEIVPDF
FT                   NEEDLDQELLELYKKKVNFTSDNILDLLYKRNLLTKKEGCYQFKKSAILLFSTMPERYI
FT                   PSASVRYVRYEGTVAKVGTEHNVIKDQRFENNIPKLIEELTYFLRASLRDYYFLDINQG
FT                   KFIKVPEYPEEAWLEGVVNALCHRSYNVQGNVIYIKHFDDRLEISNSGPLPAQVTIENI
FT                   KTERFARNPRIARVLEDLGYVRQLNEGVSRIYESMEKSLLAKPEYREQHNNVYLTLRNR
FT                   VTAHEKTVSTATMLQIEKEWTNYNDTQKAILLYLFTNGTAILSELVDYTKINQNSIRAY
FT                   LNAFIQQGIIERQSVKQRDPNAKYAFRKD"
FT   CDS_pept        141195..142445
FT                   /transl_table=11
FT                   /gene="hsdS1"
FT                   /locus_tag="HIBPF_01480"
FT                   /product="putative type I site-specific
FT                   restriction-modification system, S subunit"
FT                   /db_xref="GOA:E7A818"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E7A818"
FT                   /protein_id="CBY80399.1"
FT                   /translation="MRRYERYKDSGVDWLGEVPSHWELKRLKQLFVEKKHKQSLSLNCG
FT                   AISFGKVIEKSDDKVTEATKRSYQEVLKGEFLINPLNLNYDLISLRIALSEIDVVVSAG
FT                   YIVLKEKQIINKKYFSYLLHRYDVAYMKLLGSGVRQTINYGHISDSILVIPPLSEQQKI
FT                   AQFLDDKTAKIDQAVDLAEKQIALLKEHKQILIQNAVTRGLNPDVPLKDSGVEWIGQVP
FT                   EHWDVQRSKFIFKKIERKVNEEDQIVTCFRDGQVTLRANRRTEGFTNALKEHGYQGIRK
FT                   GDLVIHAMDAFAGAIGISDSDGKATPVYSVCLPHDKQKIDVYFYAYYLRNLALSGFISS
FT                   LAKGIRERSTDFRYSDFAELLLPIPPYLEQQKIADYLDKQTSKIDRAIALKTAHIEKLK
FT                   EYKSVLINDVVTGKVRV"
FT   CDS_pept        142545..145571
FT                   /transl_table=11
FT                   /gene="hsdR1"
FT                   /locus_tag="HIBPF_01490"
FT                   /product="putative type I site-specific
FT                   restriction-modification system, R subunit"
FT                   /db_xref="GOA:E7A819"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:E7A819"
FT                   /protein_id="CBY80400.1"
FT                   /translation="MVSGTKEKDLEIAIEKALTGTWRENMENKLGEPKAEYLPRHHGFK
FT                   LAFSQDFDAQFAIDTRLFWQFLQTSQEAELARFQQLNPNDWQRKILERLDRQIKKNGVL
FT                   HLLKKGLDIDSAHFDLLYPVPLASSGEKVKQRFEQNLFSCMRQVPYSASSNETVDMVLF
FT                   VNGLPIITLELKNHWTGQTAIDAQKQYLNRDLSQTLFHFGRCLAHFALDTEEAYMTTKL
FT                   AGPATFFLPFNLGNNCGKGNPPNPNGHRTAYLWQEVFGKASLANIIQHFMRLDGSTKDP
FT                   LDKRTLFFPRYHQLDVVRRLIADVSEHGVGKRYLIQHSAGSGKSNSITWLAYQLIEAYP
FT                   RNEKAANGREADRPIFDSVIVVTDRRLLDKQLRDNIKDFSEVKNIVAPALSSAELRQSL
FT                   EQGKKIIITTIQKFPFIVDGIADLGDKQFAVIIDEAHSSQSGSAHDNMNRVIGKTEDLD
FT                   AEDVQDLILQTMQSRKMHGNASYFAFTATPKNSTLEKFGEKQADGKFKPFHLYSMKQAI
FT                   EEGFILDVIANYTTYKSFYEITKSIEDNPEFDSKKAQSRLKAYVERSQQTIDTKAEIML
FT                   DHFIYQVFNRKKLKGKAKGMVVTQNIETAIRYFQALKHLLAGRGNPFKIAIAFSGSKVV
FT                   DGVEYTEAEMNGFAESETKEYFDQDEYRLLVVANKYLTGFDQPKLCAMYVDKKLSGVLC
FT                   VQALSRLNRSANKLSKRTEDLFVLDFFNSVEDIQQAFEPFYTSTSLSQATDVNVLHDLK
FT                   DRLDETGVYEQAEVNDFTEGYFANKDAQQLSSMIDVAVQRFDDELELDLDRNEKVDFKI
FT                   KAKQFLKIYGQMASIINFENIAWEKLYWFLKFLVPKLKVQDPMDEFDEILDAVDLSSYG
FT                   LARTKLNYSIKLDDEETELDPQNPNPRGTHGEDKEKDPIDEIIRVFNERWFQDWSATPD
FT                   EQRVKFINITERIRSHKDFEQKYQNNPDIHTRELAFQAILRDVMSERHRDELELYKLFA
FT                   KDAAFRTAWTQSLQRALAG"
FT   CDS_pept        complement(145796..147175)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01500"
FT                   /product="Signal recognition particle protein"
FT                   /db_xref="GOA:E7A820"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004125"
FT                   /db_xref="InterPro:IPR004780"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR022941"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036891"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:E7A820"
FT                   /protein_id="CBY80401.1"
FT                   /translation="MFENLSDRLSKTLRNITGKGRLTEDNIKETLREVRMALLEADVAL
FT                   PVVREFIAKVKESALGEEVNKSLTPGQEFLKIVQRELEKAMGEANESLNLATQPPAVIL
FT                   MAGLQGAGKTTSVGKLAKFLRERHKKKVLVVSADVYRPAAIKQLETLAQSVGVDFFPSD
FT                   VKQNPVDIAKEALADAKLKFYDVLIVDTAGRLHVDTEMMDEIKQVHAALNPIETLFTVD
FT                   AMTGQDAANTAKAFNEALPLTGVILTKVDGDARGGAALSIRQITGKPIKFLGVGEKTEA
FT                   LEPFHPDRVASRILGMGDVLSLIEDLERSVDREKAEKMAQKFKKGDDFTLDDFREQLIE
FT                   MKKMGGMMSMLEKLPGAKNLPEHVKNQVDDKMFVKMEAIINSMTLKERANPDIIKGSRR
FT                   RRIALGSGTQVQDVNKLLKQFDEMQRMMKKMRKGGMAKMMRGMQGLMGGGLGGLGGMFK
FT                   R"
FT   CDS_pept        147426..148718
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01520"
FT                   /product="putative Mg2+ and Co2+ transporter"
FT                   /db_xref="GOA:E7A821"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E7A821"
FT                   /protein_id="CBY80402.1"
FT                   /translation="MLINEQKDFPLDSIPLSTLFIILIICLVLSAYFSGSETGLLSLNK
FT                   YRLRFLSEQGNKGAKKAEKLLEKPDTLLSFILIFNNLVNISASAIATVIGMRLYGDAGV
FT                   AIATGLLTFVMLVFSEIFPKTVAAMHAEKVSFFSSHILTSLLKIFYPLVWLMNIFTKSL
FT                   MQIVGLKLDMQKQVISSEELRSIVSEAGEATPNEQHPQMLLSILDMETVTVDDIMVPRN
FT                   EIGGINIDDDWRAIMRQLNHAAHNRVVLYKGSLDEQVLGILRVREAFRLLLEKNEFTKE
FT                   TLIRAADEVYFIPESTPLKTQLANFRTNKERIGLVVDEYGDIKGLVTLEDILEEIVGDF
FT                   TTSTAPSIDKEVIQQSDGSMIIDGSANLRDLNKMFNWELDTEDARTFNGLILEHLEEIP
FT                   DEGTICEIDGLLITILEVGDNMIKQAKVVKL"
FT   CDS_pept        148847..149617
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A822"
FT                   /db_xref="InterPro:IPR010619"
FT                   /db_xref="UniProtKB/TrEMBL:E7A822"
FT                   /protein_id="CBY80403.1"
FT                   /translation="MEHEYQRAVTRVCVQTALLLLQHGAESTVVVQMAQRLGVALGVES
FT                   VECALTANAVVLTTLSDNHCITTARKNTDKGINMQMVTDVQRIVIAVEHHLYELEIVQR
FT                   KLDQLKPLKYNRWLVVFMIGLSCAAFAHLSGGDWIICSITFVAAAIAMFVRQEFSKRHY
FT                   NPLIVFSITSFVASLISGVSLKYNLGNDPQIALASSVLLLVPGFPLINSLADILKGYVN
FT                   MGLGRWTIATVLTFGACLGIVFALSLLHITTWGH"
FT   CDS_pept        149619..150098
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A823"
FT                   /db_xref="InterPro:IPR024528"
FT                   /db_xref="UniProtKB/TrEMBL:E7A823"
FT                   /protein_id="CBY80404.1"
FT                   /translation="MLSDITIFILKLLDDMLCAAIPAVGFALVFNVPPKALKYCAILAA
FT                   LGHVTRTLLLHINMPIVFATFFATCVIGFLGVHLSHRYLAHPKAFTVAAIIPMIPGVHA
FT                   YKAMISMVQIHHFGFSDALFEQMISSFINTSFILGAIVFGLALPGLLFYRQKPVV"
FT   CDS_pept        complement(150188..150529)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A824"
FT                   /protein_id="CBY80405.1"
FT                   /translation="MVKIERKATDSAYHEFTKILTSSAQLMAFLNQSDFVKAGAKVENE
FT                   TVQQIASHFKFSQENNLNQLILSSFDRKEEDQLFVEYIRYVNNQARQTLNNELITKWKS
FT                   LFEKRKITD"
FT   CDS_pept        150884..152173
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01560"
FT                   /product="Seryl-tRNA synthetase"
FT                   /db_xref="GOA:E7A825"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/TrEMBL:E7A825"
FT                   /protein_id="CBY80406.1"
FT                   /translation="MIDPNLLRNNLAEVAEKLKVKRNFMLDTEKLTALEDQRKNLQVTT
FT                   ENLQAERNARSKAIGAAKARGKDIAPLLAEMDDIGNQLTEAKAQLDAVLAEINQIALSI
FT                   PNLPADEVPLGKDDTENKEILRWGTPRTFDFEVKDHVTLGKEANGLDFAAGAKLTGARF
FT                   AVMKGQIAKMHRALAQFMLDLHTEQHGYLETYVPYLVNHATLYGTGQLPKFGEDLFHTL
FT                   ALQGEQPYALIPTAEVPVTNLVRDVIIDEAELPIKMTAHTPCFRSEAGSYGRDTRGLIR
FT                   MHQFDKVEMVQIVDPDKSMEALEELTGHAEKVLQLLNLPYRKVLLCTGDMGFGSCKTYD
FT                   LEVWVPAQNTYREISSCSNMWDFQARRMQARCKAKGDKKTRLVHTLNGSGLAVGRTLVA
FT                   VLENYQNADGSITVPEVLRPYMGGLDVIGK"
FT   CDS_pept        152509..153138
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01570"
FT                   /product="glutathione S-transferase"
FT                   /db_xref="GOA:E7A826"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:E7A826"
FT                   /protein_id="CBY80407.1"
FT                   /translation="MKLYGLIGACSFVPHMALEWVKIRENADYEFEPVTRELIKSPEFL
FT                   SLNPRGAVPVLVDGDLVLSQNQAILHYLDELYPNSKLFGSKTVRDKAKAARWLAFFNSD
FT                   VHKSFVPLFRLPNYAKDNETLAHTIRQQAVEQILDQLAVANEYLESHIYFGEDISVADA
FT                   YLYIMLNWCRAVGIDFSHLTQLSAFMQRVETDQAVENVRKIEELKV"
FT   CDS_pept        153628..155865
FT                   /transl_table=11
FT                   /gene="hemR"
FT                   /locus_tag="HIBPF_01580"
FT                   /product="TonB-dependent heme receptor"
FT                   /db_xref="GOA:E7A827"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E7A827"
FT                   /protein_id="CBY80408.1"
FT                   /translation="MNILINKRIFLLVTFIGIQLNVTAKQNSSNSNREELLPIIVNTND
FT                   DSNKLPGRSVLKQKNIEQQQADNAANLINILPGVNMAGGFRPGGQTLNINGMGDAEDVR
FT                   VQLDGATKSFEKYQQGSIFIEPELLRRVTVDKGNYSPQYGNGGFAGTVKFETKDARDFL
FT                   QENQKIGGFLKYGNNSNNNQKTYSTALVLQNEQKNIDLLLFGSVRNAGDYKRPDNSKIL
FT                   FSKNNQKTGLIKVNWQISLEHLLTLSSVYGIHKGWEPFAAKRDILPKPNLKDIMRYGAD
FT                   IAWKRKLVYRDQKDENYTLKYNYLPENNPWINLSTQFSYSKTTQNDTRHEKVTSSFLGT
FT                   LGNKSWITYSDLTFDINNTSTFNIKTTVHELLYGLQWLKNTRNTLMYHKGKMTDKTYNY
FT                   GYFQPYYMPSGRQYTQAFYLQDQIKWKNIIFSTGVRYDHINNIGQKNLAPQYNDISAGH
FT                   NYSQKNYNGWSYYLGLNYDVNHYLTLFTNFSRTWRAPVIDEQYETQYKQSSGSVTATSL
FT                   NLEKEMINQTRVGGIITLNHLFQENDAFQFRTTYFYHRGKNEIFKTRGVNCVGNAANTN
FT                   HVCPKPIGNYRNLPGYVIQGAELEAYYQSTYLFGEITYSYVKGKRDTSPRNPWGKTSTW
FT                   IAEIPPRKATATLGFNVPKYYLTVGWRAEFVRRQDRSPLSGDPEAKYWSLPASRGYSLH
FT                   NLFLSWSPAKIKGMNIKITVDNLFNRAYNPYLGELASGTGRNIKFSLSQKF"
FT   tRNA            complement(160349..160421)
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:160386..160388,aa:Ala)"
FT                   /note="tRNA Ala anticodon TGC, Cove score 72.75"
FT   tRNA            complement(160503..160576)
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:160540..160542,aa:Ile)"
FT                   /note="tRNA Ile anticodon GAT, Cove score 76.73"
FT   CDS_pept        complement(162553..163458)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01590"
FT                   /product="BirA bifunctional protein"
FT                   /db_xref="GOA:E7A828"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR004409"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:E7A828"
FT                   /protein_id="CBY80409.1"
FT                   /translation="MNFTLLTYLADCQTKVRSELEKFSKNLEEDIQQLREIGLDILVDG
FT                   QDYRLVPMLPLLNPQQISTALFPYGIHYQPIISSTNEWILQNILSLKKGDLCVAEYQTA
FT                   GRGRRGRQWLSPFAGQIMFSFYWTFDPKKSIEGLSLVIGLAIAEVLNVQVKWPNDILFD
FT                   ERKLGGILVEIANHKNGMLNLVIGIGINVSLSKQTEISQPYAEVCEIDPDVERQTLLPK
FT                   LIQHLYTRLNIFEKNGIDEEFQQAWQSYNAFSNSEVNVLTEQGVISGIEQGIDERGYLK
FT                   VLCGNKIQMFNGGEVSLRKK"
FT   CDS_pept        163588..165054
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01600"
FT                   /product="IMP dehydrogenase"
FT                   /db_xref="GOA:E7A829"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:E7A829"
FT                   /protein_id="CBY80410.1"
FT                   /translation="MSLRIKQEALTFDDVLLVPAHSTVLPNTANLSTQLTKEIRLNIPM
FT                   LSAAMDTVTETKLAISLAQEGGIGFIHKNMTIERQADRVRKVKKFESGIVSEPVTVSPD
FT                   LSLAKLAELVKKNGFAGYPVVDGENNLIGIITGRDTRFVKDLSKTVSQVMTKKEDLVTV
FT                   KEGASREEILELMHQHRVEKVLVVNDSFKLKGMITVKDFQKAEQKPNACKDEFGRLRVG
FT                   AAVGAGAGNEKRIDALVKAGVDVLLIDSSHGHSEGVLQRVRETRAKYPNLPIVAGNVAT
FT                   AEGAIALADAGASAVKVGIGPGSICTTRIVTGVGVPQITAIADAAAALKDRGIPVIADG
FT                   GIRFSGDIAKAIAAGANCVMVGSMFAGTEEAPGEIELYQGRAFKSYRGMGSLGAMAKGS
FT                   SDRYFQSDNAADKLVPEGIEGRIPYKGYLKEIIHQQMGGLRSCMGLTGCATIDELRTKA
FT                   EFVRISGAGIKESHVHDVTITKEAPNYRMG"
FT   repeat_region   164560..164571
FT                   /note="GCA x4"
FT   CDS_pept        165164..166735
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01610"
FT                   /product="glutamine-hydrolyzing GMP synthase"
FT                   /db_xref="GOA:E7A830"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E7A830"
FT                   /protein_id="CBY80411.1"
FT                   /translation="MTNIHYHKILILDFGSQYTQLIARRVREIGVYCELWAWDVTEQQI
FT                   REFAPTGIILSGSPESTTEENSPRAPEYVFNAGVPVLGICYGMQTMAMQLGGLTETSDH
FT                   REFGYASVSLENSTALFANLNDNLTASEPKLDVWMSHGDKVTRLPENFKVTGTTPTCPI
FT                   AAMSDENRRFYGVQFHPEVTHTKKGLELLTNFVVNICGCETKWTAENIIEDAVARIKEQ
FT                   VGDDEVILGLSGGVDSSVVALLLHRAIGKNLHCVFVDNGLLRLHEGDQVMEMFGDKFGL
FT                   NITRVDAESRFLGELAGVSDPEAKRKIIGKVFVDVFDDESKKLTNVKWLAQGTIYPDVI
FT                   ESAASKTGKAHVIKSHHNVGGLPDYMKLGLVEPLRELFKDEVRKIGLALGLPAEMINRH
FT                   PFPGPGLGVRVLGEVKKEYCDLLRRADAIFIEELRNSGWYEKTSQAFSVFLPVKSVGVM
FT                   GDDRKYDWVISLRAVETIDFMTAHWAHLPYDLLGKVSNRIINEVNGISRVVYDISGKPP
FT                   ATIEWE"
FT   CDS_pept        complement(166797..167687)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A831"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:E7A831"
FT                   /protein_id="CBY80412.1"
FT                   /translation="MKVVIQGVLLCIFSQCLFGILYLFSIWLQPLSGTDVFAWRVLTMI
FT                   FGLFLILFPTIGCRSLLSLITTTLGKSWTRWVLFLLGTLDAGSQFWLFMWAPLNGEGIN
FT                   IAMGYFLFPLIMAVLGWAWLKERLSFIQKIALLLAACGVAHELWHTQSFSWTSLWVCMV
FT                   YPFYYLSRKLMKIPALQGITLDIILISIPCFIYILSQSDTLSLVTQEYRYWLLLPALGI
FT                   VSAISLSANLKSSQQIPVSIFAVLSYIEPILLFLIAVFVLDNQITTSDYFTYVPIWLSL
FT                   IVIGIEGVLNKNKVR"
FT   CDS_pept        167807..168268
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01630"
FT                   /product="putative transcriptional regulator"
FT                   /db_xref="GOA:E7A832"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E7A832"
FT                   /protein_id="CBY80413.1"
FT                   /translation="MQTLDKLDRNILNVLQQDAMIPLKELSEKVNSSVATCQRRVQSLT
FT                   DSGVITKRVAVVSPKAVGRTISVFVMVEMDNQHSYYQEQFERKMRQEDEVVSCYEISGD
FT                   YDFMLLLHAKDMESYHAFTRRVLTGEFHVRTYKSLFVMNFTKADSGIIL"
FT   CDS_pept        complement(168307..169473)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01640"
FT                   /product="Na(+)/H(+) antiporter 1"
FT                   /db_xref="GOA:E7A833"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:E7A833"
FT                   /protein_id="CBY80414.1"
FT                   /translation="MIKLIQRFFKLESAGGILLLFSAVVAMLLANSPLSNQYNDFLNLP
FT                   VSLQIGSFSINKTLIHWINDGFMAVFFVLVGMEVKKELFEGALSTYQQAIFPAIAAIGG
FT                   MVIPAVVYWFIAKQDPSLANGWAIPMATDIAFALGIMALLSKQVPLPLKIFLLALAIID
FT                   DLGAIVVIALFFSHGLSVQALIFSVVAIIALILLNRFKVSALCAYMVVGAILWASVLKS
FT                   GVHATLAGVIIGFSIPLKGKKGERPLDDFEHILASWSSFVILPLFAFANAGVSFAGIDV
FT                   NMISSPLLLAIASGLIIGKPVGIFGFSYISVKLGLAKLPDGINFKQIFAVAVLCGIGFT
FT                   MSMFLASLAFDANAGESVNTLSRLGILLGSTVSAILGYLFLKQTTKLS"
FT   CDS_pept        169698..171008
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01660"
FT                   /product="predicted branched chain amino acid transporter
FT                   (LIV-II)"
FT                   /db_xref="GOA:E7A834"
FT                   /db_xref="InterPro:IPR004685"
FT                   /db_xref="UniProtKB/TrEMBL:E7A834"
FT                   /protein_id="CBY80415.1"
FT                   /translation="MFSRKDIIILGMMIFALFLGAGNIIFPPMEGFSSGQHWTSASLGF
FT                   VLTGVLMPFITLVVVAILGRGEELTKDLPKWAGTGFLVILYLTIGSTFAMPRITNVAYE
FT                   MAWLPLGLTENNANVRFVFSLIFNLIAMGFMISPNTIISSVGKFMTPALLVLLIAVAIT
FT                   VFISPLSEIQVPSNAYENSHSLLIGLTSGYQTMDVLAAIAFGGIVARALSAKNVTKTKD
FT                   IVKYTISAGFVSVILLASLYFSLFYLGATSAAVAEGATNGGQIFSRYVNVLFGSAGTWI
FT                   MAGIIVLASLTTLVGVTSASADYFSKFSVRFSYPFWAALFTAMTITVSQYGLTDLLRIT
FT                   IPALLLIYPVAIVLVLLQFLRKKLPSIKFTYNSTLLVTVCFSLCDSLNNVKMLSESINS
FT                   LLKHFPLSSEGMAWLVPTLVMLVASIFIGKALHKTHS"
FT   CDS_pept        complement(171116..171583)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:E7A835"
FT                   /protein_id="CBY80416.1"
FT                   /translation="MIISSLTNPNFKVGLPKVITEVCDYLNTLDLNALENGRHDINDQL
FT                   YMNVMEPETAEPSSKKAELHHEYLDVQVLIRGTENIEVGATYPNLSKYEDYNEADDYQL
FT                   YADIDDKFTVTMKPKMFAVFYPYEPHKPCCVVNGKTEKIKKLVVKVPVKLI"
FT   CDS_pept        complement(join(171659..172069,172071..172556))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01690"
FT                   /product="putative glycosyltransferase (pseudogene)"
FT                   /db_xref="PSEUDO:CBY80417.1"
FT   repeat_region   complement(172006..172073)
FT                   /note="CAAT x17"
FT   CDS_pept        172829..174958
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01730"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /db_xref="GOA:E7A837"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:E7A837"
FT                   /protein_id="CBY80418.1"
FT                   /translation="MNPIVKQFKYGQHTVTLETGAIARQATAAVMASMDDTTVFVTVVA
FT                   KKDVKEGQDFFPLTVNYQERTYAAGKIPGGFFKREGRPSEGETLIARLIDRPIRPLFPE
FT                   GFFNEIQVVATVVSVNPQISPDLVAMIGASAALTLSGVPFNGPIGAARVGFIDNQLVLN
FT                   PTMAEQKQSRLDLVVAGTDKAVLMVESEADILTEEQMLAAVVFGHQQQQVVVEAIKEFA
FT                   KEAGKPRWDWVAPEPNTDLINKVKAIAEARLGDAYRITEKQARYEQIDAIKADVIAQIT
FT                   AEDEEISEGKIVDIFTALESQIVRGRIIAGEPRIDGRTVDTVRALDICTGVLPRTHGSA
FT                   IFTRGETQALAVATLGTERDAQIIDELTGERQDHFLFHYNFPPYSVGETGMIGSPKRRE
FT                   IGHGRLAKRGVAAVMPSLAKFPYVVRVVSEITESNGSSSMASVCGASLALMDAGVPIKA
FT                   AVAGIAMGLVKEKEKFVVLSDILGDEDHLGDMDFKVAGTREGVTALQMDIKIEGITPEI
FT                   MQIALNQAKSARMHILGVMEQAIPAPRADISDYAPRIYTMKIDPKKIKDIIGKGGATIR
FT                   SLTEETGTSIDIDDDGTVKIAAVDSNAAKNVMGRIEEIVAEVEAGAIYKGKVTRLADFG
FT                   AFVAIVGNKEGLIHISQIAEERVEKVSDYLQVGQEVNVKVVEIDRQGRIRLTMKDLAPK
FT                   QETEINQEDPVEEQE"
FT   repeat_region   173453..173464
FT                   /note="CAA x4"
FT   CDS_pept        175040..175984
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01740"
FT                   /product="Lipoprotein NlpI"
FT                   /db_xref="GOA:E7A838"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023605"
FT                   /db_xref="UniProtKB/TrEMBL:E7A838"
FT                   /protein_id="CBY80419.1"
FT                   /translation="MRCFRLSRHFIVYLFSLCAILLLAGCVQSRGGFVSKNHVVLAEQN
FT                   PNTHFEQEVMIVRLSQVLLVGKMSNEERASLHFERGVLYDSLGLWGLARYDLTQALALQ
FT                   PKMASVYNYLGLYLLLEEDYDGALDAFNTVFELDSGYDYTHLNRGLNFYYVGRYHLAQQ
FT                   DFLQFYQADTKDPYRVLWLYLNEQKLKPQEAQTNLVERAKGLSEDFWGTHIVQYYLGHI
FT                   SVEELQQRASEFAENSQQYAEILTETYFYLAKQKLNVGLVDEAAALFKLAMANQVYNFV
FT                   EYRFAAFELMKLKPVQTEDEKEEKSAVTKAIVF"
FT   CDS_pept        176104..177945
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01750"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="GOA:E7A839"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028618"
FT                   /db_xref="InterPro:IPR034415"
FT                   /db_xref="UniProtKB/TrEMBL:E7A839"
FT                   /protein_id="CBY80420.1"
FT                   /translation="MTDKITFNDLGLPEFILKAVSDLGFETPSPIQQSCIPHLLSGNDV
FT                   LGMAQTGSGKTAAFALPLLAQIDPSEKHPQMLVMAPTRELAIQVADACELFVKYAQGTR
FT                   IVTLYGGQRYDIQLRALKQGAQVVVGTPGRILDHIRRGTLNLSELRFIVLDEADEMLRM
FT                   GFIDDVETVMAELPENHQTALFSATMPEPIRRITKRFMNDPQEVKIKVNNENAPDIDQS
FT                   CWYVHGVRKNEALLRFLEVEDFDAAIIFARTKTGTLDITELLEKNGFRSAALNGDMTQQ
FT                   LREQTLDRLRNRSLDIVVATDVAARGIDIERISLVVNYDIPLDAESYVHRIGRTGRAGR
FT                   SGRALLFVEPRERRLLRNIEHLMKKGINEVELPNHEVLQECRRKKFVAKITKQLEHHDL
FT                   EQYRSLLEDLFTADQDQENIAAAMLMLLQGKQKLILPPDPPMEKRRRERNERGDRRENP
FT                   RSAERRGERKGYVNPQPMDLYRIEVGRADGVEVRHIVGAIANEGDINSRYIGHIKLYDD
FT                   YTTVELPQGMPKELLQQFGKTRVLNKQMQMSFLGAVKSDNSRGSDDFNGKCKGRGGDFR
FT                   GERGRERGNDNRGNRKFNEKSNRTFSDKPRRDRRSSF"
FT   CDS_pept        178063..179511
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01760"
FT                   /product="Membrane-bound lytic murein transglycosylase F"
FT                   /db_xref="GOA:E7A840"
FT                   /db_xref="InterPro:IPR000189"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR023703"
FT                   /db_xref="UniProtKB/TrEMBL:E7A840"
FT                   /protein_id="CBY80421.1"
FT                   /translation="MKGLFLRIITALALLFWAIDMVFPWQFLRHTEENHYTAIQARGSL
FT                   YVGTINNQISYFINKDSERGFEYELAKAFADTLGVELEIKIFDNQEQLFDELDKHNIDL
FT                   AAAHLLYHPKNAERFQIGPAYHSASWQLAYRKNENRPKNLGNVKKDIYISNNLALEETL
FT                   KELQKQYPQLIWKRNQALTQEELLLQLAEGKIPYVIANSIDIAAIRQIKPELAIAFDIT
FT                   DEANVHWYLPNSPYRDLQTALLNFMNNAEETGLLDNLKEKYLGHISQFDYVDTRSYINA
FT                   IENTLPQFSPLFEKYKGKLDWRLLAAVAYQESHWNPDATSPTGVRGIMMLTKDTAQHMK
FT                   ISDRTDPEQSIKAGSEYLHWLISQIPESIEKEERIWFALVAYNIGLGHLIDARRLTQNL
FT                   GGNPDNWLDVKKNLPLLAEKRYYSQLKYGYARGYEAHQYVENIRRYMNSIVNYHRVQEN
FT                   QTTNDNANNESAVKNLEEIKENKD"
FT   CDS_pept        complement(179802..180098)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR035318"
FT                   /db_xref="UniProtKB/TrEMBL:E7A841"
FT                   /protein_id="CBY80422.1"
FT                   /translation="MSKQPQILLNNTWNVRISDPGEEGAKSHFFETIYLTLTAYFEENN
FT                   IRYEFVRKVEDQIKIQRSFTELNELFKFLGDYFDPVSIGLVGVKIGNLGIKLE"
FT   CDS_pept        complement(180117..180362)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A842"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:E7A842"
FT                   /protein_id="CBY80423.1"
FT                   /translation="MRKKQKSVVENETVYLHTRGVIKDNAVMALLGDKLFRQRVEKKRK
FT                   GKGSYQRKAKHPGKMFEKPDYKFFDYRNFIIGFFLG"
FT   CDS_pept        complement(180430..180780)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01790"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="GOA:E7A843"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A843"
FT                   /protein_id="CBY80424.1"
FT                   /translation="MSVIIYHNPHCSKSRETLALLENKGIQPIIELYLQKQYSVNELQS
FT                   IAKKLGIDDVRQMMRTKDELYKSLNLDNLDLSQAELFKAISEHSALIERPIVINGDKAK
FT                   IGRPPETVLEIL"
FT   CDS_pept        180858..181907
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01800"
FT                   /product="putative permease PerM homolog"
FT                   /db_xref="GOA:E7A844"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E7A844"
FT                   /protein_id="CBY80425.1"
FT                   /translation="MLEMLKSWYSRRLSDPQAMGLLAILLFGFISIYFFGDLIAPLLIA
FT                   LVLSYLLEMPINFLNQYLKCPRMLATILIFGSFIGLAAIFFLVLVPMLWNQTISLLSDL
FT                   PAMFNKSNEWLLNLPKNYPELIDYSMVDSIFNSVREKILGFGESAVKLSLASIMNLVSL
FT                   GIYAFLVPLMMFFMLKDKSELLQGVSRFLPKNRNLAFKVWKEMQQQISNYIHGKLLEIL
FT                   IVTLITYIIFLIFGLNYPLLLAFAVGLSVLVPYIGAVIVTIPVALVALFQFGISPTFWY
FT                   IIIAFAVSQLLDGNLLVPYLFSEAVNLHPLIIIISVLIFGGLWGFWGVFFAIPLATLVK
FT                   AVINALPQD"
FT   CDS_pept        complement(182022..182999)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01810"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="GOA:E7A845"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:E7A845"
FT                   /protein_id="CBY80426.1"
FT                   /translation="MMKLFTKDKDGHFIREINGIKLPFPLTEFMKVRKLGYILSALLMV
FT                   ISLFFIITKGFNWGLDFTGGVVFDTHFSQSANLEQIRSKLHENGIESPIVQTTGSVQDV
FT                   MIRLPASNNDSTIGEHVKSMLQNVDKDIQIRSIEFVGPNVGEELAQGAVYATLATLAMV
FT                   LIYVGSRFEWRLGFGSIASLAHDVIITLGVFSALQIEIDLTFVAAILSVVGYSINDSIV
FT                   VFDRVRENFRKIRRLDTIDIIDISLTQTLSRTIITSVTTLVVVMALFFFGGPSIHNFSL
FT                   ALLVGIGFGTYSSIFVAIAIAYDVGLRREHMIPPKVDKEIDELP"
FT   CDS_pept        complement(183007..184857)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01820"
FT                   /product="protein-export membrane protein SecD"
FT                   /db_xref="GOA:E7A846"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022646"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="InterPro:IPR027398"
FT                   /db_xref="UniProtKB/TrEMBL:E7A846"
FT                   /protein_id="CBY80427.1"
FT                   /translation="MLNRYPLWKNLMVIFIVAIGILYSLPNIYGEDPAVQISGTRGQEA
FT                   NTSVLGQVQDVLKTNNLPTKSIVLENGSILARFTNTDDQLLAKDKIAERLGNNYTTALN
FT                   LAPATPAWLSMFGANPMKWGLDLRGGVRFLMEVDMNAALVKRQEQLQDSLRGELRKEKI
FT                   QYTAIKNTEHFGTLITLANVSQRAKAERIIRQLHPTLDITEPDADSINLGLSTAALNEA
FT                   RDLAIEQNLTILRKRVAELGVAEAVIQRQGAERIVIELPGVQDTARAKEILGATATLEF
FT                   RIVNQNVTADAISRNMLPADSEVKYDRQGHPVALFKRAVLGGEHIINSSSGLDQHSSTP
FT                   QVSVTLDSEGGEIMSQTTKKYYKKPMATLYVEYKDNGKKDENGKTILEKHEEVINVATI
FT                   QGRFGSNFQITGVDSIAEAHNFSTLLKSGALIAPIQIVEERTIGPSLGAQNVEQGINAS
FT                   LWGLVAVIAFMLFYYKMFGVIASFALVINIVLLVGLMSILPGATLSMPGIAGIVLTLGM
FT                   SVDANVLIFERIKEEIRNGRSIQQAINEGYNSAFTSIFDANLTTILTAIILYAVGTGPI
FT                   QGFAITLSLGVAISMFTAITGTRALVNALYGGKQLKKLLI"
FT   CDS_pept        complement(184927..185220)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01830"
FT                   /product="conserved hypothetical preprotein translocase
FT                   subunit YajC"
FT                   /db_xref="GOA:E7A847"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:E7A847"
FT                   /protein_id="CBY80428.1"
FT                   /translation="MEAQSPMSTLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKG
FT                   TEVLTAGGLIGKITKVTEGSDSIVIALNDTTEITINRNYIVSVLPKGSLKSL"
FT   CDS_pept        complement(185328..185549)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01840"
FT                   /product="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:E7A848"
FT                   /protein_id="CBY80429.1"
FT                   /translation="MKYQLNLTALRCPIPLLSAKKALKNLDKNDELMLILNLESAVENF
FT                   SIFAEENSVALVEQYCASEKEFIVILKK"
FT   CDS_pept        complement(185546..186064)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:E7A849"
FT                   /protein_id="CBY80430.1"
FT                   /translation="MQILEPQQFATWNEPIEMLYACHSKVKRFCRQLSILPDYLEKHGY
FT                   TRAVLNDVEQILSYFNRAAPLHHDDEESDFFPQLVKVAPQTQTSIDELEKQHESLHENW
FT                   NALSVQLEELISEQRQNIDKHLIERFIQGYDRHIALEEPLFEMGRECLSADILTEMGKH
FT                   MSARRQVKE"
FT   CDS_pept        complement(186091..186591)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01860"
FT                   /product="Restriction modification enzyme"
FT                   /db_xref="GOA:E7A850"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E7A850"
FT                   /protein_id="CBY80431.1"
FT                   /translation="MVSFVEMSSVSNFGFIENKIDKTLGSLRKGSYTYFRENDVIIAKI
FT                   TPCMENGKCALAIGLSNGIGMGSSEFHVFRANENKVFPFFLFYSLNRESIRKEAERNMT
FT                   GSSGHRRVPISFYEDLEISLPDLNEQQSIVNQINEIETQISELEKVLENSRQEKKAVLD
FT                   KWL"
FT   CDS_pept        complement(186665..189853)
FT                   /transl_table=11
FT                   /gene="HaeIVRM"
FT                   /locus_tag="HIBPF_01870"
FT                   /product="HaeIV restriction/modification system"
FT                   /db_xref="GOA:E7A851"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:E7A851"
FT                   /protein_id="CBY80432.1"
FT                   /translation="MITRSNFPELLSSLDFSQTNKIYYKTINSYELKVDFANEKLIYPE
FT                   GLKAQRDTTKNFSAPENFVVFECVHNLLQSGYKPEHIILEQGMPGGHGDTGGFCDIIVQ
FT                   DNDGVEYLLIECKTADDGKSREFSKAWAKMLKNGGQLFNYFNTYRRAKWLCLYCSDFRN
FT                   DKVESIYHLISMTDNNDFLKNNDKLQSFAQIQAENGAKVDYFNVWTDTYQQDFITHNLF
FT                   ESEIFKVGNRPYNVNDLKIVDNDTIQKKYHQFATIMRQHNVSARENAFDKLVNIFLCKV
FT                   VDEKANPENLKVYWKGAASDNHYDLQDRLQQLYKIGMKDFLGEEVTYISEEEINNAFHL
FT                   FKNKKDETKRTVLEYFTQLKFYSNNPFAFLDVHNEKLFFQNAVILKEIVQMLQDIKLKS
FT                   EEEQHQFLGDLFEGFLDQGVKQSEGQFFTPMPIVKFLISSLPLEQVLQNKNAPKVIDYA
FT                   CGAGHFLTEYASQIKPLLKDSGRNLSEFYQKIYGIEKEYRLSKVAKVSAFMYGQDEMNI
FT                   IYADALAQNQEQGKALQDGSFSLLVANPPYSVKGFLSTISDEDKAKFTLYENIDNEETF
FT                   NSIETFFIEKAKQLLHAEGIAVIVLPSSILTNGNIYIKCREILLQHFDLVAIAEFGSGT
FT                   FSKTGTNTATLFLRRKQATPNLSEHYKNRIEQWQSGNFGFDGLFEDHHLLQSYCNHCGF
FT                   NLDDYKAFLSAIEEMPLAIAETELFQEYRKAFEKRKFAKSANLAKEWLKFAKAIEADKM
FT                   QFFMLAQNNPQDVLVVKMPADNKEKKAFLGYEWSSAKGSEGIKYLNQTSGDEDDSLAKL
FT                   KGINQIQTPLFNPQNLFDETKINNLIRQNFNQKKVEIPQTLINYVSLLPLTQMLDFSRV
FT                   DFDKSIRTNVQKKIKVLSKYPIIALEEFPAEIKKGKSITAKNAIVGDYKVVAGGKNFAY
FT                   MHNEFNRMENTITISASGANAGFVNFWTEKIFASDCTTVRADNYVGTKFIFTYLQSIQE
FT                   NIFDLARGAAQPHVYPDDIKRLPIPKVPLDIQQKVVEECQKIDDEFNRTRMQIEEYRAK
FT                   IAKIFNELEIVRGG"
FT   CDS_pept        complement(189943..191091)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01880"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="GOA:E7A852"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/TrEMBL:E7A852"
FT                   /protein_id="CBY80433.1"
FT                   /translation="MKYELDKTSGNARRGRLVFERPQGMFSVETPAFMPVGTYGTVKGM
FT                   TPEEVRATGAEILLGNTFHLWLRPGQEVMRKHGDLHDFMQWHRPILTDSGGFQVFSLGK
FT                   LRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSM
FT                   EMSLRWAKRSRDRFDELGNKNALFGIIQGGVFEELRKVSLEGLVNIGFDGYAVGGLAVG
FT                   EPKEDMHRILEYICPQIPTDKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHL
FT                   FVTDGIVKIRNAKYRDDTSPLDPECDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLR
FT                   YYQRLMAEIRQAIEDDRFDDFVVEFYARMGKPVPPLQLADKS"
FT   CDS_pept        complement(191435..192526)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01890"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="GOA:E7A853"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:E7A853"
FT                   /protein_id="CBY80434.1"
FT                   /translation="MRVSDFNFDLPDELIARYPKTDRVSCRLLQLNGENGEIFHRTFSD
FT                   VLDLIDEGDLLIFNNTRVIPARMFGRKASGGKIEVLVERMLDEHRFLAHIRSSKSPKEG
FT                   AELFLGEDKLGENNGIKAVMKARHSSLFEVELSDKSTALLDVLQTIGHMPLPPYIDRPD
FT                   EEADKECYQTVYSKVPGAVAAPTAGLHFDDPLLEKLKKKGVNFEFVTLHVGAGTFQPVR
FT                   VENIEDHVMHAEYVEVSQEVCNAIIATKKAGKRVIAVGTTSVRSIESAALSAEEFGNPD
FT                   LIEPYFSDTSIFIYPGKKFRVVDCLITNFHLPESTLIMLVSAFAGYKNTMNAYKHAVQE
FT                   KYRFFSYGDAMFINKNSNVRGLE"
FT   CDS_pept        complement(192650..193096)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR016777"
FT                   /db_xref="UniProtKB/TrEMBL:E7A854"
FT                   /protein_id="CBY80435.1"
FT                   /translation="MNLTKILPAFAAVVVLSACAKDAPEMTKSSAQMTEMQTLPTITDK
FT                   TVVYSCNKETVTAVYQFENQEPVAAMVSVGDGIIAKDFTRDKSQNDFTSFVSGDYVWNV
FT                   DSGLTLDKFDSIVPVNLIQKGKSSDSIIVKNCDVNVKATKKANL"
FT   CDS_pept        complement(join(193238..194869,194868..196760,
FT                   196760..197251))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="hap"
FT                   /locus_tag="HIBPF_01920"
FT                   /product="adhesion and penetration protein Hap
FT                   (pseudogene)"
FT   CDS_pept        complement(197556..200387)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01930"
FT                   /product="UvrABC system protein A"
FT                   /db_xref="GOA:E7A855"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:E7A855"
FT                   /protein_id="CBY80437.1"
FT                   /translation="MENIDIRGARTHNLKNINLTIPRNKLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDSIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLFARVGEPRCPDHNVPLTAQTISQMVDKVLSLPEDSKMMLLAPVVKNRKGEHL
FT                   KILENIAAQGYIRARIDGEICDLSDPPKLALQKKHTIEVVVDRFKVRSDLATRLAESFE
FT                   TALELSGGTAIVADMDNPKAEELVFSANFACPHCGYSVPELEPRLFSFNNPAGACPTCD
FT                   GLGVQQYFDEDRVVQNPTISLAGGAVKGWDRRNFYYYQMLTSLAKHYDFDVEAPYESLP
FT                   KKIQHIIMHGSGKEEIEFQYMNDRGDVVIRKHPFEGILNNMARRYKETESMSVREELAK
FT                   NISNRPCIDCGGSRLRPEARNVYIGKTNLPIIAEKSIGETLEFFTALSLTGQKAQIAEK
FT                   ILKEIRERLQFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLNTLIHLRNLGNTVIVVEHDEDAIRAADHIIDIGPGAGVHGGQVIAQGN
FT                   ADEIMLNPNSITGKFLSGADKIEIPKKRTALDKKKWLKLKGASGNNLKNVNLDIPVGLF
FT                   TCVTGVSGSGKSTLINDTLFPLAQDALNRAEKTDYAPYQSIEGLEHFDKVIDINQSPIG
FT                   RTPRSNPATYTGLFTPIRELFAGVPEARARGYNPGRFSFNVRGGRCEACQGDGVLKVEM
FT                   HFLPDVYVPCDQCKGKRYNRETLEIRYKGKTIHQVLDMTVEEAREFFDAIPMIARKLQT
FT                   LIDVGLSYIRLGQSSTTLSGGEAQRVKLATELSKRDTGKTLYILDEPTTGLHFADIKQL
FT                   LEVLHRLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGQIIATGTPEQVAKVKSS
FT                   HTARFLKPILEKP"
FT   CDS_pept        200541..201047
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="HIBPF_01940"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="GOA:E7A856"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E7A856"
FT                   /protein_id="CBY80438.1"
FT                   /translation="MAGINKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTG
FT                   ERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDV
FT                   MQMLGGRNQNAGGSGNDMGGAPQSSYQARQTNNGNSYQSSRPAPQQSAPQAEPPMDGFD
FT                   DDIPF"
FT   CDS_pept        complement(201225..202007)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01950"
FT                   /product="TonB"
FT                   /db_xref="GOA:E7A857"
FT                   /db_xref="InterPro:IPR003538"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:E7A857"
FT                   /protein_id="CBY80439.1"
FT                   /translation="MQQTKRSLLGLLISLIAHGIVIGFILWNWNEPSDSANSAQGDIST
FT                   SISMELLQGMVLEEPAPEPEDVQKEPENVQKEPEPEKQEIVEDPTIKPEPKKIKEPEKE
FT                   KPKPKEKPKNKPKKEVKPQKKPINKELPKGDENIDSSANVNDKASTTSAANSNAQVAGS
FT                   GTDTSEIAAYRSAIRREIESHKRYPTRAKIMRKQGKVSVSFNVGADGSLSGAKVTKSSG
FT                   DESLDKAALDAINVSRSVGTRPAGFPSSLNVQISFTLQ"
FT   CDS_pept        complement(202017..202460)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01960"
FT                   /product="transport protein ExbD"
FT                   /db_xref="GOA:E7A858"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="InterPro:IPR014171"
FT                   /db_xref="UniProtKB/TrEMBL:E7A858"
FT                   /protein_id="CBY80440.1"
FT                   /translation="MKKFDEINIIPFIDIMLVLLTVVLITASFISQGKIQVNVPKASTA
FT                   VAFKSDELAKLLTVTADKQLYFNDKPISQEALEAEIAQWNKDQKVTLKIDAEASFQDFV
FT                   TITDMLSKNEIKNVAIVSMKDKGKSAGKNSQESTPSQSVPTTP"
FT   CDS_pept        complement(202464..202916)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01970"
FT                   /product="transport protein ExbB"
FT                   /db_xref="GOA:E7A859"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="InterPro:IPR014172"
FT                   /db_xref="UniProtKB/TrEMBL:E7A859"
FT                   /protein_id="CBY80441.1"
FT                   /translation="MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAH
FT                   YSTIHALDIDLNRNMTVISTIGANAPYVGLLGTVIGILLTFYQIGHGGGDIDPSVIMLH
FT                   LSLALKATALGILVAIPSMVFYNGLGRKVEVNRLKWKVLSEQKDKE"
FT   CDS_pept        complement(203085..203552)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01980"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="GOA:E7A860"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR024706"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A860"
FT                   /protein_id="CBY80442.1"
FT                   /translation="MNPLSVGNQAPAFTLLNQQEKFVSLSDFRGKKVLIYFYPKALTPG
FT                   CTTQACGLRDSKSELDALGLVVLGISPDAPKKLAQFIEKKELNFTLLSDPDHQVAEQFG
FT                   VWGEKKFMGRTYDGIHRISFLINESGTIMQVFDKFKIKDHHQMIIDYLRSL"
FT   CDS_pept        203658..204554
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_01990"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="GOA:E7A861"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:E7A861"
FT                   /protein_id="CBY80443.1"
FT                   /translation="MSAQNPLFSGSIVALVTPMNHYGEVDFSCLEKLVEHHIEAGSNAL
FT                   VSVGTTGESATLSIEENVKVIEKTVEFAKGRIPIIAGAGANATSEAITMTKLLRDSGVA
FT                   GCLSVVPYYNKPTQEGMYQHFKAIAECTDLPQILYNVPSRTGSDMKPETVARLAEIENI
FT                   VGIKEATRDVSRIVKIKQLAGKNFIVLSGDDATGLEAIKLGAEGVISVTNNIAAKDMAD
FT                   MCRYALAGDFDKAEEINARLMRLHHDLFIESNPIPVKWAAYRLGLIKSPHLRLPLTTLS
FT                   EEIQPKVEDALKIAGLL"
FT   CDS_pept        204665..205312
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02000"
FT                   /product="Conserved hypothetical lipoprotein"
FT                   /db_xref="InterPro:IPR010653"
FT                   /db_xref="UniProtKB/TrEMBL:E7A862"
FT                   /protein_id="CBY80444.1"
FT                   /translation="MKKIILNLVTAIILAGCSSNPETLKATNDSFQKSETSIPHFSPLA
FT                   TGGVQLPKADDAYSLPNIEVKKGEDIDIRPPLIPLAIIQNSITKFDGERSLIVYPKQQA
FT                   KLYNLQQVERLLKEEGISSTTDGSILTTDWAKTERIGDKSMEIKYQIEQVMTADVSALT
FT                   VSILHMRRDGIIFTPNVSDKQYYTSERLNRIVLTLTTAYNKQLQDLSSTLIQ"
FT   CDS_pept        205482..205805
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02010"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A863"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="UniProtKB/TrEMBL:E7A863"
FT                   /protein_id="CBY80445.1"
FT                   /translation="MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVP
FT                   NGFSVEASIGTPLGNLLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRADERLKDS
FT                   FEN"
FT   tRNA            complement(206238..206324)
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:206288..206290,aa:Ser)"
FT                   /note="tRNA Ser anticodon GGA, Cove score 52.76"
FT   CDS_pept        complement(206508..207458)
FT                   /transl_table=11
FT                   /gene="lgtC"
FT                   /locus_tag="HIBPF_02020"
FT                   /product="UDP-galactose--lipooligosaccharide
FT                   galactosyltransferase"
FT                   /db_xref="GOA:E7A864"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A864"
FT                   /protein_id="CBY80446.1"
FT                   /translation="MTDRQTDRQTDRRTVSQTMNIIFSSDNYYAPYLAVSIFSIIKNTP
FT                   KKINFYILDMKINQENKTIINNLASEYSCKVFFLLVCESDFQNFPKTIDYISLATYARL
FT                   NLTKYIKNIEKAIYIDVDTLTNSSLQELWNIDITNYYLAACRDTFIDVKNEAYKKTIGL
FT                   EGYSYFNAGILLINLNKWKEENIFQKSINWMNKYNNVMKYQDQDILNGICKGKVKFINN
FT                   RFNFTPTDRNLIKKKNLLCVKMPIVISHYCGPNKFWHKKCSHLNCHIGNLLLKEMDKII
FT                   DIPSSWYDHFEKIPFLIKIKRLRKRIRDKLIYGIY"
FT   repeat_region   complement(207425..207456)
FT                   /note="GACA x8"
FT   CDS_pept        complement(207552..208139)
FT                   /transl_table=11
FT                   /gene="orfM"
FT                   /locus_tag="HIBPF_02030"
FT                   /product="predicted xanthosine triphosphate
FT                   pyrophosphatase"
FT                   /db_xref="GOA:E7A865"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:E7A865"
FT                   /protein_id="CBY80447.1"
FT                   /translation="MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGL
FT                   TFVENALLKARYASEKSGLPAIADDSGLVVSALNGAPGLYSARYAGEEGNDAKNREKLL
FT                   AELAHIAQDQRQAKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFS
FT                   PEQGCTFAELETVEKKKISHRAKALSVLKSKL"
FT   CDS_pept        complement(208151..208876)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02040"
FT                   /product="3-deoxy-D-manno-octulosonic acid kinase"
FT                   /db_xref="GOA:E7A866"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR022826"
FT                   /db_xref="UniProtKB/TrEMBL:E7A866"
FT                   /protein_id="CBY80448.1"
FT                   /translation="MHQFQQDNQYFIFNFDRTFEQATEFFQAEFWQKQERVIGSAKGRG
FT                   TTYFLQTEDWFGVNCALRHYYRGGLWGKLNKDRYRFSALETTRSFAEFHLLQRLYEAGL
FT                   PVPKPIAARIQKGKLGICYQADILTEKIENAQDLTALLQTQTLPKETWMQIGRLIRKLH
FT                   DLQICHTDLNAHNILLQQAEQEQKCWLLDFDKCGEKLGDFWKAQNLNRLKRSFEKEVGR
FT                   MNIQFTEQNWADLTAAYHQ"
FT   CDS_pept        208953..209996
FT                   /transl_table=11
FT                   /gene="opsX"
FT                   /locus_tag="HIBPF_02050"
FT                   /product="ADP-heptose--lipooligosaccharide
FT                   heptosyltransferase I"
FT                   /db_xref="GOA:E7A867"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:E7A867"
FT                   /protein_id="CBY80449.1"
FT                   /translation="MPLFTEAPKSLCILRLSAVGDVCHALAVVQHVQVYYPQTEITWIV
FT                   GKTEMGLLSGIPNVSLISYDKKAGWKGVLSLWKQLKNKQFDALLNMQTAFRASILSLGI
FT                   KAKFKIGFGEKRSREGQWLFVNRRIRDPFSPHVLDGFMAFAEYIGVPKAEPKWELAISQ
FT                   DDYKFADQFIDFSRKNLLISPCSSKAEKDWLIEGYAEVANIAHQHNINVIFCSSPAKRE
FT                   LEIVEKITALCHFTPTNIAGKTNLKQLTALISKVDLVLSPDSGPAHIATTQGTPVIGLY
FT                   AYHNPLRTAPYNNLDNVISVYEKNAQKEFGKPSSELPWATKLKGKNLMAEIQVEPVIEQ
FT                   MKKLGLF"
FT   CDS_pept        210319..212484
FT                   /transl_table=11
FT                   /gene="hxuC"
FT                   /locus_tag="HIBPF_02060"
FT                   /product="heme/hemopexin-binding protein C"
FT                   /db_xref="GOA:E7A868"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR010949"
FT                   /db_xref="InterPro:IPR011276"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:E7A868"
FT                   /protein_id="CBY80450.1"
FT                   /translation="MRFSKLSLAITTTLVTANALAQSVELDSINVIATRDPSRFAYTPE
FT                   KQSKDSLLSKQATSVADALEDIPNVDVRGGSRSIAQKPNIRGLSDNRVVQVIDGVRQNF
FT                   DLAHRGSYFLPMSLIQEIEVIKGPSSSLWGSGALGGVVAMRTPNALDLLKNNDKFGVKI
FT                   RQGYQTANNLSEKDVSVFAANDKFDVLISGFYNNADNLRTGKGNKLNNTAYKQFGGLAK
FT                   FGWQINDANRVELSHRETRFKQTAPSNNEVENELTNEQITDQIKKFHGQKDDLLPPTTQ
FT                   PSPSETLKFYSGVKTRFGSVSYLTDQQIPDQSTVFNYYLTPDNPYLNTHIALYNNKTIE
FT                   KEQRKVSGVQDQTKLTTRGINLRNSSELSHISFVYGVDYMRDKIRTERGTNNNDAKFRA
FT                   EPYNANSNTTGIYLIAHIPLFGEKLLLSPSVRYDHYDTSSKTVKYKDNHLSPATKLTWI
FT                   VTNWLDFTAKYNEAFRAPSMQERFVSGTHFGADIAGRNEINKFVANPNLRPETAKNKEI
FT                   TANLHFDSLFKQGDKFKIEATYFRNDVKDFINLKIFNDVNANPNANKNATGALLPKNSQ
FT                   YQNITNARLSGIELQAQYQTERLTLFTNYGSTKGKDKDSGEALSNIAASKIGVGVNYAL
FT                   VKDKFTVGATVTHYAAQRRVPKDHSVTYPSYILTDLRATYAPLKGEWKNLRLDFALENL
FT                   FDRKYQPAFSLMEGTGRNAKISAVYSF"
FT   CDS_pept        212566..214257
FT                   /transl_table=11
FT                   /gene="hxuB"
FT                   /locus_tag="HIBPF_02070"
FT                   /product="heme/hemopexin-binding protein B"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:E7A869"
FT                   /protein_id="CBY80451.1"
FT                   /translation="MRPRYSVIASAVSLGFVLSKSVMALGQPDTGSLNRELEQRQIQSE
FT                   AKPSGELFNQTANSPYTAQYKQGLKFPLTQVQILDRNNQEVVTDELAHILKNYVGKEVS
FT                   LSDLSNLANEISEFYRHNNYLVAKAILPPQEIEQGTVKILLLKGNVGEIRLQNHSALSN
FT                   KFVSRLSNTTVNASEFILKDELEKFALTINDVPGVNAGLQLSAGKKVGEANLLIKINDA
FT                   KRFSSYVSVDNQGNKYTGRYRLAAGTKVSNLNGWGDELKLDLMSSNQANLKNARIDYSS
FT                   LIDGYSTRFGVTANYLHYKLGGNFKSLQSQGHSHNLGAYLLHPTIRTPNFRLSTKVSFN
FT                   HQNLTDKQQAVYVKQKRKINSLTAGIDGSWNLIKDGTTYFSLSTLFGNLANQTSEKKQY
FT                   AVENFQAKSHFTVYNYRLSHEQILPKSFAFNIGINGQFADKTLESSQKMLLGGLSGVRG
FT                   HQAGAASVDEGHLIQTEFKHYLPVFSQSVLVSSLFYDYGLGKYYKNSQFLAKGVKNSVK
FT                   LQSVGAGLSLSDAGSYAINVSVAKPLDNNIDNADKHQFWLSMIKTF"
FT   CDS_pept        214269..217052
FT                   /transl_table=11
FT                   /gene="hxuA"
FT                   /locus_tag="HIBPF_02080"
FT                   /product="heme/hemopexin-binding protein A"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:E7A870"
FT                   /protein_id="CBY80452.1"
FT                   /translation="MYKLNVISLIILTTYTGATYASTQDFPQNHTTVSGTVTVTTTADK
FT                   MTIKQTTSKTQIDWYSFDIGKNKEVKFEQPDANSVAYNRVTGGNASQIQGKLTANGKVY
FT                   LANPNGVIITQGAEINVAGLFATTKDLERISENGNGNGNGNGNGNGNGNGNGNGNGNKF
FT                   TRKAKEGKVLTEGKVLNQGEIKAKDFVVLNGDEVINEGKIDATNGKVYLSSDYNFTFTL
FT                   LPDSGISVALEDNAVQGIVKNEGSIKAGEITLSAKGRKEALDSLVMNNGVLEATKVSSK
FT                   NGKVVLSADEIKLNDKSNIKGESEVVFTSNKELENNIKITSQNGSKVTSPKINFKGKSV
FT                   NIKGDFGREDNNDYYKDEFKTLNTEVNIDVPDTENIRIADKDKEQDKDNTGTGSFIQTD
FT                   ALSSLLANNGKVNLKGKDVNISGNIKINSFKGTDSLLKLTNQGHININNADIHSTGRLF
FT                   FITSLQNDVDFQSNITITNSKINLGNGAMGLGRSLNKENCDHPRWCRTETSQRKKFDVD
FT                   MRNVVFDQVDDVVVAGGFRKVNLDRIVATGKTNFYIDGGVSRNNSKYEYGVLDLDERTQ
FT                   LSSLDQRKRRWKYYYNLDLDMNKAYWHRFDMFASKNTGRSTIKDTEINISNSNINLKNG
FT                   FMHLLAEKIKLDKSKIDITFDKDNSEDISSQINRLGMNGKVSMVNSHIKIVGDEKSDIS
FT                   AKAPYATMFLIGELIGEKSSIFVKSHQGYTFRTDGNTKIAGKYSKDDLKITAINTGGRT
FT                   GKEVIINGAPGSIDNDANIANMAFTIGDNADTKTTIENADITALAPNGGTAYLSSKGVE
FT                   IEVKSNSNFTFFELPREKNFNQTKINGASTKLSERDFARLYDKINGVRASNLSAEQLNV
FT                   TDASEKIINTKLVSSLDVEKLVSVAVCDAGNGCEEQQFGDKGNNTKVSVGELEAEQ"
FT   repeat_region   214680..214751
FT   CDS_pept        complement(217148..217504)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02090"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="GOA:E7A871"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:E7A871"
FT                   /protein_id="CBY80453.1"
FT                   /translation="MDRIFIEELTVFAQIGVYDWEQQIKQKLVFDLEMAWDCKQAAETD
FT                   DVAYCLNYAEVSQAIIDYVESKPFLLIERVAYEVADLLESRYQLQGLKIKLSKPKAVAQ
FT                   ARNVGVLIVRGCLK"
FT   CDS_pept        217587..218186
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02100"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="GOA:E7A872"
FT                   /db_xref="InterPro:IPR003811"
FT                   /db_xref="UniProtKB/TrEMBL:E7A872"
FT                   /protein_id="CBY80454.1"
FT                   /translation="MSLFALFYMLFAYLLGSVSSAILICRIAGLPDPRQNGSHNPGATN
FT                   VLRIGNRKSALAVLIFDMLKGMIPVWAGYYLGLTQFELGMVALGACLGHIFPIFFQFKG
FT                   GKGVATAFGAIAPISWAVAGSMFGTWIFVFLVSGYSSLSAVISALLVPFYVWWFKPEFT
FT                   FPVALVCCLLIYRHHDNIQRLWRGQEDKVWAKFKKK"
FT   CDS_pept        218228..219931
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02110"
FT                   /product="sensor protein NarQ"
FT                   /db_xref="GOA:E7A873"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR016380"
FT                   /db_xref="InterPro:IPR029095"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR042295"
FT                   /db_xref="UniProtKB/TrEMBL:E7A873"
FT                   /protein_id="CBY80455.1"
FT                   /translation="MYTKGSVSTRIAKYLFIILIVAGVISSLSLAIMSSNKYDAEAINI
FT                   SGSLRMQSYRLLYEMQEQPESVETNLRRYHISLHSSALLEVQNQFFTPNVLKHSYQNIL
FT                   QRWTNMEKYARQQDVKNYSKQLTNYVADVDYFVFELQRFSEQKWILGVSVLGFAMLLIL
FT                   LMVSYVIWYTQREVVKPLHLMTKASMQVQMRQFNHIPLDTRKQNELGTLARIFTQMSTE
FT                   LGQLYSRLEEAVNEKTQKLRQTNRTLSTLYQSAQLLNTNTINDKILNQVLNYIFISDHL
FT                   NFVKVEVMGAEHWDITLGKQDANNELQIETLSVDNEELGVLSWQAGLPCPDPRIMQNLA
FT                   QMLARALYFHKNLRQKEQILLMEERSIIARELHDSLAQVLSFLQIQLTLLKHNLKKEDE
FT                   QSKEKSLAIIANFEQALSGGYAQLRELLATFRLTIQEANLQLALKQVIDSLRSQTTMQM
FT                   NVNCQLPSQSLNPQQLVHVLQIVREATTNAIKHSQGTVIEISARINAEGEYEILVEDDG
FT                   IGIPNLEEPEGHYGLNIMAERCRQLNARLHIHRREQGGTQVKITLPHTLY"
FT   CDS_pept        219941..220966
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02120"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="GOA:E7A874"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:E7A874"
FT                   /protein_id="CBY80456.1"
FT                   /translation="MQNLQPFHTFHIQSNAREIIEAHSIEQLQQVWAHSKSENLPTLFL
FT                   GQGSNVLFLDDFNGIVILNRLMGITHEQDANFHYLHVNSGENWHKLVEWSINNGIYGLE
FT                   NLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEVLNLNTNETFRLDTEQCEFGYRESIFK
FT                   HRYQQGYVITAVGLKLKKDWQPILKYGSLVEFDPKTVTAKQIFDEVCHIRQSKLPDPNE
FT                   FGNAGSFFKNPVVSLEHFEKIKKHHENLPHFPQEDGSVKLAAGWLIDQCNLKGFQIGGA
FT                   AVHKKQALVLINKSGATGQDVVKLAHHVRQTVAEKFGVYLQPEVRFISATGEVNSEQII
FT                   T"
FT   CDS_pept        221092..221937
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02130"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="GOA:E7A875"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012759"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:E7A875"
FT                   /protein_id="CBY80457.1"
FT                   /translation="MDKETQMMLVPQGSIEGYIRAANEYPMLTAEEEKELAERLYYHED
FT                   LDAAKKLILSHLRFVIHVARGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRLVSFA
FT                   VHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNENEVDMVANELGVS
FT                   KEDVIEMESRMSGADVGFDLPTDDAETETYSPALYLEDKSSNFAAELENENFESQATEQ
FT                   LGAALQSLDARSQDIIKARWLDDNKATLHDLAAKYNVSAERIRQLETNALKKLKSAVNF
FT                   "
FT   CDS_pept        complement(221977..222909)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02131"
FT                   /product="tRNA-dihydrouridine synthase C"
FT                   /db_xref="GOA:E7A876"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR032886"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR042270"
FT                   /db_xref="UniProtKB/TrEMBL:E7A876"
FT                   /protein_id="CBY80458.1"
FT                   /translation="MRVILAPMQGVLDSFVRQLFTEVNDYDLCITEFVRVVDQLLPEKV
FT                   FYRLCPELKNQGFTSSGTPVRVQLLGQNPECLAENAIRAIDLGSHGVDLNCGCPSKTVN
FT                   GSNGGAALLKQPELIYCATQALRKAVPSEFPVSVKVRLGWDDISQAFEIADAVEQGGAT
FT                   EITVHGRTKADGYRADRINWKKISEVRERLSIPVIANGEIWHWQDGQDCLSQTGCQDLM
FT                   VGRGALNIPNLSHVLKSNAEKMPWCEIQKILQKYANVENEYDSGFYHVARIKQWLRYLN
FT                   KEYDEANQVFDKIKTCQTAEDLKLRLNDK"
FT   CDS_pept        complement(222909..223775)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02140"
FT                   /product="DnaJ-like protein, membrane anchored"
FT                   /db_xref="GOA:E7A877"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR023749"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E7A877"
FT                   /protein_id="CBY80459.1"
FT                   /translation="MEFIGKIIGVFLGWKVGGFFGAIAGLILGSIADKKLYELGSVSSS
FT                   FFKKKTTRQDLFMQTTFAVLGHLSKSKGRVTEEDIQLANQLMIQLKLDDAGRKLAQDAF
FT                   RRGKESDFPIRQVIREFRIGCGQRADLLRMFLQVQVQAAFADSELHENEKEVLYVIAEE
FT                   LGLSRMQFEQMIAMEMAARAFTQGGFYQQYQQGAYQGGYQYQQQNSGGYQHASGPTLND
FT                   AYKVLGVTESDEQSTVKRAYRRLMNEHHPDKLVAKGLPPEMMEMAKEKTQQIQAAYDLI
FT                   CKAKGWK"
FT   CDS_pept        complement(223854..224495)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02150"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="GOA:E7A878"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E7A878"
FT                   /protein_id="CBY80460.1"
FT                   /translation="MEQYKRDFIEFALSRNVLKFGEFTLKSGRKSPYFFNAGLFNTGAD
FT                   LARLGEFYAAAIQASAVDFDVVFGPAYKGIPIGTSVSVALFNRYGIDKPVCFNRKEVKD
FT                   HGEGGNLIGSPLQGKILLVDDVITAGTAIRESMELISANKAELAAVLIALNRKERGKGE
FT                   LSAIQEVERDYQCQVLSIIDLDDLMQFIEQDPRYSSHLPEMSAYRAEFGV"
FT   CDS_pept        complement(224519..225235)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02160"
FT                   /product="ribonuclease PH"
FT                   /db_xref="GOA:E7A879"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:E7A879"
FT                   /protein_id="CBY80461.1"
FT                   /translation="MRPNNRENNQPRQIKITRNYTKHAEGSVLVEFGDTKVLCTATVED
FT                   AVPRFLKGQGQGWVTAEYGMLPRSTHSRMQREAAKGKQGGRTMEIQRLIARSLRAMVDL
FT                   KALGERAITLDCDVIQADGGTRTASITGAAVALCDAINGLIENGTLKTNPIKGLVSAIS
FT                   VGIVDGQAVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLDLAK
FT                   QGCNQIFIAQREALGL"
FT   tRNA            complement(225375..225447)
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:225412..225414,aa:Ala)"
FT                   /note="tRNA Ala anticodon GGC, Cove score 68.05"
FT   CDS_pept        complement(225528..226970)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02180"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A880"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004527"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR033910"
FT                   /db_xref="UniProtKB/TrEMBL:E7A880"
FT                   /protein_id="CBY80462.1"
FT                   /translation="MKLDAPFNLDPNVKVRTRFAPSPTGYLHVGGARTALYSWLYAKHN
FT                   NGEFVLRIEDTDLERSTPEATATIIEGMEWLNLPWEHGPYYQTKRFDRYNQVIDEMIEQ
FT                   GLAYRCYCTKDRLEELRHTQEQNKEKPRYDRHCLHDHSHSPDEPHVVRFKNPTEGSVVF
FT                   DDAVRGRIEISNSELDDLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQI
FT                   NILKAIGAPIPTYAHVSMINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG
FT                   HGDQEIFSREEMINYFELDHVSKSASAFNTEKLQWLNQHYIRELPPEYVAKHLEWHYKD
FT                   QGIDTSNGPALTEIVSMLAERCKTLKEMANSSRYFFEEFETFDEVAAKKHFKGNAAEAL
FT                   AKVKEKLTALSSWNLHSIHEAIEQTAAELEVGMGKVGMPLRVAVTGSGQSPSMDVTLVG
FT                   IGRDRVLVRIQRAIDFIHAQNA"
FT   tRNA            227141..227213
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:227174..227176,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 65.58"
FT   tRNA            227260..227332
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:227293..227295,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 70.91"
FT   tRNA            227394..227466
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:227427..227429,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 70.91"
FT   tRNA            227522..227594
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:227555..227557,aa:Val)"
FT                   /note="tRNA Val anticodon TAC, Cove score 70.91"
FT   CDS_pept        227720..229375
FT                   /transl_table=11
FT                   /gene="lpt6"
FT                   /locus_tag="HIBPF_02190"
FT                   /product="PE-tn-6--lipooligosaccharide
FT                   phosphorylethanolamine transferase"
FT                   /db_xref="GOA:E7A881"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E7A881"
FT                   /protein_id="CBY80463.1"
FT                   /translation="MIAYIFLALFTIAAVIFIVNSHYRWTYFFAITLFTFLFGGMLMVS
FT                   SQWQRALNFSSVLFVVLMLFHRLKIHYYKQPLLISDFFLVVDWRNWETLIHYKGALFGV
FT                   IGLLALLGYAIFGFNDVESLGVLGNSIGALLFIVSFSLMWHYSKNPSAVQVWLDSLPDD
FT                   GRDVFLNLPMSCRGIFFKVPNFDGNSQNFIEKMTALSSDTNNLSETKPDIVVTLMESTL
FT                   NPHQFAFSQQSIPPLSMFESQSDTVFASPLRVHTFAGATWKSEFAFLAGVPSTDFGALA
FT                   SGVFYSVVPHLQSGLVKNLKAQGYFCVALSPFTKGNYNAKSAYDHFGFDLMLQPQDLGY
FT                   PAPISKNLWDISSEEMMKYTRMILEKQHPALENVDQPMFVYVLTMREHGPYELGMENTF
FT                   NLQMPNLGAKSISALNDYTQRIVALNDAIEGMNNYLQERKKPFVLGYFGDHQVAFDNAI
FT                   PPKKGDYAQPDYVTQFVVRSNCASQFKQEQKFLDLAFAGGVLMNVAGLSAEDEFMKANM
FT                   AMCKLSDGKLEDSSDIQLLNEYRHYLYQTLAIAR"
FT   CDS_pept        complement(229395..230222)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02200"
FT                   /product="trna-processing ribonuclease"
FT                   /db_xref="GOA:E7A882"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/TrEMBL:E7A882"
FT                   /protein_id="CBY80464.1"
FT                   /translation="MLWGISMISLKNFGLLFWKRFSENKLNQVAGALTYSTMLAIVPLV
FT                   MVIFSIFSAFPVFNEVTGELKEMIFTNFAPSASDMVGEYIDQFVSNSKKMSAVGIVSLI
FT                   AVALMLINNIDRTLNSIWHNSQSRSPLSSFAIYWMILTLGPLIIGVSIGISSYIKIMFE
FT                   QSEHLSLGLKLLSFVPFLFTWFIFTLIYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAF
FT                   TWYIVTFPSYQLIYGAMATLPIMLLWIQISWLVVLVGAQLASTLDEIGEQIEQ"
FT   CDS_pept        complement(230201..230683)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR023006"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:E7A883"
FT                   /protein_id="CBY80465.1"
FT                   /translation="MSEISTALSEDCPCQSGHYYADCCGKFHLRQAFPETAEQLMRSRY
FT                   TAYVLKNIPYIVVTTVPSQQTLLKPRLLQEWADNTTWLGLEILKTESLTKTQSAVEFKA
FT                   IFQGEEGELAHQERSIFVKIENRWYFVDPTVSLPTMKQPCVCGSGKKFKHCCGGFL"
FT   CDS_pept        complement(230686..231348)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A884"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:E7A884"
FT                   /protein_id="CBY80466.1"
FT                   /translation="MNAKILVIKVGQVQTLTFSDGSQYESAIRKKVVPSVKIHSLGAEG
FT                   NDVGLKKHHGGVDKALFFMSADSFNELNTLLNKDFSYMDTATYGENFVVSGLNEDNVCI
FT                   GDRYQIGSTILEVSQPRKPCERLSKNTENEDTRDIVYQTGLSGWYVRIIETGTIKQKDE
FT                   LKLLARPYPQITIRHLNRLLSAPENEAELDAALEIEVLAEAFKRSIRSQISKFKQQG"
FT   CDS_pept        231585..232343
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02230"
FT                   /product="uridine phosphorylase"
FT                   /db_xref="GOA:E7A885"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:E7A885"
FT                   /protein_id="CBY80467.1"
FT                   /translation="MSDVFHLNLTKAQLKGATLAIVPGDPARSERIAKQLDNPEFLTST
FT                   REFTSWLGYINGQPIVVCSTGIGGPSTSICVEELAQLGVRTFLRIGTTGAIQPHINVGD
FT                   VLITTAAVRLDGASHHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVTVSSDTFYPG
FT                   QERYDTYSGKVYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMVAGVIVNRT
FT                   QQEIPNEATIKQTEEKAVSVVIAAAQALLS"
FT   CDS_pept        complement(232568..233884)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02240"
FT                   /product="conserved hypothetical metabolite transport
FT                   protein"
FT                   /db_xref="GOA:E7A886"
FT                   /db_xref="InterPro:IPR004736"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E7A886"
FT                   /protein_id="CBY80468.1"
FT                   /translation="MSTQLRNNPMKVALASMVGTAIEFFDYYIYAAAAVLVFNTQFFHS
FT                   DDPLSNDLLSLSTLALAFFARPIGSALFGHFGDKIGRKKTLVASLVLMGGSTVVIGLLP
FT                   NYAQIGIWAPILLCVCRVGQGIGLGGEWGGAALVATENAPEGKRAWYGTFPQLGAPIGL
FT                   FVANGTFFLVSCLLGHNALVEWAWRIPFVSSILLVAVGLYVRLTLHESHVFVEAEQKGK
FT                   KLNAPVSVVFTKHLKPMIIGTFIMVATYSLFYIMTAFAQAYSRTAPKLSEAGYALGLGI
FT                   PANTFTGLLLISAIVFGIFISISGFYADKIGRRKWLIWVTIAIGVLGLAMPLFLENGTP
FT                   VSVFAFLVIGMAIMGMTFGPMAALLPELFPTEVRYSGASLAYNLASIIGATIAAMISLK
FT                   INASFGVMGVGIYLAINALMTFLALLASKETKNVDLTEI"
FT   CDS_pept        complement(233940..234683)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A887"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7A887"
FT                   /protein_id="CBY80469.1"
FT                   /translation="MINIIFLHGLLGTKNDWQKVIENLPHFNCIALDLPFHGQAKDLEV
FT                   TNFEETAEYLAKQIKSAVKNEPYFLVGYSLGGRIALYYALQAQLERSNLQGVILEGANL
FT                   GLKTDEEKQARFLQDFAWAQRFMQESPEKVLNDWYQQPVFSHLTAEERLQLVEKRKSSC
FT                   GENIGKMLLATSLSKQPDFSEKVRLSSLPFFYFCGERDHKFQVLAKENQIDLVTIPCAG
FT                   HNSHLENSKYFSKKIENCILKIARP"
FT   CDS_pept        complement(234744..236450)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02260"
FT                   /product="menaquinone biosynthesis protein MenD"
FT                   /db_xref="GOA:E7A888"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:E7A888"
FT                   /protein_id="CBY80470.1"
FT                   /translation="MSVSVFNRCWSKVILETLVRQGVSHVCIAPGSRSTPLTLEAVRLQ
FT                   NAGSVTCHTHFDERGLGFFALGIAKATQSPVAIIVTSGTATANLYPAIIEARQTGVNLF
FT                   VLTADRPPELWECGANQAILQQNMFGQYPVANVNLPKPNADYSAQWLISLLEQAAFQQK
FT                   QQGGVVHINVPFAEPLYDATDEEVNSHSWLQPLQRWLIQNKSWINVEVQQNEVLMHENW
FT                   DHWRTKRGVVVVGQLPAEQAMGINSWASAMGWVLLTDIQSGVVPTTPYEDIWLANQTVR
FT                   EKLLQADIVIQFGARFISKRINQFLQAFKGEFWLVEQSGKALDPYHHSLTRFNAKAHHW
FT                   LRAHPPLRQKPWLLEPLALSKFCATFIEQQVGGNLTEASLALRLPTLLPYNGVLFLGNS
FT                   LLVRLVDALTQLPESYPVYTNRGASGIDGLLATAAGIGIGSNKPVVAVIGDTSTLYDLN
FT                   SFALFKNVTQPTLIFVINNNGGAIFDMLPVDEQVKDQFYRLPHNGDFSQIAAMFDLKYA
FT                   HPYTWADLNSVVKQAYSRRKATLIEIKTNPSDGSSLYKRLIEQISHAVIGA"
FT   CDS_pept        complement(236466..237737)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02270"
FT                   /product="menaquinone-specific isochorismate synthase"
FT                   /db_xref="GOA:E7A889"
FT                   /db_xref="InterPro:IPR004561"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR034681"
FT                   /db_xref="UniProtKB/TrEMBL:E7A889"
FT                   /protein_id="CBY80471.1"
FT                   /translation="MSYLAQAIGELKSQIHAYLQQSTNELVRFQVKLDKVDLLAWLKGQ
FT                   SAYPQFYLHFRDEEKALAALGAVQSFSQLNLAQEFIEESGFPLVGGLQFQGTAQFVLPK
FT                   MLVEQDNKGALVSFFVKNEQSANDTLAHLKTFGNLTALSALPKQIPLHTEPRANERTWC
FT                   DWVNQALVEIKSGELTKIVLANETTFHLKQAINAYDFLAESEKQNQGCYHFLWAENSHS
FT                   VFVGSTPERLFAREYNLLLTEALAGTASVSESEEETQSQANWLLNDEKNLKENWLVVED
FT                   ISQNLRKQVESFDVSNVELKPLRKVQHLIRKIRANLTAHYADVNILKAIHPTAAVSGLP
FT                   QQQAKMILSEIETFDRGWYAGTLGVMSDVCSEFCVAIRSAFIEGHRIRVFAGAGIVAGS
FT                   QPLEEWKEIERKAAGLISLFAEEK"
FT   CDS_pept        237894..239108
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02280"
FT                   /product="probable aspartate aminotransferase"
FT                   /db_xref="GOA:E7A890"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7A890"
FT                   /protein_id="CBY80472.1"
FT                   /translation="MRLFPKSDKLEHVCYDIRGPVHKEALRLEEEGNKILKLNIGNPAP
FT                   FGFEAPDEILVDVLRNLPSAQGYCDSKGLYSARKAIVQYYQSKGIHGATVNDVYIGNGV
FT                   SELITMAMQALLNDGDEVLVPMPDYPLWTAAVTLSGGKAVHYLCDEEANWFPAIDDIKA
FT                   KVNTKTKAIVIINPNNPTGAVYSKELLQEIVEIARQNNLIIFADEIYDKILYDGAVHHH
FT                   IAALAPDLLTVTLNGLSKAYRVAGFRQGWMILNGPKHNAKGYIEGLDMLASMRLCANVP
FT                   MQHAIQTALGGYQSINEFILPGGRLLEQRNKAYDLITQIPGITCVKPMGAMYMFPKIDV
FT                   KKFNIHSDEKMVLDLLRQEKVLLVHGKGFNWHSPDHFRVVTLPYVNQLEEAITKLARFL
FT                   SDYRQ"
FT   CDS_pept        239225..240481
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02290"
FT                   /product="tryptophan-specific transport protein"
FT                   /db_xref="GOA:E7A891"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR013059"
FT                   /db_xref="InterPro:IPR013061"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:E7A891"
FT                   /protein_id="CBY80473.1"
FT                   /translation="MIQQKSPSLLGGAMIIAGTAIGAGMLANPTSTAGVWFIGSILALI
FT                   YTWFCMTTSGLMILEANLHYPTGSSFDTIVKDLLGKSWNTINGLSVAFVLYILTYAYIT
FT                   SGGGITQNLLNQAFSSAESAVDIGRTSGSLIFCLILAAFVWLSTKAVDRFTTVLIVGMV
FT                   VAFFLSTTGLLSSVKTAVLFNTVAESEQTYLPYLLTALPVCLVSFGFHGNVPSLVKYYD
FT                   RDGRRVMKSIFIGTGLALVIYILWQLAVQGNLPRTEFAPVIEKGGDVSALLEALHKYIE
FT                   VEYFSVALNFFAYMAISTSFLGVTLGLFDYIADLFKFDDSLLGRTKTTLVTFLPPLLLS
FT                   LQFPYGFVIAIGYAGLAATIWAAIVPALLAKASRQKFPQASYKVYGGNFMIGFVILFGI
FT                   LNIVAQIGANLGWFASFTG"
FT   CDS_pept        complement(240590..241957)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02300"
FT                   /product="L-serine deaminase I"
FT                   /db_xref="GOA:E7A892"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:E7A892"
FT                   /protein_id="CBY80474.1"
FT                   /translation="MISVFDMFKVGIGPSSSHTVGPMKAGKQFIDDLIKRNQFEQTTEI
FT                   HVDVYGSLSMTGRGHSTDIAIIMGLAGYLPHNVDIDMISGFIEKVKQTALLPINVGQKI
FT                   VKFDFENNLIFHRTFLKLHENGMTITALDENRTELYLQTYYSIGGGFIVDEAHFGKAEK
FT                   NTVQVPYPYKNAEDILKHCSDNGLMLSTVMLENEIALNGKEAVSAHLENVWKTMQACIE
FT                   HGIHTEGILPGPLRVPRRAASLYRALQANTNLSNDPMRVIDWVNMFALAVNEENAAGGR
FT                   VVTAPTNGACGIIPAVLAYYEKFISPLTPEIIERYLLAAGMIGSLYKMNASISGAEVGC
FT                   QGEVGVACSMAAAGLAEILGGNPLQVCIAAEIAMEHNLGLTCDPVGGQVQVPCIERNAI
FT                   ASVKAINASRMALRRTTNPRVTLDKVIETMYETGKDMNAKYRETSQGGLAVKIICN"
FT   CDS_pept        complement(241992..243230)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02320"
FT                   /product="predicted serine transporter"
FT                   /db_xref="GOA:E7A893"
FT                   /db_xref="InterPro:IPR004694"
FT                   /db_xref="InterPro:IPR018227"
FT                   /db_xref="UniProtKB/TrEMBL:E7A893"
FT                   /protein_id="CBY80475.1"
FT                   /translation="MKSTEKLKWNKFDATWMLNLFGTAVGAGVLFLPINAGMGGFWPLV
FT                   LMAIIVGPMTYFAHRGLAYFVLSSKNPGSDITEVVEEHFGKTAGKLITLLYFFAIFPIL
FT                   LIYGNGITNTVDSFIVNQLGMASPNRVILSFVLIAVLISVMLFNEKVMLKITEWLVYPL
FT                   VLILFVLSIYLIPEWNSAVLYELPTAGGFLTTLWLTIPVLVFSFNHSPAISSFTCSQFR
FT                   EYKTFEGAERHISHTEKGVSTILLFFVMFFVFSCVLTLTPEELVAAKEQNISILSFLAN
FT                   KFDNPYISYFGPLVAFLAITSSFFGHYMGAREGLEGLYLKMKGEAVNRKKLNYATALFF
FT                   LLTLWGVAIINPSILGLIESLGGPIIAMILFIMPMYSIRKIPAMKRYSGRFSNVFVTIM
FT                   GLIAISAVVYGLL"
FT   CDS_pept        complement(243453..245621)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02330"
FT                   /product="copper transporter"
FT                   /db_xref="GOA:E7A894"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E7A894"
FT                   /protein_id="CBY80476.1"
FT                   /translation="MLDLTPQSKKISIQIGGMTCQSCANRIEKVLNKKPFVQQAGVNFA
FT                   AEEAQVLFNPDQASEAQIIEIIHKTGFSAHIKQANELPIEENTSIPWRLIVLWIINIPF
FT                   LIGMLGMISGSHHLMLPPIWQFALASIVQLWLAIPFYRGAIGSIRGGLANMDVLVSTGT
FT                   LTIYLYSAFMLFYHANHAMGHVYFEASVMVMGFVSLGKFLEERTKKHSLNSLSMLLQLT
FT                   PKKVTALRNDKWTEIALDQVDIGEIIRANQGERIAADGIIESGNGWCDESHLTGESRPE
FT                   EKQKGGKVLAGAMVTEGSIIYRANQLGSQTLLGDMMNALSDAQGSKAPIARFADKVASV
FT                   FVPAVLVISLVTFTLTYILTNDSVFSLIHAVSVLVIACPCALGLATPAAIMVGLGKAVN
FT                   AGVWFKDAAAMEETAHVDTVVLDKTGTLTKGELEISALWQPQSAVYSEEDLYRFAAAVE
FT                   RQANHPIAKAIVQTAEQKMLEIPTALFSKMEVGQGIQAELEQVGTIKVGKPDYCGLILP
FT                   KNLEDIWQIASIVAVSINDKPIGAFALTDTLKNDSLHAIQRLQQQNIDVVIMSGDQQSV
FT                   VDYIAKQLGIKKVFGGLSPRDKAEQIQKLKAQGHIVAMVGDGINDAPALAAANVSFAMK
FT                   SGSDIAEQTASATLMQHSVNQLVDALFIAVATLKNIKQNLFFALIYNILGIPLAAFGFL
FT                   SPIIAGAAMALSSISVLMNALRLKKVRF"
FT   CDS_pept        complement(245888..246094)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02331"
FT                   /product="Mercuric ion scavenger protein"
FT                   /db_xref="GOA:E7A895"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E7A895"
FT                   /protein_id="CBY80477.1"
FT                   /translation="MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKVNITF
FT                   DENRVNVAQLIEVIEDAGFDATE"
FT   CDS_pept        complement(246169..246375)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02332"
FT                   /product="Mercuric ion scavenger protein"
FT                   /db_xref="GOA:E7A896"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR017969"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:E7A896"
FT                   /protein_id="CBY80478.1"
FT                   /translation="MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKVNITF
FT                   DENRVNIAQLIEVIEDAGFDATE"
FT   CDS_pept        246452..246838
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02380"
FT                   /product="probable heavy metal dependent transcriptional
FT                   regulator"
FT                   /db_xref="GOA:E7A897"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR011789"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:E7A897"
FT                   /protein_id="CBY80479.1"
FT                   /translation="MNISEAAKLVGLSTKQIRDYEKIGLIKPAVRSLSGYRNYGESDLE
FT                   RLHFIRHSRNVGFSLHQIAQLLALQDNPKRSCREVKVLTAQHIATLNQQIEQLQKMVQK
FT                   LQHWHDSCQGNDNPECLILNGLNG"
FT   CDS_pept        complement(246852..247169)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02390"
FT                   /product="Met repressor"
FT                   /db_xref="GOA:E7A898"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:E7A898"
FT                   /protein_id="CBY80480.1"
FT                   /translation="MANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQ
FT                   LKSLRHATNSELLCEAFLHAFTGQPLPTDADLMKERNDEIPEDAKVLMRELGVDPESWE
FT                   Y"
FT   CDS_pept        247417..248679
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02400"
FT                   /product="transcription termination factor rho"
FT                   /db_xref="GOA:E7A899"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:E7A899"
FT                   /protein_id="CBY80481.1"
FT                   /translation="MHLTELKNTPVSDLVKLGEEQMGLENLARLRKQDIVFAILKQHAK
FT                   SGEDIFGGGVLEILPDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRP
FT                   PKEGERYFALLKIDQVNDDKPEVSRSKILFENLTPLHANSRLRMERGNGSTEDLTARIL
FT                   DLASPIGKGQRGLIVAPPKAGKTMLLQNIAQSITHNYPDVELIVLLIDERPEEVTEMQR
FT                   SVKGEVIASTFDEPATRHVQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPA
FT                   SGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTG
FT                   NMELHLSRKIAERRVFPAIDFQRSGTRKEDLLTTADELQKMWILRKILNPMDEVDAMEF
FT                   LIDKLMMAKTNEEFFEVMKRS"
FT   CDS_pept        complement(248734..249426)
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="HIBPF_02410"
FT                   /product="putative type 4 prepilin-like protein specific
FT                   leader peptidase"
FT                   /db_xref="GOA:E7A8A0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A0"
FT                   /protein_id="CBY80482.1"
FT                   /translation="MIYFTMFLLGGIFGIALWFYLSGFITRLQQEIYATYIELFPQNFL
FT                   PFQSSVSSIQQKKCGHILRYFLSVGVGFIFLQIAFKDSIFTVWFGLTLLILWAISYLDW
FT                   HYQLISTTLCLWLLTIGLFGADNNFSLLTLSESIKSAASFFIVFYAIYWIAKFYYGKEA
FT                   FGRGDYWLAMALGSFIQLETLPHFLLLASVLGICFSLIHKKKKEFIPFAPFMNLSAVII
FT                   YFVKYYWY"
FT   CDS_pept        complement(249423..250640)
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="HIBPF_02420"
FT                   /product="putative type IV pilin secretion protein"
FT                   /db_xref="GOA:E7A8A1"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A1"
FT                   /protein_id="CBY80483.1"
FT                   /translation="MTKKLFYYQGSNALNQKQKGSIIADTKQQAHFQLISRGLTHIKLQ
FT                   QNWQFGAKPKNSEISELLNQLATLLQSAIPLKNSLQILQQNCTQIMLNEWLERLLQSIE
FT                   SGLAFSQAIEQQGKYLTQQEIQLIQVGEMTGKLAVVCKKIATHRSQSLALQRKLQKIML
FT                   YPSMVLGISLLLTLALLLFIVPQFAEMYSGNNAELPTITAILLSISNFLKQNIGILLFF
FT                   ALSFVLFYYFYLKRQTWFHQKKNQLISITPIFGTIQKLSRLVNFSHSLQIMLQAGVPLN
FT                   QALDSFLPRTQTWQTKTLVNDIILDKEVRSILQWVSQGYAFSDSVSSDLFPMEAQQMLQ
FT                   IGEQSGKLALMLEHIADNYQEKLNHQIDLLSQMLEPLMMVIIGSLIGIIMMGMYLPIFN
FT                   MGSVIQ"
FT   CDS_pept        complement(250637..252031)
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="HIBPF_02430"
FT                   /product="putative type IV pilin secretion protein"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A2"
FT                   /protein_id="CBY80484.1"
FT                   /translation="MTSYALLHTQRVTAQNGEIFTISPDLWVRNQQQQSLLLRYFALPL
FT                   KEENNRLWLGVDSLSNLSACETIAFITGKPVEPILLESSQLKELLQQLTPRQMQVEEQV
FT                   KFYQHQETHFEQEDDEPVIRLLNQIFESALQKNASDIHLETLADQFQVRFRIDGVLQPQ
FT                   PLISKIFANRIISRLKLLAKLDISENRLPQDGRFQFKTTFSDILDFRLSTLPTHWGEKI
FT                   VLRAQQNKPVELSFAELGMTENQQQAFQRALSQPQGLILVTGPTGSGKSISLYTALQWL
FT                   NTPDKHIMTAEDPIEIELDGIIQSQINPQIGLDFSRLLRAFLRQDPDIIMLGEIRDEES
FT                   AMIALRAAQTGHLVLSTLHTNDAISAISRLQQLGIQQYEIENSLLLVIAQRLVRKICPK
FT                   CGGNLINSCDCHQGYRGRIGVYQFLHWQQNGYQTDFQNLRVSGLEKVSQGITDEKEIER
FT                   VLGKNS"
FT   CDS_pept        complement(252028..252477)
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="HIBPF_02431"
FT                   /product="putative type IV pilin secretion protein"
FT                   /db_xref="GOA:E7A8A3"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A3"
FT                   /protein_id="CBY80485.1"
FT                   /translation="MKLTTQQTLKKGFTLIELMIVIAIIAILATIAIPSYQNYTKKAAV
FT                   SELLQASAPYKADVELCVYSTNETTNCTGGKNGIAADITAAKGYVKSVTTSNGAITVKG
FT                   DGTLANMEYILQATGNAATGVTWTTTCKGTDASLFPANFCGSVTQ"
FT   CDS_pept        252592..253152
FT                   /transl_table=11
FT                   /product="AmpD signalling protein"
FT                   /db_xref="GOA:E7A8A4"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A4"
FT                   /protein_id="CBY80486.1"
FT                   /translation="MQKLKDIEQGILDCRQIQSPHFDKRPNPQDISLLVIHYISLPPKQ
FT                   FGGGYVDDFFQGKLDPKIHPYFAEIYQMRVSAHCLIERNGRITQYVNFNDRAWHAGVSN
FT                   FQGREKCNDFAIGIELEGSNEQPFTDAQYFSLQELTNVIMKSYPKITKDRIVGHCDISP
FT                   GRKIDPGQYFDWERYLSSVKQTV"
FT   CDS_pept        253775..254674
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02460"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /db_xref="GOA:E7A8A5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A5"
FT                   /protein_id="CBY80487.1"
FT                   /translation="MNDEQQNSNQPENTKKPFFQSLFGRFFQGELKNREELVEVIRDSE
FT                   QNDLIDQNTREMIEGVMEIAELRVRDIMIPRSQIIFIEDQQDLNTCLNTIIESAHSRFP
FT                   VIADADDRDNIVGILHAKDLLKFLREDAEVFDLSSLLRPVVIVPESKRVDRMLKDFRSE
FT                   RFHMAIVVDEFGAVSGLVTIEDILEQIVGDIEDEFDEEEIADIRQLSRHTYAVRALTDI
FT                   DDFNGQFNTDFDDEEVDTIGGLIMQTFGYLPKRGEEIILKNLQFKVTSADSRRLIQLRV
FT                   TVPDEHLAEMNNVDEKSE"
FT   CDS_pept        254697..256226
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02470"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="GOA:E7A8A6"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A6"
FT                   /protein_id="CBY80488.1"
FT                   /translation="MNKYLTYFIAFISGLVGVFAFSPFDYWPLAYVSLLGLLYVVKNPK
FT                   KSTALLSTFLWAMGFFCFGVSWLNVSIHQFGGASLGVSYFLVSLLAAYLALYPMLFTYL
FT                   VQRFKVQSAVIFAVIWTLTEFLRGWIFTGFPWLQFGYTQIDSPFYGLAPIFGVTGLTFF
FT                   TLWASAVIFNLVSSLFKTKNLKLVLSNALLLIIVGGLSAYSSRIHFVKSVENKAISVTL
FT                   AQGNIEQNLKWDPNYFYSTLAIYQKLIAENLGKTDLIILPESALPTLENAITPFFEKLE
FT                   HAAKETKTEIMIGTVFQDTKSGKLLNSIMTTGNPDFPYQPDTPNRYNKHHLVPFGEYVP
FT                   LESILRPLNSVFNLPMSAFQSGEAVQPSLIAKKRAFSPAICYEIIFGEQVRQNLKQDTD
FT                   YLLTLSNDAWFGDSIGPWQHLQMARMRALELGKPLIRATNTGISVFVDAQGKVLAQATQ
FT                   FIETTLTYKIAPAEGKTPYSVLGNMPLYALSLLFLLLHSMMAFIRRKMNIL"
FT   CDS_pept        256276..257013
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02480"
FT                   /product="conserved hypothetical RNA methyltransferase"
FT                   /db_xref="GOA:E7A8A7"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A7"
FT                   /protein_id="CBY80489.1"
FT                   /translation="MRIPRIYHPISLENQTQCYLSEDATNHVARVLRMTEGEQLELFDG
FT                   SNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGV
FT                   NVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAEN
FT                   DGALKLNLHPRAHYSIKTLPTIPAEGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRV
FT                   LRTETASLAAISALQICFGDLGE"
FT   CDS_pept        257013..257570
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A8"
FT                   /protein_id="CBY80490.1"
FT                   /translation="MELQGKFLIAMPHLDDYFNRTVVFMCEHNEQGSMGLVINQPTDLS
FT                   IAELYSKLNFMMKNDRTFGNEMVVAGGPMHTERGFILHKNTLNAFQHTYKVTEELSMTT
FT                   SADVVETLGSTFAPEKYLVALGCSSWGAGQLEKEIRDNAWLVVSSNDQILFDMPYEDRY
FT                   AAANQLLGIHPYNFALAQVGHS"
FT   CDS_pept        257570..257989
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02500"
FT                   /product="putative holliday junction resolvase"
FT                   /db_xref="GOA:E7A8A9"
FT                   /db_xref="InterPro:IPR005227"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8A9"
FT                   /protein_id="CBY80491.1"
FT                   /translation="MGITALAFDFGTKSIGCAIGQSITGTAQALPAFKAQDGIPNWEAI
FT                   EKCLKEWKPDVVIVGLPLNMDGTEQDLTLRARKFANRLQGRFGVNVHLQDERLTTTQAR
FT                   SEIFERGGFKALKKGKIDGVSACLILESWFEYAEY"
FT   CDS_pept        complement(258039..258947)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02510"
FT                   /product="recombination associated protein"
FT                   /db_xref="GOA:E7A8B0"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B0"
FT                   /protein_id="CBY80492.1"
FT                   /translation="MWFKNLMTYRLTKPLDWDLAQLQTQLEDCQFHPCGAQDQSKFGWS
FT                   APLRGADLLYFSVGKQILLIAKKEEKILPANVVKRELDERIESLEQKENRKLKKVEKQT
FT                   LKDDVVMNLLPRAFSKNQHTALWIDTENNLVHVDAASSKRAEDALALLRKSLGSLPVVP
FT                   LAFANEPSTILTNWILQDSLPHWLLALEEAELRGSQEDSVIRCKKQPLENEEILALLQD
FT                   GKKVVSKLALEWEDTLTFVFNEDCTIKRLKFADTVREKNDDILKEDFAQRFDADFVLMT
FT                   GILAKLTENLLDEFGGEKARL"
FT   CDS_pept        259013..259828
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02520"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="GOA:E7A8B1"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B1"
FT                   /protein_id="CBY80493.1"
FT                   /translation="MQHKLIAFIGGGNMAQAIILGLLKQGYPAEQIIVNDPNEEKRAFF
FT                   ANLGMATSENNVESATKAEVVLLAVKPQMMADVCLPLSAVDFSDKLLISIAAGISTERL
FT                   NALIPSLKSIVRVMPNTPALVGEGMAGLFAPKNTSENHRTFAQDLLGAVGRTVWVNDET
FT                   QMHAVTAASGSSPAYFFLMLEAMQKALVKMNIEEKTARELVQQSMLGAAKMVTENPQIA
FT                   LSTLRENVTSKGGTTAAALAVFDAQHFNQTIEQAMQACLSRSQEMETLF"
FT   CDS_pept        259828..260994
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02530"
FT                   /product="probable 3-phenylpropionic acid transporter"
FT                   /db_xref="GOA:E7A8B2"
FT                   /db_xref="InterPro:IPR024989"
FT                   /db_xref="InterPro:IPR026032"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B2"
FT                   /protein_id="CBY80494.1"
FT                   /translation="MQVRPFYWLALSFLGYYCAYGVFLPFFPAWLKSQQYGEEMIGLVI
FT                   GSAYIFRFAGGLFFSSLIKKANHIISSLRLLALASAIIMAAMSLVAHNFWLLFIAIGLY
FT                   ASVNSAGMPIGDSLASTWQRQIGLDYGKVRLIGSSAFILGVVVFGGMIGWVGEQNIVWI
FT                   LTALLSFYTIIQLLKPTIPPKDEIPEDGVQNDVGFIALLKNPMTLRVMVAVGLIQGSHA
FT                   AYYVYSTIYWTSIGISVSQTSLLWGIGVLAEIVLFFFSRHLFQNISISVLLYISAFACV
FT                   GRWAVMGYIEDFWLIFLLQLIHSFTYAVCHYAIVRYITTQPQSHIAKLQGLYNGLSNGV
FT                   LIAIFTAIAGMIYPTSPAMTFVFMSIIAAAAFFVIPRKLNAFLIVQHK"
FT   CDS_pept        261025..261918
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02540"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="GOA:E7A8B3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B3"
FT                   /protein_id="CBY80495.1"
FT                   /translation="MKNLALIDLFLNEYWIEKGLSENTVQSYRLDLTALCDWLDKNGLS
FT                   LETLDAVDLQGFLGERLEKGYKATSTARMLSAMRKLFQYLYREKYRVDDPSAVLSSPKL
FT                   PSRLPKYLTEQQVSDLLNTPDVEVPLELRDKAMLELLYATGLRVTELVSLTIENMSVQQ
FT                   GVVRVIGKGNKERIVPMGEEAAYWVRQFMLYGRPVLLNGQSSDVVFPSQRTQQMTRQTF
FT                   WHRVKHYAILADIDADALSPHVLRHAFATHLVNHGADLRVVQMLLGHTDLSTTQIYTHV
FT                   AKERLKRLHERFHPRG"
FT   CDS_pept        262091..262378
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR020493"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B4"
FT                   /protein_id="CBY80496.1"
FT                   /translation="MKKITLFFTALLCLFSTSVLAESNSMPKQCEQLFKETENLIAQAE
FT                   KQPGTHIQVNKIKSKLNQSKQQILQMELATQLKSCEVGLAKLSNLKSYSE"
FT   CDS_pept        complement(262430..263437)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02560"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /db_xref="GOA:E7A8B5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004605"
FT                   /db_xref="InterPro:IPR008823"
FT                   /db_xref="InterPro:IPR008824"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041445"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B5"
FT                   /protein_id="CBY80497.1"
FT                   /translation="MIEADRIISGQAKVDEDVIDRAIRPKLLADYVGQPQVCEQMDIFI
FT                   KAAKLRQDALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAAMLTNL
FT                   EPHDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTR
FT                   AGSLTSPLRDRFGIVQRLEFYSVEDLTSIVARSAGCLNLELEQQAAFEVARRSRGTPRI
FT                   ANRLLRRVRDYADVRNGGIISINVAKQALSMLDVDDAGFDYLDRKLLSAVIERFDGGPV
FT                   GLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSQTYRHFGLQKLSD"
FT   CDS_pept        complement(263445..264059)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02570"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /db_xref="GOA:E7A8B6"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B6"
FT                   /protein_id="CBY80498.1"
FT                   /translation="MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQET
FT                   TLFTHLVVREDAHLLFGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIER
FT                   EELSKLTKIPGVGKKTAERLLVELKGKFKGIKQSDFFVESTHIPLSPSIESHSESSSDE
FT                   AISALIALGYKPAEAEKMVKLVAKPELTSEQVIREALKAAL"
FT   CDS_pept        complement(264122..264694)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02580"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="GOA:E7A8B7"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B7"
FT                   /protein_id="CBY80499.1"
FT                   /translation="MSIILGIDPGSRVTGYGVIRQTGRHLEYLGSGAIRTQVEDLPTRL
FT                   KRIYAGVTEIITQFQPNMFAIEQVFMAKNADSALKLGQARGTAIVAAVNHDLPVFEYAA
FT                   RLVKQTVVGIGSADKVQVQEMVTRILKLSDKPQADAADALAIAITHAHSIQHSLHIANS
FT                   VKMTETQEKMTALLKTRYSRGRFRLKI"
FT   CDS_pept        complement(264741..265481)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8B8"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B8"
FT                   /protein_id="CBY80500.1"
FT                   /translation="MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSA
FT                   NPRLRAAVDKALSNNMTRDTINRAIDRGVGGGDDTNMETKIYEGYGPGGTAVMVECLSD
FT                   NANRTISQVRPSFTKCGGNLGTEGSVGYLFSKKGLILIAEADEDALTEAAIEAGADDIQ
FT                   PQDDGSFEIYTAWEDLGSVRDGIEAAGFKVQEAEVTMIPSTTVDLDIETAPKLLRLIDM
FT                   LEDCDDVQNVYHNGEICDEVASQL"
FT   CDS_pept        complement(265641..266117)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02600"
FT                   /product="dATP pyrophosphohydrolase"
FT                   /db_xref="GOA:E7A8B9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR003564"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8B9"
FT                   /protein_id="CBY80501.1"
FT                   /translation="MRSDLTAFLMMQYKNNQSVLVVIYTKDTNRVLMLQRQDDPDFWQS
FT                   VTGTIESGETPKKTAIRELWEEVRLEISENSTALFDCNESIEFEIFPHFRYKYAPNITH
FT                   CKEHWFLCEVEKEFMPVLSEHLDFCWISAKKAVEMTKSQNNAEAIKKYLFNLRR"
FT   CDS_pept        complement(266139..267905)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02610"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A8C0"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004115"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004524"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029351"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C0"
FT                   /protein_id="CBY80502.1"
FT                   /translation="MMRTHYCGALNRNNIGQDVTLSGWVHRRRDLGGLIFIDMRDRDGI
FT                   VQVCFDPKYQDALTAAAGLRNEFCIQIKGEVIARPENQINKNMATGEVEVLAKELRIYN
FT                   ASDVLPLDFNQNNTEEQRLKYRYLDLRRPEMAQRLKTRAKITSFVRRFMDDNGFLDIET
FT                   PMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDL
FT                   RADRQPEFTQIDVETSFLTAPEVREIMERMVHDLWLDTIGVDLGKFPVMTWQEAMCRFG
FT                   SDKPDLRNPLEMVDVADIVKDVEFKVFNEPANNPNGRVAVIRVPNGAEITRKQIDEYTQ
FT                   FVGIYGAKGLAWAKVNDINAGLEGVQSPIAKFLNEEVWKALAERVNAQTGDILFFGADK
FT                   WQTTTDAMGALRLKLGRDLGLTRLDEWKPLWVIDFPMFERDEEGNLAAMHHPFTSPKDF
FT                   TPEQLEVNPTDAVANAYDMVINGYEVGGGSVRIFDPKMQQTVFRILGIDEEQQREKFGF
FT                   LLDALKFGTPPHAGLAFGLDRLTMLLTGTENIRDVIAFPKTTAAACLMTEAPSFANPQA
FT                   LEELAISVVKAE"
FT   CDS_pept        268124..268642
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8C1"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C1"
FT                   /protein_id="CBY80503.1"
FT                   /translation="MLFINITFACILAIRFYSLSISIRHEKALIAKGAIQYGKRNSTLL
FT                   SIAHVAFYFAAIIEANKQNLSFNSTSQIGLAILIFAIAMLFYVIYELKEIWTVKIYILP
FT                   EHQINRSFLFKYVRHPNYFLNIIPELIGLSLFCQAKYTALVGLPIYLLILVVRIKQEES
FT                   AMSHLFPKS"
FT   CDS_pept        268695..269420
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8C2"
FT                   /db_xref="InterPro:IPR005271"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C2"
FT                   /protein_id="CBY80504.1"
FT                   /translation="MVKDTLFSTPIAKLGDFIFDENVAEVFPDMIQRSVPGYSNIITAI
FT                   GMLAERFVTADSNVYDLGCSRGAATLSARRNIHQPNVKIIGIDNSQPMVERCRQHIAAY
FT                   HSEIPVEILCDDIRHVEIKNASMVILNFTLQFLPPEDRIALLTKIYEGLNPNGVLVLSE
FT                   KFRFEDTKINHLLIDLHHQFKRANGYSELEVSQKRTALENVMRTDSIETHKVRLKNVGF
FT                   SQVELWFQCFNFGSMIAVK"
FT   CDS_pept        269494..269901
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02640"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="GOA:E7A8C3"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR004361"
FT                   /db_xref="InterPro:IPR018146"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C3"
FT                   /protein_id="CBY80505.1"
FT                   /translation="MQILHTMLRVGDLDRSIKFYQDVLGMRLLRTSENPEYKYTLAFLG
FT                   YEDGESAAEIELTYNWGVDKYEHGTAYGHIAIGVDDIYATCEAVRASGGNVTREAGPVK
FT                   GGSTVIAFVEDPDGYKIEFIENKSTKSGLGN"
FT   CDS_pept        269975..270664
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02650"
FT                   /product="ribonuclease T"
FT                   /db_xref="GOA:E7A8C4"
FT                   /db_xref="InterPro:IPR005987"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C4"
FT                   /protein_id="CBY80506.1"
FT                   /translation="MSDSQEIPYHNQLKNRFRGYFPVIIDVETAGFDAKKDALLELAAI
FT                   TLKMDENGYLHPDQKCHFHIKPFEGANINPESLKFNGIDIHNPLRGAVSELDAITGLFQ
FT                   MVRRGQKDADCQRSIIVAHNAAFDQSFVMAAAERTGVKRNPFHPFGMFDTASLSGLMFG
FT                   QTVLVKACLAAKIPFDGKQAHSALYDTERTAELFCYMVNHLKDLGGFPHIASELEQEKT
FT                   TEKETAL"
FT   CDS_pept        270978..272330
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8C5"
FT                   /db_xref="InterPro:IPR018461"
FT                   /db_xref="InterPro:IPR032813"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C5"
FT                   /protein_id="CBY80507.1"
FT                   /translation="MLSNPVVISIIVLLALSLLRINVIIALVIAALTAGFIGDLGLTKT
FT                   IETFTGGLGGGAEVAMNYAILGAFAIAISKSGITDLIAYKIITKMNKTPTAGNLTWFKY
FT                   FIFAVLALFAIFSQNLLPVHIAFIPIVVPPLLSIFNRLKIDRRAVACVLTFGLTATYML
FT                   LPVGFGKIFIESILVKNINQAGATLGLQTNVAQVSLAMLLPVIGMILGLLTAIFITYRK
FT                   PREYNINVEEATTKDIEAHIANIKPKQIVASLIAVVATFATQLVTSSTIIGGLIGLIIF
FT                   VLCGIFKLKESNDIFQQGLRLMAMIGFVMIAASGFANVINATTGVTDLVQSLSSGVVQS
FT                   KGIAALLMLVVGLLITMGIGSSFSTVPIITSIYVPLCLSFGFSPLATISIVGVAAALGD
FT                   AGSPASDSTLGPTSGLNMDGKHDHIWDSVVPTFIHYNIPLLVFGWIAAMYL"
FT   CDS_pept        272363..272953
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02670"
FT                   /product="predicted primosomal replication protein N"
FT                   /db_xref="InterPro:IPR010890"
FT                   /db_xref="InterPro:IPR038338"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C6"
FT                   /protein_id="CBY80508.1"
FT                   /translation="MAVQQLIQCLDQKVQQLYQAHLSKREEKIFAKFDRTLFSENGQNV
FT                   SFYLKEINQTLDKIKSLQSENPDHYIFITKRLLAQCTALSEALTHKNKPFIINTNSIPP
FT                   QSQKKSQHSIHKLPPRERLEKYYEAREQLNNLYRQHKDLAQAEKNNDEKIRYAQLAEVY
FT                   KKRQQKCQDAIDLLEEYLVFKEEVENRENTENK"
FT   tRNA            complement(273008..273094)
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:273058..273060,aa:Ser)"
FT                   /note="tRNA Ser anticodon TGA, Cove score 57.52"
FT   CDS_pept        complement(273309..273875)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02680"
FT                   /product="elongation factor P"
FT                   /db_xref="GOA:E7A8C7"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C7"
FT                   /protein_id="CBY80509.1"
FT                   /translation="MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRK
FT                   LISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAE
FT                   KWLLDQADCIVTLWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQIGEVIRVDTRSGEYVSRVK"
FT   CDS_pept        273913..274929
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02690"
FT                   /product="predicted lysine 2,3-aminomutase"
FT                   /db_xref="GOA:E7A8C8"
FT                   /db_xref="InterPro:IPR003739"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022462"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C8"
FT                   /protein_id="CBY80510.1"
FT                   /translation="MCILTQEPVIREEQNWLTILKNAISDPTLLLKALNLPEDDFEQSI
FT                   AARKLFPLRVPQPFIDKMEKGNPQDPLFLQVMCSDLEFVQAEGFSTDPLEEKNANAAPN
FT                   ILHKYQNRLLFMTKGGCAVNCRYCFRRHFPYDENPGNKKSWQLALDYIAAHSEIEEVIF
FT                   SGGDPLMAKDHELAWLIKHLENIPHLQRLRIHTRLPVVIPQRITDEFCTLLAETRLQKV
FT                   MVTHINHPNEIDQIFTNAMQKLNTVNVTLLNQSVLLRGVNDDAQILKILSDKLFQTGIL
FT                   PYYLHLLDKVQGASHFLISDIEAMQIYKTLQSLTSGYLVPKLAREIAGEPNKTLYAE"
FT   CDS_pept        275001..>275813
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02700"
FT                   /product="opacity associated protein OapA"
FT                   /db_xref="GOA:E7A8C9"
FT                   /db_xref="InterPro:IPR013731"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8C9"
FT                   /protein_id="CBY80511.1"
FT                   /translation="MRTSIRGNPVNSMDKNQQSSQNELDLGLNQEPITPKKTIQPSSSI
FT                   LGKAKGLFAKKNHAQTNFQQRKEPTFGDSSTQENDPLIPSENLKKAQKPVLQTSSTEEN
FT                   ISAVDEEISAENNADEPVKKAEKPILAQPEKWKVLQILPAKHRRLFMAIFVLVILLIIF
FT                   FALKPSSDTVESFTQSNSNEIPVQFQSLDQSQPLETTILDNPPAQNQMAVEQANQSEFA
FT                   PKAEEATNNTTAQNPLVENAPMQQNVVQAPSQMPNEMTAASVMPMQPVQ"
FT   CDS_pept        276388..276792
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02710"
FT                   /product="opacity associated protein OapB"
FT                   /db_xref="InterPro:IPR012097"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D0"
FT                   /protein_id="CBY80512.1"
FT                   /translation="MLKKTSLIFTALLMTGCAQNANVTTPQAQKMQVEKVDKALQKGEA
FT                   DRYLCQDDKVVRVVHATHKKYKKNLHYVTVTFQGISEKLTLMISERGKNYANIRWMWQE
FT                   RDDFSTLKTNLGEILATQCVSQTSERLSGQ"
FT   CDS_pept        276795..277505
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02720"
FT                   /product="DNA repair protein Rec0"
FT                   /db_xref="GOA:E7A8D1"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D1"
FT                   /protein_id="CBY80513.1"
FT                   /translation="MQSELQRGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRS
FT                   SWKSVLQPFTPLLLRWTGKSALKTLTKAEPAAITLPLQQIALYSGFYVNELLTRVIESE
FT                   TPNPALFQHYLKCLTGLATETNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDCTMT
FT                   YRYREEKGFIASLVKDNLTFYGRDLLAFETLDFSDDSVRQAAKRFTRIALKPYLGDKPL
FT                   KSRELFSQHILLLK"
FT   repeat_region   277541..277552
FT                   /note="A x10"
FT   CDS_pept        277655..278269
FT                   /transl_table=11
FT                   /gene="aef2A"
FT                   /locus_tag="HIBPF_02730"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="GOA:E7A8D2"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D2"
FT                   /protein_id="CBY80514.1"
FT                   /translation="MKKQLLSAALVAVFSGALAINANAATNGKITFQGKVVEQTCQIND
FT                   NDQNQIVKLNPVARNVFTNKADVAMPTPFSIVLKDCTTGTRTHAKKVKAGFSSVANVDA
FT                   TNAYTLKNKTASNYASNVHIQLFNKNGTSAISPMKYSNAANNTTNPATVTHSLDDNGEF
FT                   KEIGTTSTPALQYIAKYYATTNGGVTAGEVETSVDFELVYE"
FT   CDS_pept        278364..279059
FT                   /transl_table=11
FT                   /gene="aef2B"
FT                   /locus_tag="HIBPF_02750"
FT                   /product="putative F17-like fimbrial chaperone"
FT                   /db_xref="GOA:E7A8D3"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D3"
FT                   /protein_id="CBY80515.1"
FT                   /translation="MLKKILFGVLLLSSTAQANVVITGTRVIYPENEKTITVKLDNPGK
FT                   KASLVQAWIDEGDPDSDPRYIQVPFAITPPVSRIESQSGQTLRITYTGAKALPKDRESL
FT                   FYFNLLDIPPKPSKAFLESNQNFLQFAVRSRLKFFYRPENLPMKPEEAYKMVRWQAVSN
FT                   GVNVNNPTPYYLSYVSAEVNRTPLKKVRMVAPFSQAVFEGKGIHKGDKLKWYLVNDYGG
FT                   DSTGEAVLQ"
FT   CDS_pept        279093..281612
FT                   /transl_table=11
FT                   /gene="aef2C"
FT                   /locus_tag="HIBPF_02770"
FT                   /product="putative F17-like fimbrial usher"
FT                   /db_xref="GOA:E7A8D4"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D4"
FT                   /protein_id="CBY80516.1"
FT                   /translation="MKKLTTKPFTRRTLAYLLILAFYTSWGYAVEEDEFDGAYWGGGSK
FT                   LGVDFSRFNQKNAVLPGEYDAEVRVNNVLKGNVRLRFADNDETQRAELCLTPALQEILD
FT                   LEKSAIKQQSEEDSCVWAKYAIPDAVFTYQTGEFRLDVDIPQALTVSHPRDYISPTRWQ
FT                   SGTTAAFVNYDVNYYRYHNQRSVNDNVYLGIRAGANIGSWALRHYGSLSWNKSNLSGSY
FT                   TDGYQRSETYLQRDFALLQGDVTLGDFYTSDEIGESFGLRGIRVASDDRMLAPSQRSFA
FT                   PVIRGIANTNANITIRQNGNIIYQIAVPAGPFIIDDLYSSGYNGDLLVEIQESDGKVRS
FT                   FSVPFSNTAPLLRVGHFRYRLSGGKYRHNDDAVEDNVMQATLQYGLFNSLTINGGAIAS
FT                   PNYRARLFGFGLATPIGAFSADSTWAKARFSHQTFKGQRLHGNYRIDFNNFGTNIMLSV
FT                   YRYSRDFYRLQDTLSINHEAKKYTGFYFPLPYLVPKGQYQLSINQNMGKWGDFYLSGQT
FT                   FTYWGTEGESREYQIAYSNRYKSLGYQISLSQTHDKISDRREKAVYLSFSLPLGDNHSL
FT                   SSSYSRQSDYSSTQLGVNGSLGDKRQWNYGLSVSQDGKRYRQVSANGGFQSGIGDYRAS
FT                   FSQDNQHSRQMGISANGSIVAHQYGVTLGTRVSDSFAIIHAKEGRGAGIESSNGNLDYF
FT                   GNGIVPYVSPYSVNYIGIDPKEAQENVDFEATETQIIPRANSIHLVDFSTHKNTMILFN
FT                   LSLPSHGIVPMTATAQDEKGQFVGYVGQGGMLFAERLTKSEGRLNVKWGQNSADQCEFD
FT                   YRVDLSENSKLQAKTYDALCTPVKNRE"
FT   CDS_pept        281616..282734
FT                   /transl_table=11
FT                   /gene="aef2D"
FT                   /locus_tag="HIBPF_02810"
FT                   /product="Fimbrial protein, adhesin subunit"
FT                   /db_xref="GOA:E7A8D5"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR015303"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D5"
FT                   /protein_id="CBY80517.1"
FT                   /translation="MNKYVIGIISLLLTSQVWGRDSTSWDGATRTVRVNATDFTLPPPN
FT                   EQNKLRAYGQDNIPFQFNRMLMRTQDRNKIPLNASWGTGQQCWTIEAKTDLPNWGTLNR
FT                   RTIYKLTDYIGIVIEAGDTYTNNQNVPSNSWSDVFLGGYCTAGEAGAAVEAWPVLLQSP
FT                   PAGMKLDVPRTKIASMRIVKPRYAPQRKTYFWNGFNGFSGKTDWDVWLPAFSLRVQAKT
FT                   CQLDTPNDLIVVMPTIANQHIPKRGDQRYGGKFQIRLTCPTARDDNGKKIAAYMTLTDQ
FT                   TNPSNRDDILTLTQQSTARGVGIKLYKNDDPSALSYGPASSLKGTDNQWKFSSIDGEER
FT                   PTVEFKAFYVNKDGNITGGTVNAVATYTFSYQ"
FT   CDS_pept        complement(282879..283148)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02820"
FT                   /product="hypothetical protein"
FT                   /db_xref="GOA:E7A8D6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D6"
FT                   /protein_id="CBY80518.1"
FT                   /translation="MQATLRQQGGAAVLTVPMAILQQMGWQIGHKINLEAQGERVVLTP
FT                   IKRQARGRKTVAELLSNIDSQEIAELNASVSNFTQSEPTGKEVC"
FT   CDS_pept        283286..284602
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="HIBPF_02830"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="GOA:E7A8D7"
FT                   /db_xref="InterPro:IPR001566"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D7"
FT                   /protein_id="CBY80519.1"
FT                   /translation="MVLLYTPKQKTKNAQTITADILDLDYQGLGVAKINGKTWFIENAL
FT                   PHEKVECRILEDKRQYGHAIVKKWRVKSPERLAPKCAYFMRCGGCQGQHIPIEMQRKAK
FT                   ESALFKRLSKLQSEPISFQPMICGDAWAYRRRVRLSLWFNPNTKQIEMGFRQKNANDLI
FT                   PVQSCEVVEPAINHLLPKLTALLEQFSAPKQLGHIELVAADNGVAMLLRYTKKLAEIDR
FT                   TLLLKFAEQEKLMLFLQSDEGIEQNYGDAPYYQFSDGIKLHFDIRDFIQVNRVLNERMV
FT                   NTALDWLELNQQDCVLDLFCGMGNFTLPLAKRVKSAVGIEGVFEMVQKAAQNAERNQIK
FT                   NIEFFQADLDQSFVEQPWANQSFNKILLDPPRSGAAFALNALCELKAEKILYVSCNPAT
FT                   LVRDAGILCDFGYKIEKSAVIDMFPHTGHLESITLFTTK"
FT   CDS_pept        284680..286911
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02840"
FT                   /product="GTP pyrophosphokinase"
FT                   /db_xref="GOA:E7A8D8"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D8"
FT                   /protein_id="CBY80520.1"
FT                   /translation="MVAVRGSHLLNPQDFVIEQWCTGLKLAEQTEKSLIDAWYYARDLM
FT                   NAYPDEMKNATLMLQSGVEMVEILHELNMDAETLLTAMLFPIVANKLTDWESLKEKFGA
FT                   KITKLLKGVLEMDNIRQLNASHSANALQVDNVRRMLLAMVDDFRCVIIKLAERITFLRD
FT                   AEHRCAEEDKVLAVKECSYIYAPLANRLGIGQLKWELEDYCFRYLHPEQYRAIAKLLQE
FT                   RRLDREHYIADFVSELSGYLRENIEQVEVYGRPKHIYSIWRKMQKKHLEFSGLYDVRAV
FT                   RIIVQKLQDCYTALGIVHTQFKHLPKEFDDYVANPKPNGYQSIHTVVLGKGDKPIEVQI
FT                   RTQQMHDDAELGVAAHWKYKEGNTGSMSAYEEKIAWLRKLLAWQDDITDSGEVLAELRS
FT                   QVFDDRVYVFTPKGEVVDLPTGSTPLDFAYAIHSEIGHRCIGAKVAGRIVPFTYQLQMG
FT                   DQIDIITQKNPNPSRDWLNPNLGFTHTAKSRAKIQAWFKKQDRDKNIPAGKELLDNELV
FT                   RLNLSIKQVEPYALPRYNLKNLDDLYASIGSGDIRLNNLINFLQSKLIKVTAEEADQEI
FT                   LRHVANKSAVNSQQKSEKNNGYVIVEGVGNLMHHIARCCQPIPSDAIVGYITMGRGISI
FT                   HRADCEQFLDLQAAHPERVVESIWGENYASGFHINIRIVAGDRNGLLRDITTVLANEKI
FT                   SVLGVSSRADTKKQLATIDMEIELHNVESLSKILARLTKLDDVIEAKRL"
FT   CDS_pept        286926..287282
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02850"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="GOA:E7A8D9"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033718"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8D9"
FT                   /protein_id="CBY80521.1"
FT                   /translation="MYKTTGLTHLINSTKYSLQGLKSAFKNETAFRHECFLACILIPLA
FT                   FFLGETKIEIILMISSVLLVMALELLNSAVEAVVDRIGTERHELSGRAKDQGSASVFIA
FT                   LCIVGIVWGGILFF"
FT   CDS_pept        287365..287958
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02860"
FT                   /product="molybdopterin biosynthesis mog protein"
FT                   /db_xref="GOA:E7A8E0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E0"
FT                   /protein_id="CBY80522.1"
FT                   /translation="MTALLKIGLVSVSDRASAGVYQDQGIPELQAWLEQALVDPFHLET
FT                   RLIPDEQPIIEQTLKELVDEQGCRLVLTTGGTGPAKRDVTPDATLAVADREMPGFGEQM
FT                   RQVSLHFVPTAILSRQVGVIRKESLILNLPGQPKAIKETLEGVKDKEGNVLVKGIFSAV
FT                   AYCLQLINGLYIDTKPEIIESFRPKSARRENLEK"
FT   CDS_pept        287960..288298
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02870"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="GOA:E7A8E1"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E1"
FT                   /protein_id="CBY80523.1"
FT                   /translation="MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKLEVVVPDELVDQCIEAIIETAQTGKIGDGKIFVYNVERAIRIRT
FT                   GEENEDAI"
FT   CDS_pept        288298..289344
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8E2"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E2"
FT                   /protein_id="CBY80524.1"
FT                   /translation="MQNNLNLHRTLLGIAAVIIILAGVKLAAEIVVPFLLSLFIAIICS
FT                   PIIKAMTQRRVPHWLAITLLFVLISLVFFFLVGLINSTAREFTQSIPQYKVLLSQRVSD
FT                   LTGLLQRFNLPFTLSRETIQENFDPSIIMNFVSRVLLNFSGVVSNVFVLVLVVIFMLAE
FT                   APTMKHKFAMVISSTPHDAAKEERHIDRVLQGVIGYLGIKSITSLLTGVGVFILLEACG
FT                   VQYAILWATLSFLLNYIPNIGSIIAAIPIIVQALLLNGFGIGFGVAIGVIAINMVVGNI
FT                   IEPKMMGQRLGLSTLVVFLSLLFWGWLLGTVGMLLSVPLTMALKIALESSPNTAKYACL
FT                   LGDVEDFK"
FT   CDS_pept        complement(289386..291578)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02890"
FT                   /product="primosomal protein N'"
FT                   /db_xref="GOA:E7A8E3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040498"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E3"
FT                   /protein_id="CBY80525.1"
FT                   /translation="MKIVRVALAVPLLRLFDYFVPDDVSLQIGMRVFVPFGTQKRVAIV
FT                   ADFPTKSDVPEDKFKAILQPLDLAPLFTPIYWDWLHWAANYYQAGLGDVLFQSLPVKLR
FT                   NGESAVKNDRTFWRITDAGKNALEQGLLKRSKKQAEALQYLSETDLEKGNNNFSSAIWS
FT                   ALKAKGFIEEITIQTNPLSWQQRLGNNPIVNAENRLTLNKQQALAFSQLLFHSGFNVWL
FT                   LDGVTGSGKTEIYLQYIEEILKSGKQVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNL
FT                   TDTQRLYVWDRARSGQSAIVIGTRSALFTQFSNLGAIILDEEHDSSYKQQDSWRYHARD
FT                   LAIVLAQKLNIAVLMGSATPSLESINNVQNGKYQHLVLSKRAGNSTALRHFVIDLKNQN
FT                   IQNGLSKPLLERMKAHLEKGNQVLLFLNRRGFAPVLLCHECGWIAQCPHCEKPYTYHQH
FT                   QNVLRCHHCGAQKTIPRQCGDCGSTHLVTTGLGTEQLEETLKTLFPHYSVARIDRDSTA
FT                   RKGKLEGYLEDIQQGKSQILIGTQMLAKGHHFPNVTLVALVNVDSALFSLDFRAEERLA
FT                   QLYIQVAGRAGRADKQGEVVLQTHYPDHPLLTTLLANGYQAFAKETLQLRHSMGLPPFT
FT                   FQALFKAQARHSDLAENCLSQIADFFQSKQITGLQMLGPMPAPFSKKAGQYRWQLLLQH
FT                   PSRMTLQKALREYQQAELEKNSLVRLILDVDPQDLS"
FT   CDS_pept        291662..292402
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02900"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="GOA:E7A8E4"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E4"
FT                   /protein_id="CBY80526.1"
FT                   /translation="MTQTFADQKRKTVETAEFTEDGRYKRKVRSFVLRTGRLSEFQRNM
FT                   MNNNWGTLGLDYQTEPFDFAKIYGNDNPVVLEIGFGMGKSLVDMAFANPDKNYLGIEVH
FT                   TPGVGACIAYAVEKGVTNLRVICHDATEILRDSIADGALGGLQLFFPDPWHKAKHHKRR
FT                   IVQPHFVTQVIQKLGENGFIHMATDWENYAEQMLEVLSANTDLVNTSKNGDYIPRPDFR
FT                   PLTKFEARGYKLGHGVWDLYFVKK"
FT   CDS_pept        292487..292831
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02910"
FT                   /product="predicted protein"
FT                   /product="putative uncharacterised protein"
FT   CDS_pept        293037..293567
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02920"
FT                   /product="ferredoxin-type protein NapF"
FT                   /db_xref="GOA:E7A8E5"
FT                   /db_xref="InterPro:IPR004496"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E5"
FT                   /protein_id="CBY80528.1"
FT                   /translation="MTVENLPRRQFLRGKFSTLSCLENNQKQNFVGIRPPWSVENSIFV
FT                   AQCTRCGDCLSVCETNILVKGDAGFPEVRFDNGECTFCGKCVDACKQPIFYPRDQLPWS
FT                   HKIDIGVACLTLHRIECRTCQDNCPANAIRFKLQMGGVAQPLVNFDACNGCGACVQGCP
FT                   VNAITMNDLKQNE"
FT   CDS_pept        293560..293841
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02930"
FT                   /product="NapD"
FT                   /db_xref="GOA:E7A8E6"
FT                   /db_xref="InterPro:IPR005623"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E6"
FT                   /protein_id="CBY80529.1"
FT                   /translation="MNNTNLILENTRDWHVVGLIVQGNPKKLSAIQTALLAIEHTEIPT
FT                   FDEKLGKFVVVMQSNDQHLLLEKMESVKDIDGVINVSLVYHEQDEQNK"
FT   CDS_pept        293878..296361
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02940"
FT                   /product="periplasmic nitrate reductase"
FT                   /db_xref="GOA:E7A8E7"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR010051"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="InterPro:IPR041957"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E7"
FT                   /protein_id="CBY80530.1"
FT                   /translation="MNLSRRDFMKANAAMAAATAAGLTIPVKNVVAAESEIKWDKAVCR
FT                   FCGTGCAVLVGTKDGRVVASQGDPDAEVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMTN
FT                   GKFDKNGDFAPVSWDFAFKTMAEKFKEAFKKNGQNAVGMFSSGQSTIWEGYAKNKLWKA
FT                   GFRSNNVDPNARHCMASAAVAFMRTFGMDEPMGCYNDIEHADAFVLWGSNMAEMHPILW
FT                   SRITDRRISNPDVRVTVLSTYEHRSFELADHGLIFTPQTDLAIMNYIINYLIQNSAINW
FT                   DFVNKHTKFKRGETNIGYGLRPEHPLEKDTNRATAGKMHDSSFEELKQLVSEYTVEKVS
FT                   KMSGLDKVQLETLAKLYADPTKKVVSYWTMGFNQHTRGVWVNQLIYNIHLLTGKISIPG
FT                   CGPFSLTGQPSACGTAREVGSFPHRLPADLVVTNPKHRETAERIWKLPKGTVSEKVGLH
FT                   TIAQDRAMNDGQMNVLWQMCNNNMQAGPNINQDRLPGWRKEGNFVIVSDPYPTVSALSA
FT                   DLILPTAMWVEKEGAYGNAERRTQFWRQQVKAPGEAKSDLWQLMEFAKYFTTDEMWTED
FT                   LLAQMPEYRGKTLYEVLFRNGQVDKFPLSELAEGQLNDESEYFGYYVHKGLFEEYAEFG
FT                   RGHGHDLAPFDMYHKARGLRWPVVEGKETLWRYREGYDPYVKEGEGVAFYGYPDKKAII
FT                   LAVPYEPPAESPDNEYDLWLSTGRVLEHWHTGTMTRRVPELHRAFPNNLVWMHPLDAQA
FT                   RGLRHGDKIKISSRRGEMISYLDTRGRNKPPRGLVFTTFFDAGQLANNLTLDATDPISK
FT                   ETDFKKCAVKVEKAA"
FT   CDS_pept        296415..297254
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02950"
FT                   /product="ferredoxin-type protein NapG"
FT                   /db_xref="InterPro:IPR004494"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E8"
FT                   /protein_id="CBY80531.1"
FT                   /translation="MKVRLKSKKKMKKPALNPERRKFLKEATRTAGGLAGVGILLGLQQ
FT                   NQSLAREGVPLRPPFALQDAKAFSAACIRCGQCVQACPYDMLHLASLLSPVEAGTPYFI
FT                   ARDKPCEMCPDIPCAKACPSGALDRQATDINESRMGLSVLLDHETCLNYQGLRCDVCYR
FT                   VCPLIDKAITLETQHNPRSDKHALFIPTVHSDACTGCGKCEQACVLEEAAIKILPMDLA
FT                   KGMLGKHYRLGWEEKAKAGHSLAPKDMISLPTRTPEGTTVIPEPAEPVLAPILGSGK"
FT   CDS_pept        297254..298117
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02960"
FT                   /product="ferredoxin-type protein NapH"
FT                   /db_xref="GOA:E7A8E9"
FT                   /db_xref="InterPro:IPR011886"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8E9"
FT                   /protein_id="CBY80532.1"
FT                   /translation="MANAPKFAGKESREKWGWWYANRFLFWRRLSQLSILAMFLSGPYF
FT                   GVWILKGNYSGSLLLDTIPLSDPLITAESLAARHLPDALTLIGAAIIVLFYAILGSKVF
FT                   CGWVCPLNVVTDCAAWLRRKLGIRQTAKISRGLRYGILVLILLGSSVSGMLLWEWVNPV
FT                   AALGRAFVFGFGATGWLLLVIFLFDLLIAEHGWCGHLCPIGAAYGVIGAKSLIRIKVID
FT                   RAKCDNCMDCYNVCPEAQVLRSPLHGKKDESLLVLSKDCISCGRCIDVCAEKVFKFSTR
FT                   FDHSGE"
FT   CDS_pept        298123..298566
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02970"
FT                   /product="diheme cytochrome C NapB"
FT                   /db_xref="GOA:E7A8F0"
FT                   /db_xref="InterPro:IPR005591"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F0"
FT                   /protein_id="CBY80533.1"
FT                   /translation="MTKQVSKILAGLFTALFAGSLMASDAPAVGKDLTQAAENIPPAFH
FT                   NAPRQGELPALNYVNQPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFM
FT                   DRDGKVGSSSSPRRYFCLQCHVSQANVDPIVPNDFKPMKGYGN"
FT   CDS_pept        298581..299183
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02980"
FT                   /product="cytochrome C-type protein NapC"
FT                   /db_xref="GOA:E7A8F1"
FT                   /db_xref="InterPro:IPR005126"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR011885"
FT                   /db_xref="InterPro:IPR024717"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR038266"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F1"
FT                   /protein_id="CBY80534.1"
FT                   /translation="MSEKKPNILKRFWQWFRKPSRMAIGTIIILSAIGGILSWVGFNYG
FT                   LEKTNTEQFCASCHMQDAYPEYLHSVHYQTRTGVGASCPDCHVPHEFGAKMKRKIIAAK
FT                   EVYAHYTGKVDTLEKFNAHRLEMAQNEWARMKANDSKECRNCHNVDRMNFNDQRSVAAR
FT                   MHQKMKTEGKTCIDCHKGIAHQLPDMSGVESGFKDEK"
FT   CDS_pept        complement(299343..299987)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_02990"
FT                   /product="adenylate kinase"
FT                   /db_xref="GOA:E7A8F2"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR007862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F2"
FT                   /protein_id="CBY80535.1"
FT                   /translation="MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTEL
FT                   GKQAKALMDEGKLVPDELTVALVKDRIAQADCANGFLLDGFPRTIPQADALKDSGVKID
FT                   FVLEFDVPDEVIVERMSGRRVHQASGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPET
FT                   VLDRLAVYHKQTSPLIDYYQAEAKAGNTQYFRLDGTQKVEEVSQELDKILG"
FT   CDS_pept        complement(300072..301310)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03000"
FT                   /product="putative integral membrane signal transducer
FT                   protein"
FT                   /db_xref="GOA:E7A8F3"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F3"
FT                   /protein_id="CBY80536.1"
FT                   /translation="MLICAFTGFNSGLPLFVLLQMLPVWLTDKHLSIELIGAVTGVMLP
FT                   YGLKFLWAPLLDRYFPSFLGRRRSWMLLSQVALLILLYIISLFDPLTQLGTVANIALLI
FT                   AFFSATQDIVLDAYRREILSDHELGLGNTIHINAYRIAGLIPGGLSLYLAAIYPWETVF
FT                   LWTALCMLAGIFMTLFLAKEPKINVQQSNQPFYQAFWIPLQEFFQRKGVIQAIGFLLFL
FT                   FLYKFGDSFATTLQTKFIYDMGFSKEDIAIVVKSTALWSSILSGLAGGMIMLKLGINRA
FT                   LWLFGLVQMVTIGGFIWLSAFGHFDVITSAELWKLGVVIAAEYIGVGLGTAAFVAFMAR
FT                   ESNPLYTATQLALFTSLSALPSKVLGILSGYVVGAVGYYQYFWFCLFLAIPGMLCLFWV
FT                   APWKQENNKTSSV"
FT   CDS_pept        complement(301491..302507)
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="HIBPF_03010"
FT                   /product="UDP-galactose-4-epimerase"
FT                   /db_xref="GOA:E7A8F4"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F4"
FT                   /protein_id="CBY80537.1"
FT                   /translation="MAILVTGGAGYIGSHTVVELLNAGKEVVVLDNLCNSSPKSLERVK
FT                   QITGKEAKFYEGDILDRALLQKIFAENEINSVIHFAGLKAVGESVQKPTEYYMNNVAGT
FT                   LVLIQEMKKAGVWNFVFSSSATVYGDPKIIPITEDCEVGGTTNPYGTSKYMVEQILRDT
FT                   VKAEPKFSMTILRYFNPVGAHESGLIGEDPNGIPNNLLPYISQVAIGKLAQLSVFGSDY
FT                   DTHDGTGVRDYIHVVDLAVGHLKALQRHENDAGLHIYNLGTGHGYSVLDMVKAFEKANN
FT                   ITIAYKLVERRSGDIATCYSDPSLAAKELGWVAERGLEKMMQDTWNWQKNNPKGYRD"
FT   CDS_pept        complement(302680..303648)
FT                   /transl_table=11
FT                   /gene="lic3A"
FT                   /locus_tag="HIBPF_03020"
FT                   /product="CMP-Neu5Ac--lipooligosaccharide alpha 2-3
FT                   sialyltransferase"
FT                   /db_xref="GOA:E7A8F5"
FT                   /db_xref="InterPro:IPR009251"
FT                   /db_xref="InterPro:IPR036715"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F5"
FT                   /protein_id="CBY80538.1"
FT                   /translation="MSINQSINQSINQSINQSINQSINQSINQSKSVIIAGNGTSLKSI
FT                   DYSLLPKDYDVFRCNQFYFEGHYFLGKKIKKVFFNCSVIFEQYYTFMQLIKNNEYEYAD
FT                   IILSSFVNLGDSELKKIKNVQKLLTQVDIGHYYLNKLPAFDAYLQYNELYENKRITSGV
FT                   YMCAVATAMGYKDLYLTGIDFYQEKGNPYAFHHQKENIIKLLPSFSKNKSQSDIHSMEY
FT                   DLNALYFLQKHYGVNIYCISPESPLCNYFPLSPLNNPITFILEEKKNYTQDILIPPKFV
FT                   YKKIGIYSKPRIYQNLIFRLFWDILRLPNDIKHALKSRKWD"
FT   repeat_region   complement(303561..303644)
FT                   /note="CAAT x21"
FT   CDS_pept        304047..304769
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03030"
FT                   /product="putative ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component"
FT                   /db_xref="GOA:E7A8F6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F6"
FT                   /protein_id="CBY80539.1"
FT                   /translation="MVHIQDLSLAFNGQTLFEHLNLTLLPNEWVSLLGSSGVGKSTLLR
FT                   LLAGIETQGMVQGKILFEPKIRIAWLPQKETLYPWLSIVDNVQLQAVLFGRKSAKTTEK
FT                   AKMLLEKVGMAAHWHKPCSQLSGGQKQRVALARTLMQEADLILLDEPFSALDAISRHQL
FT                   QDLAFELLEDKSVLLVTHDPQEALRLSQRIFVLRSPETHQTALSAVILPEGNAPRELHQ
FT                   ANLWALQQQLLQELEGEQ"
FT   CDS_pept        304766..305503
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03040"
FT                   /product="putative ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, permease component"
FT                   /db_xref="GOA:E7A8F7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F7"
FT                   /protein_id="CBY80540.1"
FT                   /translation="MKIRLLKPLLIVGVLLMIWQMVATLGSFPHYIFPSPQAVGQQLFT
FT                   HAELLWQHTQVTLLEICLGLLLGFLFGLISALLLSFSRQISAVLLPILVISQAIPVFAI
FT                   APLLVLWFGYGMASKIVMSVLIIYFPVTAACYDGLRNTPQAWLDLAKTFNISPLRLLLK
FT                   VRLPAALPAFASGLRIAVSVAPIGAVVGEWVGSSEGLGYLMIHANARMQVDLMFAALLI
FT                   LVSISLCLYFSIDWLLHRFIWSV"
FT   CDS_pept        305525..306469
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03050"
FT                   /product="putative ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems, periplasmic component"
FT                   /db_xref="GOA:E7A8F8"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F8"
FT                   /protein_id="CBY80541.1"
FT                   /translation="MKIIIRYFSFVMGLMLTLPSFAKEKISIMLDWYVNPDHAAIIVAQ
FT                   QKGFFEKNNLEVEIIEPADPALPPKLAAAEKVDLAVSYQPQLYQQVAEGLPLVRVGSLI
FT                   SNPLNSVVVLKKSNLKSLADLKGKKVGYSVSGFEDGLLDTMLHSIGLSNKDVELVNVNW
FT                   SLSPSLLTGQVDAVIGAFRNFELNQLALEKQEGIAFFPEQYGVPAYDELILVANKNNVT
FT                   DKKTSAFLTALEQATSYLQAHPNEAWQAFVSYKPNELNTPLNQLAWKDTLPFLADKPRK
FT                   LDAKRYQQMAEFMQQKGLIPKALALKEYAVEIK"
FT   CDS_pept        306480..307127
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03060"
FT                   /product="TENA/THI-4 protein"
FT                   /db_xref="GOA:E7A8F9"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8F9"
FT                   /protein_id="CBY80542.1"
FT                   /translation="MIEQLIQQAQPYWQQYIEHEFVQQLAKGTLPKACFQHYLKQDYLY
FT                   LFHYSRAFALGVFKSKNFAEMETPRKTLEILCQEIQLHLNYCREWGISEQEIFATQESA
FT                   ACIAYTRYLLDCGMTGSLAELYAAVTPCALGYAQVARYITQHYPRLPNNPYQTWIDTYA
FT                   SEEFQHAAQETVDFLTALCKPLNPSQLAEIQQIFTTATRMEIAFWQMGLGLA"
FT   CDS_pept        complement(307221..308036)
FT                   /transl_table=11
FT                   /gene="hfeD"
FT                   /locus_tag="HIBPF_03070"
FT                   /product="putative ABC-type chelated iron transport
FT                   system,permease component"
FT                   /db_xref="GOA:E7A8G0"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G0"
FT                   /protein_id="CBY80543.1"
FT                   /translation="MFDWLLEPLQFEFMQNALLTALIVSIICALLSCYLVLKGWSLMGD
FT                   AISHAVLLGIVLAYLAGIPLAIGAFFSGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFA
FT                   IGLVIFTKIQTEQHLTHILFGNVLGVSHQELIQSAVISAIIFCLIVFKRKDFLLYCFDP
FT                   NHARVAGLSPKILHYGLLMLLALTIVSTMQVVGVILVVAMLIAPGITALTLTKSFDKML
FT                   WIAIISSITSSLIGVILSYHFDASTGACIILLQAAFFVIALAYSKIRIR"
FT   CDS_pept        complement(308029..308877)
FT                   /transl_table=11
FT                   /gene="hfeC"
FT                   /locus_tag="HIBPF_03080"
FT                   /product="putative ABC-type chelated iron transport
FT                   system,permease component"
FT                   /db_xref="GOA:E7A8G1"
FT                   /db_xref="InterPro:IPR001626"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G1"
FT                   /protein_id="CBY80544.1"
FT                   /translation="MLDLLLEPFSYDYMLKAMILSTAVGGICAFLSSYLMLKGWSLIGD
FT                   ALSHSVVPGVAIAYAFALPYALGAFFAGIFAALSILWIKSISKLKEDAIIGFIFSTFFA
FT                   LGLLLISLNPTAVNVQSIILGNILGIADEDIYQVAIIIGVCLVLLLLFWKDLLLIFFDE
FT                   TQARTVGLSPLFYKVLFFTLLSACVVAALQTVGAILVIAMVITPGATAYLLTDKFKTLS
FT                   IIAIILGAVTSFVGVYISYYLDGATGGVIVTLQTLLFLAAFLFSPKYGLLTRNKKAVEN
FT                   V"
FT   CDS_pept        complement(308881..309801)
FT                   /transl_table=11
FT                   /gene="hfeB"
FT                   /locus_tag="HIBPF_03090"
FT                   /product="putative ABC-type chelated iron transport
FT                   system,ATPase component"
FT                   /db_xref="GOA:E7A8G2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G2"
FT                   /protein_id="CBY80545.1"
FT                   /translation="MDSFSTSIWVNDVTVRYNNGHTAIHNMTFSLNSGTICALVGVNGS
FT                   GKSTLFKSIMGLVKPQQGEIKLCDLPISQALKRNLVAYVPQSEEVDWQFPVSVYDVVMM
FT                   GRYGYMNFLRIPKAIDKQKVQEAMQRVNIEHLAHRQIGELSGGQKKRVFLARALAQQSP
FT                   IILLDEPFTGVDVKTENAIVDLLQQLREEGHLILVSTHNLGSVPDFCDQVVMINRTVIA
FT                   AGKTEDTFNQHNLEIVFGGVLRHIKLLGENLHNDEDKRSVTVLTDDEKAVVFYGETKQD
FT                   PPALTTQDCHFEDCPCKSAVENKKD"
FT   CDS_pept        complement(309801..310682)
FT                   /transl_table=11
FT                   /gene="hfeA"
FT                   /locus_tag="HIBPF_03100"
FT                   /product="putative periplasmic chelated iron binding
FT                   protein"
FT                   /db_xref="GOA:E7A8G3"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR006128"
FT                   /db_xref="InterPro:IPR006129"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G3"
FT                   /protein_id="CBY80546.1"
FT                   /translation="MRNSFKIMTALALGLFAMQANAKFKVVTTFTVIQDIAQNVAGDAA
FT                   TVESITKPGAEIHEYEPTPKDIVKAQSADLILWNGLNLERWFERFFQNVKDKPAVVVTE
FT                   GIQPLSIYEGPYKDAPNPHAWMSPSNALIYIENIKNALVKYDPQNVAVYEKNAADYAQK
FT                   IKQLDEPLRAKLAQIPEAQRWLVTSEGAFSYLAKDYNLKEGYLWPINAEQQGTPQQVRK
FT                   VIDLVRKNNIPVVFSESTISAKPAQQVAKESDAKYGGVLYVDSLSAKNGPVPTYLDLLN
FT                   VTVSTIVKGFGK"
FT   CDS_pept        complement(311043..311921)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03110"
FT                   /product="penicillin-binding protein 7 homolog precursor"
FT                   /db_xref="GOA:E7A8G4"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G4"
FT                   /protein_id="CBY80547.1"
FT                   /translation="MFKKALFILSLCPSFALAQSYVVYDFTHNRVLESHASDSIQPIAS
FT                   VTKLMTANVFLENNKNPNCRIAITKEDTDRIKGTGTKLPKNIPISCNELLKAMLVHSDN
FT                   YAAHALSRAAGISRRQFINKMNEKAHQLGMYSTRFHDSSGLSSYNISSPMDLVKLAKYS
FT                   LNKSDIKRLSNLNATYIQAGKHKLYIKNTNKLVRDEIFDAAVNKTGYIQESGYNLVFIN
FT                   KHLCKNATIGVISLNNTSSAYRSSFTKSKLEKFGCTALNGRTIRDVAGEAQYEDGYDEV
FT                   GFNTLIQQLSK"
FT   CDS_pept        312168..313319
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03120"
FT                   /product="predicted Fe-S-cluster redox enzyme"
FT                   /db_xref="GOA:E7A8G5"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G5"
FT                   /protein_id="CBY80548.1"
FT                   /translation="MSELLSVQSDAPAKKINLMDLTRQQMREFFKELGEKPFRADQLVK
FT                   WIYHFGEDNFDNMTNINKKLREKLKAVAEIKAPEVAVEQRSADGTIKWAMQVGEQQVET
FT                   VYIPEADRATLCVSSQVGCALACTFCSTAQQGFNRNLTVSEIIGQVWRASKIIGNFGVT
FT                   GVRPITNVVMMGMGEPLLNVANVVPAMEIMLDDFAYGLSKRRVTLSTSGVVPALDNLSK
FT                   MIDVALAISLHAPNDELRDEIVPINKKYNIKTLIDSVNRYLTVSNANHGKVTIEYVMLD
FT                   HVNDGVEHAHQLAEVLKNTPCKINLIPWNPFPEAPYAKSSNTRIDRFQKTLMEYGFTVI
FT                   IRKTRGDDIDAACGQLAGDVIDRTKRTAMKRQFGQNIGVTEVN"
FT   CDS_pept        313420..313959
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013360"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G6"
FT                   /protein_id="CBY80549.1"
FT                   /translation="MKTISKQLSAVIFPFIFSACVSQSASNLNHQAAAKARVELALSYL
FT                   QQNNPQLAKINLDKALQHDKNYYLVHSALAHYYQQQGQIENAFREYEIAVNLNHKQGDV
FT                   HNNFGTFLCSQKKFEQAQQQFELALNSPNYYHQADTFENIVLCAYSAQKMDIYQQTLEK
FT                   LRQIDGKRAEKFNSLK"
FT   CDS_pept        314031..314942
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03140"
FT                   /product="conserved hypothetical transcriptional regulator
FT                   with an N-terminal xre-type HTH domain"
FT                   /db_xref="GOA:E7A8G7"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G7"
FT                   /protein_id="CBY80550.1"
FT                   /translation="MNPTTEQVLSPGEIFRQTREALNLSLEDVAKEITLRPSILEQLEN
FT                   NEFIQKSTPSIFVKGYVRSYAKFLRLPDSVWENIVFAETEKNDLGKNARSTRAVNQYSS
FT                   HNRWIGRLTAIVFVIVIGMTGLWWWQSYQQNTQERDDLVQSYVASTENNQPSTALVTTE
FT                   ESNKTVPETAAPVSQPVEITNNLLPEIAQENSVSQPKNDEKSVSDIQSAVENPSISPTL
FT                   PIAKGDLVIEILTNSSWISVKDNARHVLAQKEYKQGEILTFNGNEFSLIVGAPSNVRIT
FT                   YKGENYPLKVDGRVAKFKLSQP"
FT   CDS_pept        314951..316057
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03150"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="GOA:E7A8G8"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G8"
FT                   /protein_id="CBY80551.1"
FT                   /translation="MSAFQPTIKRRESTKIYVGNVPIGGDAPIAVQSMTNTRTTDVEAT
FT                   VAQIKSLERVGADIVRVSVPTMDAAEAFKQIKQQVNIPLVADIHFDYRIALKVAEYGVD
FT                   CLRINPGNIGREDRVRAVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPEALLESAL
FT                   RHVEILDRLNFDQFKVSVKASDVFLAVESYRLLAKAIKQPLHLGITEAGGARAGAVKSA
FT                   VGLGMLLAEGIGDTLRVSLAADPIEEIKVGFDILKSLRIRSRGINFIACPTCSRQEFDV
FT                   IGTVNALEQRLEDIITPMDVSIIGCVVNGPGEALISDLGVTGGNKKSGYYLDGERQKER
FT                   FDNEDIVNQLEAKIRAKVARQDPKNRII"
FT   CDS_pept        316067..317338
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03160"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A8G9"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR015807"
FT                   /db_xref="InterPro:IPR033656"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8G9"
FT                   /protein_id="CBY80552.1"
FT                   /translation="MAKTIQAIRGMNDCAPTESPLWQWIEAQVRNVLNSYGYSEVRMPI
FT                   VESTPLFARAIGEVTDVVSKEMYTFWDNDEQLTLRPEGTAGCVRAAIEHGWIYNNEQRL
FT                   WYIGPMFRHERPQKGRYRQFHQVGVEVFGIANPEIDAELIMLTYRLWKALGIDQHVTLQ
FT                   LNSIGSLEARANYRSALVGFLENHQDLMSDEEKERLVRNPLRILDTKNPELQKVLDNAP
FT                   KLLDYLDDESRAHFEQLCSLLDAVGIQYEINPKLVRGLDYYNKTVFEWVTSALGAQGTV
FT                   CGGGRYDGLVEQLGGHATPSIGFAMGLERLVLLVQEVNPNIPAKSAVDIYVVYQGEGAT
FT                   LAAFELAEKVRSELPHLNTMLHCSSGNFKKQFKRADKSGATLALVIGESEVQNKQVVVK
FT                   HLQGGTDQQTLDLVNIIDYLQTQF"
FT   CDS_pept        317356..317970
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8H0"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR018704"
FT                   /db_xref="InterPro:IPR026039"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H0"
FT                   /protein_id="CBY80553.1"
FT                   /translation="MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQTH
FT                   QAEQIAQASAQYDTLINSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQD
FT                   FSAAEANLNQALTQSQDEVLTSIVALRLSAVQFQLGQLDNALTTLNQVKGESFNARKAI
FT                   LTGDIQVAKGDKVAAKNSFEQAQQSGSQLEQQMAKMKLNNL"
FT   CDS_pept        complement(318021..318215)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8H1"
FT                   /db_xref="InterPro:IPR007479"
FT                   /db_xref="InterPro:IPR036762"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H1"
FT                   /protein_id="CBY80554.1"
FT                   /translation="MKWTDAQLIAEELYDRNPDLDPKTVRFTDLHKWICELEDFDDDPN
FT                   KSNEAILEAILLKWLDEFE"
FT   CDS_pept        complement(318215..318556)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03190"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /db_xref="GOA:E7A8H2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR011536"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H2"
FT                   /protein_id="CBY80555.1"
FT                   /translation="MPKVIFLPNEDFCPEGMVVDAATGDNLLEVAHNAGVEIHHACDGS
FT                   CACTTCHVIVREGFDSLNETSDQEEDMLDKAWGLEMDSRLSCQCVVGNEDLVVEIPKYN
FT                   LNHANEAAH"
FT   CDS_pept        complement(318596..320455)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03200"
FT                   /product="chaperone protein HscA"
FT                   /db_xref="GOA:E7A8H3"
FT                   /db_xref="InterPro:IPR010236"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="InterPro:IPR042039"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H3"
FT                   /protein_id="CBY80556.1"
FT                   /translation="MALLQIAEPGQAAAPHQHRLAVGIDLGTTNSLVASVRSGQSVILN
FT                   DEQERSLVPSVVHYGVEEKKVGLEAFEQASLDPKNTVISVKRLIGRSLSDVQSRYSSLP
FT                   YEFVASENGLPLIITAQGPKSPIEVSSDILSRLNHIAEQRLGGELSGVVITVPAYFDDA
FT                   QRQSTKDAARLAGLNVLRLLNEPTAAALAYGLDSGQEGIIAVYDLGGGTFDISILRLSK
FT                   GIFEVLATGGDTALGGDDFDHLIADWIIEQTKLKPQTANQQRELITLANQAKITLTNEK
FT                   SAVISWQDFSVEISREQFNELIYPLVKRSLLTCRRALKDANVESEEVQAVVMVGGSTRV
FT                   PYVREQVGEFFSKTPLTSIDPDKVVALGAAIQADILVGNKTDSDMLLLDVVPLSLGIET
FT                   MGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMTVHVLQGERELVDDCRSLGRFTLRGI
FT                   PPMAAGAAHIRVTYQVDADGLLSVTAMEKSTKVQASIQIKPSYGLTDEEVTAMIKSSFD
FT                   NAQEDLQARELAEQRVEADRVIESVIVALQADGAELLSTDEFHHIETVLKQLMDVKQGS
FT                   DRDAIAQGIKALDTATQEFAARRMNASINKALTGKNLSDIENP"
FT   CDS_pept        complement(320474..321160)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021239"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H4"
FT                   /protein_id="CBY80557.1"
FT                   /translation="MQTLEQLTSPEHSAWITLSQWIDNARNHCEVIKKDQSSAERELFT
FT                   MQMPTSSPMGAVIYETGGILIHYGWLRILGSGSFKLPRGLMDWNFSKSFSESGEKPKYL
FT                   LVADDVIGGYFALNGGWLGNNIGKIYYYSSKDLTWHNLNFTYTEFLAWALNGDVEAFYQ
FT                   GLFWKNWQDDVKQLDGNQVFVFTPDLNQDRKIAIDERQKQEVNIETHYQASFAEKNKFD
FT                   LAYSVA"
FT   CDS_pept        complement(321211..321735)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03220"
FT                   /product="Co-chaperone protein HscB"
FT                   /db_xref="GOA:E7A8H5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR004640"
FT                   /db_xref="InterPro:IPR009073"
FT                   /db_xref="InterPro:IPR036386"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H5"
FT                   /protein_id="CBY80558.1"
FT                   /translation="MFNPFQIFDLPVDFQLDEKVLNARYLKLQKALHPDNFVSSSALEQ
FT                   RIAMQKSTEVNDALKTLKDPILRAEAIIALNTGEQLDLEQKSTQDVAFLMQQLQWREQL
FT                   EEVESQQDERALNVFAKEIKQETQSLLTALFESLKSQQWARASQYCDKLRFTHKLSEEI
FT                   ERVEERIFELD"
FT   CDS_pept        complement(321748..322071)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03230"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8H6"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR011302"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H6"
FT                   /protein_id="CBY80559.1"
FT                   /translation="MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFV
FT                   DVLNSEDQVFEQHGVNIIVDPKSFVYLNGIELDYVKEGLNEGFKYNNPNVKESCGCGES
FT                   FHV"
FT   CDS_pept        complement(322129..322509)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03240"
FT                   /product="NifU-like protein"
FT                   /db_xref="GOA:E7A8H7"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="InterPro:IPR011339"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H7"
FT                   /protein_id="CBY80560.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSLDKKDSNVGTGMVGAPACGDVMQLQI
FT                   KVDDNGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLEEAGAIKNSQIAEELELPPVKV
FT                   HCSILAEDAIKAAIADYKAKQG"
FT   CDS_pept        complement(322569..323783)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03250"
FT                   /product="cysteine desulfurase"
FT                   /db_xref="GOA:E7A8H8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010240"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H8"
FT                   /protein_id="CBY80561.1"
FT                   /translation="MKLPIYLDYAATCPVDERVAKKMMAFLTIDGTFGNPASRSHKFGW
FT                   QAEEAVDIARNQIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHIITCKTEH
FT                   KAVLDTCRQLEREGFEVTYLSPEADGLIDLEKFKAALRPDTILASIMHANNEIGVLQDI
FT                   KAIGELCRANKTIFHVDATQSVGKVEINLEELAVDLMSMSSHKLYGPKGVGALYVRRKP
FT                   RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKKEMASEMPRLKALRDRLYNGL
FT                   KDIEETYVNGSMEHRLDSNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLR
FT                   ALGLNDELAHSSIRFTLGRYTTEEEIDYTINLMKGAVEKLRALSPLWDMFKEGIDLNTI
FT                   EWSAH"
FT   CDS_pept        complement(323851..324303)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03260"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="GOA:E7A8H9"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR010242"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8H9"
FT                   /protein_id="CBY80562.1"
FT                   /translation="MKLTSKGRYAVTAVLDIALNADGGPVSLADISERQHISLSYLEQL
FT                   FAKLRKGGLVKSVRGSGGGYQLGLPSEQISVGMIIAAVNENIHVTKCLGRENCKNGVEC
FT                   LTHELWQDLSLRIESFLNEITLAELVNKRNVKRQSHRDFNNLLVNQ"
FT   CDS_pept        complement(324356..325081)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03270"
FT                   /product="hypothetical tRNA/rRNA methyltransferase"
FT                   /db_xref="GOA:E7A8I0"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I0"
FT                   /protein_id="CBY80563.1"
FT                   /translation="MLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQS
FT                   YALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKG
FT                   KIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNK
FT                   KNSLSLIEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNI
FT                   LNGMLSAVEKRIDLTKEDN"
FT   tRNA            complement(325192..325243)
FT                   /note="tRNA-Lys-4 fragment"
FT   CDS_pept        complement(325729..326187)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03280"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I1"
FT                   /protein_id="CBY80564.1"
FT                   /translation="MTEGKVYLALYKGKKTGWTPKAILARLSDWLTRKLTKGLYSHCEI
FT                   VVNKGFKVCYSSSIRDGGVRSKIMYLEHEKWDLIELQNITEERIKAYFEQTKNMRYDWW
FT                   GALGIVLGIKQKRSKYFCSEWCFNAICGGENGWRFSPNQLGAMFKHDD"
FT   CDS_pept        complement(326184..326786)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03290"
FT                   /product="phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I2"
FT                   /protein_id="CBY80565.1"
FT                   /translation="MKVYFLKENLNSYQIFPIPQNLNDFVEMEVENESELETKQLIDFK
FT                   SQYILVDRQPTELHKWNGNSWVVDKKKKTEIKRELIKNLVDSIDDTAASISAKWNRFAE
FT                   EYKERESAALAFKEANFTGEVSIYISSFATVAGLDNKSATLLILKQAEGLRTLQEQLAV
FT                   QRMRKYELKHEELSEEELQQIHNDIIRKMKALTEVQQ"
FT   CDS_pept        complement(326798..329167)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03300"
FT                   /product="probable phage tail fiber protein"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I3"
FT                   /protein_id="CBY80566.1"
FT                   /translation="MKLKLIDLFKRITWAKNGDLTDFSQTNYEAGWAHLGDDTPTVQDF
FT                   NYVQQMNDKKDQWLFNQLKAVLEKANIEPTEENVNSLRDAILALSKGYSHPKSLTADTV
FT                   NFVDEQGHTHEIAKATLQQQGITQLYTGYNSQREDLALTPKTAYQLKQLIDSNTRSLDN
FT                   VIPNSKKSSAVNSNSADTVANSAAVKTAYDKAVEAKTTAESKVGLRGNESIQGTKSFES
FT                   KIIGFRGIGVADSQTYANANHLLNMGANDGDGWIEYKKSNRVIGTIRIRANGELSYNNQ
FT                   KIYHAGAKPQFNTDIEGKPNTLAGYGIGNFKVEEFRGNLNTLKTDGIYAITQASRSQNL
FT                   PVSTSCHIQVIAGGDGAWCRQLAYVAYSTDVYERHQTSYQTDSWSAWKKLNTDGIPTGA
FT                   VVSFPRAVTNPVGFLKASGSTFNQQTFPDLYRVLGNSNKLPDLTRSDVGMTAYFAVDNI
FT                   PTGWIAFDSIRTTVTQQNYPELYRYLVGKYGSISNVPLAEDRFIRNASNNLSVGETQSD
FT                   EIKKHVHKVRTHWVNSSDSNIFYDKTKTVIDSRLRTATTTDDNLSDNGFMHPLLDSPMA
FT                   TGGAETRPRAIALKLCIKAKNTFDDVQFWVKAFGVVENAGALDAGTLAQNMQALSESVE
FT                   QKIEENKQSTLLEITNAKADINQQFLQAQENLSQIGTLKTVWQGNVGSGQITISEKCFG
FT                   KTLILYLQSSESHSLDDNNNIEIVSFEVGAEIEGKKGGRVRWLDVREVNAHSYSSGRRI
FT                   TDYVEVKRFDVTVDRDGTTIQIQDLAGRFVKRIDIR"
FT   CDS_pept        complement(329177..329791)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021283"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I4"
FT                   /protein_id="CBY80567.1"
FT                   /translation="MKDILTALNDDFKQLGRERLLSQFNYSPNLNAFLSLLLLPHHEIQ
FT                   ATLKQMLTERHIDTAIGKQLDGVGDIVGMPRPFARVNGDWYFGFSGQSKAKPFSRAPIR
FT                   DLATQTNSRDFNYMLDEHYRRLIKWKVIANHSHGTLDDVIEACRAIFLAERVSITEGQD
FT                   ADVHITITRMAKNRLDAVEQEPVLWIPTAAGVKVTVEFINA"
FT   CDS_pept        complement(329800..331236)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I5"
FT                   /protein_id="CBY80568.1"
FT                   /translation="MANYGLTRSGFVRKRMPEQLKELYENAKKMFGEDIDLSPETVMGM
FT                   MLNIESERFATLWELIESVYSAMYPMSATGANLDRAVSFTGVTRLQAEHSTVPVIFYGN
FT                   AGVEIPQYTAVRNAATQTLYYSDEDARIDSNQAAYARIELNSNTINVGDVFSVVVNGVT
FT                   YRFTAMRSSSASIIQGLANQLKAISYADVSNDNVIIEISAQSIPHFSISVSQNLTLSRL
FT                   GVRCMLSTESPSEDKADIGQMIELVNMIDGVVEVNNVVEGASGRLEESDIELYQRYHRG
FT                   VWQNGAGTIDSLYANLSKVAGVHSLRIYENDADQTINGIPKRSLYAVVKGGLDTDIAST
FT                   LLKFKPLGIGTHGQTEVTVRDSQNQPHLIKFSRPTKCYIWLKVTIETFVDEDEIARAGY
FT                   IVSALNNILKYGKSLGVGADVIHQRLIAACIAVQGVGKVTVQIGKTNNITDPEPRYQEQ
FT                   NITIAPDEEAIFDPSIIVMS"
FT   CDS_pept        complement(331229..331594)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I6"
FT                   /protein_id="CBY80569.1"
FT                   /translation="MIDLKLSGQHDLMIKDRKLVLVDGVNQKAQQIKVVLLTFLGEWFL
FT                   DTTIGLPYFDEILTKNPDNARIQSIFRKKIMGVKGVLAVERLSLEFHLKDRVLAVQFSA
FT                   RTNEGVVKDKVSIKRNG"
FT   CDS_pept        complement(331591..332262)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="InterPro:IPR041599"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I7"
FT                   /protein_id="CBY80570.1"
FT                   /translation="MTDILTALSEINVSLPGKIVSYDAGTVRATVQPSIPKRLANGEVL
FT                   NAPQIVNVPVMFPMADINGAVAQVTLPVKVGDGCLLIFSQRSLENWLSGSNDAPDDPRM
FT                   FDLSDAFCVMGGNSHSPNADVENLCIKYGSGKIKIAPNGNITINSPDVRVTTDNFTVTA
FT                   PTSTFNGNVIVNGGISTAGDSGSVSVSGSLTTTGDVMADGVSLQSHKHKGDSGGTTGAP
FT                   L"
FT   CDS_pept        complement(332259..333221)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I8"
FT                   /protein_id="CBY80571.1"
FT                   /translation="MSYRFLRSYKLMIGKKGQKDAIVIEPPMRIEFDIEKDCEAEPNEN
FT                   TIKIYNVASTTRKTIEQPDMRCVLYAGYEQEGNVLLCSGDIATAYSYHQGADWVTELYV
FT                   LDGLVEIRDTAVSLGYGGGVSSTQITNDIAAKMGVTVVGADNLKSRTWANGFSFYGAAR
FT                   KALDKVVAGTGLEWSIQNSELQIVNRNGVTKRSGYVLAKDSGLIGFPERTREAARSKKQ
FT                   DTPNKKQDEKFAFDRQARDGWNVKSLLLPMVNPCDKIKLESVTVTNWFRVEKIKHSGDS
FT                   HSGDWQSELHLVDLNAPTKEQMKAQSKHRKKRKKKDEQK"
FT   CDS_pept        complement(333218..333532)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03430"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8I9"
FT                   /protein_id="CBY80572.1"
FT                   /translation="MITINLANKNDFITEVNLDDEVFFLHFSWNDTIGFWSLTIENTYN
FT                   DELVSSIVILPNRPLIAPVRRDELPLGELIAVRDDNLQTIGRDDFINGKAVLIYIGVDE
FT                   "
FT   CDS_pept        complement(333529..334110)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03460"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J0"
FT                   /protein_id="CBY80573.1"
FT                   /translation="MSIVNLLFSALSGKRTTIGVLELDALLTENTSLSSQITEYPIEDG
FT                   TVISDHITRESERLSLSGVITGAGTLFNVGLGKYKLIAAKETLRELHAKRELVTIVTGL
FT                   DVYEDFAIESLEIERNSDDGERLNISAEFRKIQKVTLRKEEIPPEKAAPNAKGKAGQTK
FT                   AKTGKAQTGKPTNTQAQKITKLGEWSGKKQ"
FT   CDS_pept        334272..334994
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J1"
FT                   /protein_id="CBY80574.1"
FT                   /translation="MTDGARNTIPKGNNSARLFTGFEPLVAQLWVNYQSSQKGINSMNT
FT                   QIQFSTFNFKDLPVRVISDPKGEFWFCGTDVCAILGYTNSRKALQDHCKQGGVTKRYTP
FT                   TKSADQEMTFINEPNLYRLIIKSRKPEAEPFEAWVFEEVLPQIRKTGKYQLQPQQLALP
FT                   MVNDDFKQAMAKMVTYASQYANFQQAITSAQLEKQKRLVEFFFSSIPNGDSYLFVFNKN
FT                   IQQDIQQASDLLHKLITQ"
FT   CDS_pept        complement(335069..337486)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03500"
FT                   /product="predicted phage-related minor tail protein"
FT                   /db_xref="GOA:E7A8J2"
FT                   /db_xref="InterPro:IPR013491"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J2"
FT                   /protein_id="CBY80575.1"
FT                   /translation="MNAIRELVTLLRYKVDNSGLKAYVVQTQQAAKGIRSNLNNAVDGL
FT                   RAKFSEAAVSAKGVGNNLNDAKNQMLSLRNLVAGYFAMIAGGNVIKIADDWAAVDSRVK
FT                   LATKSAEEHKYALSQIFDLSQRSGQDYLASADLFSKVNRSAGDLGLSLDDTLNLTEIIG
FT                   QTMTIGGGDQGAQQAALMQLGQALGSGALRGDELNSIIEQAPRLANAIADSFGVPIGQL
FT                   KDLGKEGKLTSKELAQGLLKQADKIQKEFDQMPKTFGRGMTILKNKAGQLIDVAVNKVS
FT                   KLGAAFYNAAEWVTENIRLVGFLAGTVIGGKLMFALAAAKKSLRQLLMMGARAVAPYLA
FT                   MAAAAGVVALVLEDIYGWTQGDLSFTGALVGRYEVWADKFAALGKLADKLWINVRGLLK
FT                   DLSRMAGVEINFDSWQAFATDVLEYIIAAVRNLINTVSGMVRIIRALINGDYAGAWSSA
FT                   GDMIDGLSLKFLPLYSVGLMVLGGILSAVWALFSPFRAFFGLLKGGFRSVMFVAKPFIK
FT                   VAKGIASPFIWAQKHFKLFSRVGSGAFSLLKRAAVKFTVYGLKAFKWLAIKGINGFFGI
FT                   LRAAVKFGMIFKSVVGTVVKGIFAIGRAMFMAVASNPILLAISAVIGLVILLVVYWDEV
FT                   KAFAIAAWEAISKKAAEIWQSIITGASEMWDNITNKAAESWDNVKKDAVEKWNSVTTMF
FT                   KNAWQKSIDTVVGWFNSLIPSWIRDLFSDGAKAEVKLSGEALTTPVSGHVSPQRLGYGG
FT                   RPIFAPNQNMTQTNNFNIQGSANPSGVANAVSDKLSRGSSTSFGMGAIEYAG"
FT   CDS_pept        complement(337671..338153)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J3"
FT                   /protein_id="CBY80576.1"
FT                   /translation="MARSEIQIGESTFFVQKFSVMDQLRIFGDLQKTLIPSLAKVIGFS
FT                   DEKPKDATSAQLAELAQKSAANFAQGLQDLSQQLSGAELVKLADMLIKPELVTVQRDDF
FT                   NNGTDKKLSKTDFDLVFDDMSELIELVIFILQLNFSSFFTKFLARLGSVQELVKKS"
FT   CDS_pept        complement(338153..338578)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03580"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR021695"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J4"
FT                   /protein_id="CBY80577.1"
FT                   /translation="MALATYAPDEVSIVIGAVIVSGFADGTFIDIEEMSDGVSSVAGAD
FT                   GEVARATSADPRKKVTLTLLQTSDTNDVLSELYAADKVSKNATFPIAVKDLRGRSLFAA
FT                   STAWVVKSAKLELGKEVGSREWTLETADGKLFVGGND"
FT   CDS_pept        complement(338624..339697)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021808"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J5"
FT                   /protein_id="CBY80578.1"
FT                   /translation="MAKIDRLVNVAIDLNTTTIAGKSFSDLLILGEHTLNNSARLLVVT
FT                   DPNELLDLGLKSNNPLYIAVATAFAQPSHVAQVFIGRKAQDESVTDALAAVARENNSWY
FT                   GLALVSREDSDVMLAAAWAETNGKLFVTASADEKLPQSAEKTDIASKLEAKQYYRSAVM
FT                   YSHKATEEYPEIALMSYSFTFYPGSETWNLKKLAGVSYSPLMEGEYLACAKKNATTFEK
FT                   FNDSFAVTQGGKVAAGEWIDIIRFRDWLVQEVQINVTSVLINAYGKVPYTDKGIQLIGA
FT                   AVRQALDLGVARGGIAPTELDDNNKEIPSYVISLPLAAKVSNNNKGKRLLQDVKFSARL
FT                   AGAIHLTEIKGNLAYSL"
FT   CDS_pept        complement(339684..340193)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J6"
FT                   /protein_id="CBY80579.1"
FT                   /translation="MLERLYDLLGDLSDRPFIRAYENGREPEKPFFTYELKFERTPEHF
FT                   HYSAVNDEGNQTVKTHIDAVLELNYFGGNSLQALRDVCMRLSMQSCRERWLNDGVALIR
FT                   IGRITHLAFLNEQREYEDRAMVEIEIRYAASVQDIVGIIEQVEVTANIGRASEKNLIGV
FT                   NKNGEN"
FT   CDS_pept        complement(340195..340554)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J7"
FT                   /protein_id="CBY80580.1"
FT                   /translation="MQVFSSQSSFRKPYKILVRSDGEYVKGKWVKGGEIEQMLMASIQP
FT                   LNGAEMDRLVVSMQGRRVSSAVKIYTDQKLTVAGENAHNGTVVLFDGERYEVISRASYH
FT                   SGVLSHHRYVAIRVK"
FT   CDS_pept        complement(340554..341012)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J8"
FT                   /protein_id="CBY80581.1"
FT                   /translation="MSSVVKVKINNKGLEKELELINKIGKARVKVGVQADAGVHSESGE
FT                   SLVDIGIWNEYGTAHIPSRPFIRQTFEDNQQAVAQYLGRVVENVAKGADLVQELSKLGQ
FT                   WYQDKQKKTLKSYPWTPNAPSTRKRKKSSKPLVDTSQLVNSIRYKVEI"
FT   CDS_pept        complement(341005..341355)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR025127"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8J9"
FT                   /protein_id="CBY80582.1"
FT                   /translation="MSAYSLLNLFYPLSQQMPEDIVNKALSVADNKRPDCLSDEKQDEA
FT                   VAWYAAYLLAQSIESGVNAAGLRREREGDLEREYFSSSDKGGNAERFLAKYNELNNICV
FT                   RLGAITVGSHCV"
FT   CDS_pept        complement(341359..341547)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K0"
FT                   /protein_id="CBY80583.1"
FT                   /translation="MIVRNIEARLIRVGGEFIAPNQEVEIADDAVGLDRLIERGVLIDV
FT                   TPKAEEPKKDGKSKKQE"
FT   CDS_pept        complement(341550..342551)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR020049"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K1"
FT                   /protein_id="CBY80584.1"
FT                   /translation="MFNDALSENLGLFYWRKIMTDIRQDAFELNAINTCLNAVGVFNQD
FT                   AGLFTQRQLEFVRNKIYEEKLPGMNGLSLVPVSSEAPEWAETVTERIYDMVGMAKVIAN
FT                   YADDLPRADVAMTERAVKVKNIGAAYGYNLQELKAAAANQTDLPSSKARAARRAVEVKM
FT                   NEIALLGDKEFGLNGFINHPNLGETSVTGSWKTATADAVLADLDNLHDTVVLQSKGVHQ
FT                   PTHLLLSLTDYQTLSSKYMNTADKVDVLTFFKRKHPNLTIQGLWELEKAGTGNKNLAIC
FT                   YEKSLDNLTLETPQDFTQLPAQERNLELVVNCVARVGGVFLRYPLSATKAEI"
FT   CDS_pept        complement(342559..342978)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011231"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K2"
FT                   /protein_id="CBY80585.1"
FT                   /translation="MSMYDQLQQKAFAGMKGDSRYDLVETFAAENEIPFGVVITQGTSA
FT                   TQAKLGGTKPIGIALHSHAVVGGYAKFDAVSVLRKGVAWCVVKDGETITAGSAVSFDPA
FT                   SGKVAKTGTALPNATFKTAVVDCGKYGKLALVELA"
FT   CDS_pept        complement(342991..344064)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8K3"
FT                   /db_xref="InterPro:IPR006141"
FT                   /db_xref="InterPro:IPR016913"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K3"
FT                   /protein_id="CBY80586.1"
FT                   /translation="MVMRYDRRGIQARRDDNGFIYDTPILTRSGVFVYELPNGKTRREY
FT                   RPPDEVFKADSLRAYKGLPITEDHHGLVTKNNAHLVVGSILTEGKQDGQNLTADIVIHN
FT                   TKAVDFGKKELSVGYKVDIDETSGTTEDGEPYDVIQRNIRPNHLAIVTVGRAGNAALNL
FT                   DAADAVEFNEDGENPMSNTQTTLSDIRLDSGITYQAAPEVIVELNKLKQDAKDAVTAKD
FT                   KEAARADAAEAKVKELETQVEQIKQDAVSQAKVRVELENVAKVHKVEVKADSTDRALRE
FT                   AVIKAIRQDNADLSQKSDGYIEAAFDIAVSDAKQRADAAGVQRQQLTPSATNQPTFTQD
FT                   SQTKLTGRAAMIASRNQ"
FT   CDS_pept        complement(344190..345458)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="InterPro:IPR041301"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K4"
FT                   /protein_id="CBY80587.1"
FT                   /translation="MTMMLKSIKKNRKPKAWLFPHAIEREYVGYLRGVARNINTMVNQK
FT                   FVEIRPHFKANIRQDSFSDTLERWLIELLQAVLIFVDEKEITQFVRGYIHQTANFNGKQ
FT                   FHKVLKSVYSVDVFTTEPWLDDALKIAEWENIRLIKSLPTQTLEKLRSRFTQAVRGGWR
FT                   WESVVDDVKSILNTNEKRATLIARDQIGKLNSHLTKLRQQNIGVKSYIWRGMLDERERA
FT                   HHVDREGKQFDWDNPPDDGHPGEPILCRCYAEAVFPEFEDLGRDDAEPIDPISTIKTGK
FT                   MNLDELFDNSLSGGGNKSFSNFGSVGPALVTLAKESIGLDISGWQHSIDESSIRHILKQ
FT                   HGNEKAENKRGQRAVTKADILMLPQIVSSFDSIDYTGTSDAGSETFLLRKEIGDEIFCV
FT                   QEVRKRHKKIAVKTMWIRKKKKP"
FT   CDS_pept        complement(345388..346704)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR024459"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K5"
FT                   /protein_id="CBY80588.1"
FT                   /translation="MEFNQDGYAEALGINHFARNSANSTALFDLTLYELGGLAARVVDM
FT                   PADAAISRSIEIQGDQDDAISNEIERLKILPALADMVRWSRFFGGAVMVLLTDDGARLS
FT                   EPLEPSRITRIDEVRVFDLSQISPTANRYSDPTKPNYGRYSSYRLNIGTIAGSLDSQVE
FT                   IHESRLLFMGGDSLPERLKNGLHWIGRSAVRSVYPKIRDYQKSLMWASLILERKQQAVH
FT                   KMKGLALAIDNGLEPVIRERINLVERGRSLLNGVAVDSEDDYNILNADLGGIVDVLDEF
FT                   KVAISADVNIPVAILFGQSAKGMNATGQSDFESYYDLVESIQQHKIKPVLEKLIELLMF
FT                   QKHIKPFENWKIKFPSLNTPTDKEIADVRKTNADAAKIELDRLINLVDSGALSTDELRT
FT                   QIAGEFGIQADKLPQVDDDDVEKYQEEQKAKGVVVSSRN"
FT   CDS_pept        complement(346706..348055)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03890"
FT                   /product="predicted phage terminase large subunit"
FT                   /db_xref="GOA:E7A8K6"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="InterPro:IPR035413"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K6"
FT                   /protein_id="CBY80589.1"
FT                   /translation="MRQTLIKPLKPMIKPCRYKILYGGRGSGKSWGVAQLLVEIAVRTK
FT                   VRVFCGRELQNSMSDSVIKLIADTIEDLGYLEDFEVQRNAIYCLKTGSEFMFYGIKNNP
FT                   NKIKSLEGIDLVWIEEAENVSNESWDILIPTIRKERSEIWVTFNPKNILDPTYQRFVIA
FT                   PPKNSFVRKINYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWI
FT                   ECAVDAHKKLGFLPAGRKIVGFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADR
FT                   TRLNALEFGANEIVYDSIGVGAGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKT
FT                   NRDMFANIKAQAWWCLRDRFYKTYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPY
FT                   VDYDGNGRVKVESKKDMKKRGIPSPNKADALIMCFAPKEDVLSRFIGLGS"
FT   CDS_pept        complement(348036..348404)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8K7"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR024978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K7"
FT                   /protein_id="CBY80590.1"
FT                   /translation="MSKKKTKPKIEIDLSMVESLAAQGLTNQQIADSLGISERTLQNRK
FT                   KDNAEFAEAIKKGKAKGIAVVTNALMKKIKSGNVTAMIFFLKTQGGWKENNQLEIEMKK
FT                   EKKLPTLAELFGDETDPD"
FT   CDS_pept        348462..348683
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K8"
FT                   /protein_id="CBY80591.1"
FT                   /translation="MMKKIDVLKDLMAKNEWKKAISLASKFPRLGNAKDAIKSAQMAYT
FT                   NPNFVRQIKKDPDKLIYQGIQALIAKYG"
FT   CDS_pept        complement(348680..350035)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8K9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8K9"
FT                   /protein_id="CBY80592.1"
FT                   /translation="MNKDLNIEYISTDVLKPYVNNSRTHSDEQIDQICESIEEFGFTNP
FT                   ILIDENNGIIAGHGRLLAAIKLNLYTVPTIRLTGLSDIQKKAYVIADNSLALNAGWNFE
FT                   LLSLELNELKDLGFDIDLLGFDDDFLKSLDGDLLADISGDSNSKEKLDLKQAFLAPPFS
FT                   ILNSREGWWQDRKRKWKALGIDSGSGRDSGMQRGMNSMARYNSKEDTSMSESDDSIFDP
FT                   VLCEILYSWFSPKGCQILDPFAGGSVRGIVASKLNRNYIGVDLRAEQIEANLKQRNLVC
FT                   SNDELQPIWICGDSINIDKLANGVSADLVFSCPPYADLEVYSNNPNDLSNMDYDNFKKA
FT                   YFEIIKKSCDMLKDNRFACFVVGEVRDKKGNYYNFVGDTIQAFLEAGLSYYNEMILVNV
FT                   CGTMPMRAATPFKGSRKIGKVHQNVLVFVKGNPKIAAEYCGDVDVYIPNEDN"
FT   CDS_pept        complement(350047..350277)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_03980"
FT                   /product="hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L0"
FT                   /protein_id="CBY80593.1"
FT                   /translation="MLLPSCASKPDVEYRTVTLMPPAALLAPCPIPAFYGSTFGETVEY
FT                   ALLLKQELRLCANKVDGVREYVKARESAVEN"
FT   CDS_pept        complement(350252..350521)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L1"
FT                   /protein_id="CBY80594.1"
FT                   /translation="MQHTNKLNIERQSAVIDSLHEKVIKRDKIIDELHEDVDEQRKIAE
FT                   KRLAQEQLIREQSYAQIQSIKKILESNQCSRATLPSGVAAELRK"
FT   CDS_pept        complement(350638..351042)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04020"
FT                   /product="putative uncharacterized protein"
FT                   /db_xref="GOA:E7A8L2"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR039561"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L2"
FT                   /protein_id="CBY80595.1"
FT                   /translation="MSKFKLSAASEEKLVGVHADLVKVVHRAIELSVVDFKVIEGKRTL
FT                   ERQKELFAKKATKTMNSRHLTGHAVDLVPLPVNWNDREPFKTVASAMFQAAKQLGVAIR
FT                   WGGDWNMNERSDDERFYDGPHFELLRSVYP"
FT   CDS_pept        complement(351029..351355)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8L3"
FT                   /db_xref="InterPro:IPR032126"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L3"
FT                   /protein_id="CBY80596.1"
FT                   /translation="MPTKDPTNWESFLRWLPLVFIGLFAGVAKYASDIQAGKLHFSVGL
FT                   FLCQVLVSMFAGWIGGLICLSSGLDSDLVYVGSGLSGYGGGAVLNAIWRGFFASKLGIK
FT                   DEQV"
FT   CDS_pept        complement(351778..352746)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A8L4"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L4"
FT                   /protein_id="CBY80597.1"
FT                   /translation="MTTLGERLKFLLIERNVTQAELAEMVGTTQGAISNIVKGETQKPR
FT                   NILEIANALGVDPNWLKYGSTKMTTLSERLKALLVEKGINQTEFANMIGIAQPSMQKIL
FT                   AGETRNPRKIVEIAKELGTTPDYLLYGDMTVSHSTLENSQINNNQGQTVNNFFDSGSDE
FT                   LREMLQKQQVSLKTKPTEEWVFALDVNRLAETDIINAHFPRPFEALHLSQDGMMDLLKL
FT                   RSTANVAMITMFNESMSPVINKKDLMFVDTTCKQYAGEGIYLFVMNNELYVRRLYQTPS
FT                   GVLNVVAENERVGSSFEIDDLSRLNVLGRCVRKFSIIAEDL"
FT   CDS_pept        353130..353582
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L5"
FT                   /protein_id="CBY80598.1"
FT                   /translation="MNSKDIQRTLHRDCKNASGGITTLALTLGKSPNILGNKLNVECEN
FT                   NHLSFIEALDLIEITNSTRTVAAIADKIDHLIVPMPKCASCCADVVQGFLDITTNAGKI
FT                   GEQIKSAVHPNSDLGRELSNKEKQTISASIDALIESALCLKWELEQ"
FT   CDS_pept        353628..353861
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04111"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L6"
FT                   /protein_id="CBY80599.1"
FT                   /translation="MENTNPNEKISQSQCDRILRYLQSGKRLTSLEALDKFGCLRLSAR
FT                   ILDLKNRGHQISDEFVHDARTGKVYKAYFMAV"
FT   CDS_pept        353863..354645
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E7A8L7"
FT                   /protein_id="CBY80600.1"
FT                   /translation="MSVELMTKAFKSKTGNPLTKLVLVKLADNANDDGVCYPSYKRIAI
FT                   QCEVSRPTAISHVKKLEAMKYLSIRERKTENGNATNVYILHPENWEEVEPFTSKPALPP
FT                   LVNELNQPSKPALPPLVNELNPEPSIEPSDNHHIKKTTQKSEAEMLLEQFGITGQLAKD
FT                   FIAHRKAKKGVINQTQLNRLQKQADKAGISICEAVEICIERNWQGFNASWDWRDEKLRP
FT                   NSPHLGQSHPNKPKFDDTQTGWSAGMNFTVDGTQWQIP"
FT   CDS_pept        354630..355271
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3I1"
FT                   /db_xref="InterPro:IPR009731"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I1"
FT                   /protein_id="CBY80601.1"
FT                   /translation="MANSITENQINTLPPERAQRAEETINWLFQELKSIFLGWRAAFET
FT                   EADYLSAKKTWLRVLVREKITRPQLENGLYKAENSLDKFLPSVGLFVFWCKAYDYHALG
FT                   LPNEAELYQRYNTFLGYARFNRDEFQYRSKVEFWLLKNLYEKCKKKSEEDTLKTIPKLL
FT                   TEAAEKVRSNFPFEDIPKMIPTKPRFYDKAKADKARDSLMAMMKGKGALQ"
FT   CDS_pept        355529..355945
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04161"
FT                   /product="putative recombination protein NinB"
FT                   /db_xref="InterPro:IPR008711"
FT                   /db_xref="InterPro:IPR036619"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I2"
FT                   /protein_id="CBY80602.1"
FT                   /translation="MSQYKPFFLRDQRIKNNCLDLIKELPIDDKKPLVVKIQPITRSLE
FT                   QNSKLHALLSDISKQCEFNGKKRDIDTWKMIMVSAHKIATGGQAEMVIGLEGEVINLRE
FT                   STAQMSVKRLASLIEYITCWCVQNGVRFNDRWGL"
FT   CDS_pept        356038..356625
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04162"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR008713"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I3"
FT                   /protein_id="CBY80603.1"
FT                   /translation="MAKEYKCKMCGNYFIKTVSSLQKVCSPECAIKLSREQTRKAREKK
FT                   DKQARIENRKKMTALKEKNKTKHELTKEAQAAVNKYIRLRDMGKECISCGTPLVAEQLG
FT                   GGFDAGHYRSRGAAPHLRFYTINIHGQCKKCNRYYGGNVQQYRLGLLDRLGSEKVEQIE
FT                   ADNRPRHYFPDDLRRIKQIFNKKCRLIEKRKG"
FT   CDS_pept        357031..357549
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04163"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I4"
FT                   /protein_id="CBY80604.1"
FT                   /translation="MFRLAKPLENRMITYAQLCEQNDRYQAMRHDNAQMLRTAINCFTI
FT                   ALEEDLGLTDKSYKKEFNQDQQVPYVDVLNIDDHKSCPWYQLKTEFEQNAPVIEFELAL
FT                   TLEKAPNVYPKTTLISPMRAIYINENSIQLEFTAHRDKPQFIISIKEKDAYSHAINAYK
FT                   QLILEMFKF"
FT   CDS_pept        357660..358559
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04164"
FT                   /product="Unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I5"
FT                   /protein_id="CBY80605.1"
FT                   /translation="MFIMGFMSSAIDAVQRGIAKAEGKSGELDPSLLKLFSELSLDIND
FT                   YPKDINARIEKFCGFFERITMSKKDIELLGEMKNSAYSFAGEWKYSFFKQMSIPTKLKF
FT                   SILIDFVRACLDSTGKIEDLNALGKKLRLERELIDYAQVIHFNAYIQREFNNGNPEGYI
FT                   DTDALILQKDEFTVLELPASIIEEKSKTIRQGSRNGVSVRLAKGLWFHSGKGNSTSEKI
FT                   NYLSHKADGNLIFTNQRIVFSGENASFSIKKQNIVSVENRDGLLYFHSRKSKPDIVESH
FT                   IPILDKTLKSVIRWIINQ"
FT   CDS_pept        359286..359597
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04180"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I6"
FT                   /protein_id="CBY80606.1"
FT                   /translation="MATIIVKRDAGSRKFTEKGEILQRGKAGRLERMFDKQRRINAAFE
FT                   KMVEKESTVDRAIKFAANRQKEQLIDIANYHYYKGKPAGTNTVHAMQKRRLGVRELIR"
FT   CDS_pept        359718..359969
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04180"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I7"
FT                   /protein_id="CBY80607.1"
FT                   /translation="MKNKITDLNNHLFSQLEKLLDEDLTDEELNREIKRANAVSGIAAN
FT                   IIASNAISLKAMTLFENRQIERESPDFLRISKAQGDDL"
FT   CDS_pept        359959..360990
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR018876"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I8"
FT                   /protein_id="CBY80608.1"
FT                   /translation="MTSNAERFKFTDEHIAFIRLHWDKKPSDLIKLFQQQFDLLINRNV
FT                   FYKLKKKHNIPSLKHANRYSKEELAFIKANCTLNERILAQKMEVYFNKPFNPHALKVLR
FT                   VKRQWLTGRSGRFEKGENLKPIGFERYCKNAKCWLIKASIKRYERKSHYLWRKAGRKIP
FT                   RGHIIDYKDGNSRNCILENLELISRVEMAWRKKLQYHQLNDEIKPTFSAFVKLKEGINQ
FT                   RKKEKDMEENQSPNIATQEPTTFTFEFTEHELQTMAWAWFALLRGTELCQVLHPALKQI
FT                   GSHYAASVYDIAYEYRSTLRHAHNVLTRITEQFECEQGNNWRVLKYLRAYDPKKTGFQL
FT                   EIL"
FT   CDS_pept        361081..361818
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04200"
FT                   /product="DNA methylase"
FT                   /db_xref="GOA:E7A3I9"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3I9"
FT                   /protein_id="CBY80609.1"
FT                   /translation="MKTELFNDHFQNYKRYHIPKAQLVIADIPYNLGNNAYASNPEWYV
FT                   NGDNKNGESDKANSSFFDTDKDFRIAEFMHFCSKMLIKEPKERGKAPCMIVFCAFQQIS
FT                   MVIDYAKQHGFKNHIPLVFIKSSSPQVLKANMKVVGATEYALILYRDKLPKFNNNGKMI
FT                   KNWFEWEKDNRKEIPKLHPTQKPIAVLKRLIEIFTDEGDVVIDPVAGSASTLRAARELY
FT                   RPSYGFEIKKDSCKIAKEQMLNI"
FT   CDS_pept        361832..362179
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04220"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3J0"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J0"
FT                   /protein_id="CBY80610.1"
FT                   /translation="MKHSKTPLRQEKQSFTHFMNGSEKWLNRICYFLAALIIAMIVGGI
FT                   SLHANANPTDWHDNELSEQIQQEAQAKAKAQWREENGIYQANLTPQVNADMYRYVEQKQ
FT                   TEINRTLGAKQ"
FT   CDS_pept        362482..363432
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04230"
FT                   /product="Predicted recombinational DNA repair protein,RecE
FT                   pathway"
FT                   /db_xref="GOA:E7A3J1"
FT                   /db_xref="InterPro:IPR004590"
FT                   /db_xref="InterPro:IPR018330"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J1"
FT                   /protein_id="CBY80611.1"
FT                   /translation="MTNQVQHQQNKQPPALKTFFESANVQNKIKELVGKNAATFATSVM
FT                   QIANSNAMLKTADPMSIFNAACMAATLNLPLQNGLGFAYIVPFRNNNEKKTEAQFQIGY
FT                   KGFIQLAQRSGQFKRLVALPVYKKQLIKKDFINGFEFDWEKEPEEGELPIGYYAYFKLV
FT                   NDFSAELYMTHEEINAHAKKYSQTYRTYLDKKAKGQWAQSVWAENFEAMALKTVIKLLL
FT                   SKQAPLSVEMQQAVLADQAVVKDVENQEFNYADNIQNAEFVAVVDDETFNNCKQSIANG
FT                   ETTLQELCDSGAYEFSQEQIAELEAIENGNVQAES"
FT   CDS_pept        363407..364057
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J2"
FT                   /protein_id="CBY80612.1"
FT                   /translation="MEMYKLKARCSGLADLMVKPKSGNGISATAKSAVRKIVKYDLFGY
FT                   QDFEGNKYTEKGIALEEQAIKLSGRKRGLALKKNEERRENDWITGECDIYVPSRKLIID
FT                   TKCSWDIGSHPFFADEAEEKAKKAGYDAQMQGYMWLWDCDEAQIDFVLLPTPYDQLSSY
FT                   DDPSRYIDLVEQIPQEKRITTVTIKRDEKIIEKIKERVEIAQEYYQQLIQEMR"
FT   CDS_pept        364057..364491
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04270"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="GOA:E7A3J3"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J3"
FT                   /protein_id="CBY80613.1"
FT                   /translation="MARNTNTVILVGHLGSDPEIRQFQNGGQIATFNLAIGDDYRDKQG
FT                   NTVKRTHWIPIVVHGNSADVARQYLQKGSKICVTGKLVQESWQDQNGNNRTALKVATQS
FT                   FEMLDSKANNETQQPTKDKEKPDPLSAAAEQDGFNDDIPF"
FT   CDS_pept        364553..365629
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04280"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J4"
FT                   /protein_id="CBY80614.1"
FT                   /translation="MAEENKEIIAYKGFKQDWTCRGYQYEVGKTYEHKGNVKACESGFH
FT                   ACEYPLDVLSYYSPAVSKFAVVKMSGETSKDSDDTKIASAKITIETEINLPEMIKKAVE
FT                   WIKGKVDWDAAKVSNTGYRSVATNTGYRSVATNTGYRSVATNTGYRSVATNTGDQSTAT
FT                   NTGDRSVATNTGDQSTATNTGDRSVATNTGYWSAATNTGDRSVATNTGYWSAATNTGDR
FT                   SAATNTGYQSAATNTGYQSAATNTGYRSVATNTGYQSAATNTGYRSVATNTGYQSAATN
FT                   TGDQSVAEVSGKQSIAVALGWQSKAKASINGAIVCVYRNHDGELIHIKASKVGENNIKA
FT                   DTWYTLDEIGEFVEVKDD"
FT   CDS_pept        365908..366477
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04290"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J5"
FT                   /protein_id="CBY80615.1"
FT                   /translation="MIRNSRWTPEVPRPTLNDEHLFVPFLKEWVEKEYKDEINSDKEYF
FT                   EDEEFDIEYFGIYQDILKVWSGDNEDAAENLIKWQGWDYRQAKEFEEKNLEYDFDKENN
FT                   RLSKQWVTDNVYTLPFSVGSRVKWGLKEGIIMEDKNNNYLPFGKVCVLTDKQAAENKKW
FT                   QDQGISSRHGGYIVNWESLELIEEKP"
FT   CDS_pept        366474..366710
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04291"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J6"
FT                   /protein_id="CBY80616.1"
FT                   /translation="MNLLKSLARIILKEELENNKYHFEKLSNENLAKSRRIKELESDND
FT                   RLRIKVEQIRQDNLKLRENRPHFKHHKKKGGRK"
FT   CDS_pept        366707..367066
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J7"
FT                   /protein_id="CBY80617.1"
FT                   /translation="MNEINIKFPLHKFQTLIHRYVRDSLHDNGTPVLICIHDVKEYWAV
FT                   LDSHTREKIKGEVKFFIKEYHHLRNDEFFKKDLAAWSELADWINENRSSPSTTATTAKP
FT                   IVPVLPVINPKQRKK"
FT   CDS_pept        367074..368348
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04320"
FT                   /product="Cytosine-specific methyltransferase"
FT                   /db_xref="GOA:E7A3J8"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J8"
FT                   /protein_id="CBY80618.1"
FT                   /translation="MFTYGSICSGIEAVSVAWKGLGKPLWFSEIEPFPCAVLTYHYPNI
FT                   PNLGDMTTLPEKILNREIPAPDVLVGGTPCQAFSIAGLRNSLDDERGNLTLMLIHILEA
FT                   IDYVRYQDGKQPCILLWENVPGVLSTKDNAFGHFLAGLAQEREPLQPAGARWANSGYVH
FT                   SARTIAWRILDAQYFGVAQRRRRVFVVASARPRSVAQILIERKSLCGDIETGKSAEKNI
FT                   TAYTESSFGTYIRSTVGGVVTASGGALGGGSEILVVHGTQDPIISSTTAHCLGRNGGRE
FT                   NILFDIAHRSDVVRIQDDDTTPTLTARMGTGGNNIPCIALAGNTIGRQPHNGGNGNGFD
FT                   DSGVSYTLTTTDIHGVFNGLTVRKLTPSECEKLQGFPPGYTQIPYRNKLANDCPDSPRY
FT                   KAIGNSMAVPVIKWIGERMINYLNK"
FT   CDS_pept        368396..368812
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04350"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3J9"
FT                   /protein_id="CBY80619.1"
FT                   /translation="MDIINLIKQQTPEERQTLFNEFIKLLNQKREYVDIPERIVCSACQ
FT                   VFVDERDGTNEDGGEIIHEVYGLRHYDPFMRKQIKELEKQYKYALLDWEQGFLTNKGRF
FT                   VGRKEAMEIAKAQNQVIRLSGSPNSDILFSEDLY"
FT   CDS_pept        368884..369417
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K0"
FT                   /protein_id="CBY80620.1"
FT                   /translation="MFGAVVRDENEIGEDMKVLDEHILEYIWDETLDRIAQHTLVTYIG
FT                   GSVGTYSDDHAEKRAEDFAILSVRHLIAGSGLSESQFRRRVKKLMAQGVLLQRIGPNSF
FT                   VINSDVVKDAAVHAARCWRAIGVPYGMDDTGRACKTLPINALPRSIFELKTNCYRILRS
FT                   EYPSYKGKGVGNEQ"
FT   CDS_pept        369682..369951
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K1"
FT                   /protein_id="CBY80621.1"
FT                   /translation="MSENNGWINCANELPEPFSTDLEYRNATNKHLIYFTEDGDHWAVG
FT                   LGWYLYDDKSDCEGCLIPYWESDENPGEEVEVIYWQPLPQPPEE"
FT   CDS_pept        369955..370392
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04390"
FT                   /product="Unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K2"
FT                   /protein_id="CBY80622.1"
FT                   /translation="MPNWCVGNLKIRGESADITHFLTECIEGCECDIDELGTLEIKNIR
FT                   EQEIKGARRVFCDNPNEIIEGYELENGYIVVIPISAAWVLSQPEMIELSKKFNVDFRFY
FT                   GFELGQEFNQELEIIKGVLTLDKCIEFKNYIWECPMPYLGG"
FT   CDS_pept        370522..370836
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K3"
FT                   /protein_id="CBY80623.1"
FT                   /translation="MEQTLTIRDVAKCLNLSETTVRKNKLKWGFFQMEGSRMWRVFKSD
FT                   LDRNRKKAENLSDLYAKVGDTQEKQKCRSAKIKMACGKSILPHQAASEFDAVVKQLTKN
FT                   "
FT   CDS_pept        370734..371759
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04410"
FT                   /product="Prophage integrase"
FT                   /db_xref="GOA:E7A3K4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K4"
FT                   /protein_id="CBY80624.1"
FT                   /translation="MPIRKNKNGVWQIDFTTPSGERVRCSSKTTDKKLAQHLHDKLKHE
FT                   AWQVEQLNKKPEKTVEQALILLLKDAEHKKDKLTKIQHAKYWRDEIGNKLLSSLTSEDI
FT                   QNAIPTHVVRTGKILSPATQNRYRSSIMRAINLAKQAGWIDVVPYIAKNSEPKKRIRWI
FT                   TEKEAERLLDSLNLNWMKDVCQFALLTGARMTEILSMTWDKINFANKMAIVTGDIAKSG
FT                   RGRSLPLSDDAINLIKERMKYQVSPYVFHSGTGKLRDDISRRDFKRALQRANIKNFRFH
FT                   DLRHTWASWHIQRGTPLMVLKELGGWETIEMVQKYAHLNADHLLSYVNQVKFSSNTRLA
FT                   R"
FT   tRNA            complement(371867..371939)
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:371904..371906,aa:Lys)"
FT                   /note="tRNA Lys anticodon CTT, Cove score 72.47"
FT   tRNA            complement(371966..372038)
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:372003..372005,aa:Lys)"
FT                   /note="tRNA Lys anticodon TTT, Cove score 84.38"
FT   tRNA            complement(372092..372175)
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:372139..372141,aa:Leu)"
FT                   /note="tRNA Leu anticodon TAA, Cove score 52.82"
FT   tRNA            complement(372183..372255)
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:372220..372222,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 69.72"
FT   CDS_pept        complement(372412..372969)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04420"
FT                   /product="phosphatidylglycerophosphate synthetase"
FT                   /db_xref="GOA:E7A3K5"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K5"
FT                   /protein_id="CBY80625.1"
FT                   /translation="MKFNIPIFLTIFRVILIPFFVIAFYLPIESSPFITTLIFFIAGVT
FT                   DWLDGYLARKWKQTTRFGAFLDPVADKVMVVVALVLIVEHQHTFWITIPAIIMISREII
FT                   ISALREWMAELGERSKVAVSWWGKWKTTAQMLALGGLLWRYNNYMEIAAIILLYIAAIL
FT                   TIWSMIQYLQVAKGSLLDNIQL"
FT   CDS_pept        373244..374434
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04421"
FT                   /product="Cystathionine beta-lyase"
FT                   /db_xref="GOA:E7A3K6"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR006233"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K6"
FT                   /protein_id="CBY80626.1"
FT                   /translation="MQTKYDLSTMFIHSGRQKRFSQGSVNPVLQRASSLLFDSIEDKKH
FT                   ATQRRAKGELFYGRRGTLTHFALQDLMCEMEGGAGCYLYPCGTAAVTNSILSFVKTGDH
FT                   VLMSGAAYEPTQYFCNIVLKKMQIDITYYDPLIGEDIATLIQPNTKVLFLEAPSSITME
FT                   IPDIPTIVKAARKVNPNIVIMIDNTWSAGVLFKALEHDIDISIQAGTKYLVGHSDIMIG
FT                   TAVANARTWDQLREHSYLMGQMVDADSAYTTARGIRTLGVRLKQHQESSIKVAKWLNEQ
FT                   PEVKTVYHPALPSCPGHEFFLRDFSGSSGLFSFELTQRLTSEQVSKFMDHFQLFAMAYS
FT                   WGGFESLILCNQPEEIAHIRPNIKRNLTGSLIRVHIGFENVDELIADLKAGFERIA"
FT   CDS_pept        374819..376180
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04440"
FT                   /product="UDP-N-acetylmuramate:L-alanyl-gamma-D-gluta
FT                   myl-meso-diaminopimelate ligase"
FT                   /db_xref="GOA:E7A3K7"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005757"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K7"
FT                   /protein_id="CBY80627.1"
FT                   /translation="MKHIHILGICGTFMGGVAMIAKQMGYHVTGSDTNVYPPMSTFLEE
FT                   QGIEIIPNYDVAQLQPAPDMVIVGNAMKRGNPCVEYVLENNLKYISGPQWLHDHLLRDR
FT                   WVLAVSGTHGKTTTTGMLTWILEQNGLNPGFLIGGIAGNFGISARLGDSPYFVIEADEY
FT                   DTAFFDKRSKFVHYNPRTLIVNNISFDHADIFDDLKAIQRQFHHMIRTIPASGLVLSSA
FT                   SEQSAKETLALGCWSQQQFLGKDNEWFAERITNDASHFVVFHHGEKVAEVKWNVVGQHN
FT                   MHNALMAIAAAHHTGVAIEDACKALGSFVNAKRRLEVKGEVNSITVYDDFAHHPEAILA
FT                   TLTALRDKVGGGVRILAVLEPRSNTMKMGVHKDDIAPALGRADEVFMLQPEQLSWEVAD
FT                   IANQCVQPAYWNANLDRLVDMIVAEAQPTDHILVMSNGSFGGIHQKILDKLKLK"
FT   CDS_pept        376293..376799
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3K8"
FT                   /db_xref="InterPro:IPR019275"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K8"
FT                   /protein_id="CBY80628.1"
FT                   /translation="MADPHIKSPMDFLDYLTVIIYRTGFVIAALAVLTVSWYPDLSLTF
FT                   ILIAATCCASSLHIYLKSFRLLFQFATWIGLLFYINHYPALALGGALLTLGGLCFKEYF
FT                   CFRVPLLNLQPIFVACLWFSWVLNNLIALRIFSIISGVLLLVLAIQKWRMPLHFDIGDK
FT                   TKYQI"
FT   CDS_pept        complement(376849..377856)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04460"
FT                   /product="High-affinity zinc uptake system protein ZnuA"
FT                   /db_xref="GOA:E7A3K9"
FT                   /db_xref="InterPro:IPR006127"
FT                   /db_xref="InterPro:IPR035520"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3K9"
FT                   /protein_id="CBY80629.1"
FT                   /translation="MKKLLKISAVSAALLSAPMMANADVLASVKPLGFIVSSIADGVTG
FT                   TQVLVPAGASPHDYNLKLSDIQKVKSADLVVWIGEDIDSFLDKPISQIERKKVITIADL
FT                   ADVKPLLSKAHHEHFHEDGDHDHDHKHEHKHDHKHDHDHDHKHEHKHDHEHHDHDHHEG
FT                   LTTNWHVWYSPAISKIVAQKVADKLTAQFPDKKALIAQNLSDFNRTLAEQSEKITAQLA
FT                   NVKDKGFYVFHDAYGYFNDAYGLKQTGYFTINPLVAPGAKTLAHIKEEIDEHKVNCLFA
FT                   EPQFTPKVIESLAKNTKVNVGQLDPIGDKVTLGKNSYATFLQSTADSYMECLAK"
FT   CDS_pept        complement(378034..378819)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04470"
FT                   /product="conserved protein"
FT                   /db_xref="GOA:E7A3L0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L0"
FT                   /protein_id="CBY80630.1"
FT                   /translation="MGITVMARIDNYEQRFGGIGRLYTPDGLARLRQAHICVIGIGGVG
FT                   SWVVEALARSGIGELTLIDMDDICVTNINRQLPAMSGTIGKLKTEVMSERVKLINSECT
FT                   VNIIDDFISPENQSDYLNRGYDYVIDAIDNVKTKASLIAYCKRNKINVITIGGAGGQTD
FT                   PTQIQIADLSKTIQDPLLAKVRSVLRKDYNFSQNPKRKFSIDAIFSTQPLIFPQMTEDC
FT                   SISATMNCANGFGAATMITATFGFFAVSRVIDKLLKKKS"
FT   CDS_pept        complement(378804..379913)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04480"
FT                   /product="membrane-bound lytic murein transglycosylase A
FT                   precursor"
FT                   /db_xref="GOA:E7A3L1"
FT                   /db_xref="InterPro:IPR005300"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR026044"
FT                   /db_xref="InterPro:IPR034654"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L1"
FT                   /protein_id="CBY80631.1"
FT                   /translation="MSVSKPFWFKTFSISIITALLVACTSNTKNTQIPTTSNGSDPQQF
FT                   GAKYTNRTYQQTALVPVSYIENQSAVINQGDFLTQLSNIKNYSSKLSTNFYDNYEKITN
FT                   WVLSGANINELTQFNIQPQIMRGFDGFQNVLMTGYYSPILYARHSPQGQFKNPIYRMPV
FT                   KKRLSRAQIYAGALAGKGLELAYSDSMLENFLLGVQGSGYVDFGDGNLNYFAYAGQNGY
FT                   PYTAIGRLLVEDGEIPKEKMSIQAIREWSNRNPSRVQSLLERNEAYVFFKNDPSGKVKG
FT                   SSGVPLVAMASVASDHNIIPSGSVLLVEVPDIDNNGNWIGTHKLHLMVALDVGGAVKGH
FT                   HFDLYRGIGARAGHIAGLSKHYGRVWVLR"
FT   tRNA            380100..380173
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:380134..380136,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 60.21"
FT   CDS_pept        380307..382442
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04490"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="GOA:E7A3L2"
FT                   /db_xref="InterPro:IPR000241"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR017244"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L2"
FT                   /protein_id="CBY80632.1"
FT                   /translation="MKQLFATTSRGFEELLKVELTELGAQEAKVVQGGVHYQADDETLY
FT                   RTLLWSRLASRILFPLIETKIYSDLDLYVAVSGFNWLAQFDERVTFFVDFNGTNQEIRH
FT                   TQFGAMRVKDGIVDYFERQGKTRPDVDKIQPDVRIHAYLNRENLVISLDLSGEALHLRG
FT                   YREDAGQAPLRETLAAAIVMRSGWQVGSPLVDPMCGSGTLLIEAAQIEAKIAPQLYRLH
FT                   WGFDFWKAHNQSAWEKVKNEAIELAEEKQREIQPHFYGFDLDHRVLKKAQKNAQNAGVS
FT                   HLIKWQQADVAALKNPRLNEVGTVICNPPYGERLGTTPALIALYSVFGQRLKKEFCGWN
FT                   VSVFSSESTLLDCLRMRASRQFKAKNGPLDCVQKNYQVSERKSDAITDEKELEFNRTSE
FT                   VAPDFANRLQKNIKKISKWAKQQELDAYRLYDADLPEYNLAVDRYADYIVVQEYAAPKN
FT                   IDENKARQRLLDAVTATLQVTGVETNKLILKVRQKQKGTNQYEKLANKGEYFYVNEYGA
FT                   QLWVNLTDYLDTGLFLDHRLTRKMIGELAKGKDFLNLFAYTGSATVHAALGGAKSTTTV
FT                   DMSNTYLNWAEQNLILNDIEGKQHKLIQADCLQWLEKCDRQFDLVFVDPPTFSNSKRME
FT                   ESWDVQRDHVKLMRNLKRVLSNNGTIVFSNNKRGFKMNLVALEELGLSAVEISHKTLPL
FT                   DFERNKQIHNCWMIQHI"
FT   tRNA            382591..382664
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:382625..382627,aa:Arg)"
FT                   /note="tRNA Arg anticodon CCG, Cove score 81.45"
FT   tRNA            382694..382766
FT                   /product="transfer RNA-His"
FT                   /anticodon="(pos:382727..382729,aa:His)"
FT                   /note="tRNA His anticodon GTG, Cove score 69.01"
FT   tRNA            382791..382864
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:382825..382827,aa:Pro)"
FT                   /note="tRNA Pro anticodon TGG, Cove score 62.64"
FT   tRNA            384716..384788
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:384750..384752,aa:Glu)"
FT                   /note="tRNA Glu anticodon TTC, Cove score 58.29"
FT   CDS_pept        388648..389577
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04500"
FT                   /product="DNA-binding transcriptional
FT                   activator,homocysteine-binding"
FT                   /db_xref="GOA:E7A3L3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037406"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L3"
FT                   /protein_id="CBY80633.1"
FT                   /translation="MKPTFLEFRHLKTLLALKETGSVSLAAKRVYLTQSALSHQIKLIE
FT                   EQFGLPLFERKSNPLRFTSAGERLIRLANEVMPKVIDAERDLARVKHGDAGQLRIAVEC
FT                   HTCFDWLMPAMDEFRQHWGLVELDIVSGFHTDPVGLLLSHRADWAIVSEIEHNDDVIFK
FT                   PLFSYEMVGICSKNHSLAEKDIWEAEDFIDETWVTYPVPDDMLDLWRKVLKSKGINPTR
FT                   RTTELTIAMIQLVASKRGIATVPYWAALPYLEKGYVVARKITKSGLYSNLYAAIRKEDE
FT                   SLSYLEDFYQTVKSQSFSTLPGLSVLNL"
FT   CDS_pept        389587..390321
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04510"
FT                   /product="predicted branched-chain amino acid permease"
FT                   /db_xref="GOA:E7A3L4"
FT                   /db_xref="InterPro:IPR004471"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L4"
FT                   /protein_id="CBY80634.1"
FT                   /translation="MNLSQQNQQSNPITEAAKAAFPYSVPMIAGFLFLGIAYGIYMKAL
FT                   GFGFLYPTLMALLIYAGSVEFIAAGALIAPFSPISVLLITLMISARQIFYGISMLEKYG
FT                   IHIGKKRWYLITTLVDESFSLNYMAKIPPHLDKGWYMFFVSLYLHIYWVLGAAMGNLFG
FT                   TVLPFNLKGVEFSMTALFLVIFAENWLKEKSHESSLLGLGIALVFLLIIGKEYFLIPTL
FT                   IGIWLILTMRITKLETKLESLK"
FT   CDS_pept        390318..390647
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04520"
FT                   /product="predicted branched-chain amino acid permease"
FT                   /db_xref="GOA:E7A3L5"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L5"
FT                   /protein_id="CBY80635.1"
FT                   /translation="MTLTEQIITIGICIVAVQFTRLLPFFVFPVNLPIPQYIRYLGKVL
FT                   PPAMFGMLVVYCYKNIEILTGYHGIPDLLAGIVVLGLHFWKKNMFLSIAVGTLFYMALV
FT                   QLIFI"
FT   CDS_pept        390750..390983
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3L6"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L6"
FT                   /protein_id="CBY80636.1"
FT                   /translation="MDFNFIEFLGYMATFFVAASFLFKSIVHLRIVNSIGAILFVIYSL
FT                   IITAYPVALLNAFLVVVNIYQLWRLKQENLSK"
FT   CDS_pept        complement(391059..392642)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04550"
FT                   /product="peptide chain release factor RF-3"
FT                   /db_xref="GOA:E7A3L7"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L7"
FT                   /protein_id="CBY80637.1"
FT                   /translation="MSYPLEEVNKRRTFAIISHPDAGKTTITEKVLLYGNAIQTAGSVK
FT                   GKGSAAHAKSDWMEMEKQRGISITTSVMQFPYNDCLVNLLDTPGHEDFSEDTYRTLTAV
FT                   DSCLMVIDSAKGVEERTIKLMEVTRLRDTPIITFMNKLDRDIRDPMELLDEVENVLKIR
FT                   CAPITWPIGCGKLFKGVYHLAKDETYLYQSGQGSTIQAVRVVKGLNNPELDVAVGDDLA
FT                   QQLRDELELVQGASNEFEQDAFIKGELTPVFFGTALGNFGVDHFLDGLTQWAPKPQSRQ
FT                   ADTRTVESAEEKFSGFVFKIQANMDPKHRDRVAFMRVVSGKYEKGMKLKHVRIGKDVVI
FT                   SDALTFMAGDRAHAEEAYAGDIIGLHNHGTIQIGDTFTQGETLKFTGIPNFAPELFRRI
FT                   RLKDPLKQKQLLKGLVQLSEEGAVQVFRPLLNNDLIVGAVGVLQFDVVVSRLKTEYNVE
FT                   AIYENVNVATARWVECADEKKFEEFKRKNEQNLALDGGDNLTYIAPTMVNLNLAQERYP
FT                   DVVFYKTREH"
FT   CDS_pept        392821..393609
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04560"
FT                   /product="enoyl-[acyl-carrier-protein]
FT                   reductase,NADH-dependent"
FT                   /db_xref="GOA:E7A3L8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L8"
FT                   /protein_id="CBY80638.1"
FT                   /translation="MGFLTGKRILVTGLASNRSIAYGIAKSMKEQGAELAFTYLNDKLQ
FT                   PRVEEFAKEFGSDIVLPLDVATDESIQNCFAELSKRWDKFDGFIHAIAFAPGDQLDGDY
FT                   VNAATREGYRIAHDISAYSFVAMAQAARPYLNPNAALLTLSYLGAERAIPNYNVMCLAK
FT                   ASLEAATRVMAADLGKEGIRVNAISAGPIRTLAASGIKNFKKMLSTFEKTAALRRTVTI
FT                   EDVGNSAAFLCSDLASGITGEIVHVDAGFSITAMGELGEE"
FT   CDS_pept        393691..395670
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04570"
FT                   /product="exoribonuclease II"
FT                   /db_xref="GOA:E7A3L9"
FT                   /db_xref="InterPro:IPR001900"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004476"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR011804"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013223"
FT                   /db_xref="InterPro:IPR022966"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3L9"
FT                   /protein_id="CBY80639.1"
FT                   /translation="MFQDNPLLAQLKQQIHDSKEQVEGVVKSTDKAYGFLECDKKTYFI
FT                   APPSMKKVMHGDKIKATIEKQGDKEQAEPEALIEPMLTRFIAKVRFNKDKKLQVLVDHP
FT                   SINQPIGAQQAKSVKEELQEGDWVVANLKTHPLRDDRFFYATINQFICRADDELAPWWV
FT                   TLARHEQSRYPVQGAEPYEMLDQKTRENLTALHFVTIDSESTMDMDDALYIEPIAQNST
FT                   QTGWKLVVAIADPTAYIALDSQIEQEAKQRCFTNYLPGFNIPMLPRELSDELCSLIANE
FT                   TRLALVCYIETDLAGNITAKPNFVSAYVQSKAKLAYNKVSDYLEQADNAWQPEMPETAQ
FT                   QIHWLHQFTKARIQWRKTHSLFFKEKPDYAFVLAENGKVQEIKAEYRRIANQIVEEAMI
FT                   IANICAAQFLHEQAKTGIFNTHSGFDKKFLENAHHFLMANLANEQNQAELAERYSVENL
FT                   ATLNGYCQMRHDIDPLESDYLELRLRRYLTFAEFKSELAPHFGLGLEGYATWTSPIRKY
FT                   SDMVNHRLIKAVLAKQPYEKPQNDVLARLQEARRQNRLVERDIADWLYCRYLAPKVAEN
FT                   VEFNAEVQDVMRGGLRVQLLENGASMFIPASTLHNNKEEMQVNSDEIALYIKGERTYKI
FT                   GDMVKVKLTEVKEATRSIVGEILQ"
FT   CDS_pept        395630..396517
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_0458"
FT                   /product="Hsf-like protein fragment (pseudogene)"
FT   CDS_pept        396753..397394
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04590"
FT                   /product="predicted enzyme subunit"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M0"
FT                   /protein_id="CBY80641.1"
FT                   /translation="MNIVPISESAVVCSLSPPASIQQQRQLWAFARQLQSEQDIVEVVL
FT                   GMNNLTVFTDFFVDFKPLVQRLEQLWAELKVSDFQGRHIEIPVIYGGERGPDLSDVAKF
FT                   HQTTPERIIQMHSEPIYTVYMIGFQAGFPYLGGLPENLHTQRRASPRAVVPAGSVGIGG
FT                   AQTGIYPFSSPGGWQLIGYTKQALFDKNQAQPTLLQAGDTVKFIVEGIEL"
FT   CDS_pept        397391..398320
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04600"
FT                   /product="predicted enzyme subunit"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M1"
FT                   /protein_id="CBY80642.1"
FT                   /translation="MIDILDVKSRATIQDLGRFGLRRFGISHCGAMDKLALRAGNILLG
FT                   NAENVPAIEVPLGGITLQFQQDMNFCVTGAFYEMMLDDKPVFAYWRYQARAGQILKMTR
FT                   AKIGMYGYLCVQGGFVLPQALNSCSTDLRAEIGGIEGRCLQAGDQLQTANDHILRSEIG
FT                   VAPIPLRDVIRALPSSEYQAFKRKSQYYWWRNEWTLQSNSDRMGYRFQGQTLELKQPLE
FT                   MLSHAIQFGSVQVPPSGQPIILMADAQTTGGYPKIANVIDADLGALAQVRLGSTIKFEA
FT                   VSLQEAAKLRRKNEIYLDQIRRIVDEKN"
FT   CDS_pept        398307..399044
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3M2"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M2"
FT                   /protein_id="CBY80643.1"
FT                   /translation="MKKIDLNADIAEGFPFDESLLQLLSSANIACGLHAGGAKEMQSAV
FT                   KFAKENKVRIGAHPSFPDRENFGRTAMALSSQELIAHLRYQLGALKAICDGEGAVISYV
FT                   KPHGALYNQAAKDEKIARVIAQTVYQFDPNLKLMGLAGSLMLRIAEEEKLQTISEVFAD
FT                   RHYMPDGSLVPRSQPNAMVESDKEAIQQVLQMVTKGQVNAIDGSLVPVKAESICLHGDN
FT                   QHSLQFAKRIVEELEKNHIKITA"
FT   CDS_pept        399088..400281
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04620"
FT                   /product="uncharacterised membrane protein"
FT                   /db_xref="GOA:E7A3M3"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M3"
FT                   /protein_id="CBY80644.1"
FT                   /translation="MASITHRRNAVLGAAFLMATSAIGPGFLTQTATFTNTLLASFGFV
FT                   ILLSILLDIGAQLNIWRIVIVSGKRAQDISNAVFPKAGYFLAALIVMGGLAFNIGNVGG
FT                   AGLGLNSIFGIAPEMGAVISGIIAILIFLRKEAGLLMDRFAQLMGFIMVALTFYVMFKT
FT                   EPPVAEAAYHSFIPEKIDPIAIVTLVGGTVGGYITFAGAHRLLDAGIQGEKAMAEVSRS
FT                   SVSAILIASTMRVVLFLAVLGVVSKGVSLNPKNPAETPFEYVAGNFGQVLFGVVIWAAS
FT                   VTSVIGAAYTSVSFLTTLCPTIERNRNRWIIAFIVISTVVLVTVGKPAAVLVFVGTLNG
FT                   LILPIALALILLAAYRSDIVGTYKHPVFLAFSGWFVVIIMAILSGKTIISYISSFFS"
FT   CDS_pept        complement(400352..401686)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04630"
FT                   /product="argininosuccinate synthetase"
FT                   /db_xref="GOA:E7A3M4"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR023437"
FT                   /db_xref="InterPro:IPR024073"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M4"
FT                   /protein_id="CBY80645.1"
FT                   /translation="MSNTILQNLPKGQKVGIAFSGGLDTSAALLWMRQKGAVPYAYTAN
FT                   LGQPDEDDYNAIPKKAMAYGAENARLIDCRSQLAHEGIAAIQCGAFHISTGGIPYFNTT
FT                   PLGRAVTGTMLVAAMKEDDVNIWGDGSTFKGNDIERFYRYGLLTNPNLKIYKPWLDVQF
FT                   IEELGGRLEMSQFLIENGFDYKMSVEKAYSTDSNMLGATHEAKDLEQLSTGMKIVKPIM
FT                   GVAFWDEKVEIKPETVTVTFEDGVPVALNGKHFDNAVDLILEANRIGGRHGLGMSDQIE
FT                   NRIIEAKSRGIYEAPGMALLHIAYERLVTGIHNEDTIEQYRINGIRLGRLLYQGRWFDP
FT                   QALMLRETAQRWVAKAITGTVTLELRRGNDFTILNTESPNLTYEAERLSMEKVEDAPFD
FT                   PVDRIGQLTMRNLDVSDTRGKLGIYAQTGLLSAIKDSVLPQLGKK"
FT   CDS_pept        complement(401842..402714)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04640"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxa mide
FT                   synthase"
FT                   /db_xref="GOA:E7A3M5"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M5"
FT                   /protein_id="CBY80646.1"
FT                   /translation="MTQQSLTLSLKKIYSGKVRDLYEIDDKRMLMVASDRLSAFDVILD
FT                   DPIPRKGEILTQISNFWFNKLAHIMPNHFTGDSVYDVLPKEEADLIKDRAVVCKRLTPI
FT                   KIESIVRGYLTGSGLKDYKQTGTICGLKLPENLVEASKLPEAIFTPSSKEEVGNHDINI
FT                   SYAECEKLIGSDLAAQVKEKAIALYTEASEYALTKGIIICDTKFEFGLDENGTLTLMDE
FT                   VLTPDSSRFWSVDTYQAGTNPPSFDKQFVRDWLENSGWNKQAPAPKVPKNIIQKTVDKY
FT                   QEALDLLTK"
FT   CDS_pept        complement(402880..405228)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04650"
FT                   /product="penicillin-binding protein 1B"
FT                   /db_xref="GOA:E7A3M6"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR011813"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR028166"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M6"
FT                   /protein_id="CBY80647.1"
FT                   /translation="MTSQHSAKKSSKNTPKNNRTFKGFLLKFSFTALVLTIFYGGYLDW
FT                   QIRSKMDGQIWHLPAEVYSRLESVKIADNLAFDEVIQILLDNEYRQTTMVAAPGDFKLE
FT                   DDSIVVLRRAFPFPDKAEPQRVLRLRFSHNKLSRIEDLVTVKTVDEFRLAPKLIAMLQS
FT                   DNEDRLAIPLQNYPRLLIDTLILTEDRRFYEHNGINPVGILRALIANIRAGQTVQGGST
FT                   LTQQLVKNLFLSRERTITRKANEALMSLVLDWRYDKNRILETYLNEIYLGQNGDTQIHG
FT                   FELASQFYFGRSIREISLDQIALLVGMVKGPSLYNPWRNPQNALERRNIVLKLMLEHKM
FT                   IGDELYQLLSQRPLGVQKKGQISRKYPAFIQTLQADLRRELGEHKMSSLLGARIFSTMD
FT                   LKQQAQAENAVVNTVSQLQLKTKNPHLESAMIITDYRTGEIRAVVGGLQTQYAGFNRAL
FT                   MAKRQIGSLVKPSIYLTALSNPEQFRLNTLINNQPITINVKGSPPWQPRNYDKKYSGSV
FT                   MLMDALARSLNIPTVNIGMKVGLSKVIDTQKAMGWDNVEIPKVPAMLLGSYTISPYDVT
FT                   KLYQTIANQGGRISLTTVDSITDRQGNLIFQHDKSVKQVVPQEAAFQTLFAMQQTVERG
FT                   TARSLQKDYADLHLAGKTGTTNEARDTWFVGIDGKNISTVWLGRDDNGETKLTGASGAL
FT                   QIYKDYLNRTNIEKLAITPPATVKWVGINQYGGWDCESYRTIPVWLNNGQNFCGEIASP
FT                   SFTPTEAETTTPPQESLWDVLDNPNPPAQ"
FT   CDS_pept        complement(405235..405537)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR008249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M7"
FT                   /protein_id="CBY80648.1"
FT                   /translation="MEHIALANWFNTEVRSNSDKILTALSTAKSLIENQEKVLIGTEYT
FT                   LFLNADEVMVRANNLAIESDEILEQDFHYYDEESLAFCGTQDFIHFLQSYVDFIA"
FT   CDS_pept        complement(405590..405934)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3M8"
FT                   /db_xref="InterPro:IPR000361"
FT                   /db_xref="InterPro:IPR016092"
FT                   /db_xref="InterPro:IPR017870"
FT                   /db_xref="InterPro:IPR023063"
FT                   /db_xref="InterPro:IPR035903"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M8"
FT                   /protein_id="CBY80649.1"
FT                   /translation="MIDDMAVPLTFTDAAANKVKSLISEEENTNLKLRVYITGGGCSGF
FT                   QYGFTFDEKVNDGDLTIEKSGVQLVIDPMSLQYLIGGTVDYTEGLEGSRFTVNNPNATS
FT                   TCGCGSSFSI"
FT   CDS_pept        406070..406876
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04680"
FT                   /product="methionine aminopeptidase"
FT                   /db_xref="GOA:E7A3M9"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3M9"
FT                   /protein_id="CBY80650.1"
FT                   /translation="MAIPIRTEKEIVKLREACKLASDVLVMIEPYVKAGVTTGELDRIC
FT                   HEYMVNEQKVIPACLNYHGFPKATCISINEVVCHGIPSDDKVLKNGDIVNIDVTVIKDG
FT                   YFGDNSKMYIVGGETNIRSKKLVEAAQEALYVGIRTVKPDIRLNEIGKAVQKYTESQTF
FT                   SVVREYCGHGVGTEFHCEPQVLHYYADDGGVILKPGMVFTIEPMINAGKKEVRVMGDGW
FT                   TVKTKDRSHSAQYEHQLVVTETGCEVMTIRDEEIAEGRISRIMVNV"
FT   CDS_pept        406970..409561
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04690"
FT                   /product="uridylyltransferase"
FT                   /db_xref="GOA:E7A3N0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N0"
FT                   /protein_id="CBY80651.1"
FT                   /translation="MLFSPTLSSPLTPSAVKIERENLKQFELENFSCYSIFELIENRCD
FT                   FYDALLIQLWQEMGLSEQQGIPLIAVGGYGRREMFPLSDLDFLILVEQTPSPEIEEKIT
FT                   QFIQFLWDCGFEVGNSVRTLAQCESEGKQDITIATNLLEARFLTGNRPHFDALNELVKR
FT                   ADFWSKEDFFNAKVQEQIERYQRYHNTAYNLEPDIKYSPGGLRDLHLLYWVALRHSGAL
FT                   TLEAILQSGFIYPQEYQQLQESRAFLFKVRFALHLILKRYDNRLLFDRQIKVSELLGFR
FT                   GEGNPAVEKMMKCFFQALHRISLISNLLIQHYRENVLSSNQATVIDQLDDDFQLINQSL
FT                   CLRNSFVFQEKPARMLDLFFYLTQYEWADIHSDTLRQLQISLDQLPQKLCEIPAAREKF
FT                   LRLFNQPNAIKRAFMPMHQYGVLTAYLPQWQAIEGLMQFDLFHIYTVDEHTLRVMLKLE
FT                   SFLSQESAQEHPIAHRIFSQLSDRTLLYIAALFHDIAKGRGGDHAELGAEDVADFAQLH
FT                   GLDRREIDTLAWLVQSHLLMSITAQRRDIHDPEVVMNFAEAVQNQVRLDYLTCLTVADI
FT                   CATNGNLWNSWKRSLFASLYEFTEQQFSQGMKELLDYSEKSAENRKLAQQILTQDYSDI
FT                   APISIEQLWTRCPEDYFVRNTPKQIAWHTSLLVDFVEALLVKISNRFSLGGTEVFIYCQ
FT                   DQPHLFNKVVSTIGAKKFSIHDAQIITTQDGYVFDSFIITELNGELVEFDRRRELEQAL
FT                   TVALQSEKLPALSITPNRQLQHFIVQTDVRFLHENKKEHTEMELVALDKPGLLAQVSQI
FT                   FTELNLNLLNAKITTVGEKAEDFFILTNQFGQALDSQQREILRNVLYRNIG"
FT   CDS_pept        409636..410703
FT                   /transl_table=11
FT                   /gene="wecA"
FT                   /locus_tag="HIBPF_04700"
FT                   /product="UDP-GlcNAc:undecaprenylphosphate
FT                   GlcNAc-1-phosphate transferase"
FT                   /db_xref="GOA:E7A3N1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR012750"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N1"
FT                   /protein_id="CBY80652.1"
FT                   /translation="MLSIFVTFLGAFLTLIVMRPLANWIGLVDKPNYRKRHQGTIPLIG
FT                   GVSLFVGNLCYYLMEWDQIRLPYLYLFSIFVLLAIGILDDRFDISPFLRAGIQAILAIL
FT                   MIDLGNIYLDHLGQILGPFQLTLGSIGLIITVFATIAIINAFNMIDGIDGLLGGLSCVS
FT                   FAAIGILMYRDGQMDMAHWSFALIVSILPYLMLNLGIPFGPKYKVFMGDAGSTLIGFTI
FT                   IWILLLSTQGKGHPMNPVTALWIIAIPLIDMVAIIYRRVRKGKSPFRPDRLHVHHLMVR
FT                   AGLTSRQAFLLITFVSAVCATIGILGEVYYVNEWAMFVGFFILFFLYVYSITHAWRITR
FT                   WVRRMKRRAKRLKKA"
FT   tRNA            complement(410843..410915)
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:410880..410882,aa:Gly)"
FT                   /note="tRNA Gly anticodon GCC, Cove score 69.72"
FT   CDS_pept        complement(411009..411557)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04710"
FT                   /product="oligoribonuclease"
FT                   /db_xref="GOA:E7A3N2"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N2"
FT                   /protein_id="CBY80653.1"
FT                   /translation="MSFDKQNLIWIDLEMTGLEPEKERIIEIATIMTDKNLNILAEGPV
FT                   LAVHQSDELLNKMNDWCQKTHSENGLIERVKASKLTERAAELQTLDFLKKWVPKGASPI
FT                   CGNSIAQDKRFLVKYMPDLADYFHYRHLDVSTLKELAARWKPEILEGFKKENTHLALDD
FT                   IRESIKELAYYREHFMKLD"
FT   CDS_pept        411628..412668
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04720"
FT                   /product="probable GTPase A"
FT                   /db_xref="GOA:E7A3N3"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N3"
FT                   /protein_id="CBY80654.1"
FT                   /translation="MAKRKLTQNQTRRIQSNNAKTLHRHKKKDIEWSDEMLGESQEGVV
FT                   VTRYSIHADVENEQGEIYRCNLRRTLSSLVVGDKVVWRKGNEQLQGVSGVIEAIHPREN
FT                   EISRPDYYDGLKPIAANINRIIIVSAVLPTLSLNIIDRYLVVCEIAEIKPLIVLNKVDL
FT                   LTQEQRQEIEEQLKIYQDIGYEILMISAKSGENMEKLTALLAQGTAIFVGQSGVGKSSL
FT                   INHILPSVNAQVGDVSETSGLGQHTTTSSRLYHLPQGGNLIDSPGIREFGLWHLDAEQI
FT                   TKGYREFQYVLGTCKFRDCKHLSDPGCALREAVEQGKISPVRYDNYHRLIESLSETKSQ
FT                   RHFSLV"
FT   CDS_pept        412827..413084
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04730"
FT                   /product="phosphocarrier protein HPr"
FT                   /db_xref="GOA:E7A3N4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N4"
FT                   /protein_id="CBY80655.1"
FT                   /translation="MYSKDVEIIASNGLHTRPAAQFVKEAKAFSSEITVTSGGKSASAK
FT                   SLFKLQTLALTQGTILTISADGEDEQQAVEYLVALIPTLE"
FT   CDS_pept        413164..414891
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04740"
FT                   /product="Phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="GOA:E7A3N5"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N5"
FT                   /protein_id="CBY80656.1"
FT                   /translation="MISGILASPGIAFGKALVLKEEKIVLDTQKITDDQIDAEVARFYE
FT                   GRAAAVEQLNSIRERALISLGEEKAAIFEGHLMILEDEELEEEILDYLRSNKVNAAVAA
FT                   SKIIDQQVTMLSEIDDEYLKERAGDIRDIGNRLIKNILGMYIVDLGDIQEESILVAYDL
FT                   TPSETAQLNLEKVLGVVTDIGGRTSHTSIMARSLELPAIVGTNKVTKLVNTGDYLILDA
FT                   INNQVYINPTASQIDELKALEAKISEEKAELAKLKDLPAITLDGHKVDVVANIGTIRDC
FT                   DGAERNGAEGVGLYRTEFLFMDREQLPTEEEQFIAYKQVVEAMNGRLTVLRTMDIGGDK
FT                   ELPYLDLPKEMNPFLGWRAIRIALDRREILNAQLRAVLRASAFGKLAVMFPMIISVEEI
FT                   RELKAVIETLKAELRAEGRLFDNNIQVGVMVETPSAAVNAKFLAKEVDFFSIGTNDLTQ
FT                   YTLAVDRGNEFISHLYNPMHPSVLGLIKQVIDASHAEGKWTGMCGELAGDERATLLLLG
FT                   MGLDEFSMSAISVPRIKKLIRNVNFQDAKVLADTALQKPTAAEIDQLIEEFLLENSLN"
FT   CDS_pept        414951..415451
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04750"
FT                   /product="PTS system, glucose-specific IIA component"
FT                   /db_xref="GOA:E7A3N6"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N6"
FT                   /protein_id="CBY80657.1"
FT                   /translation="MGLFDKLFGSKENKSVEVEIYAPISGEIVNIEDVPDVVFSEKIVG
FT                   DGVAVRPIGNKIVAPVDGVIGKIFETNHAFSMESKEGVELFVHFGIDTVELKGEGFTRI
FT                   AQEGQSVKRGDTVIEFDLALLESKAKSVLTPIVISNMDEISCIVKKSGEVVAGESVVLA
FT                   LKK"
FT   CDS_pept        415952..416317
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005220"
FT                   /db_xref="InterPro:IPR016052"
FT                   /db_xref="InterPro:IPR036700"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N7"
FT                   /protein_id="CBY80658.1"
FT                   /translation="MKKFALATIFALATTSAFAGFNGNNSQGGFQQAAPAAISVKQALS
FT                   AADNSMITLVGNITQQIDDDEFWFTDETGQIKIEIKKRVWNGLNVDSKDKVKIYGKLDN
FT                   EVFEKAELDVLRIEKVE"
FT   CDS_pept        416381..417043
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04790"
FT                   /product="transcriptional regulatory protein QseB"
FT                   /db_xref="GOA:E7A3N8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N8"
FT                   /protein_id="CBY80659.1"
FT                   /translation="MRILLIEDDNLIGNGLQIGLTTLGFAVDWFTDGKTGMAALTSAPY
FT                   DAVVLDLTLPKLDGLEVLQQWRSNHQDVPVLILTARDTLDERVKSLQSGADDYLCKPFA
FT                   LAEVAARLQALIRRYGYHHSVIEQAGVKLDQNQRSVWLNNQPISLTSREYKLLELFMLN
FT                   KDRVLSRSSIEEKLSSWDEEISSGALDVHIYNLRQKLGKQFIRTVHGVGYALGQIEK"
FT   CDS_pept        417040..418395
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04800"
FT                   /product="sensor protein QseC"
FT                   /db_xref="GOA:E7A3N9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3N9"
FT                   /protein_id="CBY80660.1"
FT                   /translation="MKNRSLTLRLISVLCLTALFVWLGSTLVAWWQVRHDVNKVFDAQQ
FT                   VLFAERLANSDLSTILLESSTTLNKNSQSVLKKSYDDDALAFAIFSKTGKLLFSDGRNG
FT                   KDFIFNYKTGFYNANIYDDDDKWRIFWSMAANGELVIAVGQELDYREDLIEEMIFGQMW
FT                   IWFASLPILIIVLGWLIHKELRPIKRLSQEVQTRKSGDVSLLNTEGLPVEILPLVKNLN
FT                   QFFDRTSAMLQRERRFTSDAAHELRSPLAALRIQTEVAQLAGDDVALREQALLHLTQGI
FT                   DRASQLIEQLLTLSRLDNLQALETLQLLDWEAIVQSLISERYFVAEKRKITLVFEKETE
FT                   PKQKQGQSILVSLMLRNLLDNAIKYCPEDTIVSVKISSSQIIIEDNGGGVEPEDLKKLG
FT                   QRFYRPAGQNEKGSGLGLSIVMRIAELHGFKVRLENVVKEGRRIGLKAIISL"
FT   CDS_pept        418672..419035
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04791"
FT                   /product="predicted choline-glycine betaine
FT                   transporter,fragment (pseudogene)"
FT   CDS_pept        419171..419506
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04792"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P0"
FT                   /protein_id="CBY80662.1"
FT                   /translation="MMTCYVNLREQSYDQVKQTQETYKMTNFKMRTEQEIMMELALIAV
FT                   KEHDGFIVDGSQYSLPNECGQTFVYNTAFLDVRFVEDGRKDCVVRFTSTLAPFAPPFYC
FT                   LLSELED"
FT   CDS_pept        complement(419546..420391)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04801"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P1"
FT                   /protein_id="CBY80663.1"
FT                   /translation="MANQNTFKQAPLPFIGQKRMFLKHFETVLNENIKGDGEGWTIIDT
FT                   FGGSGLLSHAAKVIKPKAHVIYNDFDSYAERLAYINDTNALRTQIFAKIGNATPKNKRL
FT                   PKSLKAEIIKIIDQFKGYKDLNCLTSWLLFSGQQVSSLDELYKKDFWHCVRLSDYPSAE
FT                   GYLDGVEVIRESFHTLLPKFSDNPKALFVLDPPYLCTKQESYKQATYFDLIDFLRLVNI
FT                   TLPPYIFFSSTKSEFVRFIEYMVDDKVHNWQAFENAKRITVNAKLNYQVAYEDNLVYKF
FT                   "
FT   CDS_pept        complement(420743..421243)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04802"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P2"
FT                   /protein_id="CBY80664.1"
FT                   /translation="MIGTKIYLALYKGKKSGKKPKDLLARFSDWLTRKFTKGIYSHCEL
FT                   IVRKEEFLTGHHYEVEVIYDCYSSSIRDGGVRCKQIDVYDREKWDLIELEGVTEAQIKA
FT                   YFDRTLGCKYDWWSALGIVLGIKQKRSKYFCSEWCFNAICGGESGWRFSPNQLAAIFNK
FT                   EKS"
FT   CDS_pept        complement(421240..421842)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04803"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P3"
FT                   /protein_id="CBY80665.1"
FT                   /translation="MKVYFLKENLNSYQIFPIPQNLNDFVEMEAENESELETKQLIDFK
FT                   SQYILVDRQPTELHKWNGNSWVVDKKKKTEIKRELIKNLVDSIDDTAANISARWTRFAE
FT                   EYKEREAAAIAFKEANFAGEVSVYISSFATVAGLDNQSASLLILQQAESLRTLQQQLAV
FT                   QRMRKYELKHEALSDEELQRIHDDIIGKMQALAEAQQ"
FT   CDS_pept        complement(421854..423563)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04805"
FT                   /product="Probable tail fiber protein"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P4"
FT                   /protein_id="CBY80666.1"
FT                   /translation="MAGLNETNKWETEIYRIEENDPVHGGEDGITNKPIKQLANRTKYL
FT                   KTEVEKRYIAQNASTEQTGLVQLDSNTDSDAEDKAATPKAVNVVKALVIAVRNALNNYI
FT                   PNSKKSNADNSSSSDTIATSYALKKVRDIATKRATDTTAGQTVLSHKTNGTDKSKSASE
FT                   FALGELNKELAGKGVPLGAVVSFPKGMNPRGYLRAIGGTFNRATYPDLYVANGNSDILP
FT                   NLHRSDVGMTAYFAVDNIPTGWIAFDSIRTTVTQQNYPELYRYLVGKYGSISNVPLAED
FT                   RFIRNASNNLSVGETQSDEIKKHVHKVRTHWVNSSDSNIFYDKTKTVIDSRLRTSTTTD
FT                   DNLSDNGFMHPLLDSPMATGGAETRPRAIALKLCIKAKNTFDDVQFWVKAFGVVENAGA
FT                   LDAGTLAQNMQALSESVEQKIEENKQSTLLEITNAKADINQQFLQAQENLSQIGTLKTV
FT                   WQGNVGSGQITISEKCFGKTLILYLQSSESHSLDDNNNIEIVSFEVGAEIEGKKGGRVR
FT                   WLDVREVNAHSNGGRATYYVEVKRFDVTVDRNGTTIQIQDLAGRFVKRIDIR"
FT   CDS_pept        complement(423595..424164)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04806"
FT                   /product="putative phage tail protein"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P5"
FT                   /protein_id="CBY80667.1"
FT                   /translation="MARLRYPDIIARDAKYTALAELGQRLPQFKLSPIMTTLVDLLDDR
FT                   FIEVLAEKWSVTGYDGLFLATTQESKKGLIKKSVELHRHKGTPWSVREVIRQLGFGEIE
FT                   IDEGLKNRDYSANTFVNKIPSDERWAYYGIQLSKPVTNEQAVEIRKILRNFVPARCLLG
FT                   VLDYKSAPVLYNNKVRYNKQYNHGSV"
FT   CDS_pept        complement(424157..425263)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04807"
FT                   /product="phage baseplate-like protein"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P6"
FT                   /protein_id="CBY80668.1"
FT                   /translation="MKADDVKIVSEDVKQILADTIADYEKRTGKTLQPAHIERSIIQSY
FT                   AYRELLVRKGINEAFLNTFPQFAKGLALDLCGEPMGCYRLQDKPARCVLRFSIEATHPL
FT                   VLIPKGTRVAVDEKLEFITLNDDVITPLITYVEIEAQANIKGPMGNGWEIGRVKTLKSP
FT                   LMTSLEVKVSNIDVPSGGLVQESDDDYRKRILSAPEAFSTCGSVAAYDYHVRAVSQAIA
FT                   DVNVATPKGGLVRITVLTKEGIPDSRLLNDIKQYVSGEKRRPLCDTVEVKAPTQRDYQI
FT                   TATLKLLDGFREDIVKTKARDALQFYLSDKTKKLGLDVVPSALISALRVEGVYDVTLTS
FT                   PQKIVVAENEWANCTAISVEVESERTNG"
FT   CDS_pept        complement(425263..425628)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04808"
FT                   /product="phage baseplate-like protein"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P7"
FT                   /protein_id="CBY80669.1"
FT                   /translation="MNTHTHLTTHWQLAPNDEVQSVIQGIDDIHLCIANILNTIKGTDI
FT                   LRPEFGSDHFRYIDQPEDLAVPNFVREITFALQRFEKRIEVDEVKVSGNAPHFTFTIFW
FT                   SLKEDVYREIYSTEVKG"
FT   CDS_pept        complement(425683..426291)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04809"
FT                   /product="phage baseplate-like protein"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="InterPro:IPR040629"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P8"
FT                   /protein_id="CBY80670.1"
FT                   /translation="MQTHNFTATYQEGIVSAVDSTKHKVRCKIPALDDLETAWLSYLTP
FT                   NAGGNQFYCLPDVGELVAIILDARGEGGCVLGAIFNAQDPTPTGDSNIWMKKFSNGTII
FT                   KHDRNSGNVEVSAVGEVLIKSPSKVTIDCPATETTGDLMVKGALTYMKGMTGYGGGGAT
FT                   AMINGSLETKGGDIKADNISLKTHKHTEQGDGKDTSIAK"
FT   CDS_pept        complement(426278..427342)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04810"
FT                   /product="Regulator-like protein"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P9"
FT                   /protein_id="CBY80671.1"
FT                   /translation="MSNIAQPDFSLFYEKTNITADIEPHLIELSYTDYLEGQSDELVVQ
FT                   FEDISGKWIRAWFPTQGDKLKGAIGYKGEQLVDIGAFEIDEVEYQYRPSNITLRALSAG
FT                   VSKNQRTLKPKAYEHTTLAQVIAVVAKRLKLKVVGEIKHIPIARITQYQERDLEFLARL
FT                   GREYHHSFKVVNDQLVFTAKEKLGESESVLTIEEQDTISISLRDRISSTAKEVNISGYD
FT                   ANGKKVIKKSKKAKAKREDVSQAAKSSEDSLQIVTRGESQEQIDARGEAALAEQNDDQQ
FT                   SGTIKLWGNPKLVAGNTILLRNLGVFSGKYLIKSSRHTIYRNQGYTTTIDVRLLEFIAD
FT                   DLVTQSMEKHNANP"
FT   CDS_pept        complement(427546..428478)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04811"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q0"
FT                   /protein_id="CBY80672.1"
FT                   /translation="MYLMLGTIALEPIDITDFSEIQAARFAEHQVLKGKPRLQAMGESL
FT                   AELNLSVRLHHKIGGVERRYQALLAAKAKQDALALIWGRGKFKGNFVITDIHSTTLFTD
FT                   KYGNVLCRELTINLKEYVGELKNNLLGAALNIGKGSLLGSILPPEFFAGMNAAKEALTK
FT                   GIDLYNQGKRIVDEVQNTIAIMKQFSQDPATALAYLPSVLGNLDGALGSFSELTGMREL
FT                   FNGVRSVLPVVSEFSQEVAEIQSGLMAIQSDFQQGSSGSDWSEWFPSANRTMSEVAESF
FT                   DFLAPRVAEMTAWIVLRNDDEVNNDTDRA"
FT   CDS_pept        complement(428478..431069)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04812"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR010090"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q1"
FT                   /protein_id="CBY80673.1"
FT                   /translation="MANNLVLGLVIGASLKGSFSAAFGKANKTIENLSNNLGKATQQNE
FT                   KLGAKMAKWQERQAALHQKMQLAYLSGDQNIGKLTRRYERMQAVIARTAEKQQHFTRAI
FT                   QSSEKAQRSLSSTLEKQQARKQNRDELKGKLAKSTAITASVALPTWNAVKTYMQQEEAA
FT                   NNLKISMMKADGTFGKFKEIGKIADQLGTDLPGTREDFYKLAKAMKMQGVSDDTLINSG
FT                   LKTSAKLNVLLEMDQEQGGEFFAKMMESHGLSEAELGASADDLQRAMFAAGMKKDDMYG
FT                   AMTYYASNVRSMKLTGRENSQKIYAIEGLAAQQGLEGTSFGTNFSTMLDRMSKGPQMIA
FT                   EAKKGMKAEARDILEKSGVKFNFWDKKGNFKGIDGMVKELEKLQKIRAKFGDQAAQDVA
FT                   DAMFGTEGKRVALLLGEKGTTGLQDFLQKMKDQASIEERVAQKTKTLGSALESLGGAWE
FT                   SAVGNIGSVFADDIKSGAKALQGFVEDTLTPFVSEHKTAIKWIATTVGGFSLLSTGVLA
FT                   TKFAFSGIASIFSAAFMPFKVFKAIKAAKELETLTGTVTKTGRVMKWLGSAFGVVKKAF
FT                   IGLGKALLTNPIGLTITAIAVAAYLIYDNWEPISAWFANLWTNVTTYFQSFCTWVQGIW
FT                   NSATEWVSSAWSGVSDYFGQLWNNITTFFNSGIGNITATILNWSPLGLFQQVFSTVLSW
FT                   FGIDVPAKFTDFGKNMIDGLVNGIRNAWEGAKQIVSDLGDGIKGWFAEKLGIHSPSRVF
FT                   MGFGENTVQGLAIGINKSLGLAEKASDEMSNAVGIFPHSDYQSLQTTFAQQQSEQAQHG
FT                   GMTIHFNPTINVNGSSNNQVLNDVKEGLNISLREFETMLARVLDQQKRRAY"
FT   CDS_pept        complement(431544..431828)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04813"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q2"
FT                   /protein_id="CBY80674.1"
FT                   /translation="MSQKVDAVRTTIKLSSPVQLPDGTTLEELKVREPLVKDFRTASQQ
FT                   GKTNEDREIIVAALCCGLVLEDMDLIKWKDYVQVQRFLFGSDDTDGDVK"
FT   CDS_pept        complement(431922..432440)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04814"
FT                   /product="Tail core-like protein"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q3"
FT                   /protein_id="CBY80675.1"
FT                   /translation="MSVAINQIINANVYMDGNSLLGKAKEFKLPDIEFEQIEHKGLGLV
FT                   GTIKLPSGIAALEGEVTWDSFYPEVRAKAYNPMKNVQLMARSNLQVFDARGLVAEEPMV
FT                   TIMNVSFSKITGGSLKNKEATEHADTFQVHSIKQTVGGKEIFFYDAFANILRVNGQDVL
FT                   QKYRTNIGQ"
FT   CDS_pept        complement(432451..433836)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04815"
FT                   /product="Tail sheath-like protein"
FT                   /db_xref="InterPro:IPR035089"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q4"
FT                   /protein_id="CBY80676.1"
FT                   /translation="MAFHHGTETKRVTGGSVAVETVDGAIIGIVGTAPIGPLNELTLCQ
FT                   TKKDFAKFGTILNQGFTLPDAFDVIARYAAGQVYVVNVLDVSKHKSEIQDESITLDETT
FT                   LLANTQKKGLLSLTLKSNSTPLTLNEDYWVDMQTGEIRLKVSKTSLTATYTYADPSKVT
FT                   EEDIKGGIESSTGKRKGFELLRDGFNLYGADAKILICPEFDKTASCASALGTLAEQLKA
FT                   VAYVQLPKGTSLSKAIQGRGPQGTINAKDSTERVRHFFPYALGSSNQLESLAVHAAGLR
FT                   MKVDVEKGYWHSTSNHQLLGVIGMELPLTARIDDIQSETNRLNAVGITTIFNSFGTGFR
FT                   LWGNRSSNYPTVTHIINFETALRTGDLIDESIRMVELQYIDRPIDDALIDSLTETVDTY
FT                   LRALPSIVGYSLGLDYDYDLVDAFSKGQVPIKYDYTPKLPAERITNTSVMTRKYLVNLV
FT                   SQK"
FT   CDS_pept        complement(433846..434343)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04816"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR018602"
FT                   /db_xref="InterPro:IPR035934"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q5"
FT                   /protein_id="CBY80677.1"
FT                   /translation="MSATQTILNSIQTHLLSQIDRFAIELFPDNPSEYFLRDESGAILI
FT                   QYAGSKFERINSTDIIQQRRTVTIALTVIARSQHNDDGALAILDQVRLAIVGFRPENCL
FT                   ACALINEEFAGEADGLWQYQLLVQTETWQVEQTKAVDLPKLANVYSRKPTDPLNPILQP
FT                   KS"
FT   CDS_pept        complement(434355..434789)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04817"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR009752"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q6"
FT                   /protein_id="CBY80678.1"
FT                   /translation="MYISAQDLTEVLSERSLIELSNDHSRATEYNPLVLDKACQYATET
FT                   VDGYLRSRYLLPLKSVPTIVRNICLQLARFWLYSRRPEGTGFPENVKDTYAQALKDLER
FT                   IQSGKLHLGLEELNENGTNALDDVAKFKTRANKKIDLTGY"
FT   CDS_pept        complement(434789..435106)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04818"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q7"
FT                   /protein_id="CBY80679.1"
FT                   /translation="MNKKMLYAVVGTMAILHNGKRYEKGDKIELTAEEAENLSLYIQLD
FT                   QSELEKQKEERRLAEEKAEQERLAAEKAQKEAEEKAEKERLVAEKAQKKTEEKTKGKAD
FT                   K"
FT   CDS_pept        complement(435172..436098)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04819"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q8"
FT                   /protein_id="CBY80680.1"
FT                   /translation="MSDLSKHRVVDPVLTELAQGYYNGNMISEVLFPIAETQKEGGKIP
FT                   TFGRLAFRLQTTKRELRAASNRLTPEDIGSLTVVLEENDIEYPIDIREVNEGEGVYPLR
FT                   QYATGVTQDVIVLNREKACADLALNEDNYDASNKITLSGTSQFTDKNSDPISVIKAGIR
FT                   AIKRATGRKPNVCAISGDVWEVLSEHPKVLEKIKYVATAVLTPEDFAKLVKIDKVIIGE
FT                   AVYEQSSELKDIWSKAIVLAYVAAASKEKKQNIYEPSYGYTVRRKNGLYVDTYTEVGGK
FT                   VEIVRTTDINKPYIVGKAAGYLIKGCI"
FT   CDS_pept        complement(436117..437220)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04820"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Q9"
FT                   /protein_id="CBY80681.1"
FT                   /translation="MNLIEIFKAGTRKDANGKEVTLTIEDLQQAVQSYNVEFHEAPAVI
FT                   GHPQHNHPAYAWVKRLELDGDILKAEFDQIDPEFAEMVDKGRFKKVSASFYLANSQANP
FT                   KQGSLYLRHVGFLGAMPPAVKGLRNPEFAEDEEGVVDFSDWTEATLWRRLRDWFIGKHG
FT                   QEEADKVLPDYLVGSVQEEAVRNSLQPQKAESPIFNEPTQQQGEPEMSAEEKAELERLK
FT                   AENQQLKDEKAQAEAQKAEAQLNQTKAENADFAESLVSVGKLAPVSKEKAIELLNCAAV
FT                   QSAGGVVEFGEGENILTAIKAFLEAQPQIIQFGEVATKDNATTTEDNTVEYAEGTSAEA
FT                   IDMDKRVRAYMKEHNVSYVTAFNAIHS"
FT   CDS_pept        complement(437463..437963)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04821"
FT                   /product="Mu G-like protein"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R0"
FT                   /protein_id="CBY80682.1"
FT                   /translation="MIKITLNDTQALAKLHSIAQQLQHPRKLYGLLGETLKKIHADRFK
FT                   AEVAPDGKKWQPLSSITRKIKGNDQILKQGGYLSQKTAYNYDDNRLEFGSDAKYARLHQ
FT                   FGGVIRPKKGKRLKFGKGSNTVYAKQSKIPARPWLGVNAQDEQKLLKKATALLQRQINQ
FT                   NLK"
FT   CDS_pept        complement(438541..439818)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04822"
FT                   /product="Mu GP30-like protein"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R1"
FT                   /protein_id="CBY80683.1"
FT                   /translation="MSKFTFQEQSRYFEKKLNLKTNSYLDVLGEEHDYFFVVAGANRNE
FT                   VINAFREAVDQAIHHGETLESFRQRFDEIVEKTGWDYNGGRNWRTRIIYDTNVYGAYNR
FT                   GRLQQHLDLADVMPYWEYQHNDNSHPRPEHVALDGTIRPATDQFWKYYYPIKAYGCHCT
FT                   VIAHDEHDLKAMGKQVSPPVEIEYEDKLVGVRSGSPRLVTLPKGYDVGFAPYNFDDLSS
FT                   SRNVEIDSILFQKLTTAEPRFASLLIQDVMKNTATVALLNHSMKEMVETVSNEKIARGK
FT                   MKYVGVIHDEVIDKLTAMDKAPQTAVIAVRDEDVLHALRDTKQAKGINLPIEFWEQLPE
FT                   KLRNPKAILFQPKESFNDKNAKDTLLFIYDTDHGKVAVKMDYEVKLRDQLTSKKFKANL
FT                   NVVKTASVIDEDLKKLQQFEVLWGEL"
FT   CDS_pept        complement(439819..441234)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04823"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR009279"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R2"
FT                   /protein_id="CBY80684.1"
FT                   /translation="MAKKFDLVKEIAVRSHAIDYFSMGQYLPNPDPVLKKMGRDISAYR
FT                   EVLSDSHVAGCVRRRKAAIKGLEWRITPTGNEKTDEILTALFERLPLPQIITEMLDAAL
FT                   FGYQVLEVMWENQNGLWLPAELIGKPQEWFVFDEQNQLMLRDKENRNGKLVPEKKFLLT
FT                   TQEANYTNPYGKPDLALCFWAATFKRGGFKFWLEFTEKYGSPWLVGKHPRQAQTHEIED
FT                   LLDSLEQMIGTAVAAIPDDSAISMLESASKGGSSQVFDEFLKYCKSEIAIALLGQNQTT
FT                   EQESNRASATAGLELTKEIRNEDITLVESGFNQLLNWICELNFNVETLPKFELYEQESI
FT                   DKVQVERDQILSQMGVKFTAQYLHRTYGFEEGDIELTVNNTPKTAEFNEPTLPSNIADG
FT                   VVEQLEMEGEPYVEDWMQTIKDRLSQAESLEDFRNQLDSLIPELNFAEYGELMAWASTT
FT                   AFLAGRQSVVEEK"
FT   CDS_pept        complement(441236..442558)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04824"
FT                   /product="putative prophage MuMc02, terminase, ATPase
FT                   subunit"
FT                   /db_xref="InterPro:IPR004921"
FT                   /db_xref="InterPro:IPR035421"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R3"
FT                   /protein_id="CBY80685.1"
FT                   /translation="MGLTTNTTPRTVLYNYQKRWLQDNSRFKVAMFSRQSGKTFTTTLE
FT                   IVLDCMACEARGEKTRWVILSRGERQAKEAINEGVKRHLEAVGIACQIMEVPFSPTINA
FT                   LEVIFPNGSKITALPANPDTARGFSANVFLDEFAFHQDSREIWKALFPVISADWKLRVV
FT                   STPNGKGNKFYELMTDLNNTEWSRHTVDIYQAVADGLPRNIEQLRKGLNDEDAWAQEFE
FT                   LKWLDEASSWLSYDLIDAVEHHQAGIPELYTGNPCFVGMDIAVRGDLTVIWVIELVGDV
FT                   YWTREVITLKRVALREQLAELDRVFNQYHVITCYLDQTGMGEKMVEDAQYSHGKRRVQG
FT                   VLFNVATKLNMATIGKNAFEDRQIRIPQGDTDLREDLHKLKKVTGSNGVPRFIAESDSK
FT                   GHADRTWACFLALTAAKEGVIMPIKAQSRKPRTSRKMTQGY"
FT   CDS_pept        complement(442542..443090)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04825"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR021874"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R4"
FT                   /protein_id="CBY80686.1"
FT                   /translation="MAPRSSIEQLPEDVRRWLERALTENGFAGYVELEKLLKDKGYSIS
FT                   KSAIHRYGQKIEGRLKAIKESAEIAKLITESVDDDGDSQSDALMRLVQTDLMNILIESR
FT                   NTEELSVKDKIKLFGNIGKNIAAMTSASVKLKQYQAEHKAKLLAKLDEMAKNAEQEGND
FT                   MPTLERVRKGLLETYGLNN"
FT   CDS_pept        complement(443100..443402)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04826"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R5"
FT                   /protein_id="CBY80687.1"
FT                   /translation="MMEKARREGMRWQLLNVLHKAMPYTTSEQFLLDVIRGIYPNVTAL
FT                   EIRQQLEYLQDRKLISIDKQPHGVWFADIHRLGVDIVEYTIDCQAGIARPEKYWA"
FT   CDS_pept        complement(443399..443707)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04827"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A3R6"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R6"
FT                   /protein_id="CBY80688.1"
FT                   /translation="MTINVEFWHLVGLLISFLGCCFGFAKMLVAQFQNSLSERHHNQMK
FT                   VNDKVEDIEKQLNQMQSALPLNYVLRDDYIRGQAILEAKMDALHKTLSDLYKMESTR"
FT   CDS_pept        complement(443704..444087)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04828"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A3R7"
FT                   /db_xref="InterPro:IPR020274"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R7"
FT                   /protein_id="CBY80689.1"
FT                   /translation="MNLQVIVVCTTFFILLCGYVFFRLKQAQRRVEKLIEENAQLQTEK
FT                   AVAQTQVKHHQVRQKNEENIVSSSRERIIDSLHNKTISVINPSCSGFRLIKASRQDSTE
FT                   TLRQILVHNQTYREICPIQGEKK"
FT   CDS_pept        complement(444554..445090)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04829"
FT                   /product="N-acetylmuramoyl-L-alanine amidase-like protein"
FT                   /db_xref="GOA:E7A3R8"
FT                   /db_xref="InterPro:IPR002502"
FT                   /db_xref="InterPro:IPR006619"
FT                   /db_xref="InterPro:IPR015510"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036505"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R8"
FT                   /protein_id="CBY80690.1"
FT                   /translation="MAIHHIVIHCSATTNGKPLRTSSQSAAERIDEWHQKRGFKRNPTY
FT                   IKRFNPHLKHVGYHFIIDTNGTVETGREVGETGAHVKGHNQNSIGICLVGGITGMGKNH
FT                   GEYTRKQWQALHKLLRKLESRFPSSRICGHRDLSPDLNGDGTITPNEWLKDCPCFDVWE
FT                   WLDSEQVINDEHLFE"
FT   CDS_pept        complement(445177..445596)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04830"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3R9"
FT                   /protein_id="CBY80691.1"
FT                   /translation="MKKWLVITLMMLGITACGEPEDPNAPTQAEKDTLTLAFINKIKKD
FT                   SSGAVECKTKQVNNRYYVGCALISLDGRGNTYIFLYNKDKDPVKRFYALNGTAMTIYDN
FT                   YFKNESLLGSYKDTFGLPMEKDIDLSLIQKSFEEK"
FT   CDS_pept        complement(445670..446044)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04831"
FT                   /product="Probable bacteriophage transcriptional regulator"
FT                   /db_xref="GOA:E7A3S0"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014875"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S0"
FT                   /protein_id="CBY80692.1"
FT                   /translation="MSTNADIFDEKAPEILADLAKHIETQLLTKVKSNEFNSELAKQIG
FT                   IEVASHIAQSWGGEVIYIPRNLVLLLSERDRKIFNEFNGSNHRELARKYNVSMQWIYQI
FT                   VKKVTKEEIARRQFDMFSEK"
FT   CDS_pept        complement(446048..446536)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04831"
FT                   /product="Mu-like phage E16 protein"
FT                   /db_xref="InterPro:IPR009363"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S1"
FT                   /protein_id="CBY80693.1"
FT                   /translation="MRYTKAKYIQLIHIAKHKLSIDESTYRSLLMNLTGKSTCKQMKVT
FT                   ELDKVLSALETKGFQNNAASFHKKTHTSNYHSPSSGKAVVKHDIALKIRAVWIDMSKQG
FT                   FLRDGSEEALNQFVRNVINPILKPEKLMVLGVAALDYRQGTIVLERLKKWREREINRS"
FT   CDS_pept        complement(446717..447070)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04833"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S2"
FT                   /protein_id="CBY80694.1"
FT                   /translation="MANIPLAKIIKFSAHKYLVIDGIAQTENARKSPTGNQCHNHRRNK
FT                   LWLNIYIVTHWKVTILQTMMMEIYGGMKVCVLMMSLYISRKKTLMPGICLKNRNEKLCM
FT                   YGEMVILRTDCVF"
FT   CDS_pept        complement(447168..447542)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04834"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S3"
FT                   /protein_id="CBY80695.1"
FT                   /translation="MQTKIIQWLADDENVGLSSKCMAFVIGFDVIPRRKSYPLDPSDLS
FT                   RCVKLLERVPKMRDYLYKMKEISPIWAKLVEHWDELERLLNEEKGSGRCPKTYQLMKKL
FT                   TEDDQNVVFRHGGFSIRRGK"
FT   CDS_pept        complement(448300..448818)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04835"
FT                   /product="Mu nuclease inhibitor Gam-like protein"
FT                   /db_xref="GOA:E7A3S4"
FT                   /db_xref="InterPro:IPR009951"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S4"
FT                   /protein_id="CBY80696.1"
FT                   /translation="MAKKATRIKTDTFAVRYQTRDEVEVAIKEIGDLNRELERLAIEQN
FT                   DKLAAITEEYAPLMNAIKEKLVPKQDAVQAWCESRRDELTQNGKTKTGSFNTGEVQWRQ
FT                   RPPSVGIRGAESVLESLRTLGLVRFIRTKEEVNKEAMLNEPELAATVAGVTIKTGVEDF
FT                   VITPFEQDI"
FT   CDS_pept        complement(449043..449495)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04890"
FT                   /product="Mu phage DNA transposition protein B"
FT                   /db_xref="GOA:E7A3S5"
FT                   /db_xref="InterPro:IPR009084"
FT                   /db_xref="InterPro:IPR036733"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S5"
FT                   /protein_id="CBY80697.1"
FT                   /translation="MIVEKLTGTRGIVIVDESDHLTYDAIEELRYIQEKAEVGFALIGN
FT                   DRVYTRMQGGINPAHEHARLWSRLGNRCAIKASEKEDIQSVAAAWQLDTKDKELMKALY
FT                   DIGTKAGGLRALTQYLRLAGIAAKGQGVAINLDLILQAKMHMQGAI"
FT   CDS_pept        complement(449543..449959)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04910"
FT                   /product="Mu phage DNA transposition protein B"
FT                   /db_xref="GOA:E7A3S6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S6"
FT                   /protein_id="CBY80698.1"
FT                   /translation="MTLTQQIQQILERKNITQRELSQQIGMSAGALSAYLKGTYAGNIE
FT                   NIENALENWLKNQDKKIRSFIEAPEFIQTPTAERIFNALEMARFATTIVPIYGASSVGK
FT                   TKACQEFKKQNQNVWMITISPSRASLNAFYMNLP"
FT   CDS_pept        complement(449986..451995)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04940"
FT                   /product="Transposase"
FT                   /db_xref="GOA:E7A3S7"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR004189"
FT                   /db_xref="InterPro:IPR009004"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR015126"
FT                   /db_xref="InterPro:IPR015378"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S7"
FT                   /protein_id="CBY80699.1"
FT                   /translation="MKNWVTAKEIAGIGGLSKHPTNVNRLARKEKWIFREIQGVQGGGY
FT                   EYSFSSLPLEVQTEYLLKHSEELKVNKENNDSNQQTMIESAWNVLASATFEQEKRAERR
FT                   FQAVVKVARLVENKIPLMKAFEQVVALYATDSNDETISKGSLKRWWYKVKTHPQGIWLP
FT                   LLLDRTERDNSCRWADISDKAWAFFCADYLRKSKPKFSVCYYRLTLAAEENDWTIPSLS
FT                   SLKRKFYNEFTEAEIALARGGEHELRELTAPQIRTVMDLEAYEIVNGDGYQHNVFVDWY
FT                   EDGRPPIRPKTWFWQDVRTRRILSYCVDDSENGDQIRQATLRMIKQYGIPKTILMDNTR
FT                   AASDKQTTQQRKRGKRQTAGIKIDGMFDRLGIKVIRTLVFKGRGNGRAKPIERAFKRDS
FT                   LPAYVDGDARLEAFFTGWSVTEKTEDYQFKKGVNKALFLEILEQGVRLWNDKAGRETEL
FT                   GQGIFSADQLWARDYAQTRQTFATEEQLRQLMMLGESTKVDKHGRFTLKAGYVLNNQKN
FT                   VYEAQALIGGNVGSVIVRYDPDDLHGTVHIYDQNGVYLCNGECVEKIAFNSEEGARVQK
FT                   RLINEQRRITKKMVDNHEKLSEHEMAQYRKQFEQSAADFVEPAEKQVFSWTQFADGNTV
FT                   KTIKLDHELETETEEQNTLSFEQDLFNGLKQVQK"
FT   CDS_pept        452444..452944
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04970"
FT                   /product="CI repressor-like protein"
FT                   /db_xref="GOA:E7A3S8"
FT                   /db_xref="InterPro:IPR003314"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S8"
FT                   /protein_id="CBY80700.1"
FT                   /translation="MKSKKEWYLPRDLAGLGDLSPFPSNVTRKAKQEGWIKREAKGIKG
FT                   GGFEYHYSSLPPAVQQALGFKPNEAKKEPLPAARVGERLKEIDRIMAAISSLEAKVKEL
FT                   EEPTLDSLPDTLDQAEKRLVRWFRQCNKDRQAMLLSSAEVLADMSLKEQKESSEPLENC
FT                   EVA"
FT   CDS_pept        453283..455061
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_04971"
FT                   /product="Predicted choline-glycine betaine transporter"
FT   CDS_pept        complement(455106..456581)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05000"
FT                   /product="Probable cytosol aminopeptidase"
FT                   /db_xref="GOA:E7A3S9"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3S9"
FT                   /protein_id="CBY80702.1"
FT                   /translation="MKYQAKNTALSQATDCIVLGIYENNEFSKSFNEIDQLTQGYLNNL
FT                   VKSGELTGKLAQTVLLRDLQGLAAKRLLIVGCGKKGELTERQYKQIIQAVLKTLKETNT
FT                   REVVSYLTEIELKDRDLYWNIRFAIETIEHTNYQFDHFKSQKAETSVLESFIFNTDCDQ
FT                   AQQAISHANAISSGIKAARDIANMPPNICNPAYLAEQAKNLAENSTALSLKVVDEEEMA
FT                   KLGMNAYLAVSKGSENRAYMSILTFNNAPDKNAKPIVLVGKGLTFDAGGISLKPAADMD
FT                   EMKYDMCGAASVFGTMKAIAELNLPLNVIGVLAGCENLPDGNAYRPGDILTTMNGLTVE
FT                   VLNTDAEGRLVLCDALTYVERFEPELVIDVATLTGACVVALGQHNSGLVSTDNDLANAL
FT                   LQGATETTDKAWRLPLSEEYQEQLKSPFADLANIGGRWGGAITAGAFLSNFTKKYRWAH
FT                   LDIAGTAWLQGANKGATGRPVSLLTQFLINQVK"
FT   CDS_pept        456689..457783
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05010"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="GOA:E7A3T0"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T0"
FT                   /protein_id="CBY80703.1"
FT                   /translation="MILIRYLIKEVFKSQIAILLILLLIFFSQQFVRVLGAAANGNVPA
FT                   DLVFSLLGLGMPTMAQLMLPLCLFIAILLTFGRLYAESEITVMRACGVGQRILVKVALL
FT                   MSLLTASIATYNALWLSPWAIQKQANIVEDAKANPTMGVLSSGQFISTSNNNVVLFIDQ
FT                   IKDNQIHNVYLFQITPKKQIKPSVVTAEKGELIALPNGDQVLNLKNTQRVEGTSVLPDF
FT                   RITHFDEYQAYLGHQETENNADEAAELTLVQLIQQDSPAAKAELHWRITLILAVPLMAL
FT                   IAVPLSRVNPRQGRFAKILPALLLYLIYFLLQSSFKSAGGAGKLDTAIFMQLVNIGFLL
FT                   LGIVLNGWDSTVIYKFRHLFSKKG"
FT   CDS_pept        457789..458865
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05030"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="GOA:E7A3T1"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T1"
FT                   /protein_id="CBY80704.1"
FT                   /translation="MMNTLDRYIGKSILGAIFATLLTLVGLSAIIKFVEQFRSVGKGTY
FT                   DIWQAVAFTGLTIPKDIETFFPMAALLGALIALGNLASRSELVVMQSAGFSRFKIGIAV
FT                   MKTASPLVLLTMMIGEWGIPQTEQFARDMRAKALSGGSILSIKNGVWAKDGHHFVFVRR
FT                   VTDDTKLDDIYIYTFEQQHNLIKLKHANQASYSEDEAKWTLRQVNHSTITKDEIITTNH
FT                   LSETWETSLTPDKLGAVSLRPTSLSISGLYHYISFLRETGQDVSRFELTFWRKIFQPVS
FT                   VGVMMLLALSFIFGSLRSVTAGARIVTGICVGFLFYVVNEILGQTSVVYGIPAIFGALI
FT                   PSLLFIVMIWWLLSRKRD"
FT   CDS_pept        459059..461329
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05040"
FT                   /product="5-methyltetrahydropteroyltriglutamate-homocysteine
FT                   S-methyltransferase"
FT                   /db_xref="GOA:E7A3T2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T2"
FT                   /protein_id="CBY80705.1"
FT                   /translation="MTTSHILGFPRVGAKRELKFAQERYWRKELAEQDLLDLAKALREK
FT                   NWKHQAAVNADFVAVGDFTFYDHILDLQVATGAIPARFGFDSQNLTLDQYFQLARGNKD
FT                   QFAIEMTKWFDTNYHYLVPEFQKSTAFKANPAHYVNQIREAKALGLNFKPVIVGPLTFL
FT                   WLGKEKGEAFNRFDLLNQLVPVYVEILNALVAEGAEWIQIDEPALALDLPAEWVEAYKS
FT                   VYAELSKVNAKLLLATYFGSVAEHAELLKDLPVAGLHLDLVRAPEQLAAFEDYSKVLSA
FT                   GVIEGRNIWRANLNKVLDVLEPLKAKLGERLWIAPSCSLLHTPFDLEVEVQLKEKNTAL
FT                   YSWLSFTLQKVEELNVLKQALNNGRASVQAALDASQAAADARATSKEIHRPEAAERLAN
FT                   LPKGADQRKSPFAERIVKQNAWLNLPLLPTTNIGSFPQTTEIRHARASFKKGELSLADY
FT                   EAAMKKEIEYVVRRQEELDLDVLVHGEAERNDMVEYFGELLDGFAFTKFGWVQSYGSRC
FT                   VKPPVIYGDVTRPEPMTVRWSQYAQSLTNRVMKGMLTGPVTILQWSFVRNDIPRSTVCK
FT                   QIGVALSDEVLDLEAAGIKVIQIDEPAIREGLPLKRADWDAYLQWAGEAFRLSSMGVQD
FT                   DTQIHTHMCYSEFNDILPAIAALDADVITIETSRSDMELLTAFADFKYPNDIGPGVYDI
FT                   HSPRVPTAAEVEHLLRKALNVIPKERLWVNPDCGLKTRGWTETIDQLKVMVDVTKKLRA
FT                   ELA"
FT   CDS_pept        complement(461550..462293)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3T3"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T3"
FT                   /protein_id="CBY80706.1"
FT                   /translation="MLEFGKLLTALIAPPLNTFVLLIIAAIIYCVHFKKLAKFIALISF
FT                   TWLYIMSAPFTGLLLTDNDDIPALTLDEYKQAQAIVILGGGSYPTKELYAETASGAPQL
FT                   ERLRYAAFLQKETGLPILTTGYSLIGISEGDLMAKELNQFFNVPTQWIENKARNTEENA
FT                   SFTKNILIKDHIQKIILVTNQWHMKRAKYLFEKQGFDVLPAAAANYGSKGNLSAKSFIP
FT                   DLGALNSNMVLLKEWIGYWKAHYVE"
FT   CDS_pept        462428..463633
FT                   /transl_table=11
FT                   /gene="lsgA"
FT                   /locus_tag="HIBPF_05060"
FT                   /product="Polysaccharide biosynthesis protein"
FT                   /db_xref="GOA:E7A3T4"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T4"
FT                   /protein_id="CBY80707.1"
FT                   /translation="MKVFKDSVIYLVGELSSKLVPFLLLPYLSRKLGVEGYGSLSYYQT
FT                   FLSLFLIVVSLTQEGAISRYFYFYGKRSLNLVVNTGYAYTTIIGCIILMGCWIAQSEIL
FT                   FYAALSSIFQSFLNVQLSVRQCQKKAWSYAFIQFSLTVTGAVFTVALLEYYQNDLVEKR
FT                   ILAILLSNLVVWFFSYFLYRKSAISKKYQFKHYQSALFYILGFGLPLILHYASFFLKGQ
FT                   LDRIFIYHKFSETDLGLYAMGAQLALIFSIAIQALNKAIIPYFYEALKQKKLVIQQLHK
FT                   WALFSFLLIPIPALIMWIIPEDVLVWILGSQFVGMKYYFILFLISTTLSIPYLILVNYL
FT                   FYYGKNKLISQCSVLSTIIYVASLVALTFTEIKYIPYAGIIGSLSIIPILYFMTSKVSK
FT                   TL"
FT   repeat_region   463381..463395
FT                   /note="TTATT x3"
FT   CDS_pept        463630..464544
FT                   /transl_table=11
FT                   /gene="lsgB"
FT                   /locus_tag="HIBPF_05070"
FT                   /product="CMP-N-acetylneuraminate-beta-galactosamide-alph
FT                   a-2,3-sialyltransferase"
FT                   /db_xref="GOA:E7A3T5"
FT                   /db_xref="InterPro:IPR012477"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T5"
FT                   /protein_id="CBY80708.1"
FT                   /translation="MNLILCCTPLQVLIARKIIELHPNEQFFGVMFGGVWDKKRTLYAS
FT                   KLAEVCSDSMNIDTGKDLKGFDFLKLMRQLKNKITHKGFDKVFLANLNSLWLQTYLSHV
FT                   SFKELYTFDDGSDNIFPHPNLLREPDTFKYKLIKAFIGDKYSVNKLFKKIKKHYTVYPN
FT                   YKNIVSNIEPISLWDNQIDCEIDGEVSFFIGQPLLNTKEENISLIKKLKEQISFDYYFP
FT                   HPAEDYRVDGVNYVESELIFEDYVFKHLSNKKIIIYTFFSSVAFNLLSHPNVEIRFIRT
FT                   SIPRWQFCYDSFPDLGLTIYKEI"
FT   CDS_pept        464546..465607
FT                   /transl_table=11
FT                   /gene="lsgC"
FT                   /locus_tag="HIBPF_05080"
FT                   /product="putative UDP-galactose--lipooligosaccharide
FT                   galactosyltransferase"
FT                   /db_xref="GOA:E7A3T6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T6"
FT                   /protein_id="CBY80709.1"
FT                   /translation="MKKIGFFIMNIESAGGTERVPINVANTLAKQGYDVSFISIGGNKP
FT                   FFQVDEKINIYAMNKLPYSLKKDYFSITKKLRELVKELQLDTLIVVDGAIMLFSALALV
FT                   NLNIKHILWEHYSFNFTGNRLVRTLGKYLAVTTCDKIVTLTEAEKTLWQEKFKTNNIIT
FT                   IANPNTLLPKNKLAKWENKTILSVGHLFSYKGFDYLLKVWQVLAKKYPDWNLKIVGSGE
FT                   EEENLKNLAKVLDIEDSVNFIPRTNDVSFYYESSSIYCLPSQTEGLPLVVIEAMAFGLP
FT                   IVAFNCSPGVKQLVEHKENGFLCEKNNIEEMVKGLDLLMNNPELYLQMSDKSRLMSEDY
FT                   GIEKIIEEWKAIL"
FT   CDS_pept        465619..466392
FT                   /transl_table=11
FT                   /gene="lsgD"
FT                   /locus_tag="HIBPF_05090"
FT                   /product="putative UDP-glcNAc--lipooligosaccharide
FT                   N-acetylglucosaminyl glycosyltransferase"
FT                   /db_xref="GOA:E7A3T7"
FT                   /db_xref="InterPro:IPR002654"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T7"
FT                   /protein_id="CBY80710.1"
FT                   /translation="MLKKYLISLDKDIQRRKLFFSQKNTEDFQIFSAINTMQKNWDELA
FT                   AIFNIEQFKAYYFRNVTKGEIGCTLSHLSVYQKIVEDNDIAEDSYALVCEDDALFHQNF
FT                   QQNLTALLSEKLEAEIILLGQSKINNFNDTDLEINYPTTFSFLCKKTGNVNYAFPYKSY
FT                   FAGTVGYLIKKSAARRFIQQISQNKPFWLADDFLLFEQNFNIRNKVVRPLMVIENPVLI
FT                   SNLESVRGSLSNNLFKKLMKYPLKKIFAIKKNLAN"
FT   CDS_pept        466404..467288
FT                   /transl_table=11
FT                   /gene="lsgE"
FT                   /locus_tag="HIBPF_05100"
FT                   /product="putative UDP-galactose--lipooligosaccharide
FT                   galactosyltransferase"
FT                   /db_xref="GOA:E7A3T8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T8"
FT                   /protein_id="CBY80711.1"
FT                   /translation="MLSIIVPSYNRKAEVPALLESLTQQTSSNFEVIIVDDCSKDPVEV
FT                   TQSYPFVVKVIRNETNQGAAESRNIGARASKGDWLLFLDDDDRFMPEKCEKILQVIEQN
FT                   PDINFIYHPAKCEMVNEGFTYVTQPIEPQEISTERILLANKIGGMPMVAIKKEMFLKIG
FT                   GLSTALRSLEDYDFLLKLLQEPSFTPYKINEPLTYCTFHTKRSSVSTDTTNTQKAIDYI
FT                   REHYVKTVEQARNFDINASYILAYPHIMNLSRKATKYYFDIFKKTKSIKQFIITLVILI
FT                   SPKLAINLKRLGN"
FT   repeat_region   466653..466663
FT                   /note="GAT x4"
FT   CDS_pept        467290..468093
FT                   /transl_table=11
FT                   /gene="lsgF"
FT                   /locus_tag="HIBPF_05110"
FT                   /product="putative UDP-galactose--lipooligosaccharide
FT                   galactosyltransferase"
FT                   /db_xref="GOA:E7A3T9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3T9"
FT                   /protein_id="CBY80712.1"
FT                   /translation="MKFSVLMSLYIKENPQFLRECFESLVAQTRQADEIVLVFDGVVTP
FT                   ELESVVTEFETKLPLKLVKLPQNRGLGKALNEGLLHCAYDWVFRMDTDDICVPYRFEKQ
FT                   VAFIEQHPESIIFGGQIAEFGKNVNDIVAYRNVPTSAQEIIKFTQKRCPFNHMTVAYQK
FT                   SAVINCGGYEDLQEDYYLWIKLVAQGLYMANLPDILVYARVGNGMVSRRRGVNQAKAEW
FT                   RLFKLKYRLGIQGLLSGLFTFALRFGSRLLPTSLLKKLYQTFLRK"
FT   CDS_pept        468211..469344
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05120"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A3U0"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U0"
FT                   /protein_id="CBY80713.1"
FT                   /translation="MKKNMYTQSINQPTRNYGIDLLKILAMFMITILHTQGHGGILWGG
FT                   RLTFDQAHFFSSNYAWAWGLEILCYGATNCYAMISGYVNWKNPIRYEKIVNLWVQVVFY
FT                   TLSITMAYSWINNVTTAQWFRAFFPVMTYQYWYITAYFGLCLFMPILNKYLQQTSNKTL
FT                   YLHMGLIFIFISLLPAFIGGDPFILNAGYSTLWIIVMYLFGATLSRIQSASVPVSGLLW
FT                   FSLLILGTWYYKMRIDYANIWNNAELSMPNLVDYRSPSIVLASALLLFCFAKIKIKRLF
FT                   LGKTIVLISNATLGIYLIHEHPFIRENFIVNYAMHFANKPTLTMVLSIFSGALSIFFIC
FT                   LMIEILRRFLFKLLAINLFIKKLQKKLLQNFLIKRKK"
FT   CDS_pept        469341..470897
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05140"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U1"
FT                   /protein_id="CBY80714.1"
FT                   /translation="MNLKKYVLYSPSQPAELAEFLQQENGVEFTPIKGVQVEEINALAA
FT                   NHLFDVEKFYRYFNRTPFNDEIAHTYSHLQLWQIIAKDNELDENGYALIAESAVRFSSL
FT                   FQHFVELYIEKYPYDIIKLQRNGVAKATLNPELPELGAVIYHNPAELDGYGCAFYLIKK
FT                   SVIRQLLAQYQSHKPFWKADYFSLFYALEKIVEITQFLGDVAVNISPKLSPFFSIIIPV
FT                   YNTEDYLAQCLDSVLMQDYSHYEIILVNDGSSDHCANIAFQYSQAHSNITFVNSRNQGV
FT                   AAARNSAMKLATGNYLMFMDSDDYWADAHYLSQCHNLLEQQPQLDLVLTSYCTFSQQNG
FT                   EYSRINNMDNLHQYSFGQDFVKDYYHLVKHSLYLGFPSIKIIKRDLIIENQLFFPKNKV
FT                   FEDVYWSIELSYFIRRYAILPVQNYVYRIERNGSITRFVSPDSFLDLLDVARHQIHQLE
FT                   SRKTTHSALYDGNVLFLTGLHQYILKSHNLLTESQQAQVESKYQAYLKVHHQFLSAFDE
FT                   H"
FT   CDS_pept        complement(470944..471552)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05160"
FT                   /product="Unknown protein, no known homologues"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U2"
FT                   /protein_id="CBY80715.1"
FT                   /translation="MKYNCLPVAAVEIKGDKRFLIQNELVEGFHISRNHRDEKLVNYRF
FT                   LYPQQYYTQGRDYALSGNQDYELTKESLLVFPPESHHLTLELLCAFANGGYFFTKIEES
FT                   GEMFKVDSLWLEVSGFSQITLRNPHQHNVRLLYGYQSIVGYAPCSEVKICFAHSDFHPQ
FT                   MGSVYFVDLAPNESLSFCTRELDRDGKRIRWFFDNLRLI"
FT   CDS_pept        complement(471699..472169)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05180"
FT                   /product="Unknown protein, no known homologues"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U3"
FT                   /protein_id="CBY80716.1"
FT                   /translation="MKNLILTALNDDSALYYDNFIPFCLSLKQTDYQDEVGVIDYGMSE
FT                   LKKDRLHRQGIKIFPASNRVTELLLDRHLSAADIAKKYNYDNVAVYDADIWFPNPHLSL
FT                   FKTIENSTALFAAQDVWFCSFISACIKEQNKEEIINKINILSKKTVGFGNTG"
FT   CDS_pept        complement(472172..473308)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05200"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U4"
FT                   /protein_id="CBY80717.1"
FT                   /translation="MRKYKIGITLNLEEKKSDIWSNGANQNVIFLYDLFKRLDIVEEVY
FT                   LVSWGATNETTPPKGFMMENMNLNCAYIFDVIDELDILIEGGLSIEPVLSDRMHAHGGK
FT                   VVCYKMGNDYVMDIEYVLFNQKPGRIFNGATFDAVWIIPQNENTGRSYLSIMLNCPVYQ
FT                   VPAIWAPTFCDLVINHLKTEHNIEFGYRPNLSREKWRIASFEPNTFVIKSCFTPILICE
FT                   QAYRTAPEKFEHYYVTNIYDKKDHPTFFNFIGRTQMVRDGIMSVESRYQMPDFLTRYTD
FT                   IVLAHQWENGLNYAYNDALYGGYPFIHNSRLLPKGVGYYYDQFDAFEGAEVLLDVMENH
FT                   DKQHADYLKRANDYLDSLLPSNPINLYLYEKEIKRLFE"
FT   CDS_pept        complement(join(473312..473893,473893..474525))
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05220"
FT                   /product="putative glycosyl transferase"
FT                   /db_xref="GOA:E7A3U5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U5"
FT                   /protein_id="CBY80718.1"
FT                   /translation="MKKILVVHPALVLGGAESVLIDFLKILGKYSDQYNVELLLLENRQ
FT                   NHRIDEIPFSISISYGLTGIESEFLIYCINHMNENPHYFESWRHGCINKVNRKLSKKLT
FT                   EQHYDLIIDFQSSELHFGDYLFEHHVNVPVIRWCHGKVHIDIWRGNPDFYPHIFRQYAG
FT                   IISIADEMKTLVDSYLQEINLHDKVQSMRLYNPIDEYSIHQKAEFRGGGYLLGGIFDVS
FT                   DEPFLLHVSRFSSVKNALELVDIYAVLKHKGIQEKLYLIGEGDQSPAIKARIIELGLEN
FT                   DCIMLGRKDNPMPFMKKAKLFLNTSLDEGLPTVFLEAMELGTPVVSYACPTGPRDILDN
FT                   GKYGALIPMGEQQTFIEKTYELLTTPALYQHYVDLLPEAMTRFHQITIEAQFIDLIEHF
FT                   IKKEE"
FT   CDS_pept        complement(474529..475671)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05260"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U6"
FT                   /protein_id="CBY80719.1"
FT                   /translation="MKARYKIGITFNLEGENQDIWSNGLNQNVVNLYLLLEQSEIVEDV
FT                   MLVCFGPQNQTVPSQGFMLDKLNLKFALLDDVIDELDVLIDGSLTIEAWQVDRMHAHGG
FT                   KVVCYKMGNDYIMDVENVLFNRATGKVFNGKSLDMIWTLPHHENMCRSYFEVMYRCPVQ
FT                   VVPWIWSPVFVDQLASHLKENHDVHFGYRPDPTKSGKRISCFEPNIDVVKTCFTPILIC
FT                   EKLYREQPEALQHVYICNVYDKKDHPSMHNFIGWTDLVANGVLSVESRYQLPDFMARYT
FT                   DVVVSHQWENGLNYAYNDILYGGYPFIHNSRFLPKGVGYYYDEFDAEAGKKLLAKVIAE
FT                   HDQHQTEYQARANEYLDSLLPSNIVNIKKYEREILRLFEI"
FT   CDS_pept        complement(475724..482281)
FT                   /transl_table=11
FT                   /gene="tabA2"
FT                   /locus_tag="HIBPF_05270"
FT                   /product="putative trimeric autotransporter adhesin"
FT                   /db_xref="GOA:E7A3U7"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U7"
FT                   /protein_id="CBY80720.1"
FT                   /translation="MNKVFKVIWNKATQRLEVVSELARSQGKAAVTTDHHVSAGGGGIA
FT                   SAKGKPSFTLTLLALSILMLSSKAFAELKYGPVYSSGAQWGQFVFGVENTATGSVEQNN
FT                   QKLPVIVGVGNNAGTDAASENGATVNIFGRHNKANTGKTVTIVGNYNNVTKSTSEANKA
FT                   KLFIAGNNVSVANPPELGLYIGNNVTANASPISIGNNVYSEIGGSSIGYNVEVRARKPN
FT                   GNQSQYLDNDAGFAVGSNILGYGNHLFLGRNLNLTEKVANTGTANNKESVYIGQNITTK
FT                   GARHSVLVGYGIKSNDDVGHNSVAFGTNITLGTTNSQTQDLTAIGSHITATAKRAVALG
FT                   SKVNVSAEDAAAIGTNATAANKGDVVLGAESVTTTSTNSNLSDWNVAGENLKTSYDQDN
FT                   IRQTSGKGVVSVGSSTVKRQIKNVAAGDVSASSTDAVNGAQLYALSTKVGLFKIKAGKE
FT                   ETELTSSTDKLIKFKSENDNIVVSATASDNTVKFKLGDNLSVTTVTTSGAITANGGVNA
FT                   NGVQIGQNGVAVNANNKKIIGLTDAELTTTSTDAVTGKQLNQTNQNVTAAASTATSALS
FT                   KAEQASTAASTATAVAQDAKNTASTAKSTAEQAKSDASSALTKATALENQTGYLHVNST
FT                   KTGNKGKYNETAGAIGTDSIAIGPNATASNKSSIAIGDESKTTIFEYAIALGSNATATG
FT                   LNATVIGRNAKTRHANSDAIVVGTNATSANTSTVVIGKDAKASGQSSISIGQESNSTQS
FT                   ASVALGYRVSATNTNATAIGSYSNATGTNSVAIGSARASNVSTTAIGQGANASGSSGTA
FT                   VGTQANATAGSSAAFGQRANATAKASLALGYQAQAKGEWASAVGPDSKAIANFSVAIGN
FT                   LATASKNQTIAIGRSAEASKENAIALGYNTRANIKDGDIALGNGSITAAQHDAIFSLNN
FT                   KKISGFVLGSDQGVLSVGSSNVRRQIQNVGAGAITATSTDAINGSQLYHVATELNTLAN
FT                   KAQDEATKASAKATALEGRKQVFKVQNGRTENTPKDSNAKEWTLGQDNEITFGATSDLI
FT                   VSTDSNGNIIYGLSQTAKNSISSAAAAAETVTNTLNEINTQVSTAKSYASSAASSASVA
FT                   STSASVASTSASAASTSASAASTSASAASTSASAAASSATAASSSAQQASSSAQQASSS
FT                   AQQASSSAQQASSSAQQASSSAQQASSSAQQASSSAQQASSSAQQASSSAQQASSSAQQ
FT                   ASSSAQQASSSANQASSSAQQASSSAQQASSSAQQASSSAQQASSSAQQASSSANAASS
FT                   SANAASSSANAASSSANAASSSANAASSSANAASSSANAASSSANAASSSANAASSSAN
FT                   AASSSANAASSSANAASSSANAASSSANAASSSAQQASSSAEQASSSAQQASSSAQQAS
FT                   SSAQQASSSAQQASSSAQQASSSANQASSSAQQASSSAQQASSSAQQASSSAQQASSSA
FT                   NAASSSANAASSSANQASSSAQQASSSANAASSSANAASSSANAASSSANAASSSANAA
FT                   SSSANAASSSAQQASSSANQASSSAQQASSSANAASSSANAASSSANAASSSANAASSS
FT                   AQQASSSAQQASSSAQQASSSAQQASSSANQASSSANQASSSAQQASSSAQQASSSANA
FT                   ASSSANVASSSANAASSSANAASSSANAASSSANAASSSANAASSSANAASSSANAASS
FT                   SANAASSSANAASSSANAASSSANAASSSANAASSSANAASSSANAASSSANAASSSAN
FT                   AASSSANAASSSANAASSSAQQASSSAEQASSSAQQASSSAQQASSSAQQASSSAQQAS
FT                   SSAQQASSSANAASSSANAASSSANAASSSANAASSSAQQASSSAQQASSSAQQASSSA
FT                   QQASSSAQQASSSANAASSSANAASSSAQQASTAAQQIEDSGLFERDADGKVHTAFSAA
FT                   HTGDKGSVPDAKASGVNATALGWNSTASGDGAVSIGHSSQASGNMTTALGTNAQATGKN
FT                   ATALGHNAHATANGTVSLGKDSKASGENSTVIGSASSVSGKDSVVIGHNSTVSANNSVA
FT                   IGSNQTVTRDNTVSMGDRTVSNIRDGKELSDAVTVRQLNSTTQGVENRLTNKVNKLDKK
FT                   LSAGVASAVAIANIPTVSVPGGAMIGIGVGNFRGQSSLAVGYTRSSDNNKVIFKATAGA
FT                   TSQKDYAVGAGIGFQW"
FT   repeat_region   complement(482153..482165)
FT                   /note="G x13"
FT   CDS_pept        complement(482576..483343)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05320"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="GOA:E7A3U8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U8"
FT                   /protein_id="CBY80721.1"
FT                   /translation="MKNTEILLTIKLQQALFIDPKRVRLLKEIQQCGSINQAAKNAKVS
FT                   YKSAWDHLEAMNKISPRPLLERNTGGKNGGGTALTTYAERLLQLYDLLERTQEHAFHIL
FT                   QDESVPLDSLLTATARFSLQSSARNQFFGRVAQQRIIDSRCVVDVNVQGLPTPLQVSIT
FT                   TKSSARLKLITEKEVMLMFKAPWVKISEQPLANQPNQFPVNIKSLNEEEAILQFAESDI
FT                   EFCATIHQPNQWQIGQQVWIHIDQEQIILATLG"
FT   CDS_pept        483481..484245
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05330"
FT                   /product="molybdate transporter subunit"
FT                   /db_xref="GOA:E7A3U9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3U9"
FT                   /protein_id="CBY80722.1"
FT                   /translation="MKKLTKISTALLIAGLGFSFAASAKVTVFAAASMTDALQQVAKDY
FT                   AKQNPKNEVVFSFASSSTLAKQVEEGAPADIFVSASNKWMKYLSEKDLTVKETEKVLVG
FT                   NDLVLIAPAKSAVNSVDIAKGEWINALKDSYLSVGDPAHVPAGQYAAEALTKLNLWDKV
FT                   QDRLARAKDVRGALALVERAEAPYGIVYSTDAKVSQQVKTVAVFPADSHKPVVYPASIV
FT                   KGHDNVDSRDFLKYLESDAAKKVLVGYGFSAK"
FT   CDS_pept        484380..485108
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05340"
FT                   /product="molybdate transporter subunit"
FT                   /db_xref="GOA:E7A3V0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V0"
FT                   /protein_id="CBY80723.1"
FT                   /translation="MLTQFFSFFNLTPMEISAINLSLSVAVSSMLWSLPLAIFVAWLLA
FT                   RKNFYGKSLITGVIHLPLVLPPVVIGYLLLVAMGRNGFIGKYLYQWFGLSFGFSWKGAV
FT                   LSSAVVAFPLVVRAIRLSLENIDIKLEQAAQTLGASAWRVFFTITLPLSLPGVLAGLVL
FT                   GFARSLGEFGATITFVSNIAGETQTIPLAMYSFIQTPAAEEQTARLCLFAIILSLISLL
FT                   LSEWLSQRMQKKLGQGNVAD"
FT   CDS_pept        485098..486150
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05350"
FT                   /product="molybdate transporter subunit"
FT                   /db_xref="GOA:E7A3V1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V1"
FT                   /protein_id="CBY80724.1"
FT                   /translation="MQINVKKQLGQLALQANIQVPDQGVTAIFGLSGSGKTSLINLVSG
FT                   LIQPDEGFIRLNDRTLVDMESQESLPTHLRKIGYVFQDARLFPHYTVKGNLRYGMKNVS
FT                   QDDFNYIVDLLGITHLLKRYPLTLSGGEKQRVAIGRALLTDPDILLMDEPLSALDVPRK
FT                   RELMQYLERLSKEINIPILYVTHSLDELLRLADRVVLMENGIVQAYDSVEKIWNSPIFA
FT                   PWKEESEQSSVLALPVHLHNPPYKMTALSLGEQVLWIHQVPANVGERVRVCIYSSDVSI
FT                   TLQKPEQTSIRNILRGKITQIEIQDSRVDLAVLVEGNKIWASISKWAQNELRFAVGQDV
FT                   YVQIKAVSVM"
FT   CDS_pept        486259..486600
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05360"
FT                   /product="Unknown protein, no known homologues"
FT                   /db_xref="GOA:E7A3V2"
FT                   /db_xref="InterPro:IPR008688"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V2"
FT                   /protein_id="CBY80725.1"
FT                   /translation="MNDNGSNMSLLNSLEDKMLCQDDIVKLEQNLKDSISSMLDHQIEK
FT                   LENNFKTYINENVVMKSELHNSTQATIKWVNENTATKQDILKLENALLWKLVGFISAIV
FT                   ALTAYLIKH"
FT   repeat_region   486713..486729
FT                   /note="T x17"
FT   CDS_pept        486797..487447
FT                   /transl_table=11
FT                   /gene="aef3A"
FT                   /locus_tag="HIBPF_05380"
FT                   /product="Major fimbrial subunit"
FT                   /db_xref="GOA:E7A3V3"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V3"
FT                   /protein_id="CBY80726.1"
FT                   /translation="MKFILKFLYRIFKMKKTILALLALGVFGANSAFAAAVTTQNQDKT
FT                   HAKVKVIGEVVTQTCEISSNEKNKMVKLDTVGTNSLVNKGDVATQQLVTFHLQNCSFLN
FT                   GVHTPSTGNNPQTSQNKVTVTFNHTEKVDINNEYTLKNIAQDNKANNVNIQFADINGKG
FT                   IRLGQNDNDAKLRAVSIDNNQTPQIHFLARYYATSQSTPGKVEAEAELDLAYE"
FT   CDS_pept        487526..488233
FT                   /transl_table=11
FT                   /gene="aef3B"
FT                   /locus_tag="HIBPF_05400"
FT                   /product="Periplasmic chaperone"
FT                   /db_xref="GOA:E7A3V4"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR018046"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V4"
FT                   /protein_id="CBY80727.1"
FT                   /translation="MLSFSKKSIFISAILSCLFATFSAHASVIILGTRLIYPGNQSSLN
FT                   VQLNNQDSSPALVQSWIEDKQGSQAQVPFIITPPVTRVEGNQGQTLRITFTGTQALPQD
FT                   RESLYYFNLLDIPPKPSKAYLKDNPNYLQFSVRSRLKLFYRPSNLPYPPAEAYKKVSWQ
FT                   AKDGKLWADNPTPYYLTFTQATVGGKSAPEAVMVAPFSQGEFNVKGVNNGQKVKWSLIN
FT                   DYGGDVAGESTIN"
FT   CDS_pept        488425..491007
FT                   /transl_table=11
FT                   /gene="aef3C"
FT                   /locus_tag="HIBPF_05420"
FT                   /product="Fimbrial biogenesis outer membrane usher protein"
FT                   /db_xref="GOA:E7A3V5"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V5"
FT                   /protein_id="CBY80728.1"
FT                   /translation="MREFSFNPHLSLIGFLIGLAFFPLYAKAENVPNTPKESLNVEDED
FT                   VEFSAGFLNMGGNGSNIDVTRFQQKNSVLPGEYPAAVWVNGKEKGEMTLRFRDNENADM
FT                   PFAQLCFTPELEALLDLESAAIKRSPSEKECVFIQDAIPDGKAVFNTGQQRLEFTIAQA
FT                   LTINRPRDYIAPSRWQTGDVAAFADYNINHSRYANQGTQSSQMFLNLRTGVNLGNWAFR
FT                   HSGSKSWSQSEGQSYNTPYQTYETYVQRDFAPIRGLVTLGDFYTSGQVVEGFALRGIDI
FT                   SSDDRMLSPSQLGFAPRVQGIANSNAVVSIYQNGNIIYQTNVTPGPFVIDDLYSSGYNG
FT                   DLTVEIKEADGKVRSFIVPFSNVAPLIRMGQFRYQLAAGRYRSGEEIYPDNVAQGMLQY
FT                   GLYNNITINTGVTYSKNYLSGALGLGLNTPIGAFSVDSTWTRSAFLPHSLVNENGAMNT
FT                   QPSVRKGYSLHGNYSINFNRTRTNITLAAYRYSSRDFYSLSDVINANHFIGKSFFSVLS
FT                   PRPKNQYQLSIIQDFDKWGSLYLVGATRNYWNKSGSYHQYQLSYANRFKWLSYQIGFSQ
FT                   TIDRQSGQRDNQVYLSMSVPLGHNHSLSSNYARNSAGNSSSQIGINGSFGKNSQWSYGV
FT                   YGNSGQEGYRNMSANMSYRNSYFDFDASASRDNRGSRQMSSNLSGVVVAHRHGITFGES
FT                   VGDSFAVVHADGAAGAEVNSGQGQMLDWFGNAIVPYTQPYRINEIGIDPQNLPLNIEFD
FT                   GTEKKIIPRANSIHVIDFETKRNRLVLFNLTRKNGELLPMASEAYDEQGQFVGYVVQNG
FT                   VLFAGGLQQPKGTIKVSWGNGEQNQCHFDYSVNLDNATQMQQYEKVCQ"
FT   CDS_pept        491008..491646
FT                   /transl_table=11
FT                   /gene="aef3D"
FT                   /locus_tag="HIBPF_05460"
FT                   /product="Fimbrial protein"
FT                   /db_xref="GOA:E7A3V6"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V6"
FT                   /protein_id="CBY80729.1"
FT                   /translation="MEDKPMKKVKKQRLFRQMIGLFSLLFAVVPFSLARDGSVKFTVTI
FT                   KNGGTCQVHSGYENKQVDLGTVYANELSSANQTAGEKDFDLWVEDCGDLISETNKLKFV
FT                   LMNTTNKPDLLAKGVLPNLAAGANKDSVGVQLLTKKDNPVEIKYNALQLPYEGLVSSPN
FT                   GDTLGAEAVAGQAHAFKLPLKARFYAITDGKDDKAGYVRAEVIFAAFYE"
FT   CDS_pept        491639..492292
FT                   /transl_table=11
FT                   /gene="aef3E"
FT                   /locus_tag="HIBPF_05480"
FT                   /product="Fimbrial protein"
FT                   /db_xref="GOA:E7A3V7"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V7"
FT                   /protein_id="CBY80730.1"
FT                   /translation="MNKQGVKMKKTSLWAGVLVLLFALPQGYAANQGKVTFSGKVLAAR
FT                   LCNITTETAGKTIDLGRVRSHQFTGEGTTVGGTNFTLSVRNCGEMPNMNNTHRLKYYFV
FT                   SPYVFARVVNGNFANIQYYLKNTVQDSVNRDSVGIQIFAKEGSEAGKVINIIKPPLPTD
FT                   TSTGSKYTGTQLGAKAKGDTFDITLTAKFYAVTAGSSDKAGKVASEMTFEVFYE"
FT   CDS_pept        492285..493535
FT                   /transl_table=11
FT                   /gene="aef3F"
FT                   /locus_tag="HIBPF_05510"
FT                   /product="putative fimbrial protein"
FT                   /db_xref="GOA:E7A3V8"
FT                   /db_xref="InterPro:IPR000259"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR036937"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V8"
FT                   /protein_id="CBY80731.1"
FT                   /translation="MNKFVKTFQKLTALFITIFAMPKETLADKVGEWYQDGCNTGIYSA
FT                   CVRFPGNTSTYYYPNHNIETKRYNFPRDNPTSQKNPIDMGALIRDLGGTQNIRTDTYKL
FT                   YRRAGTGGNGCFQVTARFDNSLFTIRDYQGKKAFQLNTFPYLGFVFRVKADLSGFGAKI
FT                   QGNNHLNGRFYDVKGYDISFPTGCMFTGELGIQPVLEVTPVDLTPYVPSTFDFSTGNIN
FT                   LNLEHSFVGAFSIEGRDTSGHTPRVTSDGGSSINGKNVTIRLSAVTCIIDGQANQVRDF
FT                   GTKKSSGITAPITANDVDIRVNCGANTYIEPWIVFTDNNDNKNVSSTLKMVYTDDRAKI
FT                   ANVGVKLKQKNNGKYISFGPDSSKKGTQNQIQLTKEFAQQNYYIISFTPELIKLDNSKK
FT                   IEGGELEGLATYTLSYQ"
FT   CDS_pept        complement(493724..494092)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05520"
FT                   /product="Transporter"
FT                   /db_xref="GOA:E7A3V9"
FT                   /db_xref="InterPro:IPR000175"
FT                   /db_xref="InterPro:IPR037272"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3V9"
FT                   /protein_id="CBY80732.1"
FT                   /translation="MGGGAYVLLFCIAMIVIGIPMILVENVIGRRLRVNSIDAFGDKIL
FT                   DKGKGISKYWKILGYMGLLGAFGIMAYYMVLGGWVISYIISLISGTLDISTPITKDIAK
FT                   NFYDLHIGNSPYEIIYLV"
FT   CDS_pept        complement(494271..494906)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05530"
FT                   /product="DNA glycosylase and apyrimidinic (AP) lyase
FT                   (endonuclease III)"
FT                   /db_xref="GOA:E7A3W0"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005759"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W0"
FT                   /protein_id="CBY80733.1"
FT                   /translation="MNKTKRIEILTRLREQNPHPTTELQYNSPFELLIAVILSAQATDK
FT                   GVNKATEKLFPVANTPQAILDLGLDGLKSYIKTIGLFNSKAENIIKTCRDLIEKHNGEI
FT                   PENREALEALAGVGRKTANVVLNTAFGHPTIAVDTHIFRVCNRTNFAAGKDVVKVEEKL
FT                   LKVVPDEFKVDVHHWLILHGRYTCIARKPRCGSCIIEDLCEYKEKVEF"
FT   CDS_pept        complement(495028..495735)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05540"
FT                   /product="predicted inner membrane NADH-quinone reductase"
FT                   /db_xref="GOA:E7A3W1"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR010968"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W1"
FT                   /protein_id="CBY80734.1"
FT                   /translation="MTDLTEKNTALEEEKIESAVENQQKSIWKEIFAQGIWKNNPAVVQ
FT                   LLGLCPLLAVSSTATNALGLGLATMLVLTCTNTVISLFRQYIPKEIRIPIYVMIIATTV
FT                   TAVQLLMNAYTYTLYQSLGIFIPLIVTNCIIIGRAEAFASKNSLLHSIWDGFSMGLGMA
FT                   LSLTILGALREIIGQGTIFEGIENLFGEQAKFLTHHIYHTDSSFLLFILPPGAFIGLGL
FT                   LLAIKNRIDNVKK"
FT   CDS_pept        complement(495737..496360)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05550"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="GOA:E7A3W2"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR010209"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W2"
FT                   /protein_id="CBY80735.1"
FT                   /translation="MGTVKITSRYGILLGFIALLCTAISAGIYFLTKDKIDAVIAAQQR
FT                   ELLLQVIPQDYFNNNLLESAVIPQDKNFVGIQKIYFAKKDGNISAYAYETTAPDGYSGD
FT                   IRLLVGLDPKGEVLGVRVIEHHETPGLGDKIERRISNWILGFTNQSINEHNLSEWAVKK
FT                   DGGKFDQFSGATITPRAVVNQTKRSALIMLNNQALLQQLSTQVK"
FT   CDS_pept        complement(496360..497436)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05560"
FT                   /product="predicted inner membrane oxidoreductase"
FT                   /db_xref="GOA:E7A3W3"
FT                   /db_xref="InterPro:IPR004338"
FT                   /db_xref="InterPro:IPR011303"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W3"
FT                   /protein_id="CBY80736.1"
FT                   /translation="MFKMVSSPHTHSGKLTARIMLWVILAMMPAFFTQIYYFGFGVVLQ
FT                   SALAIGTAIIAEFIAIKLRGKKPLNYLSDFSVALTALILAMAIPPYAPYWIIIIGTLCA
FT                   VLLGKQVYGGLGQNPFNPAMIGYVILLISFPLQMTTWMPPINLLQEPPTFSDTFSLIFS
FT                   GLTTDGFTLSQLTHNIDGITQATPLDSAKIFYKSHTQLNDFYELIKLPIFMGNGTDFAQ
FT                   GWWQINVAFLVGGIFLILKRVIHWQIPVAMLVTFFCLATATAFTGFTHLSAISQLVSGA
FT                   MMFGAFFIATDPVTASITPRGKIIFGALVGLFVYLIRYHGNYPDGVAFAILLSNICVPL
FT                   IDHYTRPRVSGYPTKGRK"
FT   CDS_pept        complement(497441..499393)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05570"
FT                   /product="predicted NADH:ubiquinone oxidoreductase, subunit
FT                   RnfC"
FT                   /db_xref="GOA:E7A3W4"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010208"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR026902"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W4"
FT                   /protein_id="CBY80737.1"
FT                   /translation="MADVLSRFNSGKLWDFKGGIHPPEMKSQSNSQPLRHLPLGTDFYI
FT                   PLKQHLGTTGNLLIKEGDYVLKGQALTKGDGLRMLPVHAPTSGTIKSIKPYVATHPSGL
FT                   DEPTIHLQADGLDQWIERNSIDDFSTLSSEQLIHKIYQAGIAGLGGAVFPTAAKIQSAE
FT                   QKVKLLIINGAECEPYITCDDCLMRERADEIIKGIRILRYILHPEKVVIAIEDNKPEAI
FT                   SAIRNALQGANDISIRVIPTKYPSGATKQLIYLLTGIEVPSGARSSSIGVLMQNVGTMF
FT                   AIKRAVINDEPLIERVVTLTGNKIAEKGNYWVRLGTPISQILSDAGYQFDKHFPIFAGG
FT                   SMMGLELPNLNAPVTKLVNCLLAPDYLEYAEPEAEQACIRCSSCSDACPVNLMPQQLYW
FT                   FARSEDHKKSEEYALKDCIECGICAYVCPSHIPLIQYFRQEKAKIWQIKEKQKKSDEAK
FT                   IRFEAKQARMEREEQERKARSQRAAQARREELAQTKGEDPVKAALERLKAKKPNETEST
FT                   QIKTLTSEKGEVLPDNTDLMAQRKARRLARQQAASQVENQEQQTQPTDAKKAAVAAIAR
FT                   AKAKKLAQANSTSEAISNSQTAENEVEKTKSAVETTEENSTALDPKKAAVAAAIARAKA
FT                   KKLAKTQATLENNQE"
FT   CDS_pept        complement(499394..499975)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05580"
FT                   /product="Electron transport complex protein RnfB"
FT                   /db_xref="GOA:E7A3W5"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR016463"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W5"
FT                   /protein_id="CBY80738.1"
FT                   /translation="MTFLFIVITLLALIFGAILGFASIKLKVEADPVVEKIDAILPQSQ
FT                   CGQCGYPGCKPYAEAICNGDEITKCIPGGQTTIVKIAEILGVDVPTMEGIEEPIEKVAF
FT                   IDENMCIGCTKCIQACPVDAIIGTNKAMHTIIPDLCTGCELCVAPCPTDCILMIPVKKN
FT                   IDNWDWKFDAKLVIPVMNVDGSEKKLVVGE"
FT   CDS_pept        complement(500063..500641)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05590"
FT                   /product="predicted inner membrane subunit"
FT                   /db_xref="GOA:E7A3W6"
FT                   /db_xref="InterPro:IPR003667"
FT                   /db_xref="InterPro:IPR011293"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W6"
FT                   /protein_id="CBY80739.1"
FT                   /translation="MTHYILLIIGTALINNFVLVKFLGLCPFMGVSKKIETAVGMGLAT
FT                   MFVLTVASLCAYLVDHYILIPLNATFLRTLVFILVIAVVVQFTEMAINKTSPTLYRLLG
FT                   IFLPLITTNCAVLGVALLNVNLAHNLTESVVYGFGASLGFSLVLVLFAALRERLVAANI
FT                   PATFRGSAIALITAGLMSLAFMGFTGLVK"
FT   CDS_pept        complement(500850..501704)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05600"
FT                   /product="Outer membrane protein, OmpA/MotB"
FT                   /db_xref="GOA:E7A3W7"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W7"
FT                   /protein_id="CBY80740.1"
FT                   /translation="MKLSRILLSTIAISALSACGNLSKVTDAGTPEYKNINGEQVPQLV
FT                   WPKIDSATFNHDGRQFGSWPNWDNLRMIESGMNKDQIRQLIGNPHFTEGLYGVSEWDYV
FT                   FNYRENGTHKICQYKVLFDKNHNAQSFFWFPNGCNGYSTFNLSGDFLFDFDKDTLSEKG
FT                   KKIIDKVSYQLKSNGAKDIKIAGYTDRLGTDSYNLELSQRRANSVKNHLVKDGVTAQIT
FT                   AIGYGKNPQIKSCNDVPQGKALKDCLHPNRRVEIIASGSILKLQEGTKINGGTQGPTKL
FT                   YQK"
FT   CDS_pept        complement(501862..502923)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05610"
FT                   /product="predicted inner membrane peptidase"
FT                   /db_xref="GOA:E7A3W8"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR013703"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W8"
FT                   /protein_id="CBY80741.1"
FT                   /translation="MLNDILTSYGIFILEILTILLLILAIVGLIISYRQHNKSKVGELE
FT                   IKDLSEEFNEQVRLLRDFNLSEEEQKQRTKAEKKAEKQNAKKRKEKLKKGDTLEDEKKA
FT                   CVYVLDFCGDISASETTALREEISAILNVAKSEDEVLLRLESPGGIVHNYGFAASQLSR
FT                   LKQKGIKLTVAVDKVAASGGYMMACVADKIVSAPFAVIGSIGVVAQIPNVHRLLKKHDV
FT                   DVDVMTAGEFKRTVTVLGENTEKGKQKFQQELEETHKLFKQFVSQNRPCLDIDKIATGE
FT                   HWFGQQAIALQLVDEISTSDDLILEKMKEKQVLNVKYRLKKSLIKKFGRQAEESAINII
FT                   HRYSTKQSRDFMY"
FT   CDS_pept        503123..503788
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018635"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3W9"
FT                   /protein_id="CBY80742.1"
FT                   /translation="MKLRAVVLGLATLCASTATFAGMVSTSSNLEFLAIDGQKASKSLG
FT                   KAKTFTVDDTQSHQVVVRLNEIVGSGSNQSLFESNPVIVTFKGNAEDLVISAPVIRNLD
FT                   SGDKFNQMPNITVKTKSGNAISAKVDVLKQEGLFPTANVLNDLAEYNASGATASVSKFT
FT                   ATTSANSMVAAPAGNAKANKGKVVVQGENVAEQQLQYWFQQADKETQTRFLNWAKSHK"
FT   CDS_pept        503856..>505994
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05630"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="GOA:E7A3X0"
FT                   /db_xref="InterPro:IPR010019"
FT                   /db_xref="InterPro:IPR010020"
FT                   /db_xref="InterPro:IPR032692"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X0"
FT                   /protein_id="CBY80743.1"
FT                   /translation="MNIRLNAKVISTIPVFIAVNIAAVGIWFFDISSQSMPLILGIIAG
FT                   GLVDLDNRLTGRLKNVFFTLIAFSISSFIVQLHIGKPIQYIVLMTVLTFIFTMIGAVGQ
FT                   RYSTIAFGSLVVALYTTLTYVPEGNVWFINPVMILCGTLLYSVVTLIVYLFFPNRPVQE
FT                   SVAKAFCALGEYLYTKSCFFDPDEVAEIEKKHLNFAMKNTNVVTAFNIVRTALFYRIRG
FT                   QHRHPRTQRMLRYYFAAQDIHERANSTHFDYQQITEKLKNTDLIFRIQRLLELQAQSCK
FT                   EITASLRENKPYHFNERVERSLLGTLHSFELYKAQHLNDQVNDQDELIDIQTLLDNLQS
FT                   INWQLRQLAQDTTDTEQLAQIHTEQITGLKNISAVIFSHFTFESPLFRHAVRLSIVVFL
FT                   CCAIVEFFQFNLGYWILLTTVFVCQPNYSATKVRLRQRIIGTILGVVVGSLLPYLNPTL
FT                   ELKLGLVVLTSTLFFFFRSNNYSFSTFFITLQVLLSFDVMGFDTAAALMPRLLDTLLGA
FT                   AISWFAVSYLWPDWKYLQLDKVSHQALRSDAVYLLHIISQLQFGKSDDLKYRIARRNAH
FT                   QYAAALSTTLSNMNNEPVKYKAYLQKGFDLLKLNYSLLSYISALGAYRDRMKNLQQTAQ
FT                   FLSGFYPVAKKIIYTLEHIEEIPEAIFNQQKESIETHLKELEKQEMTAEERAVFSLPYQ
FT                   QLNLITQLLPQFYEYFKKE"
FT   CDS_pept        complement(506122..506664)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05640"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   phosphatase"
FT                   /db_xref="GOA:E7A3X1"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR010023"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X1"
FT                   /protein_id="CBY80744.1"
FT                   /translation="MQQKLENIKFVITDVDGVLTDGQLHYDANGEAIKSFHVRDGLGIK
FT                   MLMDAGIQVAVLSGRDSPILRRRIADLGIKLYFLGKLEKETACFELMKQAGVTAEQTAY
FT                   IGDDSVDLPAFAACGTSFTVADAPIYVKNTVDHVLSTNGGKGAFREMSDMILQAQGKSS
FT                   VFDSAQGFLKSVKNMGQ"
FT   CDS_pept        complement(506674..507609)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05641"
FT                   /product="probable phosphosugar isomerase"
FT                   /db_xref="GOA:E7A3X2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR004800"
FT                   /db_xref="InterPro:IPR035474"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X2"
FT                   /protein_id="CBY80745.1"
FT                   /translation="MNYLKIAQDSLSVESNALLQLSQRLGEDFNQVVDLILACKGRLVI
FT                   GGIGKSGLIGKKMVATFASTGTPSFFLHPTEAFHGDLGMLKPIDIVMLISYSGETDDVN
FT                   KLIPSLKNFGNKIIAVTSNKNSTLARHADYVLDITVEREVCPNNLAPTTSALVTLALGD
FT                   ALAVSLITARNFQPEDFAKFHPGGSLGRRLLCKVKDQMQTRLPTILPNTNFTDCLTVMN
FT                   EGRMGVALVMENEQLKGIITDGDIRRALTVNGAETLNKTAKDFMTSSPKTIHQDEFLSK
FT                   AEDFMKAKKIHSLVVVNDENHVVGLVEFSS"
FT   CDS_pept        508513..509526
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05670"
FT                   /product="molybdopterin biosynthesis protein A"
FT                   /db_xref="GOA:E7A3X3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X3"
FT                   /protein_id="CBY80746.1"
FT                   /translation="MQSIPIKNVGESRLVDPFQRQYYYLRLSITDQCNFRCTYCLPDGY
FT                   QPEANKPSFLTLKEITHLAQAFAEMGTEKIRLTGGEPTLRKDFISIAESIANIDGIRQL
FT                   AVTTNGYRMAKDVADWKQAGITSINVSVDSLDPKMFHQITGINKFDDVMRGIDRAFEMG
FT                   YNKVKVNSVLMKNLNDKEFEQFLAWVKDRPIQMRFIELMQTGEMDSFFDKFHLSGQVLA
FT                   DKLLQNGWLLQHKSHTDGPAKVFTHSDYAGEIGLIMPYEKNFCASCNRLRVSAKGKLHL
FT                   CLFGEEGIELRDLLQSHEQQGILQARIFAALQGKREHHYLHIGDTGVRNHLASIGG"
FT   CDS_pept        509660..510100
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05680"
FT                   /product="molybdopterin biosynthesis, protein C"
FT                   /db_xref="GOA:E7A3X4"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X4"
FT                   /protein_id="CBY80747.1"
FT                   /translation="MVDVSAKAETVREARAEAIVTMSKETLSMIVEGKHHKGDVFATAR
FT                   IAGIQAAKRTWELIPLCHPLLLSKVEVNLEPLLETNQVRIQSLCKLTGKTGVEMEALTA
FT                   ASVAALTIYDMCKAVQKDIVIEKVCLLEKSGGKSGHFIAEEK"
FT   CDS_pept        510102..510347
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05690"
FT                   /product="molybdopterin synthase, small subunit"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X5"
FT                   /protein_id="CBY80748.1"
FT                   /translation="MLNVLFFAQTRELIGIDAIQLEDDFATAEAVREHLAQKGDKWALA
FT                   LEKGKLLVAINQTLMPLESAVKNGDEIAFFPPVTGG"
FT   CDS_pept        510348..510800
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05700"
FT                   /product="molybdopterin synthase, large subunit"
FT                   /db_xref="GOA:E7A3X6"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X6"
FT                   /protein_id="CBY80749.1"
FT                   /translation="MTDIQIAVQEQPFDQNAVYQWLSEQHSIGATVIFVGKVRDLNLGD
FT                   AVSSLYLEHYPAMTEKALNEIVAQAKARWDIQRVSVIHRVGLLQTGDEIVLVGVSSAHR
FT                   GDAYHANEFIMDFLKSKAPFWKKEQTNQGERWIEARESDKEALEKW"
FT   CDS_pept        complement(510855..513500)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05710"
FT                   /product="conserved protein"
FT                   /db_xref="GOA:E7A3X7"
FT                   /db_xref="InterPro:IPR003399"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X7"
FT                   /protein_id="CBY80750.1"
FT                   /translation="MTEKNNSSSIEEKYQEITANLRKTKRISPFWLLPFIALCIGAILF
FT                   FQIVKERGTSITITFTNGSGIVADKTQIRYQGLQIGIVKEVHFTDNLQKVEVVANINPE
FT                   ASSILRENTKFWLVQPNVSLAGISGLDSLVSGNYITLQPGDGDREDEFIAEEQGPIAQV
FT                   SAGDLLIHLISDDLGSISIGASVYFKKLPVGKIYDYRINKNSKVEIDVVIDKAYAKFVK
FT                   KDSRFWNISSINANISPSGLNLNVESLNAVVQGAVSFDSPADSPKADENSHFTLYTNLK
FT                   AAKRGMEIKVTIPASSALIAGQTEVYSQDNAIGILAKLSAVENNDEILEGSLLIDPNQA
FT                   SLFKANSKIVLRNKKIDLGNLAEPKKFFRGEYFDVIAGDGETKHQFNVIKENELLLNAP
FT                   NTLVLTLTAPENYGVSEGQNVFYNNMIIGQIVSQTIDVNGVQFKAAIASEYRNLIHENT
FT                   QFVAATNFDISVGLDGLRFESATPEKWLQGGVRVLAKQGQGKAKTSYPLYQNISNAEHG
FT                   ITGNILTPTITLHTQTLPSIDKGSLVLYRQFEVGKILSIKPKTNNFDVDIYIYPAYQHL
FT                   LTDKSRFWVESAAKIDVTPKGISIQATPLARSLKGAIGFDNGGSGNNRTLYANESYAKS
FT                   IGFVITLITDDATNLSKGMNLRYLGLDVGQIDSIQLDAKAKRITAKALINPNYMNIIAK
FT                   EGANFTIISPQISAGGIDNLDSLLQPYIDIEIGNGNTKTQFNLAQTAPQRNKFSNGTPF
FT                   ILETRDAMNLSEGSPILYRGVEVGTVKKFELNSLGDRVLVHIAIMPKYSHLVRQNTEFW
FT                   IASGYDFSLGWKGAVFNTGSVQQLLKGGISFSTPAEKEIQPQAQPNKRFLLQINRPEEV
FT                   QTWGSGALSK"
FT   CDS_pept        complement(513484..514734)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05720"
FT                   /product="paraquat-inducible protein A-like protein"
FT                   /db_xref="GOA:E7A3X8"
FT                   /db_xref="InterPro:IPR005219"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X8"
FT                   /protein_id="CBY80751.1"
FT                   /translation="MPKTKLTSPPFKILKCTECDACINVPSILQSNEQAECPRCHHLLA
FT                   SGTRWSLHRCAMIALSILILMPFSLNYPLLSLHLLGIKIDASIWDGIWKMAVGGYEYTA
FT                   FMIFICAVVMPITFALLVIMLWLAKIFQIKPRSVLLFLGYIKAWVMFDVYLVALGVTIF
FT                   KVREYATLEINIYLIPFIFTALLTTLLFIKLNLSALWQEFYPECTSVYTKQAVELCPAC
FT                   HYTFTQKSIHYDHQQKICCPRCQSPLNTSDKLKLQATWATLIAGIIMLFPANLLPISGI
FT                   YLTGALSEDTLISGVISFVKSGSYFVAFVVFFASIFVPISKIFIMLYLLACVHFKWQHS
FT                   IKWQMRLLHLVHFVGRWSMLDLFVLALMMSLVTRGEIINFTVGPGAFYFGAAVFCTMLS
FT                   TSQFDSKLIWKIYDREK"
FT   CDS_pept        514919..515557
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05730"
FT                   /product="predicted structural transport element"
FT                   /db_xref="GOA:E7A3X9"
FT                   /db_xref="InterPro:IPR016103"
FT                   /db_xref="InterPro:IPR023529"
FT                   /db_xref="InterPro:IPR035236"
FT                   /db_xref="InterPro:IPR036442"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3X9"
FT                   /protein_id="CBY80752.1"
FT                   /translation="MTDTQLSSQVTDVQTEVQKLTNAKAIITYLAEKFPLCFVLEGEAK
FT                   PLKIGLFQDLAEALQDDERVSKTQLRQALRQYTSNWRYLYGCREGAVRVDLQGNPAGVL
FT                   DAEHVAHAAQQLAEAKARFAEKRKAEAAAKKAQQKKHPRKPANKNLKKESKLSLSAVDF
FT                   SQISVGSVVKVKAGDNAKKATVVEVLKDSARVELENGLIMNVAADRLFA"
FT   CDS_pept        515585..517666
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05740"
FT                   /product="carboxy-terminal protease"
FT                   /db_xref="GOA:E7A3Y0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR020992"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR040573"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y0"
FT                   /protein_id="CBY80753.1"
FT                   /translation="MKFKMSKNVICYAWLSVCLSSAIPAFAVQPTLKPSDISIPAISEE
FT                   SQLATKRATTRLTQSHYRKIKLDDDFSEKIFDRYIKNLDFSHNTFLQSDIDELRQKYGT
FT                   KLDEQLSQGDLSAAFDIYDVMMKRRYERYTYALSLLDKEPDLNGQDQIEIDREKAAAPQ
FT                   TEADANKLWDARVKNDIINLKLKDKKWSEIKAKLTKRYNLAIRRLTQTKADDIVQIYLN
FT                   AFAREIDPHTSYLSPRTAKSFNESINLSLEGIGTTLQSEDDEISIKSLVPGAPAERSKK
FT                   LHPGDKIIGVGQATGDIEDVVGWRLEDLVEKIKGKKGTKVRLEIEPAKGGKSRIITLVR
FT                   DKVRIEDQAAKLTFEKVSGKNIAVIKIPSFYIGLTEDVKKLLVKLENQKAEALIVDLRE
FT                   NGGGALTEAVALSGLFIADGPVVQVRDAYQRIRVHEDDDATQQYKGLLFVMINRYSASA
FT                   SEIFAAAMQDYRRGIIIGQNTFGKGTVQQSRSLNFIYDLDQSPLGVLQYTIQKFYRVNG
FT                   GSTQLKGVAADINFPAIIDAKEYGEDKEDNALAWDKIPSASYMEVGNIDYIDNAVNILN
FT                   EKHLARIAKDPEFVALNEELKVRNERRDRKFLSLNYKMRKEENDKDDARRLKDLNERFK
FT                   REGKKALKDIDDLPKDYEAPDFFLKEAEKIAADFVIFNSDQKINQANGLSEAKTESKK"
FT   CDS_pept        517740..519209
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3Y1"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y1"
FT                   /protein_id="CBY80754.1"
FT                   /translation="MVVFKSTLKLSLFALSLSMMMSGCVLVGLSKNDQSKSLYGINLSH
FT                   LSLAERKELEEAIYADQQRLTEEKQTLLNMTLTHEIGDHKLQFKPLLARLYASRKYAPL
FT                   WTDNAAARQLLRDYAAMVASGISKSSATSLETLALVEQQGGLVYDVLLSDILLDYLYYT
FT                   QNVRSQASNWLYSSAQYQAQQPENDHIQRWLSAVENNQLLDFIQSLAGENHLYRQTVQS
FT                   LPMFIPTSKESNIAQKLAMNAQRLRVIPDFHNGIFVNIPSYKLQYYRDGDLILESRVIV
FT                   GTNSRRTPVMYSKLSNVVVNPPWNAPIRLINEDLLPKMKADPNYITEHNYSILDNQGNV
FT                   VDPASIDWESIGNKFPYRVRQAAGDSALGNYKFNMPSSDAIYLHDTPNRGLFNRKNRAL
FT                   SSGCVRVEKSDQLASILLKEAGWTETRKNTVLASKKTTSAPIRSDNPVFLYYVTAWIEN
FT                   GNIVNLPDIYGYDRQINLAEINWDLVKKYLQ"
FT   CDS_pept        519225..519785
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y2"
FT                   /protein_id="CBY80755.1"
FT                   /translation="MNYVDENKRKWLSLGGIALGISILPNSVLAMVSTPKPRILTFRNI
FT                   NTGERLSGEFSLAKGFSPAMLKKLDYLMRDKRTNQVHKMDPNLFHKFYNIQTNLGLRNA
FT                   EIEVICGYRSVATNAMRRRQSRGVAKNSYHIKGKAIDFRIAGVPLIKVKSSAESLRNGG
FT                   VGYYPTSNFIHVDTGPVRTWKGV"
FT   CDS_pept        519837..520592
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05770"
FT                   /product="conserved putative deoxyribonuclease"
FT                   /db_xref="GOA:E7A3Y3"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y3"
FT                   /protein_id="CBY80756.1"
FT                   /translation="MLFDSHLHLDQLSDENIQKTLGDSRLTGMLVVSTNFNSAKKLLNL
FT                   KQTYPKKLYIAAGFHPEQQLPSLEEQKKLFQWIDEHHSSISAIGEVGLPHYSKRENLNL
FT                   DYAPYIELLERFILIAKKWDLPLNLHIVHNDVEIALELLEKHNIQRAHFHWFKTDEKSF
FT                   QKFFSTPYFASLTPDILWNPKTQYVAQHLPLNRLMIETDSPWQHEGFERVGISEQLLAV
FT                   LQKLAELKSLPLHSVQKQIFLNTQQFYQL"
FT   CDS_pept        520602..521240
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05780"
FT                   /product="predicted Zn-dependent hydrolase-like
FT                   protein,including glyoxylases"
FT                   /db_xref="GOA:E7A3Y4"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y4"
FT                   /protein_id="CBY80757.1"
FT                   /translation="MNIEIIPVTAFQQNCSLIWDDEKNATIIDPGGEAERLIQRIEELD
FT                   LNLKVILITHGHLDHVGAAMQLKQHFGVEIWGSNEKDKFLFESLPEQAQRFGLPNIDAF
FT                   LPDRWFNQEGEILKLDGFNFEILHLPGHTPGHIGFIEHEKKVAFTGDVLFQGGIGRTDF
FT                   PRGDYETLISSIRTKLLPLNDDIIIIAGHGSYTTIGQEKRSNPFLNPKS"
FT   CDS_pept        521450..524257
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05790"
FT                   /product="2-oxoglutarate decarboxylase, thiamin-requiring"
FT                   /db_xref="GOA:E7A3Y5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y5"
FT                   /protein_id="CBY80758.1"
FT                   /translation="MQQNKAFDDWLASTALGGANQSYIEELYESYLSDPQSVEESWRKT
FT                   FDSLPKTTALEQPHTPVRDYFRRLARENHNEAVTVIDPAAGAKLVKVLQFINAYRFRGH
FT                   LEANLDPLNYYRWKVSSVPELDYRHHGFTEQDLNETFNINHYVYKRDTIKLGELAQMLK
FT                   ETYCGSIGLEFMHVQDMEQKIWLQSKMESLLDKPLFTSEERVNFLRELTAADGLERYLG
FT                   AKFPGAKRFSLEGSDAFIPLMKEIIRHSSRQGVNDVVMGMAHRGRLNMLVNVLGKKPEN
FT                   LFDEFAGKHSSERTGDVKYHQGFSSDFAVDDKRVHLTLAFNPSHLEIVSPVVIGSVRSR
FT                   QTRMNDTEHSKVLAITVHGDSAVAGQGVVQETLNMSNARGYSVGGTIRIVINNQIGFTT
FT                   SNPNDTRSTEYCTDIAKMIQAPIIHVNGDDPEAVAFAARMAVEYRNLFKRDIFIDLISY
FT                   RRHGHNEADEPLATQPMMYSIIKKHPTPRKVYADRLVSEGVMTEEQVTEMANDYRDALD
FT                   NGDRVVSEWREMDTAKMDWLQYLNYDWTAPYESKFSQERFLTLAKRVCEYPESLRAHPR
FT                   VEKIYNDRKAMYQGEKLLDWGMAETMAYATLLDEGVNVRLSGEDAGRGTFFHRHAVVHN
FT                   QNDGTGYVPLTHLHANQGRFEVWDSVLSEESVLAFEYGYATTDPKTLTIWEAQFGDFAN
FT                   GAQIVIDQFISSGEQKWGRMCGLVMLLPHGYEGQGPEHSSARLERYLQLCAEQNMQVCV
FT                   PSTPAQVYHMLRRQSLRKMRRPLIAISPKSLLRHPLAVSSLDELINGTFQTVIGEIDEL
FT                   DPKDVKRVVMCSGKVYYDLLEQRRANNQKDVAIIRIEQLYPFPHEDVKKALEPYAHVTD
FT                   YVWCQEEPLNQGAWYCSKHNFESAIPESVKLKYAGRPASASPAVGYMSLHTKQQKQLVE
FT                   DALSF"
FT   CDS_pept        524362..525591
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05800"
FT                   /product="dihydrolipoyltranssuccinase"
FT                   /db_xref="GOA:E7A3Y6"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y6"
FT                   /protein_id="CBY80759.1"
FT                   /translation="MTIEILVPDLPESVADATVATWHKKLGDTVKRDEVIVEIETDKVV
FT                   LEVPALSDGVLAEVVQAEGETVVSKQLLGKISTAQEGDVSSATLKATNEPTPSDRQNAA
FT                   IENSHNHNADQSPAIRRLLAEHDLQADQIQGSGVGGRLTREDIEREIAKRQAQQVKQEA
FT                   ATEQNTISTVAYSARSEKRVPMTRLRKRIAERLLEAKNSTAMLTTFNEVDMQPIMTLRK
FT                   TYGDKFEKQHSVRLGFMSFYIKAVVEALKRYPEVNASIDGDDVVYHNYFDISIAVSTPR
FT                   GLVTPVLRDCDKLSMAEIEKQIKALAEKGRDGKLTVEDLTGGNFTITNGGVFGSLMSTP
FT                   IINPPQSAILGMHAIKERPIALNGQVVIRPMMYLALSYDHRLIDGRESVGFLVTIKELL
FT                   EDPTRLLLEI"
FT   CDS_pept        complement(525707..526837)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05810"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /db_xref="GOA:E7A3Y7"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR030475"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y7"
FT                   /protein_id="CBY80760.1"
FT                   /translation="MAYTTFSQNKNDQLKEPMFFGQNVNVARYDQQKYETFEKLIEKQL
FT                   SFFWRPEEVDVSQDRIDYAALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLVSIPE
FT                   LETWIETWTFSETIHSRSYTHIIRNIVNDPSIVFDDIVTNEEIIKRAQDISSYYDDLIR
FT                   DSQLYGLYGEGTYTVDGKECVVTLRSLKKQLYLCLMSVNALEAIRFYVSFACSFAFAER
FT                   RLMEGNAKIIKFIARDEALHLTGTQHILNIMAAGQDDPEMAEIAEECKQEAYDLFVAAA
FT                   EQEKAWADYLFKDGSMIGLNRDILVQYVEYITNIRMQAVGLPLPFQTRSNPIPWINAWL
FT                   VSDNVQVAPQEVEVSSYLVGQIDSKVDTNDFDDFSL"
FT   CDS_pept        complement(526980..529250)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05820"
FT                   /product="ribonucleoside-diphosphate reductase alpha chain"
FT                   /db_xref="GOA:E7A3Y8"
FT                   /db_xref="InterPro:IPR000788"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="InterPro:IPR008926"
FT                   /db_xref="InterPro:IPR013346"
FT                   /db_xref="InterPro:IPR013509"
FT                   /db_xref="InterPro:IPR039718"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y8"
FT                   /protein_id="CBY80761.1"
FT                   /translation="MNKSLMVTKRDGTQEQINLDKIHRVITWAAEGLDNVSVSQVELRS
FT                   HIQFYEGIRTSDIHETIIKAAADLISKDSPDYQYLAARLAIFHLRKKAYGHFDPPRLYD
FT                   HVKKLVRMEKYDQALLDDYTREEWDAMDGFIDHWRDMTFSYAAVKQLEGKYLVQNRVTG
FT                   EIYESAQFLYLLVSASLFSKYPKETRLDYVKRFYDATSTFKISLPTPIMAGVRTPTRQF
FT                   SSCVLIECDDSLDSINATASAIVKYVSQRAGIGINAGAIRALGSEIRGGEAFHTGCIPF
FT                   YKYFQTAVKSCSQGGVRGGAATLYYPIWHLEAENLLVLKNNRGVEDNRVRHMDYGVQLN
FT                   KLMYQRLIKGGEITLFSPSDVPGLYEAFFADQDKFEELYVKYEQDPTIRKRTVKAVEIF
FT                   SLLMQERASTGRIYIQNVDHCNTHSPFDPQVAPVRQSNLCLEIALPTKQLQHINDENGE
FT                   IALCTLSAFNLGKIENLDELEELADLAVRSLDALLDYQDYPVVAAKRSSLARRSLGIGV
FT                   INYAYYLAKNGVRYSDGSANDLTHRTFEAIQYYLLKASMNLAKEQGACEYFNETTYAKG
FT                   ILPIDTYKKDLDALTQEPLHYDWESLRKDIQEFGLRNSTLTALMPSETSSQISNATNGI
FT                   EPPRGHVSIKASKDGILKQVVPEYENLMDNYELLWDIPSNDGYLHLVGIMQKFVDQAIS
FT                   ANTNYDPKRFEDGKVPMKVLLKDLLTAYKYGLKTLYYQNTRDGAEDVQEDLDDGCAGGA
FT                   CKI"
FT   CDS_pept        complement(529505..530086)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05830"
FT                   /product="predicted periplasmic or secreted lipoprotein"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Y9"
FT                   /protein_id="CBY80762.1"
FT                   /translation="MTLSPLKKLAILLGATIFLQGCVAAVIGGGAVAAKVATDPRTTGT
FT                   QIDDETFEFKVENAVEKDAQIKAEGRVNAVSYNGRVLLIGQVPNSDVKDTATALAKGVE
FT                   GVNEVYNELTVSPKISFAQISKDSWLTTQVKSKMFVDGRVKATDVKVISENGEVFLLGN
FT                   VTQSQANAAADIASKISGVKKVIKVFKYLD"
FT   CDS_pept        complement(530143..530727)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3Z0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z0"
FT                   /protein_id="CBY80763.1"
FT                   /translation="MLQKVKDIYSESIQIQIAASSMLSENITNATQMVMQCLLGGNKII
FT                   ACGVSRSYANAQFLVSNLLNRYDLVRPSFPSVLLSLESAVGSSLVFEQSPEELYCHQFN
FT                   AIAKSGDLLIAFAPLGTEKIVLNIISHAVSKEINVIVLTGSNNDAIQGILADKDLEISI
FT                   PATKESRILENHLFVINALCELVDQTLFPSA"
FT   CDS_pept        complement(530740..531099)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A3Z1"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z1"
FT                   /protein_id="CBY80764.1"
FT                   /translation="MFSLKRQQGASFEHQARLFLESKGLTFIAANQNFKCGELDLIMND
FT                   KETIVFVEVRQRSHSAYGSAIESVDWRKQQKWLDAANLWLAKQNMSLEDANCRFDLIAF
FT                   GKTPQDIQWIPNFLD"
FT   CDS_pept        complement(531099..532826)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05860"
FT                   /product="putative lipoprotein"
FT                   /db_xref="GOA:E7A3Z2"
FT                   /db_xref="InterPro:IPR007443"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z2"
FT                   /protein_id="CBY80765.1"
FT                   /translation="MSILLQGERFKKRLMPILLSMALAGCSNLLGSNFTQTLQKDANAS
FT                   SEFYINKLGQTQELEDQQTYKLLAARVLIRENKVKQSAALLRELGELNNAQKLDRALIE
FT                   ARISAAKNANEVAQNQLRALDLNKLSPSQKSRYYETLAIVAENRKDMIEAVKARIEMDK
FT                   NLTDVQRRQDNIDKTWALLRSANTGVINNASDEGNAALGGWLTLIKAYNDYIRQPVQLS
FT                   QALQSWKNAYPNHAAATLFPKELLTLLNFQQTNVSQIGLLLPLSGDGQILGITIQSGFN
FT                   DAKGNSTIPVQVFDTSMNSVQDIIAQAKQAGIKTLVGPLLKQNLDVILADPAQIQGMDV
FT                   LALNATPHSRAIPQLCYYGLSPEDEAESAANKMWNDGVRNPLVAMPQNDLGQRVGNAFN
FT                   VRWQQLAGTDANIRYYNLPADVTYFVQENNSNTTALYAVASPTELAEMKGYLTNIVSNL
FT                   AIYTSSRASASATNTNTDFIAQMNGVQFSDIPFFKDTNSPQYQKLAKSTGGEYQLMRLY
FT                   AMGADAWLLINQFNELRQVPGYRLSGLTGILSADTNCNVERDMTWYQYQDGAIVPVAN"
FT   CDS_pept        532898..533749
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05870"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="GOA:E7A3Z3"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z3"
FT                   /protein_id="CBY80766.1"
FT                   /translation="MTDLTGILYIVATPIGNLQDITQRALETFAQVDLIAAEDTRHSGL
FT                   LLSHYGIKKPFFALHDHNEQEKAHILVEKLKQGSNIALISDAGTPLISDPGFHLVRQCR
FT                   EAGIRVVPLPGACAAITALCASGIASDRFCFEGFLPAKSKARKDKLENIAEEDRTLIFY
FT                   ESTHRILDTLEDMQAVLGEERYIVLAREMTKTWETITGNTIKNLREWLLEDPNRTKGEM
FT                   VLIVEGKPKSDNNDKISPQAVKALELIAEELPLKKAAAIVAELYGYKKNALYQFGLAHL
FT                   EK"
FT   CDS_pept        533851..535299
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05880"
FT                   /product="predicted peptidase"
FT                   /db_xref="GOA:E7A3Z4"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z4"
FT                   /protein_id="CBY80767.1"
FT                   /translation="MLNQVSNTLLTPSNLSTQTLLNIFDIMSHRNIDYADLYFQLSQDE
FT                   SWVLEDGIIKEGGFHIDRGVGVRAVSGEKTGFAYADQINLASLQQCAEAVKGIAQVKQG
FT                   NLISPSAFNVVNPIARYAAINPLESLTKEKKIELLHLVDRTARAEDHRVTKVSASLSSV
FT                   YEEVLIMATDGTLAADIRPLVRLSISVLVGENGKRERGSCGSGGRFGLDWFFEVVDGDI
FT                   RAVLFAKEAVRQALVNLSAVAAPAGLMPVVLGAGWPGVLLHEAVGHGLEGDFNRKESSL
FT                   FTGKIGEQVTSPLCTIVDDGTIENRRGSLTIDDEGVPSQCNVLIKDGILQGYMQDKMNA
FT                   RLMGVAPTGNGRRESYAHLPMPRMTNTYMLAGQSQFDDLIASVEQGIYAPHFGGGQVDI
FT                   TSGKFVFSTSEAYLIEKGKITKPVKGATLIGSGIEVMQKISMVADKSELDLGIGVCGKE
FT                   GQSVPVGVGQPALKIDEITVGGTN"
FT   CDS_pept        535415..535966
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05890"
FT                   /product="predicted peptidase, outer membrane lipoprotein"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z5"
FT                   /protein_id="CBY80768.1"
FT                   /translation="MLKRILVIIGLAVLATACSNAPRTVSHQVISENDDIQLTGLINNL
FT                   EKDNRTGIFHKVRTNRSSALMGDKALASVYNEWVGTRYRMGGTTKRGIDCSAFMQTTFS
FT                   EVFGIELPRSTAEQRHLGRKINKSELKKGDLVFFRKNNHVGIYIGNNQFMHASTRQGVT
FT                   ISSLDEKYWARTYTQSRRIM"
FT   CDS_pept        537277..538971
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05920"
FT                   /product="D-lactate dehydrogenase"
FT                   /db_xref="GOA:E7A3Z6"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012256"
FT                   /db_xref="InterPro:IPR015409"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016172"
FT                   /db_xref="InterPro:IPR016173"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z6"
FT                   /protein_id="CBY80769.1"
FT                   /translation="MSVQQLISRLTDIVGSRYIITDPTKTEAYRSGYRFGTGNALAVVR
FT                   PATLLEFWNIVKVCVEHDVIVINQAANTGLTGGSTPDGNDYDRDIVVINTMRIDGIQLI
FT                   NNASQVICLPGSTLNELENQLKPFGREPHSVIGSSCIGASVIGGICNNSGGALVQRGPA
FT                   YTEMALYAQLNEKGELELKNHLGIDLGETPEEILTNLQEKRYQVKDIRQDCGHGHDHYY
FT                   CNYVRQVDEGSPARFNADPARHYEASGCAGKLAVFAVRLDTFPLEKETAVFYIGTNQTS
FT                   VLSDIRRHMLVNFEVLPISGEYIHRDAFDIAAKYGKDTFWVIKKFGTHWLPKLFSLKSN
FT                   VDRIGKKFFFLPQHLSDKFMQAVSKFIPEHLPQSLWDYRNKYEHHLIIKMGGKGIQEAR
FT                   EYLESYIADGSKGGYFECNAIETQAAMLHRFAVASAAIRYRAIHEKEVEEIVALDVALR
FT                   RNDQDWFEVLPPEIDNRIISKLYYGHFMCHVFHQDYIVKKGYDYEELEYEMLKLLDKRG
FT                   AQYPAEHNVGHLYEAKPTLRKFYKELDPTNSFNPGIGKTTRKKYWAE"
FT   CDS_pept        complement(539520..540098)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05930"
FT                   /product="predicted glutamine amidotransferase involved in
FT                   pyridoxine biosynthesis"
FT                   /db_xref="GOA:E7A3Z7"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z7"
FT                   /protein_id="CBY80770.1"
FT                   /translation="MKIGILALQGAFAEHARMLEKLGIESLELRNLKNFQQHYSDLSGL
FT                   ILPGGESTAIGKLLRELYMLEPIKQAISSGFPVFGTCAGLILLAKEITSQKESHFGTMD
FT                   IVVERNAYGRQLGSFYTEADCKGVGKIPMTFIRGPIISSVGKKVNILATVNNKIVAAQE
FT                   KNMLVTSFHPELTNNLSLHKYFIDICKVA"
FT   CDS_pept        complement(540099..540974)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05940"
FT                   /product="conserved hypothetical pyridoxine biosynthesis
FT                   enzyme"
FT                   /db_xref="GOA:E7A3Z8"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z8"
FT                   /protein_id="CBY80771.1"
FT                   /translation="MAENRYELNKNLAQMLKGGVIMDVQNPEQARIAEAAGAAAVMALE
FT                   RIPADIRAVGGVSRMSDPKMIREIQGSVSIPVMAKVRIGHFVEAQILEAIEIDYIDESE
FT                   VLSPADNRFHVDKKEFQVPFVCGAKDLGEALRRIAEGASMIRTKGEPGTGDIVQAVRHM
FT                   RMMSQEIRRIQNLREDELYVAAKDLQVPVELVQYVHKHGKLPVVNFAAGGIATPADAAL
FT                   MMQLGAEGVFVGSGIFKSGDPVKRASAIVKAVTNYRNPQILAQISEDLGEAMVGINENE
FT                   IQILMAERGK"
FT   repeat_region   complement(540987..541042)
FT                   /note="CAAATAAT x7"
FT   CDS_pept        541482..542159
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05950"
FT                   /product="cytidylate kinase"
FT                   /db_xref="GOA:E7A3Z9"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3Z9"
FT                   /protein_id="CBY80772.1"
FT                   /translation="MGMIITVDGPSGAGKGTLCYALAEKLGYALLDSGAIYRVTALAAL
FT                   QHKTDLTNETDLAELSRHLDIQFIPQNGEVNIFLAGMDVSRLIRTQEVADAASKVAVFQ
FT                   KVRSALLQLQQDFAKNDGLIADGRDMGTVVFPNAQVKLFLDASAEERAKRRYKQLQNKG
FT                   INGNFAQILAEIKERDFRDRNREVAPLKPADDALLLDSTTLSIDEVIDQALVYIQEKVS
FT                   VLI"
FT   CDS_pept        542256..543905
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05960"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="GOA:E7A400"
FT                   /db_xref="InterPro:IPR000110"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E7A400"
FT                   /protein_id="CBY80773.1"
FT                   /translation="MSESFAQLFEESLKVLETRQGSIVSGTVVAIQKGFVLVDAGLKSE
FT                   SAIPVAEFLNAQGELEIQVGDTVNVALDAVEDGFGETKLSREKAVRHESWIELEKAYEE
FT                   KATVIGLINGKVKGGFTVELNGVRAFLPGSLVDTRPAREADHLLGKELEFKVIKLDQKR
FT                   NNVVVSRRAVIESENSQEREQVLENLVEGSEVKGVVKNLTEYGAFVDLGGVDGLLHITD
FT                   MAWKRVKHPSEIVNVGDEVTVKVLKFDKDRTRVSLGLKQLGQDPWAAIAENHPVNSKLT
FT                   GKVTNLTDYGCFVEILDGVEGLVHVSEMDWTNKNIHPSKVVSLGDTVEVMVLEIDEERR
FT                   RISLGLKQCKANPWTQFADTHNKGDKVTGKIKSITDFGIFIGLEGGIDGLVHLSDISWS
FT                   ISGEEAVRQYKKGDEVSAVVLAVDAVKERISLGIKQLEEDPFNNFVAINKKGAVVSATV
FT                   VEADAKGAKVELAGGVEGYIRSADLTSEVAVGDVVEAKYTGVDRKSRIVHLSVKAKDQA
FT                   EEAAAVASVNNKQEDIVIPNAMAEAFKAAKGE"
FT   CDS_pept        544028..544312
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05970"
FT                   /product="Integration host factor beta-subunit"
FT                   /db_xref="GOA:E7A401"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005685"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E7A401"
FT                   /protein_id="CBY80774.1"
FT                   /translation="MTKSELMEKLSAKQPTLPAKEIENMVKDILEFISQSLEKGDRVEV
FT                   RGFGSFSLHHRQPRLGRNPKTGDSVNLSAKSVPYFKAGKELKARVDVQA"
FT   CDS_pept        544387..544680
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A402"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="InterPro:IPR032906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A402"
FT                   /protein_id="CBY80775.1"
FT                   /translation="MIKYILGIVIFIAIVLVAITIGANNDQIITFNYIVAESQFQLSSL
FT                   VAILFGLGLILGWLITAFFYIKLKLKNMALARQVKRQTLQINELTTTRDKVV"
FT   CDS_pept        544680..545870
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_05990"
FT                   /product="conserved hypothetical protein"
FT                   /product="conserved protein"
FT                   /db_xref="GOA:E7A403"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR030865"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:E7A403"
FT                   /protein_id="CBY80776.1"
FT                   /translation="MIELLFLLLPIAAAYGWYMGRRSAKKDQDDISNKLSRDYVTGVNF
FT                   LLSNQTDKAVDLFLDMLQKQEIENEIESHSQFEAELTLGNLFRSRGEVDRALRIHQALD
FT                   LSPNYTFEQKLLAKQQLARDFMVVGFFDRAENLYILLVDEPEFAENALQQLLVIYQKTK
FT                   EWKKAVNIAEKLAKIKPQENNIELAQCYCEYSQSLEPESAVEKRSVLQKALSVSPTCVR
FT                   ASLLLANLAMLDGQYQQAVKILENVLEQNPDYTGEILLPLKHCYEELNQLDNFELFLIR
FT                   AGQIINNDEVELALVKLIEEKDGKSAAQAKLYQQLTKKPSTLIFHRFMQYQIDDAEDGR
FT                   GKESLILLHKMVGERIKQTSPYRCTNCGYQIHKLLWNCPSCRQWESIKPVSNQEHN"
FT   CDS_pept        545894..546586
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06000"
FT                   /product="orotidine-5'-phosphate decarboxylase"
FT                   /db_xref="GOA:E7A404"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/TrEMBL:E7A404"
FT                   /protein_id="CBY80777.1"
FT                   /translation="MTSKIIVALDFEKEAEALALVDQIDPSLCRLKVGKEMFTTLGINF
FT                   IKQLHQRNFDVFLDLKYHDIPNTVARAVRSAADLGVWMVDLHASGGLRMMEDAKKILEP
FT                   YGKDAPLLIAVTVLTSMEDLDLLQIGINASPMEQVLRLAHLTQRAGLDGVVCSPQEVEI
FT                   LRNACGEDFKLVTPGIRPIGTDFGDQRRVMTPTAAIRAGSDYLVIGRPITQADNPAEVL
FT                   RSINVSIG"
FT   CDS_pept        546593..546913
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06010"
FT                   /product="predicted translation initiation factor 1-like
FT                   proterin"
FT                   /db_xref="GOA:E7A405"
FT                   /db_xref="InterPro:IPR001950"
FT                   /db_xref="InterPro:IPR005872"
FT                   /db_xref="InterPro:IPR036877"
FT                   /db_xref="UniProtKB/TrEMBL:E7A405"
FT                   /protein_id="CBY80778.1"
FT                   /translation="MSDSVLVYSTDVGRIKEEKASVARPKGDGVVRIQKQTSGRKGAGV
FT                   SVITGLDLSDEELKKLAAELKKRCGCGGAVKNGIIEIQGEKRDLLKQLLEQKGFKVKLS
FT                   GG"
FT   CDS_pept        complement(546942..547637)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06020"
FT                   /product="ATPase regulatory factor involved in DnaA
FT                   inactivation"
FT                   /db_xref="GOA:E7A406"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR017788"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A406"
FT                   /protein_id="CBY80779.1"
FT                   /translation="MNKQLPLPIHQIDDATLENFYGDNNLLLLDSLRKNSSELKQPFFY
FT                   IWGNKGSGKTHLLRAFSNEYLINQRTAIYVPLSKSQYFSTAVLENLEQQALVCLDDLQS
FT                   VIGNDEWELAIFDLFNRIKASGKTLLLISADKSPSALSVKLPDLNSRLTWGEIYQLNSL
FT                   TDEQKIKVLQLAAYQRGFQLSDETANFLITRLARDMHTLFEALDLLDKASLQAQRNLTI
FT                   PFVKEILNL"
FT   CDS_pept        complement(547703..548947)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06030"
FT                   /product="probable uracil transporter"
FT                   /db_xref="GOA:E7A407"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:E7A407"
FT                   /protein_id="CBY80780.1"
FT                   /translation="MTNQIPPSLAENQSKLKQSFVGLQMLFVAFGALVLVPLITGLDSN
FT                   TALLTAGVGTLLFQFCTGKQVPIFLASSFAFIAPIQYGVQTWGIATTMGGLAFTGLVYF
FT                   ALSTLVKLRGAEALQRFFPPVVVGPVIIIIGMGLAPIAVDMSLGKNSAYAYNDAVLVSM
FT                   VTLLTTLSVAVFAKGLMKLIPIMFGITAGYILCLFLGLINFQPVIDAPWFSLPKLTTPE
FT                   FNLEAILYMLPIAIAPAVEHVGGIMAISSVTGKDFLKKPGLHRTLLGDGVATAAASLVG
FT                   GPPNTTYAEVTGAVMLTRNFNPNIMTWAAVWAIAISFCGKVGAFLSTIPTIVMGGIMML
FT                   VFGSIAVVGMSTLIRGKVDVTEARNLCIISVVMTFGIGNMFVDVGNVSLKGISLCAIVA
FT                   IILNLVLPKAKNEVE"
FT   CDS_pept        complement(549051..549677)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06040"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /db_xref="GOA:E7A408"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:E7A408"
FT                   /protein_id="CBY80781.1"
FT                   /translation="MKLVEVKHPLVKHKLGVMREAEIDTKKFRELATEIGSLLTYEATS
FT                   DLETEKVTINGWNGPVEIDRIKGKKVTVVPILRAGLGMMDGVLEHVPSARISVVGIYRN
FT                   EETLEPVPYFQKLASDLEERLAIVVDPMLATGGSMIATLDLLKAKGCKHIKVLVLVAAP
FT                   EGIKALEAAHPDIELYCASIDSHLNEQGYIIPGLGDAGDKIFGTK"
FT   CDS_pept        complement(549801..551867)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06050"
FT                   /product="DNA polymerase III/DNA elongation factor III, tau
FT                   and gamma subunits"
FT                   /db_xref="GOA:E7A409"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR021029"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A409"
FT                   /protein_id="CBY80782.1"
FT                   /translation="MSYQVLARKWRPKTFADVVGQEHIISALANGLKDNRLHHAYLFSG
FT                   TRGVGKTSIARLFAKGLNCVHGVTATPCGECENCKAIEQGNFIDLIEIDAASRTKVEDT
FT                   RELLDNVQYKPVVGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLP
FT                   VTILSRCLQFHLKALDETQISQHLAHILTQENIPFEDPALVKLAKAAQGSIRDSLSLTD
FT                   QAIAMGDRQVTNNVVSNMLGLLDDNYSVDILYALHQGNGELLMRTLQRVADAAGDWDKL
FT                   LGECAEKLHQIALMQLLPQKSSDNNEHFSFLAKHISPENVQFFYQVIVSGRKDLSNAPN
FT                   RRIGAEMTLLRALAFHPKFLTAVPKANTTITPPPSTPSAVENTGNYVDVPVLSQSIKSA
FT                   YSQAKPNKTSIPNLASLSALDALEHLTQLENQERQEHKAESLAVVSETLHHIQELDEEK
FT                   SHKKMTALPVREMTEPKPKHIEKPTLPSNAAQAPQKNSTEENSSDDNVEIAQDEQEILS
FT                   ADTYRWEWSNPELAKADTGVRPSDIKQAILKDITPELRLKIITQTQQQDEWADIVERSG
FT                   VTGFSKELALNCFLQSKTDDEINLGLHSEKSHLRQDRSIKNLAEALSKLQGKDIRLTIN
FT                   LDDSNVMTPIEYRRNIYQALREKAQNELQKDSKLQILLNEFDAKLDIESIRPV"
FT   CDS_pept        complement(551879..552421)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06060"
FT                   /product="adenine phosphoribosyltransferase"
FT                   /db_xref="GOA:E7A410"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005764"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E7A410"
FT                   /protein_id="CBY80783.1"
FT                   /translation="MTTQLDLIKSSIKSIPNYPKEGIIFRDITTLLEVPAAFKATIDLI
FT                   VEQYRDKGITKVLGTESRGFIFGAPVALALGLPFELVRKPKKLPRETISQSYQLEYGQD
FT                   TLEMHVDAISEGDNVLIIDDLLATGGTVEATVKLVQRLGGAVKHAAFVINLPELGGEKR
FT                   LNNLGVDCYTLVNFEGH"
FT   CDS_pept        complement(552580..554004)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06070"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /db_xref="GOA:E7A411"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E7A411"
FT                   /protein_id="CBY80784.1"
FT                   /translation="MSKEIKTQVVVLGAGPAGYSAAFRCADLGLETVIVERYSTLGGVC
FT                   LNVGCIPSKALLHVAKVIEEAKHANKNGIYFSEPRIELDEVRAGKEAVVAKLTGGLAGM
FT                   AKARKVTVVEGLATFTDSHTLVARDRDGNPTTVKFDNAIIAAGSRPVQLPFIPHEDPRI
FT                   WDSTDALKLKEVPKKLLIMGGGIIGLEMGTVYNALGSEVEVVEMFDQVIPAADKDVVGI
FT                   YTKQVEKKFKLMLETKVTAVEAKDDGIYVSMEGKACNDTKRYDAVLVAIGRVPNGKLID
FT                   AGKAGVEVDDRGFIHVDKQMRTNVPHIYAIGDIVGQPMLAHKGVHEGHVAAEVIAGQKH
FT                   YFDPKVIPSIAYTEPEVAWVGKTEKECKQEGLNYEVAKFPWAASGRAIASECSEGMTKL
FT                   IFDKDTHRVLGGAIVGSNGGELLGEIGLAIEMGCDAEDIALTIHAHPTLHESVGLAAEV
FT                   FEGSITDLPNAKAKKK"
FT   CDS_pept        complement(554118..555764)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06080"
FT                   /product="Dihydrolipoamide acetyltransferase"
FT                   /db_xref="GOA:E7A412"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006256"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:E7A412"
FT                   /protein_id="CBY80785.1"
FT                   /translation="MSKQIQIPDIGSDEVTVTEVMVNVGDTISVDQSIINVEGDKASME
FT                   VPAPEAGVVKEILVKVGDKVSTGTPMLVLEAAGAAPVADAPTAPVVATAPTASAIVEVN
FT                   VPDIGSDEVNVTEIMVKVGDSVEVDQSIINVEGDKASMEVPAPIAGVVKEILINVGDQV
FT                   STGKLIMKFETASAAPAAEVAPAQVATPAAPAASASTSAQAPQAAAPDTTAQAAQSNNN
FT                   VSGLSQEQVEASTGYAHATPVIRRLAREFGVNLDKVKGTGRKGRIVKEDIEAYVKTAVK
FT                   AYESGATAQTTGNGVANGAGLGLLPWPKVDFSKFGEIEEVELSRINKISGANLHRNWVI
FT                   IPHVTHFDKADITDLEAFRKEQNALAEKQKLGVKITPVVFIMKAVAKALEAYPRFNSSI
FT                   TEDAQRLILKKYINIGVAVDTPNGLVVPVFKNVNKKGIIELSRELMEVSKKAREGKLTA
FT                   SDMQGGCFTISSLGGIGTTHFAPIVNAPEVAILGVSKSSMEPVWNGKEFAPRLILPMSL
FT                   SFDHRVIDGADGARFISYLGSVLADLRRLVM"
FT   CDS_pept        complement(555827..558487)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06090"
FT                   /product="pyruvate dehydrogenase, decarboxylase component
FT                   E1, thiamin-binding"
FT                   /db_xref="GOA:E7A413"
FT                   /db_xref="InterPro:IPR004660"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR035807"
FT                   /db_xref="InterPro:IPR041621"
FT                   /db_xref="UniProtKB/TrEMBL:E7A413"
FT                   /protein_id="CBY80786.1"
FT                   /translation="MSEILKNDVDPIETQDWLQSLDSLIREEGVERAQYIVEQVIGQAR
FT                   TSGVSLPTGVTTDYVNTIPVAEQPAYPGDHAIERRIRSAVRWNAIAMVLRSQKKDLDLG
FT                   GHISTFQSAATMYEVCYNHFFKAATEKNGGDLIFFQGHAAPGMYARAFLEGRLTEEQMD
FT                   NFRQEAFTDGLSSYPHPKLMPEFWQFSTVSMGLGPVNAIYQARFLKYLDNRGLKDTKDQ
FT                   KVYAFLGDGEMDEIESKGALTFAAREKLDNLIFTISCNLQRLDGPVNGNGKIVQELEGL
FT                   FTGAGWEVIKVLWGSNWDKLFAKDTSGKLTQLMMEVVDGDYLTFKSKDGAYIREHFFGR
FT                   YPETAALVADMTDDEIWALRRGAHDSEKLYAAYAKAQNATKPVVILAHQVKGYKIPEAE
FT                   SKNTAHQSKKMSYESLKGFRDFFELPLTDEQVEKLEYIKFAEGTPEYEYLHGHRKALNG
FT                   YVPARRTKFDVEYKVPALEEFKALLEEQPRGISTTMAFTRALNILLKDKNIGKTIVPMI
FT                   ADEARTFGMEGLFRQVGIYNPHGQNYVPSDRDLVAYYREAKDGQVLQEGINELGATASW
FT                   LAAANSYSVNNQPMIPFFIYYSMFGFQRVGDMMWAAGDQLARGFMVGGTSGRTTLNGEG
FT                   LQHEDGHSHIQAGIIPNCITYDPSFAFEVAVIMQDGINRMYGEKQEDVFYYMTTLNEVM
FT                   DQPAMPAGAEEGIRKGLYKFETVEGKKGKGHVQLLGSGAIMRHVREAAQILANDYGVTS
FT                   DVFSAPSFNELAREGHDAARWNLLHPTETQRVPYVAQVLADLPTVASTDYVKAYADQIR
FT                   AFVPSKHYHVLGTDGFGRSDSRANLREHFEVDARYVVVAALSQLAKEGTVSNQVVADAI
FT                   AKFGLNVDRINPLYA"
FT   CDS_pept        558788..559246
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06100"
FT                   /product="methylglyoxal synthase"
FT                   /db_xref="GOA:E7A414"
FT                   /db_xref="InterPro:IPR004363"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR018148"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:E7A414"
FT                   /protein_id="CBY80787.1"
FT                   /translation="MQTTTRTLTQHKRIALVAHDSCKKNLLNWTQKHKETLKPHILYAT
FT                   GTTGHILERETGLSIQSLLSGPMGGDQQLGGLIAEKKIDMMIFFWDPMNAAPHDPDVKA
FT                   LMRIATVWNVPVAINQSSADFLLTSVLFEQDVEVEVPDYEGYLEERLA"
FT   CDS_pept        complement(559391..560833)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010352"
FT                   /db_xref="UniProtKB/TrEMBL:E7A415"
FT                   /protein_id="CBY80788.1"
FT                   /translation="MKKSKIAAGVVVALAAVWCTGAWFTGKKAEEEYLYQLKQLNQLFT
FT                   KTEALEESKIFYKNIKFERGLFASHIQDQIEIHKANETIIIPLSSTLYHGPLPLDRVAK
FT                   LNFVPTIFSSQTLLEKNATTQAFFDITESEKPLQLNFAMNYSLSGNAELKLASGQYHNE
FT                   QSKTDFDWSNVVLNIDLNQNTPNNYVLSVDTFNSNTPNHAVSTASSIKIKDLVVQGSLQ
FT                   STKWPFIYSGNINSKIGYFEQNTESAETGEKFSLIQKNSQANLTTQVEGDTVNIINKTN
FT                   LDELHINGNNLGKVSNNVEFNHIDGNALQELLNILVAIGKADSDTPLSKPLVQKLQQAG
FT                   MIIANNQPQIKFTPLSISDEKGKVALDLNIALVPNPKFDLMRSGLYKQFKDFSINFDVN
FT                   KETAISLLSKFVPENQKQDFVRRLNELVTEGEVNDIIVNTDKTVTLTLALENNDLKLNG
FT                   KPIPEEQLKVVLFILVMGGFGR"
FT   CDS_pept        561099..563006
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06120"
FT                   /product="Chaperone protein dnaK"
FT                   /db_xref="GOA:E7A416"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:E7A416"
FT                   /protein_id="CBY80789.1"
FT                   /translation="MGKIIGIDLGTTNSCVAVMDGDKARVIENAEGARTTPSIIAYTDN
FT                   ETLVGQPAKRQAITNPKNTLFAIKRLIGRRFESEEVQRDIKIMPFEITRADNGDAWVNV
FT                   KGDKLAPPQISAEVLKKMKKTAEDFLGEAVTEAVITVPAYFNDAQRQATIDAGKIAGLD
FT                   VKRIINEPTAAALAFGLGSSKENQVIAVYDLGGGTFDISIIEIDNFDGEQTFEVLATGG
FT                   NTHLGGEDFDNRVIDYIIDEFKKEQNIDLRNDAMALQRVKEAAEKAKIELSSAQSTEVN
FT                   LPYITADATGPKHLALNITRAKLEALVEDLVASSIESLKAVLKDADKGVSEIHDIILVG
FT                   GQTRMPLVQQKVAEFFGKEARKDVNPDEAVAIGAAVQGGVLKGDVKDVLLLDVTPLSLG
FT                   IETMGGVMTTLIEKNTTIPTKKSQVFSTAEDNQSAVTIHVLQGERKRAADNKSLGQFNL
FT                   EGINPASRGMPQIEVTFDIDANGVINVSAKDKNTGKEQQIRIQASSGLSDEEIQQMVRD
FT                   AEANADADRKFEEVVQARNQADGIAHATRKQIAEAGDALSVADKEKIEAAVAELETAAK
FT                   GEDKAEIEAKIEAVIKASEPLMQAVQAKAQQAGGEQPQQSSAKDDGVVDAEFEEVKDNK
FT                   "
FT   CDS_pept        563093..564238
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06130"
FT                   /product="Chaperone protein dnaJ"
FT                   /db_xref="GOA:E7A417"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:E7A417"
FT                   /protein_id="CBY80790.1"
FT                   /translation="MAKKDYYEVLGLQKGASEDDIKRAYKRLASKHHPDKNQGSKEAEE
FT                   KFKEINEAYEVLGDDQKRAAYDQYGHAAFEGGGAGGFGGGFGGADFGDMFGDIFGDIFG
FT                   GGGRGRQRVVRGEDLRYDLEISLEEAVKGTTKDIQINTLAHCDSCGGSEAEKGSKVETC
FT                   PHCHGSGRIHRQQGFFVSESICPTCHGSGKKIEKPCRSCHGEGRVHKKENLSVKIPAGV
FT                   DTGNQLRLAGKGAAGENGAPAGDLYVVIHVREHHIFERDGSNLYCEVPISFATAALGGE
FT                   IEVPTLDGRVKLKIPAETQTGKLFRMRGKGVASTRSGYAGDLICRIVVETPVNLTSEQK
FT                   ELLHKLEESLQGKDLSKHAPKSSGFLDGVKKFFDNLGKSDK"
FT   CDS_pept        complement(564317..565426)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06140"
FT                   /product="Gamma-glutamyl phosphate reductase"
FT                   /db_xref="GOA:E7A418"
FT                   /db_xref="InterPro:IPR000965"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR020593"
FT                   /db_xref="UniProtKB/TrEMBL:E7A418"
FT                   /protein_id="CBY80791.1"
FT                   /translation="MLEQMGKQAKDAAFILAQLTTAEKNCALSIIAEQLEQQAPLILDE
FT                   NAKDIELAKQNGLSDALIDRLLLTQERLQGIANDVRHVISLADPVGKIIDGGKETQFSN
FT                   KILIEVVQNALEQAGLPKFAVQAITDPNRELVMQLLKLDRYVDMIIPRGGAGLHELCKQ
FT                   HSTIPVIVGGVGVCHTFVEESADQNKAVFVIDNAKTQRPSTCNTLETLLVQDSIAEEFL
FT                   PKLVSHLVTKNVKYHAKSTALNILKQAGANVCKVTEKELRKEWGSLDLNVVVVEDIHAA
FT                   IEHIRQYGTQHSESILTSSQNLARQFINQVDAAAVYVNASTRFTDGGQFGLGSEVAVST
FT                   QKLHARGPMGLEALTSYKWVCEGEYTVRK"
FT   CDS_pept        complement(565447..566109)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06150"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="GOA:E7A419"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:E7A419"
FT                   /protein_id="CBY80792.1"
FT                   /translation="MLLSILYIIGITAEGMTGALAAGREKMDIFGVIIIASVTAIGGGS
FT                   VRDVLLGHYPLGWVKHPEYFLMVASAAVITVYVAPFINHFMRYFRTIFLVLDAMGLVVY
FT                   SIIGAQIAMDMGHSLTIVCIAGCITGAFGGVLRDMLCNRIPLVFQKELYASIALFATLT
FT                   YYALSTLQVEHTLAVLLTLISSFTLRLLAIHFEWGLPVFNYQELTSEEQDKLPNKKK"
FT   CDS_pept        566207..567007
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A420"
FT                   /db_xref="UniProtKB/TrEMBL:E7A420"
FT                   /protein_id="CBY80793.1"
FT                   /translation="MSEQSSKYIAALLAVLSISMVLGIDLFIFSLQSEKQTMPHLGVGV
FT                   LVAQLISLLVFYRGEICPGQRGRLIKVNMTFAIYWAVWLLISLLQNNHTLTNVMSVCGL
FT                   SVVYFIWKQPKTEKIRNSFLLMAALIAGLGCLSYLMIFTVLPASDFAEYNPFAPILSGV
FT                   ILANLALVIARNRLQGFIALLPLAMIILLALNALAMFLFLLLNGMESAVNSDSVFAYII
FT                   YFVCHFVIAAILILHSFQKWKLSANSLFILLFIAVCLPLWMVFV"
FT   CDS_pept        complement(567039..568235)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06170"
FT                   /product="bicyclomycin/multidrug efflux system"
FT                   /db_xref="GOA:E7A421"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:E7A421"
FT                   /protein_id="CBY80794.1"
FT                   /translation="MNQQKSTFIFILTLGILSMLPPFGVDMYLPSFLEIAKDLGVSPEQ
FT                   VQHTLTSFAYGMAFGQLFWGPFGDSFGRKPIILLGVIVGALTALVLTEINSVGNFTALR
FT                   FVQGFFGAAPVVLSGALLRDLFSKDQLSKVMSTITLVFMLAPLVAPIIGGYIVKCFHWH
FT                   AIFYIISLVGLLAAALVFFIIPETHKKENRIPLRLNIIARNFLLLWKQKEVLGYMFAAS
FT                   FSFGGLFAFVTAGSIVYIGIYGVPVDQFGYFFMMNIVTMIFASFLNSRFATKVGAETML
FT                   RIALAIQFLSGMWLILTALLDLGFWPMAIGVAFFVGPNPVISSNAMASALERCPQMAGT
FT                   TNSLIGSVRFAVGAIMGSLVASMKMDTAAPMLFTMGACVVISVLAYYFLTSRNLKSRG"
FT   CDS_pept        complement(568237..568935)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06180"
FT                   /product="ribosomal small subunit pseudouridine synthase A"
FT                   /db_xref="GOA:E7A422"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:E7A422"
FT                   /protein_id="CBY80795.1"
FT                   /translation="MRLDKFIAENTGLTRSQATKAIHQSAVKINGEIVKSGAVQISQED
FT                   KIYFEDELLTWVEEDQYFMLHKPQGCVCSNDDGDYPTIYQFFDYPLAGKLHSAGRLDVD
FT                   TTGLVLLTDDGQWSHRITSPKHHCEKTYLVTLADPVEENYAAACSEGILLRGEKEPTKP
FT                   AKLEILDDYNVNLTISEGRYHQVKRMFAALGNKVVGLHRWKIGDVVLDESLEEGEYRPL
FT                   TQSEIEKLVK"
FT   CDS_pept        complement(569026..569646)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR015037"
FT                   /db_xref="InterPro:IPR037226"
FT                   /db_xref="UniProtKB/TrEMBL:E7A423"
FT                   /protein_id="CBY80796.1"
FT                   /translation="MNPFQKIKSAVNKCQRFFINRTLQRKLTNQGMTVISANCMGAFIL
FT                   HDLHQPFNSPFVNLYLSPQDFLRYLQNMDFYRTQPLTFVQTEKSYPVGKLADLDIHFMH
FT                   YHSEQEANEKWQLRTSRMNFDNLFIMMTDRDGVTEKDIQLFDQLPFKNKVIFTHKPYPA
FT                   FKSAYYIKGFEKQNQVVDIFEFSGWNGKKYYDQFDYVKWFNHA"
FT   CDS_pept        569843..572113
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06200"
FT                   /product="fused malic enzyme predicted
FT                   oxidoreductase/predicted phosphotransacetylase"
FT                   /db_xref="GOA:E7A424"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR012188"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="InterPro:IPR042112"
FT                   /db_xref="InterPro:IPR042113"
FT                   /db_xref="UniProtKB/TrEMBL:E7A424"
FT                   /protein_id="CBY80797.1"
FT                   /translation="MTEQLRQAALDFHEFPIPGKIEVTPTKSLATQRDLALAYSPGVAE
FT                   PCLEIEKDPAASYKYTARGNLVAVISNGTAVLGLGNIGALAGKPVMEGKGVLFKKFAGI
FT                   NVFDIEVNEHDPDKLVDIIASLEPTFGGVNLEDIKAPECFYIEQKLRERMNIPVFHDDQ
FT                   HGTAIISAAAIINSLRIVGKKIEDVRLVASGAGAASIACLNLLLSLGMKRENITVCDSK
FT                   GVVYKGRDDKMDQTKKEYAIEDNGWRKLGDAMPNADIFLGCSAAGALTQDMVKSMAAHP
FT                   IILALANPNPEITPPEAKAVRPDAIVCTGRSDYPNQVNNVLCFPFIFRGALDVGATTIN
FT                   EEMKRAAVYAIADLALEEQNEVVTSAYGGEGATFGADYVIPRPFDPRLIVRIAPAVAKA
FT                   AMESGVATRPIQNWDAYVEKLTQFVYKTSLFMRPIFSQAKAAKQRVILAEGEENKALHA
FT                   TQEVISMGLANPILIGRRSVIEEKIKKLGLRLTAGVDFEIVDNEDNPRYEECWKHYYEL
FT                   TKRKGITPAIAKRVVRSNTTVLASTLLSLGYADALVCGLFGSYGKHLASIRDIIGLKDG
FT                   VKTAAALNSLVLPTGNVFLTDTHVNSNPTAEELAEITLMAAEEIHRFGIEPAVALLSHS
FT                   NFGSSDSLGAPKMREVLQIVKERNPHLMIDGEMRGDLAMNEAHRKELMPDSPLKGSANL
FT                   LVFPDLSASRISYSLLRGTTTAITVGPILMGMNKSAHILNPGASVRRIINMIAYAAVKA
FT                   QQE"
FT   CDS_pept        572382..574307
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06210"
FT                   /product="predicted phosphoglycerol transferase-like
FT                   protein"
FT                   /db_xref="GOA:E7A425"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:E7A425"
FT                   /protein_id="CBY80798.1"
FT                   /translation="MKKAYFPLFPIFTFVLINLILLSLSRLGLAVWQSERVFAVDGWLQ
FT                   LFLQGVRMDVVALCYLFGVPALLTTLFHSSKVWVKILRLWLTLGSVFIIFMEIATPAFI
FT                   ETYDYRPNRLFIEYLIYPKEVFSMLAEGHLSAVIFSLVFTILAAVIYWKISGWAVKNLG
FT                   SMSWKLRPVIALLVIVVSFLGARSSFQHRGINPAMVAFSSDALVNSLVLNSGYSVIYAA
FT                   QQFKDEEKSSEMYGKMDADEMFRIVKASRGRPDSDYISDKYPTLTKNVATYQGKPKNIV
FT                   ILLQESLGAQFIGTLGGKPLSPNVDQLAKEGWLFENLYATGTRSVRGIEATTAGFTPTP
FT                   ARAVVKLNNAQSGFFTIANLLHKQGYNTSFIYGGEKHFDNMASFFYGNGFKDIWDQQDY
FT                   QNPTFTGTWGVSDEDLFDKANETFTKLQNEGKPFFSLVFSSSNHDPFEYPDGKIELYEQ
FT                   PKATRNNAAKYADYALGHFFKMAKQSNYWKDTIFLIVADHDSRVGGASLVPIKHFHIPA
FT                   LILGDGITPRRDSRLVSQIDMPTTLLSLAGVSGNYPMIGFDLTQDVNPDRAFMQYDQTQ
FT                   AMMKGNNDVVIQMPNKAAQGYHYDKSTETLTPKEVPDAMKKEALAHALLGSYLYKNRLY
FT                   SSGENK"
FT   CDS_pept        complement(574338..576377)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06220"
FT                   /product="excinulease of nucleotide excision repair, DNA
FT                   damage recognition component"
FT                   /product="UvrABC system protein B"
FT                   /db_xref="GOA:E7A426"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E7A426"
FT                   /protein_id="CBY80799.1"
FT                   /translation="MSEKINTKPFILHSDFRPSGDQPQAIEKLAENLTDGLAHQTLLGV
FT                   TGSGKTFTIANVIAQLNRPAMLLAPNKTLAAQLYAEMKAFFPENAVEYFVSYYDYYQPE
FT                   AYVPSSDTFIEKDASINDQIEQMRLSATKSFLERRDTIVVASVSAIYGLGDPDSYLQMM
FT                   LHLQQGAIIDQRQILAKLAELQYTRNDQAFQRGTFRVRGEIIDIFPAESDDRAVRIELF
FT                   DDEIERLSLFDPLTGSSFGAVPRFTIYPKTHYVTPRERILDAIENIKKELVSRREYFIK
FT                   EHKLLEEQRISQRTQFDIEMMNELGYCSGIENYSRYLSGRNEGEPPPTLFDYMPSDAIL
FT                   IIDESHVTVPQIGGMYRGDRSRKETLVEYGFRLPSALDNRPLRFEEFERLAPQTIYVSA
FT                   TPGAYELEKSGSEIIDQVVRPTGLLDPLIEIRPVSIQVDDLLSEARQRADKNERVLVTT
FT                   LTKKMAEDLTDYLDEHGIRVRYLHSDIDTVERVEIIRDLRLGEFDVLVGINLLREGLDI
FT                   PEVSLVAILDADKEGFLRSERSLIQTIGRAARNLNGKAILYADSITKSMEKAITETNRR
FT                   REKQTKYNEEHGIVPQALNKKVGELLDIGQGANQKAKANKQRGKMAAEPTALYNAPKNA
FT                   KEYQQQIKKLEQQMYKFAQDLEFEKAAAIRDQLHQLREQFVFDN"
FT   tRNA            complement(576799..576871)
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:576836..576838,aa:Asn)"
FT                   /note="tRNA Asn anticodon GTT, Cove score 81.00"
FT   repeat_region   577078..577093
FT                   /note="TA x8"
FT   CDS_pept        577196..581668
FT                   /transl_table=11
FT                   /gene="tabA1"
FT                   /locus_tag="HIBPF_06240"
FT                   /product="putative trimeric autotransporter adhesin"
FT                   /db_xref="GOA:E7A427"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:E7A427"
FT                   /protein_id="CBY80800.1"
FT                   /translation="MNRIFKIIWNKTTQRLEVVSELTKGAVKASSTSSSEKNNKTLPIS
FT                   ILATLVTSILASSVSYADKINYNDIPTQGVAVVSDKDSDILRNMALEGTESLGFLSASN
FT                   AVNSLNKMLGHYKGFVHVNSEGDKTNKTGIWDDWLTAKTSKVEAETKNSGGAFSYNLGK
FT                   FTEKSGAQGSRSVAVGVYANALAADSIAIGSRANVNNYWGNQYREALNGIAIGRQAQVE
FT                   GAINSIAFGTNAKLLASTPYALKPDNSIAIGNNSTVNWASNAIALGNNASITGAHAVNG
FT                   AWQGSDNSIAIGHETKIGRENTVAIGSNVNAQRENTVAIGTNVTAKRENSVVIGQNAKG
FT                   ELERVVAIGAYAAANGDRTVAIGPEATANGSKSIVIGGLGNNKTDNKAQSEKGATQAIV
FT                   IGNGAQAKAAASYSITLGNSAKTEAATGISIGDRANVASGANSGIALGKSAVANKSGDI
FT                   AIGESSSTSDKHTVNGLKIGDTTLSTGVAATNNGTVSFGNNNVKRQIQNVGAGEISENS
FT                   SDAITGSQLYSVIKATDEIAKTTYTFKVNGQDVKIMQNKAVSATNNANNTLDFKAGDGL
FT                   EVAYENGAVTYKLNSESKKSIADAKAAAKTVSDKLVEINKSVERAETAASSAASSASAA
FT                   STSASAASSSATAASDSASAASSSATAASSSATAASSSASAANSSATAASSSASASAAS
FT                   SSATAASDSASAASSSASAASSSATAASDSASAASSSATAASSSASAANSSATAASSSA
FT                   SAASSSATAASDSASAASSSASAASSSATAASDSASAASSSATAASSSASAANSSATAA
FT                   SSSASAASSSATAASDSASAASSSASAASSSATAASDSASAASSSATAASSSASAANSS
FT                   ATAASSSASAASSSATAASDSASAASSSASAASSSATAASDSASAASSSATAASSSASA
FT                   ANSSATAASSSASAASSSATAASDSASAASSSASAASSSATAASDSASAASSSATAASS
FT                   SASAANSSATAASSSASAASSSATAASDSASAASSSASAASSSATAASDSASAASSSAS
FT                   AASSSATAASDSASAASSSASAASSSATAASDSASAASSSATAASSSASAANSSATAAS
FT                   SSASAASSSATAASDSASAASSSASAASSSATAASDSASAASSSATAASSSASAANSSA
FT                   TAASSSASAASSSATAASDSASAASSSASAASSSATAASDSASAASSSASAASSSATAA
FT                   SDSASAASSSATAASSSASAANSSATAASSSASAASSSAAAAAITAQRIENSGLISKDG
FT                   KTAFAADNTSNRNSSKAKGKDATAMGYGSNASGENTTALGNNSQASAKNATAIGQGAKA
FT                   KAENAVAIGQGSVANEKDTVSVGNDGSNGQPIVNRRITNVATPIHNTDAVNKQYVDNSV
FT                   NSVRNELKQTDKKLRGGIAGAVAMANIPTANRAGGTMIGLGVGNFKGQNAVAVGMSKSS
FT                   DNNRIHFKVSGSATSTGDYAVGGGIGYQW"
FT   CDS_pept        581802..582938
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR021234"
FT                   /db_xref="UniProtKB/TrEMBL:E7A428"
FT                   /protein_id="CBY80801.1"
FT                   /translation="MKKYRIGITLNLEDPISDLWANGITQNIIHLYHLFQHSKIVENVV
FT                   LVSWGPEKRTSPPEGLMLDGIDLKFAYIEDVIDQLDVLIEAGLTIEPDQATRIHQHGGK
FT                   VVSYKMGNDFIMDIEYFLFGKKAGRLLNGTKFDAVWVLPHHNNTCNSYFSIMHSYSCYV
FT                   VPFIWSPIFCDKVIKRLKDQYNLDFGYKANSISKAKRIASFEANINVYKNCFTPILIAE
FT                   QAYREQPNKIQHVYMCNTYNKKDNPTFFNFIGRTNLIKDGVMTVEGRYQMPDFLTRYVD
FT                   IVLSHQWENGLNYAYNDALYGGYPFIHNSKLIPKGVGYYYDQFDAFEGAKVLLDVIDNH
FT                   DKHHEEYVKRANEYLDSQLPTNPVNIYMYEKELKRLFS"
FT   CDS_pept        583104..583679
FT                   /transl_table=11
FT                   /gene="IS1016-V6"
FT                   /locus_tag="HIBPF_06260"
FT                   /product="IS1016-V6"
FT                   /db_xref="InterPro:IPR024445"
FT                   /db_xref="UniProtKB/TrEMBL:E7A429"
FT                   /protein_id="CBY80802.1"
FT                   /translation="MKITHCKLKKSIQNKLLEFFVLEVTARAAADLLGIQANSAILFYR
FT                   KIREVISYHLALEADEVFDGQIELDESYFGGHRKGKRGLGAAGKVAVFGLLKRQGKVFT
FT                   VVVENTKTETLMPVIVRKIKPHSWVYTNTYRSYDALDVSKFHHERINHSELFAVKQNHI
FT                   NGIENFWSQAKKYSENIMESTEKTFLYS"
FT   CDS_pept        complement(<583884..584816)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06330"
FT                   /product="predicted ABC-type transport system, permease
FT                   component"
FT                   /db_xref="GOA:E7A430"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:E7A430"
FT                   /protein_id="CBY80803.1"
FT                   /translation="MKKYKTGLVLLVITLALLAYFSPWFFLHIASWQKEFNQLISENLH
FT                   QIQNNSIKAGITLIFASFVYGVLHALGPGHGKFIIASYLSTHESQLKQSTILSLLSSLM
FT                   QGIVAITATTLLVVVLNLSSRYFKLSQLWLERTALLLLVFLGCYWIWQGLRAYRKKAKL
FT                   TIKSLNPLPLHEKSAVKNNRTFQPNTCSCGHQHLPSPTQTAQATNLKSQFLVILTIGMR
FT                   PCSGAIFVLFLAYMLDLYGWGILAVLAMSFGTGLMLSAFAGIVRYARNTAIHLGRWYSS
FT                   KHTKGKSGSIVKLIAGGIMLFFALSLLYGT"
FT   CDS_pept        complement(584819..585439)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="InterPro:IPR016537"
FT                   /db_xref="UniProtKB/TrEMBL:E7A431"
FT                   /protein_id="CBY80804.1"
FT                   /translation="MKTYSLLLGLFISFGVLAHPHAFIDIQTTPIIENNQLTGFSMKWT
FT                   LDEPSSSAVIYDMKQARTKAEKQKLLDDVMGNIVSEHYFSYLYDAQNNKIKYSPRPKNY
FT                   GINVQGLQLQYYFDVPLAHPQKLEKNTFSLQTYDPTYYVAMTYASKSAVDFSALSKNCQ
FT                   GKLIEPNVDEKIQAYASSLDKSQKNEDDSLGVMFAQKIIIQCE"
FT   CDS_pept        585789..586064
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06350"
FT                   /product="DNA-damage-inducible protein J, negative
FT                   regulator of translation"
FT                   /db_xref="GOA:E7A432"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR026262"
FT                   /db_xref="UniProtKB/TrEMBL:E7A432"
FT                   /protein_id="CBY80805.1"
FT                   /translation="MAAVSFRVPDETKNIAFEVIKSYGLSPTQALNMFLAQIAKTKAIP
FT                   VSLDYQTEQMPNSKTIMAMAELDNHHGHEYKTLEEFHQAMLAEMKS"
FT   CDS_pept        586061..586324
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06351"
FT                   /product="addiction module antitoxin/putative RelE
FT                   toxin-like protein, plasmid stabilization system"
FT                   /db_xref="InterPro:IPR004386"
FT                   /db_xref="InterPro:IPR007712"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:E7A433"
FT                   /protein_id="CBY80806.1"
FT                   /translation="MISVSGEYKREFKKHIPLIINSPEYIEVMYCLLNSLPLPEKYKDH
FT                   ALTGNWKGWRDCHIKNDLVLIYKVVGDEIRLARLNTHSEIFG"
FT   CDS_pept        586419..588089
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06370"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:E7A434"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022374"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:E7A434"
FT                   /protein_id="CBY80807.1"
FT                   /translation="MSSQFVYTMHRVGKVVPPKRHILKDISLSFFPGAKIGVLGLNGAG
FT                   KSTLLRIMAGVDKEFEGEARPQLGIKIGYLPQEPKLEPQQTVREAVEEAVSEVKNALTR
FT                   LDEVYALYADPDADFDKLAAEQANLEAIIQAHDGHNLDNQLERAADALRLPDWDAKIEH
FT                   LSGGERRRVALCRLLLEKPDMLLLDEPTNHLDAESVAWLERFLHDYEGTVVAITHDRYF
FT                   LDNVAGWILELDRGEGIPWEGNYSSWLEQKEKRLEQEQATENARQKSIAKELEWVRQNP
FT                   KGRQAKSKARMARFDELNSGEYQKRNETNELFIPPGPRLGDKVIEVQNLTKSYGDRTLI
FT                   DDLSFSIPKGAIVGIIGANGAGKSTLFRMLSGQEQPDSGSVTMGETVVLASVDQFRDAM
FT                   DDKKTVWEEVSNGQDILTIGNFEIPSRAYVGRFNFKGVDQQKRVGELSGGERGRLHLAK
FT                   LLQRGGNVLLLDEPTNDLDVETLRALENAILEFPGCAMVISHDRWFLDRIATHILDYGD
FT                   EGKVTFYEGNFSDYEEWKKKTLGDAATQPHRIKYKRIAK"
FT   CDS_pept        588150..588491
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A435"
FT                   /db_xref="InterPro:IPR007360"
FT                   /db_xref="UniProtKB/TrEMBL:E7A435"
FT                   /protein_id="CBY80808.1"
FT                   /translation="MLVHLHIFFAFLSLALLVIRGAMQLNGKNWRSIKLLKILPHLSDT
FT                   LLIVSGVVILYIFTFYIEWWLVAKFALLILYIVFAAKLFSKKVSQPKPIFFWLACANFI
FT                   GAMLIAHLK"
FT   CDS_pept        588496..590466
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06390"
FT                   /product="Predicted P-loop ATPase fused to an
FT                   acetyltransferase"
FT                   /db_xref="GOA:E7A436"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007807"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR024914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032672"
FT                   /db_xref="InterPro:IPR033442"
FT                   /db_xref="InterPro:IPR038321"
FT                   /db_xref="UniProtKB/TrEMBL:E7A436"
FT                   /protein_id="CBY80809.1"
FT                   /translation="MSFRHLQILISKTLPLVSDNVLIIGESGIAFSKATNLLGQEFEHI
FT                   LFDGRNGIHLEALAIAAGTLKMGGTLCLVLSDWENLSQQPDQDSLRWNGNQLAIATPNF
FT                   IDHFKQCIERYHFPIFREESAVEFPPIFYSNEHHKNATLAQQQIIETILQAEQNIYFLT
FT                   AKRGRGKSALLGMLANQIQAPVYLTAPNKSAVHSVIEFSEREIEFIAPDELAIRLQNEP
FT                   EFSQPAWLLIDEAAMIPLPLLQEYSQYFQHIVFSTTIHSYEGTGRGFELKFKRKIHRTF
FT                   QHFELKQPLRWQENDLLEHFIDDLLLLNAEDDFQHFDYSNITYNIEENAKNLSFPCLRG
FT                   KVPEGRKGDLDIASLPQALEALLTSKGSEGKYNRQFFFRDFYGLMTIAHYRTSPLDLRR
FT                   VLDGKNQRFYFAEYQQNLLGAIWALEEGNMADDELIIQIQQGKRRPKGNLVPQALCFHE
FT                   NLSQACKLRSLRISRIAVQPNWQQKGIGQNLMQAMENADVDFLSVSFGYTDELAKFWQK
FT                   CGFVLVHLGEHQEASSGCYSAIALKGISKEGLALVDTAHKQFQRNLPLSFHPFAINFEQ
FT                   NQLDWQLDDFDWMSLKNFANFHRTLFSSVPAMRRLLKLAGKENFPLISAYLTKKQLPIN
FT                   KKKGVECLRLEIKQYLERGTL"
FT   CDS_pept        590463..590636
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR035292"
FT                   /db_xref="UniProtKB/TrEMBL:E7A437"
FT                   /protein_id="CBY80810.1"
FT                   /translation="MTEQAAKPKGWFKRALEKYDNFIKEWGLDQPNCSCVPMSATEDEN
FT                   GNLKKKESSLKK"
FT   CDS_pept        590738..594178
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06420"
FT                   /product="transcription-repair coupling factor"
FT                   /db_xref="GOA:E7A438"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:E7A438"
FT                   /protein_id="CBY80811.1"
FT                   /translation="MKTAFFQPDIPTQPNDHKILGNVLPSADALAISEIAEQNQNLTVV
FT                   VTPDTRSAVRLSRVLSELSSQNVCLFPDWETLPYDTFSPHQEIISSRLSALFHLQNAKK
FT                   GIFLLPISTLMQRLCPPQYLQHNVLLIKKGDRLVIDKMRLQLEAAGYRAVEQVLEHGEY
FT                   AVRGALLDLFPMGSAVPFRLDFFDDEIDSIRTFDVDTQRTLDEINSINLLPAHEFPTDD
FT                   KGIEFFRAQFRETFGEIRRDPEHIYQQVSKGTLISGIEYWQPLFFAEMATLFDYLPEQT
FT                   LFVDMENNQTQGERFYQDAKQRYEQRKVDPMRPLLSPEKLWLNVDEVNRRLKSYPRITF
FT                   KAEKVRSSVRQKNLPVAALPEVTIQSQQKEPLGQLRQFIEHFKGNLLFSVETEGRRETL
FT                   LDLLSPLKLKPKQIQSLEQIENEKFSLLVSSLEQGFIIEKSLPVAIIGEANLLGERIQQ
FT                   RSRDKRKTINPDTLVRNLAELKIGQPVVHLDHGVGRYGGLVTLDTGGIKAEYLLLNYAN
FT                   ESKLYVPVTSLHLISRYVGGSDESAPLHKLGNEAWAKSCQKAAEKIRDVAAELLDVYAQ
FT                   REAKKGFAFKYDREEFQQFAATFPFEETYDQEMAINAVISDMCQPKAMDRLVCGDVGFG
FT                   KTEVAMRAAFLAVMNHKQVAVLVPTTLLAQQHYENFKDRFANLPVNVEVLSRFKTAKEQ
FT                   KQILENLAEGKVDILIGTHKLIQSDVKFNDLGLLIIDEEHRFGVGQKEKIKQLRANIDI
FT                   LTLTATPIPRTLNMAMNGIRDLSIISTPPARRLSIKTFVRQNDDLVVREAILREILRGG
FT                   QVYYLHNDVASIENTAEKLTALVPEARVIVGHGQMRERELERVMSDFYHQRYNVLVCST
FT                   IIETGIDVPTANTIIIERADHFGLAQLHQLRGRVGRSHHQAYAYLLTPPPKMMTKDAER
FT                   RLDALENLDNLGAGFILATHDLEIRGAGELLGNEQSGQIENIGFSLYMELLDAAVKALK
FT                   EGREPSLEELTQQQADIELRVPALLPDDYLGDVNMRLSFYKRIAAAEGKAELDELKVEL
FT                   IDRFGLLPDATKNLLQITELRLLVEPLNVVRIDAGTQGGFIEFSAKAQVNPDKFIQLIQ
FT                   KEPIVYRFDGPFKFKFMKDLSDNKVRLEFVVDLLRTIAA"
FT   CDS_pept        complement(594231..595622)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06430"
FT                   /product="probable periplasmic serine protease do/HhoA-like
FT                   precursor"
FT                   /db_xref="GOA:E7A439"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:E7A439"
FT                   /protein_id="CBY80812.1"
FT                   /translation="MKKTRFVLNSIALGLSVLSTSFIAQATLPSFVSEQNSLAPMLEKV
FT                   QPAVVTLSVEGKAKVDSRSPFLDDIPEEFKFFFGDRFAEQFGGRGESKRNFRGLGSGVI
FT                   INASKGYVLTNNHVIDGADKITVQLQDGREFKAKLVGKDEQSDIALVQLEKPSNLTEIK
FT                   FADSDKLRVGDFTVAIGNPFGLGQTVTSGIVSALGRSTGSDSGTYENYIQTDAAVNRGN
FT                   SGGALVNLNGELIGINTAIISPSGGNAGIAFAIPSNQASNLVQQILEFGQVRRGLLGIK
FT                   GGELNADLAKAFNVSAQQGAFVSEVLPKSAAEKAGLKAGDIITAMNGQKISSFAEIRAK
FT                   IATTGAGKEISLTYLRDGKSHDVKMKLQADDGSQLSSKTELPALDGATLKDYDAKGVKG
FT                   IEITKIQPNSLAAQRGLKSGDIIIGINRQMIENIRELNKVLKTEPSAVALNILRGNSNF
FT                   YLLVQ"
FT   CDS_pept        595816..596706
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06440"
FT                   /product="acetyl-CoA carboxylase, beta (carboxyltranferase)
FT                   subunit"
FT                   /db_xref="GOA:E7A440"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="InterPro:IPR041010"
FT                   /db_xref="UniProtKB/TrEMBL:E7A440"
FT                   /protein_id="CBY80813.1"
FT                   /translation="MSWINRIFSKSPSSSTRKANVPEGVWTKCTSCEQVLYSEELKRNL
FT                   YVCPKCGHHMRIDARERLLKLLDEGSSQEIAADLEPKDILKFKDLKKYKDRINAAQKET
FT                   GEKDALITMTGTLYDMPIVVAASNFAFMGGSMGSVVGAKFVKAAEKAMEMNCPFVCFSA
FT                   SGGARMQEALFSLMQMAKTSAVLAQMREKGVPFISVLTDPTLGGVSASFAMLGDLNIAE
FT                   PKALIGFAGPRVIEQTVREKLPEGFQRSEFLLEKGAIDMIVKRSEMRQTLASVLSKLTN
FT                   QPSPFVEPELISEDE"
FT   CDS_pept        596708..598012
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06450"
FT                   /product="folylpolyglutamate synthase"
FT                   /db_xref="GOA:E7A441"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:E7A441"
FT                   /protein_id="CBY80814.1"
FT                   /translation="MQLKATSPLAEWLSYLEKSHFKPIDLGLDRIQSVAEKLDLLHPAP
FT                   YVITVGGTNGKGTTCRLLETILLNHGLRVGVYSSPHLLRYNERVRIQNQDLPDEAHTAS
FT                   FAFIDENKTESLTYFEFSTLSALHLFKQAKLDVVILEVGLGGRLDATNIVDSHLAVITS
FT                   IDIDHTDFLGDTREAIAFEKAGIFCENCPVVIGEPNVPQTMLDQAEKLHCQVARRDVDW
FT                   SFEQNAENWQWQNKKVRLENLPFCQIPLANAATALAAVQCLPFDISEQTLRKSLQEVEL
FT                   VGRFQAIKTDKREKLADYLGVPVETLPTIIVDVGHNPHAAKYLSEKLTALKCNIEGKII
FT                   AVCGMLKDKDANGVFAHLTPIIDEWHCVTLGGYRGQSGDELAEKLKSNFPNIQATSDNS
FT                   VMDGVCTALKSAVKNDVVLVFGSFHTVAEFWAVVE"
FT   CDS_pept        complement(598087..598689)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06451"
FT                   /product="putative outer membrane autotransporter
FT                   barrel,Neisseria"
FT   CDS_pept        complement(598882..599562)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06470"
FT                   /product="SanA"
FT                   /db_xref="GOA:E7A442"
FT                   /db_xref="InterPro:IPR003848"
FT                   /db_xref="UniProtKB/TrEMBL:E7A442"
FT                   /protein_id="CBY80816.1"
FT                   /translation="MFTAMLVKKFSPKFTALFRALFYAIFALIILCLLVDRGVSFYVCD
FT                   KIFINIDELPFRPYALVLGTSKYTASGKPNVYYDSRLMAAKSLIEQQKVNYLLLSGDNR
FT                   TLQYNEPRAMFRDLRKMGVPETLMFRDFAGFRTLDSVIRADKIFQVQAFTIVSQKFHCE
FT                   RALLIAQAHNIDAICFVAKQPELHFSTQIREVFARIKAVFDLILGVEPYFLGEPQPLPN
FT                   STTL"
FT   CDS_pept        599720..600796
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06480"
FT                   /product="homoserine O-acetyltransferase"
FT                   /db_xref="GOA:E7A443"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:E7A443"
FT                   /protein_id="CBY80817.1"
FT                   /translation="MSVQNVVLFDTQPLTLMLGGKLSYINVAYQTYGTLNDEKNNAVLI
FT                   CHALTGDAEPYFDDGRDGWWQNFMGAGLALDTDRYFFISSNVLGGCKGTTGPSSINPQT
FT                   GKPYGSQFPNIVVQDIVKVQKALLDHLGVSHLKAIIGGSFGGMQANQWAIDYPDFMDNI
FT                   VNLCSSIYFSAEAIGFNHVMRQAVINDPNFNGGDYYEGTPPDQGLSIARMLGMLTYRTD
FT                   LQLAKAFGRATKSDGSFWGDYFQVESYLSYQGKKFLERFDANSYLHLLRALDMYDPSLG
FT                   YDNVKEALSRIKARYTLVSVTTDQLFKPIDLYKSKQLLEQSGVDLHFYEFPSDYGHDAF
FT                   LVDYDQFEKRIRDGLAGN"
FT   CDS_pept        complement(600851..603499)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06490"
FT                   /product="DNA gyrase (type II topoisomerase), subunit A"
FT                   /db_xref="GOA:E7A444"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E7A444"
FT                   /protein_id="CBY80818.1"
FT                   /translation="MTDSIQSSITPVNIEEELKSSYLDYAMSVIVGRALPDVRDGLKPV
FT                   HRRVLFSMDREGNTANKKYVKSARVVGDVIGKYHPHGDSAVYDTIVRMAQPFSLRYMLV
FT                   DGQGNFGSIDGDAPAAMRYTEVRMQKITQALLTDLDKETVNFSPNYDGELMIPDVLPTR
FT                   IPALLANGSSGIAVGMATNIPPHNLNEVLNGCLAYIDNNEITIDELMQHIPGPDFPTAA
FT                   LINGRKGIEEAYRTGRGKVYVRARATVETNEKGREQIIVSELPYQVNKAKLVEKIAELI
FT                   REKKIEGISNITDLSNKEGIRIEIDIKRDAVGEVVLNHLYSLTQMQVTFGINMVALDHG
FT                   QPRLFNLKEIIESFVLHRREVVTRRSIFELRKARERTHILEGLAVARSNIDEMIAIIRN
FT                   SKNREEAATAISSRSWTLHSDIINLLDVSARPDELEENLGIQGEQYYLSPAQVNAILEL
FT                   RLHRLTGIAFEEVIKEYEELLVKIADLLHILSSAERLMEVIREELEEVKAQFGDDRLTE
FT                   ITAASGDIDLEDLIAQEDVVVTLSHEGYVKYQPLTDYEAQRRGGKGKSATKMKEEDFIE
FT                   KLLVANTHDTILCFSSRGRLYWLKVYQLPQASRGARGRPIVNILPLQENERITAILPVS
FT                   AYEEDKFVVMATAGGIVKKIALTEFSRPRSNGIIALNLRDEDELIGVDITDGSNEIMLF
FT                   SSQGRVVRFAENAVRAMGRLATGVRGIKLALTNDISDDESAVEIEDISDDNAEASLDLN
FT                   IDKVVSLVVPKGEGEILTATQNGYGKRTQLSEYPTKSRNTKGVISIKVSERNGKVVAAT
FT                   QVEETDQIMLITDAGTLVRTRVSEVSIVGRNTQGVRLIRTADDEHVVSLERVCDADEDE
FT                   DDSLEESNSKE"
FT   CDS_pept        complement(604099..605862)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06510"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR003776"
FT                   /db_xref="InterPro:IPR041080"
FT                   /db_xref="UniProtKB/TrEMBL:E7A445"
FT                   /protein_id="CBY80819.1"
FT                   /translation="MTEQTFILGKDAALEDSIAKFQQKLTALGFNIEEASWLNPVPNVW
FT                   SVHIRDKDCPQCFSNGKGASKKAALASALGEYFERLSTNYFFADFYLGQEIANGDFVHY
FT                   PNEKWFPIEDDALLPNGILDDYLLDYFDPNAELTPELLIDLQSGNYDRGIVAMPYVRQS
FT                   DEQTVYIPQSIIANLYVSNGMSAGNTKFEARVQGLSEVFERYVKNKIIAEAISLPEIPK
FT                   SVMDRYPSIQASIAKLEEEGFLIYAFDASLGGKYPVICVVLLNPNNGTCFASFGAHPNF
FT                   QVALERTVTELLQGRSLKDLDVFSPPSFNNDDVAEHANLETHFIDSSGLISWDLLKKTP
FT                   DYEFADWDFSGTTQEEYNNLMAIFRADEKEVYVMDYNHLDVYACRIIVPGMSDIYPADD
FT                   LIYANNNMGMDWREILLDLPNWHHDAETYQELLDELDGQDIDDATRVREFIGIVAPKNS
FT                   GWTTLRVGELKSMLHLALGELEQALDWANWTLNMNSSVFTTEPVNYYRALISIIELHLD
FT                   QNREPAQYRAVFEKMYGKDAVKQAWAAVSEGGNPFYNLPASDENLENFKEHQALLGAYG
FT                   KLQKAKRAHQK"
FT   CDS_pept        complement(605999..606475)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06520"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A446"
FT                   /db_xref="UniProtKB/TrEMBL:E7A446"
FT                   /protein_id="CBY80820.1"
FT                   /translation="MKFEVIYKFFLVWGLALSLLFVVASGISMWLGFPFSQALDIHLFF
FT                   AGFTVFGLLLHFYSRKKKWVKINTQFADLITNNRMPSYCNLDRLMMTFEHFSIQQIAEQ
FT                   LNLSLPILLNELSQAQINITDSHRTLCENFPLNDEKIFAAITIALKVRFNPTLL"
FT   CDS_pept        606711..607517
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06530"
FT                   /product="Methyltransferase type 11"
FT                   /db_xref="GOA:E7A447"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:E7A447"
FT                   /protein_id="CBY80821.1"
FT                   /translation="MTIYDINFAELYQQHLIACHHYNLPPIKWDKKAVKMAENLVGKPS
FT                   AYNQQLLQAMNVQTDETVLDIGCGPGTFAVPLAQQGSTVYALDYSNGMLDCLAQFKQKF
FT                   GLHHLTTFHKSWADNWDDVPQADVVLASRSTLVDDLDDMIEKLCAKAKKRVFLTSVTQR
FT                   HFLDEGVFEAIGREDIGFPTYIYLLNRLYQKGIQANLNFIETESGCFQGESYEDLLASV
FT                   EFSLGELSEKEKQGLKAFYDRKQANNEPISHGQKKWALIWWNVDRI"
FT   CDS_pept        607569..>608123
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06550"
FT                   /product="predicted hydroxyacylglutathione hydrolase"
FT                   /db_xref="GOA:E7A448"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:E7A448"
FT                   /protein_id="CBY80822.1"
FT                   /translation="MLFALPALNDNYIWLYQRENLPLIIVDLPETDKLFAWLEKQNATI
FT                   EAVLLTHEHDDHTQGVSAFKKRYPTVPIYGPQECEKKGATQIVNEGKILTANYQIDVIP
FT                   TGGHTKQHVSFLVDNHLFCGDALFSAGCGRVFTGNYAQMFEGLQRLNTLPDETIVCPAH
FT                   EYTLGNLAFAETVLVEKSAVEK"
FT   CDS_pept        complement(608329..609189)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06560"
FT                   /product="tellurite resistance protein"
FT                   /db_xref="GOA:E7A449"
FT                   /db_xref="InterPro:IPR004537"
FT                   /db_xref="InterPro:IPR014431"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR015392"
FT                   /db_xref="InterPro:IPR015985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A449"
FT                   /protein_id="CBY80823.1"
FT                   /translation="MKNELICYKQMPVWTKDKLPQMFQEKHNTKVGTWGKLTVLKGKLK
FT                   FYELTENGDVIAEHIFTPESEIPFVEPQAWHRVEALSDDLECTLGFYCKKEDYFSKKYN
FT                   MTAIHGDVVDAAKIISPCKVLDLGCGQGRNSLYLSLLGYDVTSWDHNENSIAFLNETKE
FT                   KENLNISTALYDINAANIQENYDFIVSTVVFMFLNRERVPSIIKNMQEHTNVGGYNLIV
FT                   AAMSTDDVPCPLPFSFTFAENELKEYYKDWEFLEYNENMGELHKTDENGNRIKMKFATM
FT                   LARKK"
FT   CDS_pept        complement(609302..611356)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06570"
FT                   /product="methionyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A450"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014758"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023458"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="InterPro:IPR041872"
FT                   /db_xref="UniProtKB/TrEMBL:E7A450"
FT                   /protein_id="CBY80824.1"
FT                   /translation="MTTQPRKILVTCALPYANGAIHLGHMLEHIQADIWVRFQRMRGNK
FT                   IHFVCADDAHGTPIMLNADKLGITPEELIAKAKADHIRDFAGFNISFDNYHSTHSEENK
FT                   QLTAEIYNKLKANGFIKSKVISQLFDPEKNMFLPDRFVKGTCPKCKAEDQYGDNCEVCA
FT                   STYSPMDLINPRSAVSGTTPIVKESEHFFFDLPAFEGMLKEWTRSGSLQSEIANKMQEW
FT                   FESGLQQWDISRDAPYFGFEIPGAKDKFFYVWLDAPIGYMASFKNLCDREGIDFNEFWA
FT                   EGSDAELYHFIGKDIVYFHSLFWPAMLEGSGYRKPTNVFAHGYVTVDGAKMSKSRGTFI
FT                   QASTYLNHIDPECLRYYYAAKLNDRIEDLDFNLEDFVQRVNTDIVNKLVNLASRNAGFI
FT                   AKRFEGKLADKLEDETLFAEFTAQAEQIAAYYESREYNKAIREIMALTDKANKYIDEKA
FT                   PWVIAKEEGKEAELQAVCSMGIELFRVLMSYLKPVLPKLAERAETFLQAELRWDNIHQP
FT                   LLGHTLAPFKALFSRLEKKQIDAVVEETKALFAAANKAAEKTEAEAKPTALSTVEPIAE
FT                   TITIDDFAKLDMRVAKVLKCEAVPESNKLLRFELDLGDHTRQVFSGIKAAYNKPEELEG
FT                   RFVIMVANLAPRKMKFGVSEGMILSAGTGGSDLFLLSADSGVTAGMQVK"
FT   CDS_pept        611607..612257
FT                   /transl_table=11
FT                   /gene="bpf001"
FT                   /locus_tag="HIBPF_06580"
FT                   /product="bpf001"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E7A451"
FT                   /protein_id="CBY80825.1"
FT                   /translation="MKLTKTLFTSALLGASILSFHPTVAAMDFGTQVGIDAYRKNDFAQ
FT                   AAEQFKDAGIVRGDPTAQLFLGRMYYNGEFFKQDYVEAAKWYRKAAEQGEEFGLLFLGE
FT                   TYEDGEGVEKDYAEAAKLYRKAAEQGSAEGQMALGKMYRFGNGVEKDYAEAIKLYRKSA
FT                   EQGNFTALFFLGEMYDNGVGVKQNKAKAKELFKKSCEQGTKEACKALKSYNKK"
FT   CDS_pept        612270..612635
FT                   /transl_table=11
FT                   /gene="bpf002"
FT                   /locus_tag="HIBPF_06600"
FT                   /product="bpf002"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E7A452"
FT                   /protein_id="CBY80826.1"
FT                   /translation="MKKQLIAMVSLLGTVSVLSACTSNEDITFPTMISPLALDVETCSS
FT                   QAKSDFQLGVAAYKDKKYAQSFELFTKASEKNCANADFYLAAQYYNGQHLSKNLDVAKE
FT                   KFKQACHKGLKTACIME"
FT   CDS_pept        612792..613904
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06620"
FT                   /product="antiporter inner membrane protein"
FT                   /db_xref="GOA:E7A453"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:E7A453"
FT                   /protein_id="CBY80827.1"
FT                   /translation="MATYFSDNLTAEQQNQVQQIIQQFQHPTLQKDLIALNTLKKVEKG
FT                   GDTLRIELQLPFAWNSGAEQLKQVVSDALLKATDCKSIKWAVTYQIATLKRANNQPAVK
FT                   GVKNIIAVSSGKGGVGKSSVSVNLALALQAQGARVGILDADIYGPSIPHMLGAADQRPT
FT                   SPDNQHITPIKAHGLSANSIGFLMNEDSATIWRGPMASSALSQLLNETLWDSLDYLVID
FT                   MPPGTGDIQLTLSQQIPVTGAVVVTTPQDIALLDAVKGISMFERVSVPVLGIVENMSMH
FT                   ICSKCGHHEAIFGTGGAEKMAEKYNVKVLAQLSLHIRIREDLDAGNPTVVRVPENEISQ
FT                   AFLQLAEKVSTELYWQGSVIPSEILFKEVK"
FT   CDS_pept        614398..614751
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06630"
FT                   /product="PemK-like protein"
FT                   /db_xref="GOA:E7A454"
FT                   /db_xref="InterPro:IPR003477"
FT                   /db_xref="InterPro:IPR011067"
FT                   /db_xref="UniProtKB/TrEMBL:E7A454"
FT                   /protein_id="CBY80828.1"
FT                   /translation="MAKQQFKRGDIITVCLNPVVGNELQGEKRPALVLSDNKFHNLGFM
FT                   MIAPITQGNAALARENGFAVTLSGTGCKTQGVVVAYQARIIDFRGRDAKKVESVPDYVL
FT                   FEVQDIVEAILRD"
FT   CDS_pept        complement(615049..615711)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06640"
FT                   /product="putative NAD(P)H nitroreductase"
FT                   /db_xref="GOA:E7A455"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="InterPro:IPR033878"
FT                   /db_xref="UniProtKB/TrEMBL:E7A455"
FT                   /protein_id="CBY80829.1"
FT                   /translation="MTQLTREQVLELFHQRSSTRYYDPTKKISDEDFECILECGRLSPS
FT                   SVGSEPWKFLVIQNKTLREKMKPFSWGMINQLDNCSHLVVILAKKNARYDSPFFVDVMA
FT                   RKGLNAEQQQAALTKYKALQEEDMKLLENDRTLFDWCSKQTYIALANMLTGASALGIDS
FT                   CPIEGFHYDKMNECLAEEGLFDPQEYAVSVAATFGYRSRDIAKKSRKGLDEVVRWIE"
FT   CDS_pept        615825..616499
FT                   /transl_table=11
FT                   /gene="siaB"
FT                   /locus_tag="HIBPF_06650"
FT                   /product="acylneuraminate cytidylyltransferase"
FT                   /db_xref="GOA:E7A456"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A456"
FT                   /protein_id="CBY80830.1"
FT                   /translation="MTRIAIIPARAGSKGIKDKNLQLVGGVSLVGRAILAAQESGMFDQ
FT                   IVVTSDGENILKEATKYGAKPVARPESLAQSDTRTIDAILHCLETLNISQGTAVLLQPT
FT                   SPLRNALDIRNAMEIFLGGKYKSVVSACECEHHPYKSFTLEGTEVQPIHELTDFESPRQ
FT                   KLPTSYRANGAIYINDIESLFEEKRFFIAPMRFYLMPTYRSIDIDSTLDLQLAESLISK
FT                   EF"
FT   CDS_pept        complement(join(617568..617876,617873..618211))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06670"
FT                   /product="putative prophage repressor protein, Neisseria
FT                   meningitidis"
FT   CDS_pept        complement(618844..621036)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR009270"
FT                   /db_xref="UniProtKB/TrEMBL:E7A457"
FT                   /protein_id="CBY80832.1"
FT                   /translation="MAKLINAPYAKQQDPTGQSLVTICIGTQAQTIAKHFNEMGKSAVE
FT                   IELENTLGEQGKSFPCVVVDSEILEHIERYRIAPKNTQSIRLIQANNGMALSNETLERV
FT                   YLNIAQSTSAESVIYCNEAGEVLEEVSRYIQRLRNGDTYHGEIKPICESIRDNHQPYTE
FT                   KRKENGIEGLFRVVPKLDKDTGEMMDKCEWLADCVDVVGIGLSDSDYFSMLSFQAQGKS
FT                   EPILIALPWADIGERAGWQLLKQNGLRITNSQRLKPHLADFLQDTQNKPIYQIVNETGW
FT                   QSDFNAYVLPSGEVLGKPERPIYFNSKSTTSAGYQAKGTLSEWQREIGQYLRGNHSMML
FT                   GVACSLSAPLIGLIGAESFGVHLFGKSSAGKTTIANIASSIYGEPDLIRLSWNGTSLGL
FT                   INEAATRNDGFIPLDEIGQGASKKHVEQTAYTLFNGVGKIQGAKDGGNRELNRWRILVF
FT                   STGEQDLELYLKQDNIKTNAGQLVRLLNIPITPSSTFYHFGNGKAHADHLNAMTRRYYG
FT                   TMGRAWIEWLLENKSAVTAEYECLSEQWQAMLPNDASPQVKRVAGRFAILETALQLAAH
FT                   LTGWETSENKTALLHGFNEWINEYGLHSREEKQIIEQVNGWLLRNGARFLDFPFNPNQK
FT                   EPNDTAGYRQLADSKEQQEGDKYWVFPQVYIQDVIKGFNEKQANEILLGAGMLIQGKER
FT                   GRKYLNRLPKTISGGKTIRCYVLEILNEDEESEDIE"
FT   CDS_pept        complement(621409..622092)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A458"
FT                   /protein_id="CBY80833.1"
FT                   /translation="MKPTNAMAQLEQWKKNNQQRKINQFVNEMNRTKNLASDSSVSANG
FT                   VHPNELKNELVKDCESKLRNAEAICESGKTIKSAVKKLGNLKIEEISKTQQEAQGEAKS
FT                   KYQGKLWANPLAFQFAQLTRQFKLILDSNRKCLDVYPDDFHHKLKMRDEMMDLIDRLKA
FT                   GGKLFNALAKSQGVTCCRDNQATLKDFNQANGYLIHKFGEVVAQIERLNIERIEGEKLQ
FT                   GVSYE"
FT   CDS_pept        complement(622079..622282)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A459"
FT                   /protein_id="CBY80834.1"
FT                   /translation="MMIKPNLPYQLIFVYDNGDQFIAGEYGTLREALQAKIKCKHEIGQ
FT                   TDICGRVLEVITILKGEENETN"
FT   CDS_pept        complement(622272..622643)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A460"
FT                   /protein_id="CBY80835.1"
FT                   /translation="MFNQSILSALQEMADFNDINNYKQIPVPMSKEKLKDLRSESKNLC
FT                   ESIEYGLMHLGDLMQTLGNLADTEQDFTREAMSNDNVKHIGGLIKANAYLLNALRETAS
FT                   LSEYYLAGGLDGEIERNDD"
FT   CDS_pept        complement(622636..623598)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR018880"
FT                   /db_xref="UniProtKB/TrEMBL:E7A461"
FT                   /protein_id="CBY80836.1"
FT                   /translation="MQPIKLGINMNLIHKHYSNDENFYNSNPLQSAVNFGIISPQSQKT
FT                   IAEPGNSTYLQLAQSTPKACFFMRNIRTPQNKLRILFQHLSTIYSSMVACSGKGSPFAV
FT                   FQLSQFSRPLHVTAKAWKLYAVTLKCLQLELRKMYQFIFALSRAPQIKIRLLADNEQQA
FT                   RSRFTDGDTLLFVGRINQNPLKNNRTFSTNGKNHSLPKCEDAGSIESTETKDGNRNRHL
FT                   SGIFLPKIHSLHAPKKLGALSYIEFAVRATHGNKALSTNNVGYSLVAVEPLSHPIQGDN
FT                   SLLTKPKRNPTMKIYPKNNRTLATFPTLSVSATQGGANV"
FT   CDS_pept        complement(623859..624155)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06732"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A462"
FT                   /protein_id="CBY80837.1"
FT                   /translation="MKCTIAKHNSLLLQQAIQHYRKSHQIFTFMSLYDDNEPYPIDDVI
FT                   QVLENRLNVIKRQIDSFTKMTAGLRKNERLETSFYTTKKHLEMMRKRKQEIGD"
FT   CDS_pept        complement(624155..624622)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A463"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="InterPro:IPR038713"
FT                   /db_xref="UniProtKB/TrEMBL:E7A463"
FT                   /protein_id="CBY80838.1"
FT                   /translation="MRVIYRELLNKAKEEEMMNELTVKQSDFCLFYIETGNASEAYRRA
FT                   YDAENMKPETVNRRAFDLMENSKIKARIEALRAEHRKEHNITVSDIMNKLEDIYSEAMK
FT                   KGNLSSAVSAVMGQAKVLGFDKQTINLEGDIKPLPTVINVTFSDEPQEENL"
FT   CDS_pept        complement(624603..624896)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06741"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A464"
FT                   /protein_id="CBY80839.1"
FT                   /translation="MTNTNQQTHTEKCKHATLWTISRTLDRLRYITDTAINGTILDYPD
FT                   KDGNRPPATPKQIYKLILEEVDCAIEQVNDLKRQIEALAIHQEYKADASYLP"
FT   CDS_pept        complement(624912..625175)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06742"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A465"
FT                   /protein_id="CBY80840.1"
FT                   /translation="MMAINTTSTHEQQKYILQRLSVRPHSTNELRELGIYFPPARIKEL
FT                   RDKGFHIDTFYRKETDSSGLAHRVGVYVLHQNEVSQNYQYND"
FT   CDS_pept        complement(625183..625431)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06743"
FT                   /product="putative prophage regulatory protein"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:E7A466"
FT                   /protein_id="CBY80841.1"
FT                   /translation="MPDKTTTPSNDTEQAPRFLKRKSTAERLGVSLTTLDDWRNPKAKR
FT                   YRPDFPKAIKVANGATCFLESEINAYVLKLANECRVS"
FT   CDS_pept        complement(625638..626660)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06770"
FT                   /product="Unknown protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A467"
FT                   /protein_id="CBY80842.1"
FT                   /translation="MSILGSYLILNDKNIQKLQNEFNFGIDEIFHYSKNNALDLFIRIE
FT                   KIESKKVKTEFNSDFELCGFVNSEKKDRFYNDFFKVADYNIDLQIDDEKDDVPFGYVYG
FT                   LSDCDEQAKGKLSMIQFDGFIQIPSRTINETAQKIILDKFSSYRFLNNEFGDLNHNFGL
FT                   NFDFPNNYLDVPTQYTYVLIEQLKEIIDFHQDEQLKKQSNDSIDSTELQAEKAKNTQLQ
FT                   AENESLKAELKAQQDRMAELEQKLQQSAVDSEPVLGNGKAYDVRERETHLLMIGALSNL
FT                   LAGYKQSYQKGSNRINQSAISRGIEHEIIKLLQPETKTRTLDTIRPRIREALNLITKAE
FT                   "
FT   CDS_pept        complement(626907..628163)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06780"
FT                   /product="Prophage integrase"
FT                   /db_xref="GOA:E7A468"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:E7A468"
FT                   /protein_id="CBY80843.1"
FT                   /translation="MARTTKTLSNTQIEKAKPKNKPYKLIDGQGLFLSITQKGSKLWRF
FT                   NYYKPFTTPPKRTEISLGSFPDISLSEARAIREEYRALLAQNIDPKTHREHLHKTKADD
FT                   LANTYESMAWAWFEYRKTKKNFSLDYQKDVASLIRRNLLPHFGALPISAITAPMALKAF
FT                   KRYQDEGTLEKLKRTIQKHNEIMTYALHRGYISSNPTEKISKEFDSPTVEHFKTIKPED
FT                   LGEFLYTLNNAQIHLQTRFLILWQMLTMTRPNEAATARYEDIDEQARIWTIYIKKGIKE
FT                   TDKGREHKITLSRQAMALLREIKKRSESKVYLFPSAKNPQTHVNTQTANSAIKRMGYHG
FT                   KLVAHGLRAIASTYLNDKGYDSELIEVALSHMKSDRIKAAYDRGERLEQRFKLLQVWGD
FT                   FIEECSNGALPKYHLKMVV"
FT   tRNA            629196..629269
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:629230..629232,aa:Met)"
FT                   /note="tRNA Met anticodon CAT, Cove score 64.25"
FT   CDS_pept        629525..629950
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A469"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/TrEMBL:E7A469"
FT                   /protein_id="CBY80844.1"
FT                   /translation="MLQDAVEDLGCELWGIECQRMGRFMTVRLFIDKDGGVTVDDCADV
FT                   SRQVSAILDVEDPIADKYNLEVSSPGLDRPLFTLPQFERYIGQDIAVHLRIPVMERRKW
FT                   QGKLERIEKDMITLIVDDQEQILVFGNIQKANVVAKF"
FT   CDS_pept        629967..631454
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06800"
FT                   /product="Transcription elongation protein NusA"
FT                   /db_xref="GOA:E7A470"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:E7A470"
FT                   /protein_id="CBY80845.1"
FT                   /translation="MSKEILLAAEAVSNEKLLPREKIFEALESAIAISTKKKFEYETDI
FT                   RVSINPKTGEFDTFRRWLVVDEVKVPTKEITLEAAQFDDPNLQLGEYVEDQIESIAFDR
FT                   IAMQTARQVISTKIREAERAKVVEQFREEEGKIVTGTVKKVSRDSIILDLGNKAEAMIA
FT                   REDMLPRENFRLGDRVRGVLYKVNPEGKTAQLFVTRSKPEMLIELFRIEVPEIGEEMIE
FT                   IRGAARDAGSRAKIAVKSNDKRIDPVGACVGMRGARVQVITNELGGERVDIVLWDDNPA
FT                   QFVINAMAPADVSSIIVDEDNHSMDIAVEADNLAQAIGRNGQNVRLATQLTGWTLNVMT
FT                   TDELNAKHQAEDNKVLNLFINALELDEEFAQILVEEGFTSLEEIAYVPMNELTAIDGLE
FT                   DEDLVEELQTRAKNAITAAAVAEEEALKKANVEDRLLNLEGMNRHVAIKLAEKQITTLE
FT                   ELAEQGVDDLTDIEELTAEQAADLIMAARNICWFGEE"
FT   CDS_pept        631466..634000
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06810"
FT                   /product="Translation initiation factor IF-2"
FT                   /db_xref="GOA:E7A471"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:E7A471"
FT                   /protein_id="CBY80846.1"
FT                   /translation="MTEDVKADAPKKLSIQRRTKTTVSSTTTGGKSKEVQVEVRKKRTV
FT                   KTDIAQQEEAKLKAQQEAEAKKIAEQKAAEEKARLEAEKVAAKKEADEKAKAEKVKAET
FT                   AKPVKSAVDSKVKSVDPEKEKRKAEEAKLRRKAEELARQKAEEQARRAAEEAKRYAEAD
FT                   DSDNESSSEDYSDYNLSSRYALEAEDEEDRRNENRGRGKNKVAKAKKGGRDDENSKNSK
FT                   NERESNRKNQKDAKFGKGKNGKKGAALQQAFTKPAQVVKADVVIGETITVAELANKMAV
FT                   KATEIIKMMMKMGEMVTINQVIDQETAQLVAEELGHKVILRNENELEEAVLGDRDVNAE
FT                   KVTRAPVVTIMGHVDHGKTSLLDYIRKAKVAAGEAGGITQHIGAYHVEMDDGKMITFLD
FT                   TPGHAAFTSMRARGAKATDIVVLVVAADDGVMPQTIEAIQHAKAAGAPLVVAVNKIDKP
FT                   EANPDRVEQELLQHDVISEKFGGDVQFVPVSAKKGTGVDDLLDAILLQSEVLELTAVKD
FT                   GMASGVVIESYLDKGRGPVATILVQSGTLRKGDIVLCGFEYGRVRAMRDENGKEVDEAG
FT                   PSIPVELLGLSGVPAAGDEATVVRDEKKAREVALYRQGKFREVKLARQQKAKLENMFSN
FT                   MSEGDVAELNVIVKADVQGSVEAIVQALNELSTNEVKVKVVGSGVGGITETDATLAAAS
FT                   NAIIVGFNVRADASARRVIEAENIDLRYYSIIYELLNEIKAAMSGMLEPEFKQEIIGLA
FT                   EVRDVFRHPKFGAIAGCMVTEGVVKRNNPIRVLRDNVVIFEGELESLRRFKDDVSEVRN
FT                   GMECGIGVKNYNDVKVGDQIEVFEVVEVKRSI"
FT   CDS_pept        complement(634079..637246)
FT                   /transl_table=11
FT                   /gene="hsdR3"
FT                   /locus_tag="HIBPF_06820"
FT                   /product="putative type I restriction enzyme HindVIIP R
FT                   protein"
FT                   /db_xref="GOA:E7A472"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:E7A472"
FT                   /protein_id="CBY80847.1"
FT                   /translation="MLNENDIEQLTLQRLQSLGWEYRYGKDLPVHEGEFARGDLSGVVF
FT                   VEQLREAVRKLNPQLPESAVDSVVKSATKSDIGDLVVRNQAFYKLLRDGVRVEYTLNGE
FT                   QKIEMVRLVDFEHWGNNRFVAVNQLEIRSRKGGKRIPDIIGFVNGLPLVVFELKNPLRK
FT                   SADLLQAFNQFETYKDEIAELFVYNQALIISDGIVARLGSLSADFQRFTPWKVVDEKNK
FT                   SARLYFDDELQSLLNGLLKPEDLLDYIRYFVLFEWDSVGKTIKKIAAYHQYYGVNEAVD
FT                   STIWATSEKGDRRIGVMWHTQGSGKSISMLFYAGKLLAQPELKNPTIVVVTDRNDLDGQ
FT                   LFQTFSSGKDLIKQTPQQVEDRDQLRQLLAQNEVGGVFFTTIQKFALNEEESRFPILNE
FT                   RNNIIVISDEAHRSQYGFTQKLHNGKFQTGYARHLRDALPNASFIGFTGTPISLEDKDT
FT                   QDVFGRYVSIYDLQDAVEDGATVPIIYEARQIKLAENANHDELFAEIDELLEGEENPKL
FT                   RLREKLLGSEARLHDLAVDFVQHFAKRNEVADSKAMMVVSSRQICVDLYNEIIKLRPEW
FT                   HSDNINEGAIKIVMTGSASDAPEMQKHVYSKQEKQTLERRFKDPNDPLKVVIVRDMWLT
FT                   GFDAPCCNTMYIDKPMQGHNLMQAIARVNRVFRNKSRENGGLIVDYVGIADELKDATQQ
FT                   YTNSQGKGKLADSVIDVFFKMKEHLEVIRSLFATPVEGKTFYVQTVLEKDNPNELLMAI
FT                   RFAANHILSLDQLPFDGKAHEQHWFNKKETEPRKKAFLKAAGLVKKGYMLCGALAEVEP
FT                   YNQEIAFYDAVRAILTRREQKGTGTNERQILLKKLVNQTVYSEGVIDLFDLLEKPQPQI
FT                   SLLSEEFLQTVKNSPTKNLWVTAMERYLASEIKAKSGANLTLQKDFEQRLKEALNQYHN
FT                   HNLTVVEILDELFKMSQDFQERLALGKKLGLTKEELAFYEALSQNQSAKDLMGDEVLSK
FT                   LAKEITETLRKSVTIDWQYKEAVRAKMRILVKRTLQRYKYPPDKQEEAVTYVIKQAEEI
FT                   AEDLTGL"
FT   CDS_pept        complement(637524..638837)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06830"
FT                   /product="putative type I restriction enzyme"
FT                   /db_xref="GOA:E7A473"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E7A473"
FT                   /protein_id="CBY80848.1"
FT                   /translation="MNKVEFGALFLEPLRNGVTKPKRVRGSGYKMVNMGEIFSLSFIQN
FT                   QTMDRVPLTDKEKATTLLQNNDLLFARQSLVRDGAGKCSIFLNDNEPVCFESHIIRVRL
FT                   NQELCYPMFYYYFFSSRLGKNTMDKIIEQGAGAAGIRGSDLAKLEVPYIGYSKQKEIAD
FT                   SLYSFDQKIQLNTQINQTLEQIAQALFKSWFVDFDPVRAKAQALSDGMSLEQAELAAIQ
FT                   AISGKTPEELTALSQTQPDRYAELAETAKAFPCEMVEVDGGEVPKGWEYQYLKDICNIV
FT                   YGKNLPTTKLIKEGYPVFGGNGVIGYYDKFLYETPQTLVSCRGAASGKVLYSLPYSFVT
FT                   NNSLVIEHEKSGLSYFYIYEVLKLQNLTELTSGSAQPQMTIANMAAVQILVPSEKINEV
FT                   CKKYLGTLYNQIYQNNIENETLAQTRDLLLPRLLNGEI"
FT   CDS_pept        complement(638830..640590)
FT                   /transl_table=11
FT                   /gene="hsdM3"
FT                   /locus_tag="HIBPF_06860"
FT                   /product="putative type I restriction enzyme HindVIIP M
FT                   protein"
FT                   /db_xref="GOA:E7A474"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:E7A474"
FT                   /protein_id="CBY80849.1"
FT                   /translation="MNIQTSDKNHFTEGIIYASETRRDETRRDETRRDETTKIVDKNHT
FT                   LQQAFLNELDEKLWASADKLRQQLDAANYKHIVLGLIFLKYISDSFTHQQEKIQAELTD
FT                   PENVLYLDRTFYDTEEKYQDALTAELENRDYYTADNVFWVPASARWQALQEVSILNTGA
FT                   ELPWGGKFSGVAKLIDDAFDAIEKDNEKLKGVLQRISGYAVNEDTLRGLIILFSDTHFT
FT                   RPTYNGEPVHLGAKDILGHVYEYFLGRFAQAEGKRGGQYFTPKSIVSLIVEMLEPYSGR
FT                   VYDPAMGSGGFFVQTERFITAHQGNINNMSIYGQEFNPTTWKLAAMNMAIRGIDYDFGK
FT                   HNADSFTQPQHIDKKMDFIMANPPFNISDWWSESLADDPRWAYGTPPKGNANFAWLQHM
FT                   IYHLSPNGKMALLLANGSMSSQTNNEGEIHKGIINADLVECMVALPGQLFTNTQIPACI
FT                   WFLNRNKKRKGEVLFIDARQIGYMKDRVLRDFTADDIAKISDTLHAWQKSDGYEDQAAF
FT                   CKSATLEEIKDNDFVLTPGRYVGTAEQEDDGVPFAEKMQNLTALLKEQFAKSAELEAEI
FT                   KKNLGGLGYE"
FT   repeat_region   complement(640485..640534)
FT                   /note="CGAGA x10"
FT   CDS_pept        640706..641092
FT                   /transl_table=11
FT                   /gene="rbfA"
FT                   /locus_tag="HIBPF_06870"
FT                   /product="30s ribosome binding factor"
FT                   /product="recname: full=ribosome-binding factor a;"
FT                   /db_xref="GOA:E7A475"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:E7A475"
FT                   /protein_id="CBY80850.1"
FT                   /translation="MAREFKRSDRVAQEIQKEIAVILQREVKDPRIGMVTVSDVEVSSD
FT                   LSYAKIFVTFLFDHDETAIEQGMKGLEKASPYIRSLLGKAMRLRIVPEIRFIYDQSLVE
FT                   GMRMSNLVTNVVREDEKKHVEESN"
FT   CDS_pept        641092..642012
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06880"
FT                   /product="tRNA pseudouridine synthase"
FT                   /db_xref="GOA:E7A476"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR015240"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:E7A476"
FT                   /protein_id="CBY80851.1"
FT                   /translation="MSRPRKRWRDVDGVFLLDKPQGMSSNDIMQKVKRLFQANKAGHTG
FT                   ALDPLATGMLPICLGEATKFSQFLLDADKRYLVTAKLGERTDTSDAEGQVVETREVNLE
FT                   TPQILTALEQFRGDILQVPTMFSALKHNGKPLYEYARQGITVEREARPITIFELNFIEY
FT                   HAPFLTLEVHCSKGTYIRTLVDDLGEVLGCGAHVTMLRRTAVADYPVAEMMPINELQLF
FT                   AESFPLSELDRLLLPTDTAVSKLPALHLDVGQSKAIGFGQRVKFANEQQLSGQVRLFSA
FT                   ENLFLGVALIDGNIIRPQRLITQSA"
FT   CDS_pept        642101..643225
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06890"
FT                   /product="fused chorismate mutase T/prephenate
FT                   dehydrogenase"
FT                   /db_xref="GOA:E7A477"
FT                   /db_xref="InterPro:IPR002701"
FT                   /db_xref="InterPro:IPR003099"
FT                   /db_xref="InterPro:IPR008244"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011277"
FT                   /db_xref="InterPro:IPR036263"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036979"
FT                   /db_xref="UniProtKB/TrEMBL:E7A477"
FT                   /protein_id="CBY80852.1"
FT                   /translation="MEALKDLRSEIDSLDRELIQLFAKRLELVSQVGKVKHQHGLPIYA
FT                   PEREIAMLQARRLEAEKAGISADLIEDVLRRFMRESYANENQFGFKTINPDIHKIVIVG
FT                   GYGKLGGLFARYLRASGYPISILDREDWAMAESILANADVVIVSVPINLTLETIERLKP
FT                   YLTENMLLADLTSVKREPLAKMLEVHSGAVLGLHPMFGADIASMAKQVVVRCDGRFPER
FT                   YEWLLEQIQIWGAKIYQTNATEHDHNMTYIQALRHFSTFANGLHLSKQPINLANLLALS
FT                   SPIYRLELAMIGRLFAQDAELYADIIMDKSENLAVIETLKQTYDEALTFFENNDRQGFI
FT                   DAFHKVHDWFGDYSEQFLKESRQLLQQANDLKQG"
FT   CDS_pept        complement(643258..644097)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06900"
FT                   /product="conserved protein"
FT                   /db_xref="GOA:E7A478"
FT                   /db_xref="InterPro:IPR016428"
FT                   /db_xref="InterPro:IPR029139"
FT                   /db_xref="InterPro:IPR029500"
FT                   /db_xref="UniProtKB/TrEMBL:E7A478"
FT                   /protein_id="CBY80853.1"
FT                   /translation="MNYQDNSLKSLKLGQKTEYASQYDRTLLQPVPRSLNRDGLGITQK
FT                   QPFTIGADIWTAYEISWLNEKGLPQVAIADIYLDYQSQNLIESKSFKLYLNSFNQSKFA
FT                   DFNAVQQTMQRDLSECAQGDVKVRLNPVVVYDSQKIDHLQGDCIDEQDIEITSYEFNAD
FT                   WLKDCVSDEIIEEKLVSHLLKSNCLITNQPDWGTLHIHYVGKKINHEKLLRYVVSFRQH
FT                   NEFHEQCVERIFCDLMHYAKPEKLTVYARYTRRGGLDINPFRSNFENLPENLRLARQ"
FT   CDS_pept        complement(644224..645009)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR016908"
FT                   /db_xref="UniProtKB/TrEMBL:E7A479"
FT                   /protein_id="CBY80854.1"
FT                   /translation="MYLIETYFRMTALENNIESQSRLLNAVIDQWRYNGQIIGREIPLY
FT                   LSEEDGAQGFAMRVICPEQDSLFPQNNNAEVNLALQKAEKCGVIFDGFQLVGDDFNSDQ
FT                   TAENASPAWQVLYTTHLQSCSPIHSGENFAPIPLYKQLKNQPHLSQDLIKWQENWQACD
FT                   QLQMNGAVLEQQSLAEISEHQSTLSKHGRYLAQEIEKETGIPTYYYLYRVGGQSLESEK
FT                   SRCCPSCGANWALKDAIFDTFHFKCDTCRLVSNLSWNFL"
FT   CDS_pept        complement(645377..646576)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06930"
FT                   /product="cysteine sulfinate desulfinase"
FT                   /db_xref="GOA:E7A480"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR016454"
FT                   /db_xref="UniProtKB/TrEMBL:E7A480"
FT                   /protein_id="CBY80855.1"
FT                   /translation="MAFDYQTFRQEFPYFQREDAVVYLDNAATALKPQVLIDRTAEFYA
FT                   SAGSVHRSQYDAAQTVQYEQARTQVKEWVNAEDKRAVIWTSGTTHAINLVANGLLPQLN
FT                   AEDEILISQAEHHANFVTWHETAKKCGAKIQVLPILDNWLIDENVLISALSEKTKLVAL
FT                   NFVSNVTGTEQPIKRLIQLIRKQSNALVLVDAAQAISHIKIDLQDLDADFLAFSAHKIY
FT                   GPNGLGVLTGKLTALSQLQPLFFGGKMVERVSNDRITFAELPYRLEAGTPNIAGVIGFN
FT                   AILNWLQKWDFTAAEQHAISLAESVKVRLKSYENCRLFNSPQASTVVCFIFDGIDCSDL
FT                   STLLSEQNIALRVGEHCAQPYLARLGERTTLRLSFAPYNTQEDVEAFFTALDKALDLLQ
FT                   "
FT   CDS_pept        complement(646566..647060)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06940"
FT                   /product="uncharacterised endonuclease"
FT   CDS_pept        647176..647598
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06950"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="GOA:E7A481"
FT                   /db_xref="InterPro:IPR005538"
FT                   /db_xref="InterPro:IPR022957"
FT                   /db_xref="UniProtKB/TrEMBL:E7A481"
FT                   /protein_id="CBY80857.1"
FT                   /translation="MIQKLFLLVRSLVILSIMLYLGNLIAYYIPAGVPGSIWGLLLLFL
FT                   GLTTRLIHLNWIYLGASLLIRFMAVLFVPVSVGIIKYSDLLREQVNILLVPNIVSTCVT
FT                   LLVIGFFGHYLYQSQSFTHKRKKVMKRRENQVKQAN"
FT   CDS_pept        647616..648311
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06960"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="GOA:E7A482"
FT                   /db_xref="InterPro:IPR005261"
FT                   /db_xref="InterPro:IPR007300"
FT                   /db_xref="UniProtKB/TrEMBL:E7A482"
FT                   /protein_id="CBY80858.1"
FT                   /translation="MQQYIIYFYTFLTIFGFWLALQISKRWKSMIFNTFVLTVLILAAI
FT                   LVIGKIPYDDYMAGNAPINNLLGLSIVALALPLYEQLRQIAKQWKIILSTVVIASFLAM
FT                   LSGGLLAFLLGATPEMVATVLPKSITTPIAMEVSRHLGGIPAVTAVGVVVAGLQGSIFG
FT                   YLVLKKLGVKHQEAIGLSVGSVSHALGTVSCMETNPTAGSYSSISLVLCGIISSILAPF
FT                   VFKLIYFFV"
FT   CDS_pept        648434..649789
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06970"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /db_xref="GOA:E7A483"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:E7A483"
FT                   /protein_id="CBY80859.1"
FT                   /translation="MKLLTVNSSWTERFLPDPPREKDNRPPFRRDRGRILHSAAFRCLQ
FT                   AKTQIHAIGENDFYRTRLTHSLEVAQIGSSLVAQLKFVETFESLSQKLNIDKNELQKQL
FT                   KPLLPSNDLIESLCFAHDIGHPPFGHGGETALNYMMAEQGGFEGNAQTFRILTKLEPYT
FT                   ENAGMNLTRRTLLGVVKYPALLDVASPQYAELNFSRNIDPRFVRIHDWIPGKGIFRDDL
FT                   KMFNWLLENLSENDRTLFGKFKKVRENPAEFLQTSFKSLDCSIMELADDIAYGVHDLED
FT                   AIVTGVVNPHQWQAAHSALKHIPSAWLHENIDSISQRLFSDKHFERKQAIGALVNFFIT
FT                   NVRWKLTANFDEPLLRYNAELPPEVIAALGIFKKFVWDYVIRNVDTQRIEYKGQRMLTE
FT                   MFQIFESDPERLLPRNTANRWRNAPEEGKKRIICDYIAGMSDAHALRVYQQL"
FT   CDS_pept        650030..651811
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_06980"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:E7A484"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:E7A484"
FT                   /protein_id="CBY80860.1"
FT                   /translation="MDDGKIQYEKDLVVSRLEQDPPRNAQGNIFDYVAEGVGHLTDLLK
FT                   EYHHISVQLEENYSDQILSQLEQVQSKLEHADGWRFENKINEVLLKLGLNPNTKLSALS
FT                   GGWLRKAALARALVCDPDVLLLDEPTNHLDVEAIEWLENFLLDFQGSIVFISHDRSFIR
FT                   KMATRIVDLDRGQLQSYLGNYDLYLTTKEENLRVEALQNELFDKRLAQEEVWIRQGIKA
FT                   RRTRNEGRVRALKAMREERHQRREVMGTAKLQLDTSSRSGKIVFEMEDVSYEIAGKTLL
FT                   KDFSTTILRGDKIALVGPNGCGKTTFIKLLLGEIQPTSGKIRCGTKLEIAYFDQYRADL
FT                   DPEKTVMDNVADGKQDIEVNGVKRHVLGYLQDFLFPPKRAMTPVKALSGGERNRLLLAK
FT                   LLLKPNNLLILDEPTNDLDVETLELLEEILTDYQGTLLIVSHDRQFIDNTATECYLFEG
FT                   EGRLNKYVGGFFDAKQQQANFWASKAVEEQAKAKKTESLKEENAVKNDRTSKPKSVKLS
FT                   YKEQRELEQLPQLLEELETKIAELQAEIADPAFFQQFHDITDAKLKVLSDAEAELEKAF
FT                   LRWEELEEKKNLADGKA"
FT   CDS_pept        complement(651895..653034)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07000"
FT                   /product="Bacterial extracellular solute-binding
FT                   protein,family 1"
FT                   /db_xref="GOA:E7A485"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:E7A485"
FT                   /protein_id="CBY80861.1"
FT                   /translation="MPVIRQVVFYDSLTGEQTKMKKFSGLITASFVAATLTACNDKDAK
FT                   QETAKATAAANDTVYLYTWTEYVPDGLLDEFTKETGIKVIVSSLESNETMYAKLKTQGE
FT                   SGGYDVIAPSNYFVSKMAREGMLKELDHSKLPVLKELDPDWLNKPYDKGNKYSLPQLLG
FT                   APGIAFNTNTYKGEQFTSWADLWKPEFANKVQLLDDAREVFNIALLKIGQDPNTQDPAI
FT                   IKQAYEELLKLRPNVLSFNSDNPANSFISGEVEVGQLWNGSVRIAKKEKAPLNMVFPKE
FT                   GPVLWVDTLAIPATAKNSEGAHKLINYMLGKKTAEKLTLAIGYPTSNIEAKKALPKEIT
FT                   EDPAIYPSADVLKNSHWQDDVGDAIQFYEQYYQELKAAK"
FT   CDS_pept        complement(653107..653877)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07010"
FT                   /product="polyamine transporter subunit"
FT                   /db_xref="GOA:E7A486"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A486"
FT                   /protein_id="CBY80862.1"
FT                   /translation="MSRLLRNAFMFVVYAYLYIPIIILVTNSFNEDRYGLSWKGFSWNW
FT                   YERLFNNDTLIQAAIHSVTIAFFAATLATIVGGLTAIALYRYRFRGKQAVSGMLFIVMM
FT                   SPDIVMAVSLLALFMVVGISLGFWSLLLAHVTFCLPYVTVTIFSRLNGFDSRMLESAKD
FT                   LGASEVTILRKIILPLALPAVVSGWLLSFTISLDDVVVSSFVSGVSYEILPLRIFSLVK
FT                   TGVTPEVNALATIMIVLSLALVVLSQLITRKNNH"
FT   CDS_pept        complement(653877..654737)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07020"
FT                   /product="polyamine transporter subunit"
FT                   /db_xref="GOA:E7A487"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A487"
FT                   /protein_id="CBY80863.1"
FT                   /translation="MKIINNKFQKITVAIIFSWLIFFVLIPNLLVLAVSFLTRDGSNFY
FT                   AFPITIENYTNLFNPLYAQVVWNSLSMSGIATIICLLIGYPFAFMMSKIHPKYRPLLLF
FT                   LVVLPFWTNSLIRIYGMKVFLGVKGILNTMLIDMGILSAPIRILNTEIAVIIGLVYLLL
FT                   PFMILPLYSAIEKLDNRLLEAARDLGANTFQRFFRVILPLTMPGIIAGCLLVLLPAMGM
FT                   FYVADLLGGAKVLLVGNVIKSEFLISRNWPFGSAVSIGLTVLMALLIFVYYRANKLLNK
FT                   KVELE"
FT   CDS_pept        complement(654721..655839)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07030"
FT                   /product="polyamine transporter subunit"
FT                   /db_xref="GOA:E7A488"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A488"
FT                   /protein_id="CBY80864.1"
FT                   /translation="MENQPQNKPIIELRSIKKSYGSNTIINDFNLTINNGEFVTILGPS
FT                   GCGKTTVLRLLAGLEELDSGSIILDGEDITNVPAEKRHINTVFQSYALFPHMTIFENVA
FT                   FGLRMQKVPNEEIKPRVLEALRMVQLEEMADRKPTQLSGGQQQRIAIARAVVNKPKVLL
FT                   LDESLSALDYKLRKQMQQELKMLQRQLGITFIFVTHDQEEAITMSDRIVLLRKGKIAQD
FT                   GSPREIYEDPANLFVARFIGEINVFEATVIERKSEQVVLANVEGRICDIYTDMPVEKDQ
FT                   KLQVLLRPEDIVIEELDENEHSKAIIGHIIDRTYKGMTLESTVEFDHNGMRVLVSEFFN
FT                   EDDPHMDHSIGQRVGITWHEGWEVVLNDEDNQ"
FT   CDS_pept        656136..657155
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07050"
FT                   /product="peptidase T"
FT                   /db_xref="GOA:E7A489"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR010161"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:E7A489"
FT                   /protein_id="CBY80865.1"
FT                   /translation="MISQIDKTELLERFLHYVSFDTQSKPHAKHSPSSVGQMKLAMQLQ
FT                   KELIQLGLENVEVSKYAVVTAFLLTNDPNLTKTIGLVAHLDTSPQCSGKNVRPEVIEEY
FT                   RGGDIALGIGEEFISPVYYSFMQKLVGQTLIVTDGTTLLGADNKAGIAEIMTALSILQK
FT                   ENIPHCNIRVAFTPDEEIGLGIHYFPMEKFSCDWAYTIDGGEVGELEYENFNAATAKVR
FT                   FFGRNIHTGYAKGKMLNALTLACEFQQVFPVDEVPEKTDGKADFYHLEDFSGDIEQVEL
FT                   TYLIRDFDEQNFVQRKAFIKNQVEKFNAKKGLKKPIALEIQDSYQNMYDVVKNVKFSG"
FT   CDS_pept        complement(657370..657852)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07060"
FT                   /product="DNA-binding ferritin-like protein"
FT                   /db_xref="GOA:E7A490"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:E7A490"
FT                   /protein_id="CBY80866.1"
FT                   /translation="MSKTSIGLDKVQSAELADKLNELLATYQVFYTNVRGYHWNIKGVN
FT                   FFALHAKFEEIYTNLIARVDEVAERILTLGYTPNNAYSQYLKISRIKEDIAVSEAQECL
FT                   SGTLQGLKTLLDQQREILSFANNANDEGTASQMSDYIKEQEKLVWMFQAACQTCHN"
FT   CDS_pept        658126..659004
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07070"
FT                   /product="cytidine/deoxycytidine deaminase"
FT                   /db_xref="GOA:E7A491"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006263"
FT                   /db_xref="InterPro:IPR013171"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR020797"
FT                   /db_xref="UniProtKB/TrEMBL:E7A491"
FT                   /protein_id="CBY80867.1"
FT                   /translation="MQELIKRTLPQDDALNQAIVNELRSQNWAGFLNYSQVQQLCHNFE
FT                   LTPLKLAMHLLPLAASYSHTAISHFNVGAIAIGEQGDFYFGANQEFANSAIQQTIHAEQ
FT                   SAISHAWLRNERRISDMVVNYTPCGHCRQFMNELHGAEKISIHLPHSQNNPLHSYLPDA
FT                   FGPKDLDIAAHLLADENHDLIADHQDDLINQAILAANQSHCPYSNSPHGIAILFKNGDV
FT                   VTGRYAENAAFNPSLPALQTALNFAYLNDKKLSDIERIVMAEKALKLSHKTMAETLLST
FT                   LTSVELEYYSL"
FT   CDS_pept        complement(659047..660012)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07080"
FT                   /product="putative methyltransferase"
FT                   /db_xref="GOA:E7A492"
FT                   /db_xref="InterPro:IPR010017"
FT                   /db_xref="InterPro:IPR027555"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A492"
FT                   /protein_id="CBY80868.1"
FT                   /translation="MIDFRPFYQQIATTNLSDWLETLPRQLKEWENQTHADYAKWSKIV
FT                   DFLPDLQADEIDLKSAVKSDRTFPLSAGEKQRIMHHLKQLMPWRKGPYHLFGIHIDCEW
FT                   RSDFKWKRVLPHLAPLQGRTILDVGCGSGYHMWRMVGEGAKMVVGIDPTELFLCQFEAV
FT                   RKLLNNDRRANLIPLGIEQMQPLAAFDTVFSMGVLYHRKSPLDHLSQLKNQLVKGGELV
FT                   LETLVVDGDVNTVLVPADRYAKMKNVYFIPSVAALINWLEKVGFTNVRCVDVATTTLEE
FT                   QRKTDWLENESLIDFLDPNDHSKTIEGYQAPKRAVILANK"
FT   CDS_pept        complement(660009..661472)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07090"
FT                   /product="sodium/proline symporter"
FT                   /db_xref="GOA:E7A493"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR011851"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E7A493"
FT                   /protein_id="CBY80869.1"
FT                   /translation="MLLIGVLAYYYTNNLSDYILGGRRLGSFVTAMSAGASDMSGWLLM
FT                   GLPGAVYLSGLVEGWIAIGLTIGAYFNWLLVAGRLRVYTELNNNALTLPEYFHNRFGSS
FT                   HKLLKLVSATIILVFFTIYCASGVVAGAKLFQNIFSVEYSTALWYGAAATIAYTFIGGF
FT                   LAVSWTDTIQATLMIFALILTPVFVLLSFTDTAQFSAVLEQAEAAVNKDFTDLFTSTTP
FT                   LGLLSLAAWGLGYFGQPHILARFMAAYSVKSLIKARRISMTWMVLCLGGAIGIGFFAIP
FT                   YFFANPAIAGTVNREPEQVFIELAKLLFNPWIAGILLSAILAAVMSTLSAQLLISSSSI
FT                   TEDFYKGFIRPNASEKELVWLGRIMVLVIAAFAIWIAQDENSKVLKLVEFAWAGFGSAF
FT                   GPVVLFSLFWKRMTSSGAMAGMLVGTVTVFAWKEVVPANTDWFKVYEMIPGFAFASLAI
FT                   IVVSLLSNKPEQDILNTFDKAEKGYKEAK"
FT   CDS_pept        661639..663114
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07100"
FT                   /product="ribonuclease G"
FT                   /db_xref="GOA:E7A494"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:E7A494"
FT                   /protein_id="CBY80870.1"
FT                   /translation="MDAVELLMNVTPNETRIALVETGMLREVHIERQAKRGIVGNIYKG
FT                   RVTRVLPGMQSAFVDIGLEKAAFLHAADIVSHTECVDENEQKQFKVKSISELVREGQDI
FT                   VVQVVKEPLGTKGARLTTDITLPSRYLVFMPENSHVGVSQRIESEEERARLKALVEPFC
FT                   DELGGFIIRTATEGASEEELRQDAEFLKRLWRKVLERKSKYPTKSKIYGEPALPQRILR
FT                   DFIGTNLEKIRIDSKLCFGEVKEFTDEFMPELSDKLVLYSGNQPIFDVYGVENAIQTAL
FT                   DKRVNLKSGGYLIIEQTEAMTTIDINTGAFVGHRNLEETIFNTNIEATKAIAQQLQLRN
FT                   LGGIIIIDFIDMQTDEYRNRVLQSLCDALSKDRMKTNVNGFTQLGLVEMTRKRTRESLE
FT                   HVLCDECPTCHGRGRVKTVETVCYEIMREIIRVHHLFSSEQFVVYASPAVSEYLINEEY
FT                   HGLLPEVEMFIGKRVKVKTEQFYNQEQFDVVVM"
FT   CDS_pept        663458..663850
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07110"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:E7A495"
FT                   /protein_id="CBY80871.1"
FT                   /translation="MYMLDTNTVSYFFRKVPSVVERLRLLNPEILCISSVTAAELFYGV
FT                   AKRNNLQLSQFLDIFLSAISILEWDTKTAEIYGKLRAEMEKEGKVMGVQDQMIAAHALA
FT                   NECVLVTSDKAFELVPNLILENWCSV"
FT   CDS_pept        join(664200..664223,664220..665608)
FT                   /transl_table=11
FT                   /gene="tabA3"
FT                   /locus_tag="HIBPF_07130"
FT                   /product="putative trimeric autotransporter adhesin"
FT                   /db_xref="GOA:E7A496"
FT                   /db_xref="InterPro:IPR005594"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:E7A496"
FT                   /protein_id="CBY80872.1"
FT                   /translation="MFLYNSVNKQTNKQTNKQTNKQTNKQTNTNLFFPSCTITTALSII
FT                   GGIFTNPALADTSSPTTSNTNFSQNFGMKDISTSEDTSNIIIGNLNTNTINGVNGTDTS
FT                   NPNSKLSDATNNLIVGNNNKLTGNSTVVVGLSNTVTGESYGGGNGNLQVYGLSNTVKGA
FT                   SSQVFGQENKVYGVYHTVSGYDNNVGKDSNKIDDHTYNVVSGYKNKVEGSHNVVLGETN
FT                   EAKKADNTAVNYTVALGYSAKTLGNDAVAIGKQAEANIGSTAIGKEANATGNYSTALGK
FT                   ESKALGSYTVAIGNGAKAEHSDSVALGSNAQTTRSDEVSVGKSGSEKFIANVKDAVNDT
FT                   DAVNKRQMEKADAKTLADANQYTDLKLGTLQTQVHNFQSDFNELNGKLGKLDRKLERGL
FT                   AAANALSGLVLPQVVGKASFSAAVGGYGSSNAVAIGVGYTPKANITLKSGIAVNAGKNS
FT                   KISYQMGAGWVW"
FT   repeat_region   664223..664278
FT                   /note="CAAA x14"
FT   CDS_pept        665805..667472
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07140"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A497"
FT                   /db_xref="InterPro:IPR000924"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR004514"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020058"
FT                   /db_xref="InterPro:IPR020059"
FT                   /db_xref="InterPro:IPR020061"
FT                   /db_xref="InterPro:IPR022861"
FT                   /db_xref="UniProtKB/TrEMBL:E7A497"
FT                   /protein_id="CBY80873.1"
FT                   /translation="MMTETSLGAENTRTHHFITQIIDEDLASGKHKSVHTRFPPEPNGY
FT                   LHIGHAKSICLNFGLAKEYQGLCNLRFDDTNPVKEDVEYVDSIKADVEWLGFKWEGEPR
FT                   YASDYFDALYGYAIELIKKGLAYVDELSPEEMREYRGTLTEVGKNSPYRDRTIEENLAL
FT                   FEKMKNGEFAEGKASLRAKIDMTSPFMVMRDPVIYRIKFASHHQTGDKWCIYPMYDFTH
FT                   CISDAIERITHSICTLEFQDNRRLYDWVLENISIERPLPHQYEFSRLNLEGTLTSKRKL
FT                   LKLVNDGIVDGWNDPRMPTISGLRRRGYTPTSLREFCRRIGVTKQDNVVEYSALEACIR
FT                   EDLNENAPRAMAVIDPVRVVIENFEGEEVLTAPNHPNRPELGERQLPFTKELYIDRADF
FT                   REEANKQYKRLVLGKEVRLRNAYVIKAERVEKDASGEITTIFCTYDPETLGKNPADGRK
FT                   VKGVIHWVSATHNHPAEFRLYDRLFTVPNPGAEDDIESVLNPNSLVTKQGFVEQSLAAA
FT                   ETEKGYQFEREGYFCADSKDSRPEHLVFNLTVSLKEGF"
FT   CDS_pept        667550..667981
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07150"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="InterPro:IPR008228"
FT                   /db_xref="UniProtKB/TrEMBL:E7A498"
FT                   /protein_id="CBY80874.1"
FT                   /translation="MQLEPNFWQTKSLLEMTESEWEALCDGCGKCCYRKYIQGRGKRQK
FT                   LYYTRIACNLLDVETGKCGNYSARFKIETDCTKLTKKNLPDFHWLPDTCAYRLLYEGKT
FT                   LPEWHPLISGSSHSVKNADILIKNGIHERDVIDWFEFVI"
FT   repeat_region   668127..668246
FT                   /note="GCATCATC x15"
FT   CDS_pept        668455..671910
FT                   /transl_table=11
FT                   /gene="hmw2A"
FT                   /locus_tag="HIBPF_07160"
FT                   /product="HMW2A, high molecular weight adhesin 2"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR010069"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR024973"
FT                   /db_xref="UniProtKB/TrEMBL:E7A499"
FT                   /protein_id="CBY80875.1"
FT                   /translation="MNKIYRLKFSKRLNQLVAVSEITAGHDRHSGCQNAVDTTSNFQMT
FT                   KWLKLKPLASLISLLSFGFATQTAMANGLQGMEVVNGTASMSINGKSTTITNSPNAIIN
FT                   WKQFNINQDELVRFVQENSNSAVFNRVTSDQISQLKGALNSNGQVFLINPNGIVMGKDA
FT                   VINAAAFTASTLNILDEDLKARNFNFEQAKDKAMAQIVNNGLISVSKNGSVNLIGGSVK
FT                   NNGVIKVEDGNILLLAGQKVTISDMTNPTITYSVVAPENKAVNLGTIFAKNGKIQVHAG
FT                   SLVNKGTLNANSVRQDKSGEIILSAKEGEANIDGTVTLNNANFKAGSLTITGKKVVLNS
FT                   GAKVELTGKEGGTVYIGGDERGKGEIQLAKTTKIKQGASVNVSGSEKGGRAIVWGDFAQ
FT                   VDGEIIANGKNKENGGFVETSGHYLGVSNTAKVEAKNWLLDPYNVRIVAPNGIKESNTV
FT                   STTSPDTTIQATGQDAVIYNTTITNALNTGTNVTITTDDTNQNTKGTQLGNLTVEANII
FT                   KTTGKDATLTLIANGQFEQKNGTKIASTDGKLNVNITSGHGLVLKGEIDTNGGDLNINA
FT                   SSLTKPKGRRSNPNPNFLIENAVLKGKGTVRISGSADYLYNFNGKQVYNKLVIKNTEFE
FT                   GYGDEGLKLEYKAVHRDWFDGKYEFFSSWEGNITTRGKVAFERKVTDPTSGNLSFSTHN
FT                   WRAHLKVKNTSRFEFLDKESKLGYASAYNKYSDYKLVNIDEDVTFETGEGSSATFTLKP
FT                   YLGNGSRGNNKPRGLSVSANITAKGSGHVTFDANANGYDVAGMSFDTRNNSKPTTIKTE
FT                   GTTTLEFTGKSASRDGLAIKNQLVLDAGEGSHIILNGSSGRAAVNVSASADVTIKGDGE
FT                   TSIKSTSGNVEVNANIKSDSSTVNITSEKNINIKENVEVKGKSVNLEAAEHLTLGNQAK
FT                   VTATMGDAILSGKNITNSGTVNAKVGNVNVNAKENFTNESTGKLDAKGKVTVDAETVDN
FT                   KGVIDGHKATSVTAGQKVTNHESGQILSTEGDVYVITNGILHNNGYIQGKTGTTIVEGQ
FT                   RQSKDNLMSDLIHTLGDIQRTVRSSLRAAENEQHPSSSAKSLMFYDKGRAVNKVASIIS
FT                   HGSVCSVELPAGKNIADGRLLTSCLAENEKSKAEYHKQSEKVGD"
FT   CDS_pept        671985..673622
FT                   /transl_table=11
FT                   /gene="hmw2B"
FT                   /locus_tag="HIBPF_07161"
FT                   /product="HMW2B, OMP-85-like protein required for secretion
FT                   of HMW1A and HMW2A"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A0"
FT                   /protein_id="CBY80876.1"
FT                   /translation="MNKMNKFKLSAVVLLLGFGMTSMANAEQQFPVNSFQLLGDIQGLT
FT                   DNEQISLAEILERYQGNQTLTSLKKAQKALQEKLNAFNKGKYEIVLPEQRVENGNVFFL
FT                   LSYNAPTTGEVFYKGSEGYDEKNIAQSLPSLKQRKYFEDGRQWFDPREFAMAKENPLKI
FT                   TRVHYELASQNKVSNLTVSGFSPYGKTRNFISVDNYGSREFNRARITFWHMNANLTGND
FT                   DVLTINALTNFKAPSKSSALGIGYSRPFYNNHQMISIQAGVSRLDSSDTDGLPSAINRK
FT                   LSRGKSTFIGLNWSYFLPQFDWGIEDQFKLNAGYSYRYYDQKSGVNNLGDTRKNFSLGG
FT                   INLGISGEVKLNPAATINVEFTDYYYAYNLPGSNHSRRLGQNYHSGYNLLVSRLGYNQD
FT                   FADGWNFNSQLSGQYTRQDLNSIDHFVVSGIYGVRGFKYSGVNAERGLIWRNELTMPKY
FT                   TQYHISPYAFYDLGQYRYNKENAKIYDANTHTVSSAGLGVKAELVKNLNMDLFVVRRLV
FT                   NSDKDILNGNKAFESDKTTFWGKITYSF"
FT   CDS_pept        673707..675554
FT                   /transl_table=11
FT                   /gene="hmw2C"
FT                   /locus_tag="HIBPF_07170"
FT                   /product="HMW2C, putative glycosyltransferase involved in
FT                   glycosylation of HMW1A and HMW2A"
FT                   /db_xref="GOA:E7A4A1"
FT                   /db_xref="InterPro:IPR040542"
FT                   /db_xref="InterPro:IPR041109"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A1"
FT                   /protein_id="CBY80877.1"
FT                   /translation="MLQESQPSINRLEKAIVDKNYEVACSELLKILEKIDANFGDINEI
FT                   EFDFPEQISDLLEKRTQYFCTRIANAVTNLFIDPNLMLSESGALRFIAFQRWLALIFAS
FT                   SPYVNADHILKTYNTNSDILGDIHLNNDFSAIAKFCILYFPESNIDLNLNALWNANKEL
FT                   CASLCFALQSPRFIGTAIAFNKRAAILQWFPNKLEEFDSLNQLPASISHDVYMHCSYDF
FT                   AQNKHDVKRALNQVIRKHLLAQGWQDREITSLSECNGKPVMIVLLEHFNSFHSIYRTHS
FT                   TSMIEARKKFYLVGIGKENVDQAGREVFDEFFQLEYDTIFQQIEFVRKKCEEYGAAVFY
FT                   MPSIGMDITTIFASNTRLAPIQVVALGHPATTHSDFIEYVIVEDDYVGSEDCFSEKLLR
FT                   LPKDALPYVPSSLAPEKVDYLFREEPEVVNIGIAATTMKLNPTFLATLRIIRDKAKVKV
FT                   HFHFALGQSFGITHPHVKWFIEQYLGDSATAHAHAPYREYLDILRHCDMMLNPFPFGNT
FT                   NGIIDMVTLGLVGVCKTGQEVHEHIDEGLFKRLGLPEWLIAQSVEEYINCAVRLAENHK
FT                   ERLELRQHIIKTNGLKTLFKGDPSPMGKVLFEKVKALKF"
FT   CDS_pept        676889..678427
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07200"
FT                   /product="pyridine nucleotide transhydrogenase, alpha
FT                   subunit"
FT                   /db_xref="GOA:E7A4A2"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008142"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="InterPro:IPR026255"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A2"
FT                   /protein_id="CBY80878.1"
FT                   /translation="MLIGVPRELLENESRVAATPKTVQQILKLGFDVIVEHDAGFKASF
FT                   EDQAFLEAGAKIGTSAEIWQSDIIFKVNAPTDEEIAQMKEGATLVSFIWRMQNPELMKK
FT                   LTAKKINVLAMDAVPRISRAQALDALSSMANISGYRAVIEAAHEFGSFFTGQITAAGKV
FT                   PPAKVLVIGAGVAGLAAIGAANSLGAIVRAFDSRPEVKEQVQSMGASFLEIDFKEEGGS
FT                   GDGYAKVMSEEFNRRAMELYAEQAKEVDIIITTAAIPGKPAPRLITKEMVDSMKPGSVI
FT                   VDLAAATGGNCEYTQAGKVVTTENQVKVIGYTDFPSRLPTQSSQLYGTNLVNLLKLLCK
FT                   EKDGNINIDFEDVVLRGVTVVRDGEEIPPAQIQVSAQPKQETKAAPVAEKKESKPTDPR
FT                   VKYGVMAGVGVLFLWLASVAPAAFLSHFTVFVLACVVGYYVVWNVSHALHTPLMAVTNA
FT                   ISGIIIVGALLQIRQPTGNLFIDALAFVAILVASINIFGGFRVTQRMLAMFRKG"
FT   CDS_pept        678438..679862
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07210"
FT                   /product="pyridine nucleotide transhydrogenase, beta
FT                   subunit"
FT                   /db_xref="GOA:E7A4A3"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A3"
FT                   /protein_id="CBY80879.1"
FT                   /translation="MSEGLVQAAYILAALLFIMSLAGLSKHETAKAGCWFGIVGMTIAL
FT                   IATIFGPHSEGTFWIIIAMIIGGAIGVQRALKVEMTEMPELVAILHSFVGLAAVLVGFN
FT                   SYGLHHEALMPEGLDAAAQAAFVAEQAVLTNIHNVEVFLGIFIGAVTFTGSVVAFGKLS
FT                   GKINSKALMLPHRHKLNLAALVVSALLMVAFLNNPESIFPVLLMTAIALAFGWHLVASI
FT                   GGADMPVVVSMLNSYSGWAAAAAGFMLNNDLLIVTGALVGSSGAILSYIMCKAMNRSFV
FT                   SVIAGGFGNDVQVSSSEEQGEHRETTAEEVAELLKNASSVIITPGYGMAVAQAQYPVAD
FT                   ITAKLRERGVNVRFGIHPVAGRLPGHMNVLLAEAKVPYDVVLEMDEINDDFADTDVVLV
FT                   IGANDTVNPAAMEDPNSPIAGMPVLEVWKAQNVIVFKRSMAVGYAGVQNPLFFKENTQM
FT                   LFGDAKDRVEDILKAL"
FT   CDS_pept        complement(679926..680843)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07220"
FT                   /product="putative HTH-type transcriptional regulator"
FT                   /db_xref="GOA:E7A4A4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A4"
FT                   /protein_id="CBY80880.1"
FT                   /translation="MDKLNAISIFCKVIETQSFTLAAKQQNISVAMASKLVSQLEEHLK
FT                   TRLLQRTTRKIMPTEAGMMYYQRCQGILLDLDEADSSITHLTSSLQGNLLISVPRDFGL
FT                   LFIAPNLPTFMAKHPHLHIEVEFNDKKIDLLSEGYDLALRIGYMEDSSLVSRKIGTTTV
FT                   HFAASPNYLEANGIPQTPDDLEHHNGLLYKNAMNQVNWVGSRINQTQRFKIQSKVVSNS
FT                   GFALLNMAKAGLGIANLAKFILGRAFEKGELIEILPEYKQQKLEIHVVYPNRRHLPIKV
FT                   RAFIEFLSGLGLCSEILENHEDNI"
FT   CDS_pept        680939..683545
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07230"
FT                   /product="DNA topoisomerase I, omega subunit"
FT                   /db_xref="GOA:E7A4A5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005733"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013263"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR028612"
FT                   /db_xref="InterPro:IPR034149"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A5"
FT                   /protein_id="CBY80881.1"
FT                   /translation="MNKSLVIVESPAKAKTINKYLGSQYVVKSSVGHIRDLPTVGSSAG
FT                   EKAKPISTKGMDAEEKAKIKAEKERNALVKRMGIDPYHDWKANYQILPGKEKVVSELKS
FT                   LAKKADHIYLATDLDREGEAIAWHLREVIGGNDDRFSRVVFNEITKNAIKQAFEKPEQL
FT                   NMDRVNAQQTRRFLDRVVGFMVSPLLWKKVARGLSAGRVQSVAVKLLVEREREIKAFQP
FT                   EEYWEVAVLTNNQNKQAIRLDVTDYKGKKFDPKNQKEAQSAVDFLNVSDYVVTDLETKP
FT                   TSSRPRAPFITSTLQQTASTRLGFGVKKTMMLAQRLYEAGYITYMRTDSTNLSQDALNM
FT                   ARSYIENHFGAQYLPEKPNFYSSKENAQEAHEAIRPSDIRALPESLEGMEKDAVRLYDL
FT                   IWRQFLACQMPPAQYDSSTLTVSAGDYTLKAKGRILRFDGWTKVLPQIGKNPEDQELPS
FT                   VTVSEKLALKEVQPTQHFTKPPARFTEAALVKELEKRGIGRPSTYAAIISTIQERGYVR
FT                   TENRRFYAEKMGEIVTDRLNESFGELMNYDFTANMEDTLDKIASGSVNWKTELNQFFKD
FT                   FSSQLSKAELDELEGGMRPNNLVETDIKCPTCDRKMAIRTASTGVFLGCSGYALPPKER
FT                   CKTTINLIPEAELLNVLDESSETKALMDRKRCTKCGTAMDSYVIDAHRKIHICGNNPNC
FT                   DGYLIEEGSFKIKGYDGPVVECDKCGADMHLKLGRFGKYMGCTNCDNTRKILKNGEVAP
FT                   PKEEPVHFPELKCEKSDAYFVLRDGASGVFMSAHNFPKSRETRPVKIAELVQYRERLPE
FT                   KLAYLADAPQKDPEENEAIVRFSRKEKKQYVTSEKEGKATKWIVDFTNGKWVERKK"
FT   CDS_pept        complement(683619..684194)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07240"
FT                   /product="NADH-azoreductase, FMN-dependent"
FT   CDS_pept        684479..686410
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07250"
FT                   /product="threonyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A4A6"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A6"
FT                   /protein_id="CBY80883.1"
FT                   /translation="MPIITLPDGSQRQFDRPVSVLEVAQDIGAGLAKATIAGRVNGERR
FT                   DACDVIEQDATLEIITAKDEDGLEIIRHSCAHLLGHAIKQLFPNVKMAIGPTIENGFYY
FT                   DVDLDRSLTQEDIDAIEKRMLELAKTNYDVVKKRVTWQEARDTFEKRGEPYKMAILDEN
FT                   IERTATPALYHHLEYIDMCRGPHVPNMRFCQHFKLQKVAGAYWRGDSKNKMLQRIYGTA
FT                   WADKKQLAEYLTRLEEAAKRDHRKIGKALDLYHMQEEAPGMVFWHNDGWTIFRELETFV
FT                   RTKLKQYDYQEVKGPFMMDRVLWEKTGHWQNYADLMFTTQSENREYAIKPMNCPGHVQI
FT                   FNQGLKSYRDLPIRMAEFGSCHRNEPSGSLHGLMRVRGFTQDDAHIFCTEDQIESEVTS
FT                   CIKMVYDIYSTFGFTNIAVKLSTRPENRIGSDEMWDRAEGGLAAALAHNGLEYEIQEGE
FT                   GAFYGPKIEFALRDCLGREWQCGTVQLDFALPGRLDATYVAEDNNRKTPVMIHRAILGS
FT                   IERFIGIITEEYAGFFPAWLAPTQAVVMNITDSQADYVQKVAKQLSDVGLRVKTDLRNE
FT                   KVGFKIREHTLRRVPYMLVCGDKEIAEGKVAVRTRKGADLGTFTVEEFAEILKNQVRNR
FT                   ELKLLNEE"
FT   repeat_region   686670..686681
FT   CDS_pept        join(686823..687584,687586..689265)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07270"
FT                   /product="putative trimeric autotransporter adhesin"
FT                   /db_xref="PSEUDO:CBY80884.1"
FT   CDS_pept        complement(689515..689844)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07300"
FT                   /product="predicted sulfite reductase subunit"
FT                   /db_xref="GOA:E7A4A8"
FT                   /db_xref="InterPro:IPR007453"
FT                   /db_xref="InterPro:IPR025526"
FT                   /db_xref="InterPro:IPR042072"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A8"
FT                   /protein_id="CBY80885.1"
FT                   /translation="MLNTNGIEVETDKDGYLLHSQQWNEDVARSIAQLESIELTNAHWE
FT                   VIYFVRDFYQEYNTSPAIRMLVKAMAEKLGADKGNSRYLQRLFPEGPAKQATKLAGLPK
FT                   PAKCL"
FT   CDS_pept        complement(689846..690676)
FT                   /transl_table=11
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4A9"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012089"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035107"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4A9"
FT                   /protein_id="CBY80886.1"
FT                   /translation="MIEDGDKVMVCLSGGKDSYTLLDILLNLQQSAPIKFDIVAVNLDQ
FT                   KQPGFPEHVLPEYLESIGVDYKIVQENTYGIVKEKIPEGKTTCSLCSRLRRGILYRTAT
FT                   ELGATKIALGHHRDDMLATLFLNMFYGGKMKSMPPKLISDDGKQIVIRPLTYCKEKDIE
FT                   KYAIAKEFPIIPCNLCGSQPNLQRQVVKEMLNTWDRQYPGRLETMFSAMQNITLSHMCD
FT                   PKLFDFKGIKHGQLINGIEADTAFDEERITPMQFENEDQTDFSNNEMINFKEVN"
FT   CDS_pept        690927..692261
FT                   /transl_table=11
FT                   /gene="mukF"
FT                   /locus_tag="HIBPF_07320"
FT                   /product="chromosome segregation and condensation protein
FT                   MukF homolog"
FT                   /db_xref="GOA:E7A4B0"
FT                   /db_xref="InterPro:IPR005582"
FT                   /db_xref="InterPro:IPR033439"
FT                   /db_xref="InterPro:IPR033440"
FT                   /db_xref="InterPro:IPR033441"
FT                   /db_xref="InterPro:IPR036141"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR038198"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B0"
FT                   /protein_id="CBY80887.1"
FT                   /translation="MIETSQTIPELVSWAKDREFSLNLPTERLVFLLAIAIYNNERLDG
FT                   EMLEADLVDIFRHTMNAFEQSTDAIATRANNAINELVKQRLLNRFSSEFTEGLAIYRLT
FT                   PLGVGVSDYYIRQREFSALRLSVQLSIVADEIQRASDSAEEGMKNNENEHYWRRNVFAP
FT                   LKYSVAEIFDSIDLSQRIMDENQQSIKDEIAELLTKDWQAAISSCERLLDETSGNLREL
FT                   QDTLNAAGDKLQAQLLRIQDCVIGRDDLYFIDQLITDLQSKLDRIISWGQQAIDLWIGY
FT                   DRHVHKFIRTAIDMDKNRVFSQRLRNSIHHYFDHPWFLWTAQAERLVDLRDEEMVLRED
FT                   DALGELPEELQYESLSDLHDQIVEHMQGLLIAYCENNRPIDLSLVLKEQLENYPLSHHF
FT                   DVARIIVDQAVRLGMANDDLSGIYPDWQAINKRGAEVQAHVIDKY"
FT   CDS_pept        692308..693039
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07330"
FT                   /product="cell division protein MukE"
FT                   /db_xref="GOA:E7A4B1"
FT                   /db_xref="InterPro:IPR007385"
FT                   /db_xref="InterPro:IPR042037"
FT                   /db_xref="InterPro:IPR042038"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B1"
FT                   /protein_id="CBY80888.1"
FT                   /translation="MTDIQDVISPKLAVAIANPIFPAVDSLLRSGRHISTEHLDNHAFL
FT                   MDFQNELDGFYRRYNVELIRAPEGFFYLRPKATTLIARSVLSELEMLVGKVLCYLYLSP
FT                   ERLAQQGIFSTQEVYDELLNLADEGKLLKAVNQRSSGSDLDKQKLAEKVRAAIGRLRRL
FT                   GMIQTVGEQNSGKFTISESVFRFGAEVRSGDDPLEAQARLIRDGEAATPESLALEKQAQ
FT                   LMENDTKSADEIDEEFDGEQE"
FT   CDS_pept        693039..697571
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07340"
FT                   /product="cell division protein MukB"
FT                   /db_xref="GOA:E7A4B2"
FT                   /db_xref="InterPro:IPR007406"
FT                   /db_xref="InterPro:IPR012090"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032520"
FT                   /db_xref="InterPro:IPR042501"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B2"
FT                   /protein_id="CBY80889.1"
FT                   /translation="MSDVFELENEIELESDEVIMENENVEEIVDAPMPFSMTANNGVER
FT                   GKFRSLTLINWNGFFARTFDLDELVTTLSGGNGAGKSTTMAGFVTALIPDLTLLHFRNT
FT                   TEAGSTGGSRDKGLHGKLRPGVCYAVLDTINSRHQRILVGVRLQQIAGRDKKVDLKTFS
FT                   IQGVELSQNPTALFTETVGERQARVLNLNELKDKIENIGAQFKQYHSITDYHGMMFDLG
FT                   IIPKRLRSASDRSKFYKLIEASLYGGISSAITRSLRDYLLPENLGVRKAFQDMESALRE
FT                   NRMTLEAIKVTQSDRDLFKHLITETTNYVASDYMRNANERRGNIEAALESRREWYKAKA
FT                   EQNLSQHRLIDLSREAAELAESERTLEVDHQSAVDHLNLVLNALRHQEKITRYQEDIAE
FT                   LTERLEEQKMVVEDANDALEESQAQFEQTEIEIDAVRSQLADYQQALDAQQTRALQYQQ
FT                   AIAALEKAKTLCGLADLSVKNVEDYHAEFDAHAESLTETVLELEHKMSISEAAKSQFDK
FT                   AYQLVCKIAGEIPRSSAWESAKELLREYPSQKLQAQQTPQLRTKLHELEQRYAQQQSAV
FT                   KLLNDFNQRANLSLQTAEELEDYHAEQEALIEDISARLSEQVENRSTLRQKRENLTALY
FT                   DENARKAPAWLTAQAALERLEQQSGERFENSQDVMNFMQSQLVKERELTMQRDQLEQKR
FT                   LQLDEQISRLSQPDGSEDPRLNMLAERFGGVLLSELYDDVTIEDAPYFSALYGPARHAI
FT                   VVRDLNAVREQLAQLEDCPDDLYLIEGDPTAFDDSVLSAQELELGVVVQVSDRELRYSR
FT                   FPEIPLFGRAAREKRLEELQIERDEVAEQHAQIAFDVQKYQRLHEHFSQFIGLHLALAF
FT                   QPNPEELMSEINRERNEIDRELNQFNSGEQQLRIQLDNAKEKLQLLNKLIPQLNVLADE
FT                   DLIDRIEECREQLDIAEQDEYFIRQYGVTLSQLEPIANSLQSDPENYEGLKNELTQAIE
FT                   RQKQVQQRVFALADVVQRKPHFGYEDAGQAETSELNEKLRQRLEQMQAQRDTQREQVRQ
FT                   KQSQFAEYNRVLIQLQSSYDSKYQLLNELIGEISDLGVRADDGAEERARIRRDELHQQL
FT                   STSRQHRSYVEKQLTLIESEADNLNRLIRKTERDYKTQRELVVAAKVSWCVVLRLSRNS
FT                   DMEKRLNRRELAYLSADELRSMSDKALGALRTAVADNEYLRDSLRVSEDSRKPENKVRF
FT                   FIAVYQHLRERIRQDIIKTNDPIDAIEQMEIELSRLTAELTGREKKLAISSESVANIMR
FT                   KTIQREQNRIRMLNQGLQNIAFGQVKSVRLVVNIRNTHAMLLDALSGQQDEYQDLFNDN
FT                   RITFSEAMAKLYQRINPHIDMGQRTAQTIGEELLDYRNYLELEVEVFRGADGWLRAESG
FT                   ALSTGEAIGTGMSILLMVVQSWEEESRRIRGKDIVPCRLLFLDEAARLDGKSISTLFEL
FT                   CERLDMQLLIAAPENISPEKGTTYKLVRKIAGNQEHVHVVGLRGFGATE"
FT   CDS_pept        697652..698644
FT                   /transl_table=11
FT                   /gene="haeIIIM"
FT                   /locus_tag="HIBPF_07341"
FT                   /product="Modification methylase HaeIII"
FT                   /EC_number="2.1.1.37"
FT                   /db_xref="GOA:E7A4B3"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR018117"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR031303"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B3"
FT                   /protein_id="CBY80890.1"
FT                   /translation="MNLISLFSGAGGLDLGFQKAGFRIICANEYDKSIWKTYESNHSAK
FT                   LIKGDISKISSDEFPKCDGIIGGPPCQSWSEGGSLRGIDDPRGKLFYEYIRILKEKKPI
FT                   FFLAENVKGMMAQRHNKAVQEFIQEFDNAGYDVHIILLNANDYGVAQDRKRVFYIGFRK
FT                   ELNINYLPPIPHLIKPTFKDVIWDLKDNPIPALDKNKTNGNKCIYPNHEYFIGSYSTIF
FT                   MSRNRVRQWNEPAFTVQASGRQCQLHPQAPVMLKVSKNLNKFVEGKEHLYRRLTVRECA
FT                   RVQGFPDDFIFHYESLNDGYKMIGNAVPVNLAYEIAKTIKSALEICKGN"
FT   CDS_pept        698647..699603
FT                   /transl_table=11
FT                   /gene="haeIIIR"
FT                   /locus_tag="HIBPF_07350"
FT                   /product="Type-2 restriction enzyme HaeIII"
FT                   /EC_number="3.1.21.4"
FT                   /db_xref="GOA:E7A4B4"
FT                   /db_xref="InterPro:IPR019059"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B4"
FT                   /protein_id="CBY80891.1"
FT                   /translation="MSNKSNDNGRAYEFAFINELGRIATQNQNINIEKNSSYYVVEKSW
FT                   STLSDLEKEKYTKSAIAGINLITSLEPIIEDGNGVLNLKIQADNKGELGDIRDILIQRE
FT                   NINWEIGLSLKHNHFAVKHSRLSHKIDFSEKWFQLPSSQNYWDNILPIFEKLEIYKKDK
FT                   IKWRELSNKEDCIYYPILKSFIAEIKEKYDKYNSIVPQRMVEYLLGYFDFYKIISQDNK
FT                   KLTSIQSFNLRGTLNKPSKKRKADIFIPVANLPTRIIDIDFKPNSKNTVELYLDKGWQF
FT                   SFRIHNASTIIEPSLKFDIKLIGVPATIICLETPWEE"
FT   CDS_pept        699812..700687
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4B5"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B5"
FT                   /protein_id="CBY80892.1"
FT                   /translation="MQNLIFAILCSVAVSVLLKIARKKNIIIEQAIAFNYITAITFSYF
FT                   LLKPDFKGLEFTDYIAQSENSPIFLALGLLLPSVFIIMSKAVEFAGIVRSDAAQRLSLF
FT                   LPILAAFLIFHETLSQSKIIGVVLAFIGLFCLLTKPTQGQSAVNFKGVLGLIGVWFGYG
FT                   IIDILFKQVAKSGGAFPATLFISFSLAACVMFIYLFLKRAQWTSSSVIGGIVLGVLNFF
FT                   NILFYIKAHQSFAGNPTLVFAGMNIGVICLGTITGALVFKERISKLNWLGIIFSLSAIF
FT                   CLYYLDKIIA"
FT   CDS_pept        700700..702121
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07380"
FT                   /product="exonuclease I"
FT                   /db_xref="GOA:E7A4B6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR013620"
FT                   /db_xref="InterPro:IPR023607"
FT                   /db_xref="InterPro:IPR034747"
FT                   /db_xref="InterPro:IPR034748"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038649"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B6"
FT                   /protein_id="CBY80893.1"
FT                   /translation="MAKNFSFFIYDYESFGVNPATDRPAQFAGIRTDADFNIIGKPIMF
FT                   YCKQTNDYLPAPEAVMVTGITPQECNEKGLSEPEFAANILAEFSQPNTCVMGYNNIRYD
FT                   DEMTRYTFYRNFIDPYEYSWKNGNSRWDLLDLVRACYALRPEGINWAYDDAGMPSFRLE
FT                   KLTKANGIEHENAHDAMADVYATIAMGKLIKEKQPKLFQYFFENRGKKEIEKLVDTGAM
FT                   TPLVHVSGMLGNYRGNCTWVAPLAWHPTNQNALIVCDLTGDIDNLLAKSADELRTDLYT
FT                   KKSELEERGVSSVPLKLVHINKCPILAPAKTLLPETADRLGIDRQLCLDNLAKLRASFD
FT                   IREKVADIFNEERQFASNDNVETELYNGFFSNADKNNMAILRSLPAEKLSEHGLAFEDK
FT                   RILELLFHYRARHFYKTLTRAEQIKWKKYRQNKLEKSAVEFESSLQRLAEEHSDNSEKL
FT                   SLLQQVYEYGIKLLG"
FT   CDS_pept        complement(702812..704089)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07390"
FT                   /product="sensory histidine kinase in two-component
FT                   regulatory system with PhoB"
FT                   /db_xref="GOA:E7A4B7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B7"
FT                   /protein_id="CBY80894.1"
FT                   /translation="MKKILNFIVEINLAIIISLFTSDFILWFAIILLLILAWHHINEYR
FT                   LLKYLNLKQDNKFSLLQLGTFSQTEAYHRHQIYKEKCASLRLLSQINKNIKYLPDAIII
FT                   CQHNGNISWCNSIAQQMFDFCWNKKVQKNIFDVIFYEQFKHYFFSQKKRRPLVLLTYNQ
FT                   RYIEVQSHAYNSHMILVIARDITDMIHLLNSRQKFLSNINHELRTPLTVLQGYLEILAD
FT                   NNIQNPLQKKAIFAMQEQSQRMEHLLQQFNFLAKIETTSDKDFRTFDMSAMINSLRKDT
FT                   DILNTYNHHIEFIIQPNIIIFGNESQLRSAVSNLIYNAIKHSGKQCHIQIQWETCEQGI
FT                   KFNVIDNGVGISPQHIPHLTERFYRVDESRSHLTGGSGLGLAIVKHILLQYHSHLNIES
FT                   TETKGSSFSFIIPKRFVISKNNKEIQ"
FT   CDS_pept        complement(704086..704781)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07400"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with PhoR (or CreC)"
FT                   /db_xref="GOA:E7A4B8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B8"
FT                   /protein_id="CBY80895.1"
FT                   /translation="MTRKILIVEDECAIREMIALFLSQKYYDVIEASDFKTAINKIKEN
FT                   PKLILLDWMLPGRSGIQFIQYIKKQESYAAIPIIMLTAKSTEEDCIACLNAGADDYITK
FT                   PFSPQILLARIEAVWRRIYEQQSQFIQIDELSIDENAQRVFFQQQEINLSSTEFKLLHF
FT                   FMRHPEKVYSREQLLNRIWHNDLEVEYRTVDSYIRRLRRNLAPFQCEHYIQTVRGSGYR
FT                   FSSYLRDKQ"
FT   CDS_pept        complement(704858..705625)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07410"
FT                   /product="phosphate transporter subunit"
FT                   /db_xref="GOA:E7A4B9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4B9"
FT                   /protein_id="CBY80896.1"
FT                   /translation="MISLQETKIAVQNLNFYYEDFHALKNINLRIAKNKVTAFIGPSGC
FT                   GKSTLLRSFNRMFELYPNQKATGEINLDGENLLTTKMDISLIRAKVGMVFQKPTPFPMS
FT                   IYDNIAFGVRLFEKLSKEKMNERVEWALTKAALWNEVKDKLHKSGDSLSGGQQQRLCIA
FT                   RGIAIKPSVLLLDEPCSALDPISTMKIEELITELKQDYTVVIVTHNMQQATRCSDYTAF
FT                   MYLGELVEFGQTQQIFDRPKIQRTEDYIRGKMG"
FT   CDS_pept        complement(705635..706483)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07420"
FT                   /product="phosphate transporter subunit"
FT                   /db_xref="GOA:E7A4C0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C0"
FT                   /protein_id="CBY80897.1"
FT                   /translation="MKTNQNLRFYWRKTHNKLMLGLSYISVIIGLFWLCWILFTLITKG
FT                   IPALSIDLFTQSTPAPNEKGGLLNALIGSFFIVGAGTLIGTPIGVLAGTYLAEYGRYSR
FT                   FAQITRFLNDILLSAPSIIIGLFVYSLYVSKIEHFSGWAGAFALALLLIPIVVRTTDNM
FT                   LLLVPNNLREAAAALGCSQWQVIMMICYRAAKSGILTGVLLAVARISGETAPLLFTALS
FT                   NQFLSWNMNEPIANLPVVIYQYAASPFTDWNNLAWAGAALITLFVLCLNIFTRLFFQHK
FT                   K"
FT   CDS_pept        complement(706485..707432)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07430"
FT                   /product="phosphate transporter subunit"
FT                   /db_xref="GOA:E7A4C1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C1"
FT                   /protein_id="CBY80898.1"
FT                   /translation="MLTKSRKYFNQTWIESLFKQTTALFALLVFILLAAILISLVIGSW
FT                   ESIKRFGGSFLLETYWDPVQEQYGAIIPILGTLITAGIALFIAVPISFGIAIFLTELAP
FT                   NWLKRPISIAIEMLAAIPSIIYGMWGLFVFVPLFQEHIQPVLIDNLGNLPGLELFFSGV
FT                   PFGVGLFTAGLVLAIMIIPFIASVMRDVFSIVPPMLKEGAYGLGATTWEVVRQVIVPHT
FT                   RIGLVGSVMLGLGRALGETMAITFIIGNSFQLPNSLFSPSTSIASAIANEFNEAGGLQK
FT                   SALMELGLLLFVITTMVLILSRLMITKMQQTKGK"
FT   CDS_pept        complement(707523..708542)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07440"
FT                   /product="phosphate transporter subunit"
FT                   /db_xref="GOA:E7A4C2"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C2"
FT                   /protein_id="CBY80899.1"
FT                   /translation="MFMHKMKKNLIIVLTLGTLPFAQANSITGAGASFPYPIYAKWASL
FT                   YEKETGNKVNYQSIGSGGGQQQIIAKTVDFGASDDPMKSELLQQHQLVQFPAVIGGIVP
FT                   VVNLPEIKPGKLKLSGKLLAEIFLGKIKKWNDPDLVALNPTLPLPNKNIIVIHRSDGSG
FT                   TTFGFTNYLSKVSNDWKNQVGEGKSVKWLTGQGGKGNEGIASYVRQMKYTIGYVEYAYA
FT                   KQNQLAWISLQNQAGQFVQPSNESFMAAASHAKWHEKAGMGVILTNETGEKSWPITAAS
FT                   FILLNKYSDNPETTKNVLAFFDWAFSRGQDAATELDYVPIPADVVSTIKSQWKTELKQ"
FT   CDS_pept        708985..709533
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07450"
FT                   /product="ferritin like protein 1"
FT                   /db_xref="GOA:E7A4C3"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C3"
FT                   /protein_id="CBY80900.1"
FT                   /translation="MIATNYALLHFINQNGKELVMLNQIIINKLNDQINLEFYSSNVYL
FT                   QMSAWCSKHGYEGAATFLLRHADEELEHMQKLFNYVSETSGMPILGKIDAPKHDYSSLR
FT                   EVFEITLEHEKLVTSKINELVEVTFESKDYSTFNFLQWYVAEQHEEEKLFSGIIDRFNL
FT                   VGEDGKGLFFIDRELATLE"
FT   CDS_pept        709549..710046
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07460"
FT                   /product="ferritin like protein 2"
FT                   /db_xref="GOA:E7A4C4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C4"
FT                   /protein_id="CBY80901.1"
FT                   /translation="MLSENVVKLLNDQMNLEFYSSNLYLQMSAWCDQQGFEGTAKFLSV
FT                   HAAEEMQHMRKLFTYLNETGSRAIISAIEAPAHEYKSLKEVIETTYEHEKLITSKINEL
FT                   VGKTFEEKDYSAFNFLQWYVEEQHEEEKLFSSILDKLNLLGEDGKSLFLIDKDLGNLAT
FT                   EA"
FT   CDS_pept        710222..711103
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07480"
FT                   /product="Possible glycosyltransferase"
FT                   /db_xref="GOA:E7A4C5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C5"
FT                   /protein_id="CBY80902.1"
FT                   /translation="MKRIYTDEPTNQPTNQPTNQPNGKTVAVVTSTIGRPELSLAIKSV
FT                   QNQTYPCKHYVFVDGNIFWDKAKSILEQFPDVIPIYLPMNTGKNGILNGAINAAATFLV
FT                   EEDIICYLDDDNQLREDHVESLVNVIEQGADFAYSLRSFYDSNHQFICNDDFDSLGNWN
FT                   TKSDIFVDVKIEDIQKQIHFTFNEVNGHIDTNCYAVPREIAQKTSYSWNTPLIGDRSFL
FT                   SALKSLGLIGQTSGKYTVKYRADFNKLIAVRRVFPQLSLSDEDNNNLSAQILEVINQQN
FT                   IEYYGGRPWAKE"
FT   repeat_region   710246..710285
FT                   /note="CCAA x10"
FT   CDS_pept        711209..712765
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07520"
FT                   /product="anthranilate synthase component I"
FT                   /db_xref="GOA:E7A4C6"
FT                   /db_xref="InterPro:IPR005257"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C6"
FT                   /protein_id="CBY80903.1"
FT                   /translation="MNIQTQAFIAVTAQSIPYYADTTAIFNTLCQPNSNSLLLDSAEIG
FT                   SKNSLQSLILVNAAVKITCLGHNVTFKALNKNGKQVLKEIHPKLTALGKISAVNFEDEF
FT                   SVQFSPLDNQLDEDSKLQSATIFDGLRVISSLYQHSQTPIFLGGLFAYDLVANFIPMNG
FT                   ITLQNDGINCPDYSFYLAEHLITIDHQNQQATLKSFCFAQEEQVNIAKTSLSIAQKLKN
FT                   IDHVLSIKSASDEVKTNFDDPEFTGIVKALKHHINIGDVFQIVPSRRFSLACPNTLASY
FT                   AQLKQNNPSPYMFYMNDEDFILFGASPESALKYAPENRQLEIYPIAGSRPRGFDAHGNI
FT                   DPELDARLELELRLDHKEQAEHLMLVDLARNDIARVCQSGTRKVAELMQVDRYSHIMHL
FT                   VSRVVGKLRPELDALHAYQACMNMGTLTGAPKIKAMQLIYQFEQQKRHSYGGAVGYLTS
FT                   DGHFDTCIVIRSAFVQNGIAHVQAGCGEVLDSDPQMEADETRHKAAAVLKAIRQVNTQA
FT                   K"
FT   CDS_pept        712778..713359
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07530"
FT                   /product="Glutamine amidotransferase class-I"
FT                   /db_xref="GOA:E7A4C7"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C7"
FT                   /protein_id="CBY80904.1"
FT                   /translation="MANILFLDNFDSFTYNLVDQFRVLGHNVTIYRNDCDLEKLVETAL
FT                   NTPDTILALSPGSGTPSEAGILLPLIERLKNQVPIIGICLGHQALIQAFGGKVVHAGEV
FT                   LHGKVSRISHDNEAMFKDLANPMPVARYHSLMGQDLPKEFIVNAEYNGIIMAIRHRDLP
FT                   ICAFQFHPESILTVQGSQLLQQSIEWLLNR"
FT   CDS_pept        713408..713794
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C8"
FT                   /protein_id="CBY80905.1"
FT                   /translation="MITVFGLKSKLAPRREKLAEVIYNSLHLGLDIPKGKHAIRFLCLE
FT                   KEDFYYPFDRSDDYTVIEINLMAGRMEGTKKRLIKMLFSELEYKLGIRAHDVEITIKEQ
FT                   PAHCWGFRGMTGDEARDLDYDIYV"
FT   CDS_pept        713847..714848
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07550"
FT                   /product="Glycosyl transferase"
FT                   /db_xref="GOA:E7A4C9"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4C9"
FT                   /protein_id="CBY80906.1"
FT                   /translation="MQHNPLLEQLYSGHSLSTSESTALFNAVIQGELSNEQIAAMLIAL
FT                   KVREANTEEISGAVAASLQNAKVFPRPDYPFADIVGTGGDGQNTINISTASAIVAASMG
FT                   AKIAKHGNRSVSSKSGASDVLTALGVNVNVTPEQARQALDEIGVCFLFAQQYHSGFRHV
FT                   APVRATLKTRTIFNILGPLINPARPTYHLLGVYAPELVKTYAETAVALEHQHSFVVHGS
FT                   GLDEVALHGETQVAEIKNGKIEYFTLTPEDFGLKTQSLESLRGGEPQENAQYLTALLQG
FT                   KGKAEHANVVAANTALLLKLFGYDDLKQNVQNVLAHLVSGKAFETLQKLTTY"
FT   CDS_pept        714885..716318
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07560"
FT                   /product="tryptophan biosynthesis protein trpCF"
FT                   /db_xref="GOA:E7A4D0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR001468"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D0"
FT                   /protein_id="CBY80907.1"
FT                   /translation="MMITQDFTKPIDSATVLQKIVLDKAQWVKAKEKEFPLSQFKQNIQ
FT                   NSDRSFYDALAKGTHQKPAYILECKKASPSKGLIRAEFNLEEIANVYKHYASAVSVLTD
FT                   EKYFQGNFEFLPLVRDIVSQPVLCKDFMISEYQVYFARYYQADAILLMLSVVNDETYRV
FT                   LAELAHSLGMGVLTETSNEEEFERALVLGAKIIGVNNRNLHDLTVDLNRVVELTEKYAD
FT                   CIPADVRIISESGIYNHKQIHQLQKVAHGFLTGSSLMGNQDLNNAVRSVIFGENKVCGL
FT                   TRAQDVKIVYENGALYGGLIFVEHSKRCVSLRQAKELVTAAPLRFVGVFQNQEIDFIVK
FT                   IANQLQLYAVQLHGAETEAFITALRQQLPKNTQIWKAISVNTEAQSAVDFTDDLNVDRY
FT                   IFDSQTANQQGGTGKTFDWSLIPENLKHKIILAGGISPNNVEQAIQQGCLGLDINSGVE
FT                   SSAGVKDQEKVRLVFNNIY"
FT   CDS_pept        716449..716715
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07570"
FT                   /product="hydrogenase 2 accessory protein"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D1"
FT                   /protein_id="CBY80908.1"
FT                   /translation="MFRRSDQIVKIDENSLQLATVDVCGVQREVNISLVCTGNPADLLG
FT                   KWVLVHVGFAMTVIDEDAAKKTQEALITISQLEHEVGDFLGLN"
FT   CDS_pept        complement(716755..719619)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07580"
FT                   /product="valyl-tRNA synthetase"
FT                   /db_xref="GOA:E7A4D2"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db_xref="InterPro:IPR033705"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D2"
FT                   /protein_id="CBY80909.1"
FT                   /translation="MTQKFEMADRFNPSAVEQALYQHWEESGYFKPSENENAPSYCIAI
FT                   PPPNVTGSLHMGHAFQQTLMDTLIRFNRMEGHNTLWQAGTDHAGIATQMVVERKIAAEE
FT                   GKTRHDYGREAFINKIWDWKAYSGGTISQQMRRLGNSIDWERERFTMDEGLSNAVKEVF
FT                   VRLHEEGLIYRGKRLVNWDPKLHTAISDLEVENKESKGSLWHFRYPLANDAKTADGKDY
FT                   LVVATTRPETMLGDTAVAVHPEDERYKDLQGKTVILPLANREIPIIADEYVDREFGTGV
FT                   VKITPAHDFNDYEVGKRHNLPMVNVLTLNANIRDEAEIIGTDGKPLAGYEATIPADYRG
FT                   LERFAARKKIVADFEALGLLDEIKPHDLKVPYGDRGGVPIEPMLTDQWYVSVKPLADVA
FT                   IKAVEDGEIQFVPKQYENLYFSWMRDIQDWCISRQLWWGHRIPAWYDAEGNVYVARNEE
FT                   EVRSKYNLDSAVELKQDEDVLDTWFSSGLWTFSTLGWPEQTKELKMFHPTDVLITGFDI
FT                   IFFWVARMIMFTMHFVKDENGKPQVPFKTVYVTGLIRDEQGQKMSKSKGNVLDPIDMID
FT                   GISLEDLLEKRTGNMMQPQLAEKIAKATRKEFAEGIAAHGTDALRFTLAALASNGRDIN
FT                   WDMKRLEGYRNFCNKLWNASRFVLTNDKLDLSEGEIEFSLADRWIQSEFNRTVETFRNS
FT                   LSQYRFDLCANAIYEFTWNQFCDWYLELTKPVFANGNAAQIRAASQTLVHVLEKLLRLA
FT                   HPLIPFITEEIWQKVKGFVGITADSIMLQPFPQVEESGFDLEAEAEIEWLKEVIVAVRN
FT                   IRAESNIAPSKGLELLFRNLSTENAKILEKQTALLKAMAKLDNVQVLAANETAPLAVAK
FT                   LVGNAELLVPMAGFINKEAELARLTKEIEKYQNEVKRIENKLSNEAFVAKAPEAVIAKE
FT                   REKQAEYQSGLEKIQEQYKAIEAL"
FT   CDS_pept        complement(720142..720462)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007374"
FT                   /db_xref="InterPro:IPR008314"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D3"
FT                   /protein_id="CBY80910.1"
FT                   /translation="MQPNDITFYQRFEADILAGRKTITIRDKSESHFKAGDILLVGRFE
FT                   DNQYFCTIEVLSVSPITLDELTEQHAKQENMGLEELKEVIQTIYPNENEFFMINFHLLF
FT                   TM"
FT   CDS_pept        complement(720684..721106)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4D4"
FT                   /db_xref="InterPro:IPR010488"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D4"
FT                   /protein_id="CBY80911.1"
FT                   /translation="MVRKKLWVMQNKAIFYCGTNGSGKSTLRSFNQDAVQIVIDSDHIA
FT                   MQINPQNPRLADIDAGRKAIGLFRFAIKQHIDFSMESMLSGNSIIQRIKNAKENGFYVH
FT                   LNYIGVNSVEINLAHVKARVKSGGHFIAEDIVKYHY"
FT   CDS_pept        complement(721324..721818)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D5"
FT                   /protein_id="CBY80912.1"
FT                   /translation="MKKTKFCLSLLLGTAVLMISACEKQENKVEATPKAEETKQAAEQN
FT                   VKKETVLLEENKEKTSVVDQKSEAVEQDKMVEAEKTVEMTTQQKMQEAQVSSKVLSAPA
FT                   KIKQANDPNTEKRKILQILEQQYQQVRCTSEGEKLGSESFCHQEEYRLLNKIDRLKKEL
FT                   R"
FT   CDS_pept        complement(721834..722268)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07640"
FT                   /product="DNA polymerase III, chi subunit"
FT                   /db_xref="GOA:E7A4D6"
FT                   /db_xref="InterPro:IPR007459"
FT                   /db_xref="InterPro:IPR036768"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D6"
FT                   /protein_id="CBY80913.1"
FT                   /translation="MAKTAQFYILTENCTLTVEEIACNLAASIWRSGKKVLISCESESQ
FT                   ALEIDELLWQRDPNEFVPHNLSGEATQYPTPIEISWLGKRNLQRRDVLINLQQEIPDFS
FT                   HSFTQLIDFVPKDDALKTQARERYKQLRALGWALSTENIA"
FT   CDS_pept        722503..723897
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07650"
FT                   /product="fumarate hydratase class II"
FT                   /db_xref="GOA:E7A4D7"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D7"
FT                   /protein_id="CBY80914.1"
FT                   /translation="MAFRIEKDTMGEVQVPADKYWAAQTERSRNNFKIGSAASMPHEII
FT                   EAFGYLKKAAAFANHDLGVLPLEKRDLIALACDEILANKLDDQFPLVIWQTGSGTQSNM
FT                   NVNEVVANRAHVINGGKLGEKSIIHPNDDVNKSQSSNDTFPTAMHIAAYKKVVEHTIPC
FT                   VERLQKTFAAKSEAFKNVVKIGRTHLMDATPLTLGQEFSAYAAQLDFGLKALKNTLPHL
FT                   SQLALGGTAVGTGLNTPKGYDVKVADYIAKFTALPFVTADNKFEALAAHDAIVETHGAL
FT                   RQLAMSLFKIANDIRLLASGPRSGIGEILIPENEPGSSIMPGKVNPTQCEAMTMVCAQV
FT                   FGNDTTIAFVGSQGHFQLNVFNPVMIANFLQSAQLLGDACVSFDEHCAVGIEPNYPRIK
FT                   QQLENSLMLVTALNTHIGYENAAKIAKTAHKNGTTLREEAINLGLVSAEDFDKWVRPED
FT                   MVGSLK"
FT   CDS_pept        724025..724633
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4D8"
FT                   /db_xref="InterPro:IPR016087"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D8"
FT                   /protein_id="CBY80915.1"
FT                   /translation="MKMKSLFVAMITFFSTAPFAHWQPIGNAEYTWGPFHVYTIGLFSE
FT                   TGTYQENERPLMLSFKYEKPIEGKNFAITLIKEIETLKLNDGDTQSWLKEMQATFPDFS
FT                   PNDILNYIALPDRGYFVLNDTVLEHDFDAKFNQAFIGIWLAPNSTFVKLQPQLLGKTKS
FT                   NREATEFYLKPEIESFDEQDSTPELPPNYLLDSQKKSQG"
FT   CDS_pept        complement(724733..725557)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4D9"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4D9"
FT                   /protein_id="CBY80916.1"
FT                   /translation="MAKKYDLHCHSTASDGVLSPTELVYRAYAQGVNVLALCDHDTIAG
FT                   IDEAEISAKEVGIELITGVEISTNWEGRGIHIVGLNFDKTHPKMTALLQSQKALREKRA
FT                   VEIGDKLEKAGIPNAYDGAKALADGEVTRAHYARYLVQIGKVSNDGQAFKRYLGQGKSA
FT                   FVKAEWADIPTAIETIHAAGGIAIIAHPLRYNMTGKWVRKLIVDFKAWGGDGMEMADCG
FT                   QAKDQRQMLARWAKEFDLLGSIGSDFHFPCGWVELGKNLDLVDSVIPVWEKF"
FT   CDS_pept        complement(725557..726576)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07680"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /db_xref="GOA:E7A4E0"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E0"
FT                   /protein_id="CBY80917.1"
FT                   /translation="MYQLFRHGIFQMDAEKAHNFTIQCLKLAGNPLFKPILKSIIHAPK
FT                   GFPKMVMGVNFPNPIGLAAGADKNGDAIDGFGALGFGFLEVGTVTPVAQDGNAKLRQFR
FT                   LIEAEGIINRNGFNNNGIDYLIENVKNARYKGVIGINIGKNKFTPLEQGKDDYIFCLNK
FT                   AYNYAGYITVNISSPNTPDLRQLQYGDYFDDLLRSIKDRQAILANQYNKYVPIAVKIAP
FT                   DLTESELVQIADTLVRHKMDGVIATNTTISRDTVMGMKNAEQQGGLSGKPLQHKSTEII
FT                   KRLHQELKGQIPIIGSGGIDGLQNAQEKIEAGAELLQVYSGLIYHGPKLVKELVKNIT"
FT   tRNA            complement(726789..726871)
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:726835..726837,aa:Leu)"
FT                   /note="tRNA Leu anticodon CAA, Cove score 51.82"
FT   CDS_pept        727157..727930
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07690"
FT                   /product="DNA-binding transcriptional dual regulator,global
FT                   regulator of anaerobic growth"
FT                   /db_xref="GOA:E7A4E1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E1"
FT                   /protein_id="CBY80918.1"
FT                   /translation="MKNFVAEAKSGRKIQSGGCAIHCQDCSISQLCIPFTLNEQELDQL
FT                   DNIIERKKPIQKSQVLFKAGDSLNSIYAIRSGTIKSYTISESGEEQIASFHLPGDLVGF
FT                   DAITQMQHPSFAQALETAMVCEIPFDILDDLAGKMPKLRQQILRLMSSEIKSDQEMILL
FT                   LSKMNAEERLAAFIHNLSKRYSARGFSAKEFRLTMTRGDIGNYLGLTVETISRLLGRFQ
FT                   KLGVISVQGKYITINDLNGLIELTGTNKTKITLVK"
FT   CDS_pept        728052..728981
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07700"
FT                   /product="universal stress protein E, UspE"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E2"
FT                   /protein_id="CBY80919.1"
FT                   /translation="MKFKNILVVLNPSNEKQYALARAVRLVEEQKNETKVKITALLSVY
FT                   DLSYEMSALLSSEERSEMHQQVIEKYRHAVQYYLDKYANPEIELQSHIVWNSNEADAIN
FT                   EEVENNNYDLVVKYTKDEEKLTSLIFTPIDWQLLRKCPIPVLMVRDGDWKHQRRILVAV
FT                   NVSGEQEYQDEFNQELVETGISLAENLNRGNVHLVAAYPSAPINMAIDLPEFNTSGYEN
FT                   GIRGQHLINMKALRQKFGIDEDHTHVREGFPEEVIPEVAKEIEAELVILGTVGRTGLSA
FT                   ALLGNTAEHVISKLSCNLLGIKPSKKDD"
FT   CDS_pept        729581..730108
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07710"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A4E3"
FT                   /db_xref="InterPro:IPR003819"
FT                   /db_xref="InterPro:IPR042098"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E3"
FT                   /protein_id="CBY80920.1"
FT                   /translation="MFNDVPTYIPDTLTLLCLKQQEGVATSILLLSDVLKDLAEEEKSL
FT                   LEESKFIIKRPASFAGEAEVRDVPLLMKCKDGSYISRFDYHNIDTESPKHKVVLEKFKK
FT                   SAIDQDKWISLYLKPGEIVTFDNQKTLHTRNGFKAKFDGNDRWLIRLFGTYDKPLKEYF
FT                   VSSECNHHLRTK"
FT   CDS_pept        730346..730918
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07720"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A4E4"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E4"
FT                   /protein_id="CBY80921.1"
FT                   /translation="MQSKSIVWKIIPIGIVSALLGAYIGAEVILMLPTHVINYIIFAFL
FT                   PLGLATTLFKGKLLKQENQEQEIKNSALSVFITCLIVGFYDGFFGPGTGSIFIIALFLI
FT                   NKLSLLRASATSKIFNFSSNIGAFVSFAIAGKMAFLIGIPMIIANLAGNHVGSKHAIHS
FT                   NGEIIKKVLVITVGLLMCTLGYKALFA"
FT   CDS_pept        731039..731791
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4E5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E5"
FT                   /protein_id="CBY80922.1"
FT                   /translation="MKTALVTGATAGFGLAICKLLIASGYKVIGTGRRAVRLAEIHSQL
FT                   GNHFLPLAFDIRDEQATINALNTLPEGWQAVDLLVNNAGLALGLEPAHKADLQDWYQMI
FT                   DTNIKGLVTITRLVLPDMIARNHGHIINLSSIAGNYPYAGSNVYGGTKAFVTQFSLNLR
FT                   ADLAGTKIRVSNVEPGLCGGTEFSNVRFHGDDEKAAKVYENVQSVQPEDIANIVLWLHQ
FT                   QPEHVNINRIEVMPTAQSFAGMSVSKEK"
FT   CDS_pept        731808..733001
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07740"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /db_xref="GOA:E7A4E6"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E6"
FT                   /protein_id="CBY80923.1"
FT                   /translation="MSDTLLNPYFGEFGGMYVPEILVPVLKQLEQAFVETQNDPAFQTE
FT                   FADLLQNYAGRPTALTLCRNLTKGTKAKIYLKREDLLHGGAHKTNQVLGQILLAKRMGK
FT                   TRIIAETGAGQHGVATALACAMLDMPCRIYMGAKDVERQSPNVFRMRLMGAEVIPVQKG
FT                   SCSLKDACCEAMRDWSANYETTHYLLGTAAGPHPFPTIVREFQKMIGIETKRQILEREG
FT                   RLPDAVIAAVGGGSNAIGMFTDFIDEPNVRLIGVEPAGKGIESGEHGAPLGHAKVGIYF
FT                   GMKSPLMQTEDGQVEESYSVSAGLDFPSVGPQHAYLNEIGRADYVSITDEEALNAFQEL
FT                   AKHEGIIPALESSHALAYALKLIKQNPEKEQLLVVNLSGRGDKDIFTVDKILNGGTN"
FT   CDS_pept        733001..733810
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07750"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /db_xref="GOA:E7A4E7"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E7"
FT                   /protein_id="CBY80924.1"
FT                   /translation="MSRFETQFATLNAKNEGAFVPFVTLCDPTFDRSFEIICTLVDNGA
FT                   DALELGFPFSDPLLDGPVIQAANNRALTAGHSSEDSFKLLEKVRSKYPEIPISLLLCAN
FT                   LIFAKGLDAFYQRCAEVGVDAVLVADIPLLAKEDYVQAAKKYGIQPVFICPPNADEKTI
FT                   QGVAKNSEGYTYLVSRTGVTSAENQAHAANLDTLIEQLKAHNAPPILQGFGIAQPEQVK
FT                   DALSLGAAGVISGSATVKIIERNLDNQAKLLEELNDFVRAMKQATQA"
FT   CDS_pept        734032..736092
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07760"
FT                   /product="putative type I restriction-modification system
FT                   methyltransferase"
FT                   /db_xref="GOA:E7A4E8"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E8"
FT                   /protein_id="CBY80925.1"
FT                   /translation="MAKSPSKIQSVEPNIANLANGWLASYKLNYKLEQEQLNTEIDKAL
FT                   DAYFSKNGGVGGNRPDAKLLLRSNITQKDYPILIEYKGYKDKLAKLDADGNVENRSAKN
FT                   EPIFKNINGYAVNGAVHYANALLHHTSYTDIIAIGMTGYKESHTDKLCYEIGVYYVSKA
FT                   NLGIGQKIGKFSDLSFLAPEHFEDFITQVNNLSLSHNELERIKAKRENEIDASLTKLNN
FT                   DIYQNESGLGENDRVYLVAASIMATLGVQGKVSPLEKEDLKSKTEEGERDGDILIRKIN
FT                   AFLSAKNLPQEKKNLIIRTLSNTVLTENINKVVDGESQLKRVFIKIVDDLGIYYKIGLT
FT                   TDFTGKLFNEMYSWLGFSQDKLNDVVLTPSYVATLLAKLARVNKDSYVWDFATGSAGLL
FT                   VAAMNEMLIDAKNTITSPDELRQKEAHIKAHQLLGVEILSSVYMLAILNMILMGDGSSN
FT                   VLNKNSLSDFEGKGFEDKAFPADAFILNPPYSKEGNGMIFVEKALNMVNKGYAAVIIQD
FT                   SAGTGKAKEINQRILQKHSLIASIKMPADIFIGKSSVQTAIYVFKVGEKHEEKQLVKFI
FT                   DFTNDGYKRSSRKKAKASTNLRNVDHATERYQELVNLVKFGKGELNHFTENEYIEDKIS
FT                   VSGDNAGCDWNFTQHKKIDTKPTLDDFQKTVADYLAWEVSQLLKKESEQGK"
FT   CDS_pept        736104..737225
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07770"
FT                   /product="putative type IIS restriction enzyme"
FT                   /db_xref="GOA:E7A4E9"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4E9"
FT                   /protein_id="CBY80926.1"
FT                   /translation="MQKLEEEFLASGGEWKRTILKDWFTIKTSVSFDKGNIELSNNRNG
FT                   NNYEFIGRTSINNGIQGYVKHLGFEPNNGNTFSVIQVGENIAQFRKHKWYGSQNLFLLT
FT                   PKFDWIISHYKYMIACINSGLKIFDKDYSSYPTVNTLNNLVIFLPIRNEQPDVSYMYHF
FT                   ISELQAERLQELQGYLQVTGLSNYTLTEEEQRAIDDLDNIKWGTFNIEKLFGKATRGKR
FT                   LKSADRISGDLPFVTAGENDTGISAFIGNDVEVFKANTITIDMFGSAKYRNYQYGADDH
FT                   IAVVHCDKLAKESVLFLTSAIHKVSNAGQFSYAKNFYAKDANELNISLPTKNNVPDYAL
FT                   MKTLGSAIQKLIIADVVKYADRELSAYQSVIGE"
FT   CDS_pept        complement(737408..738361)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07790"
FT                   /product="predicted semialdehyde dehydrogenase"
FT                   /db_xref="GOA:E7A4F0"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F0"
FT                   /protein_id="CBY80927.1"
FT                   /translation="MDATLNIAIAAEFELSEKIVERFEQSALEISKVSIVEIIPFEEEQ
FT                   NIRFRNKSVEQLSPNEVEWADFNYVFFAGKLEQVSHIAQAAEQGCIVIDMLGVCSALSD
FT                   VPVVVPTVNESQLFELRQRNIISLPDPQVSQLALTLAPILQETNLNQVFVTSSLPASYT
FT                   DAETVTKLAGQTARLLNGIPLDEEETRLAFDVYPHQAPNLSNQLQRIFPQLERATFHAI
FT                   QVPVFYGLAQKVTALSDYDFDYQPQNSELVALEETLITPVLNGEQENGKESVKLHLSQI
FT                   SAVENGVEFWSVADEQRFNLALLSVKLLEGIYQQGY"
FT   CDS_pept        738420..738896
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4F1"
FT                   /db_xref="InterPro:IPR004369"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F1"
FT                   /protein_id="CBY80928.1"
FT                   /translation="MTPAIDLLKKQKIPFILHTYNHDPNNQHFGDEAAEKLGIDPNRSF
FT                   KTLLVAENGDQKKLACFVLATANMLNLKKAAKSIGVKKVEMADKDAAQKSTGYLVGGIS
FT                   PLGQKKRVKTVINSTALEFETIYVSGGKRGLSVEIAPQDLAKVLGAEFTDIVDE"
FT   CDS_pept        complement(739054..739272)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07810"
FT                   /product="cold shock protein homolog"
FT                   /db_xref="GOA:E7A4F2"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012156"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR012751"
FT                   /db_xref="InterPro:IPR019844"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F2"
FT                   /protein_id="CBY80929.1"
FT                   /translation="MEIGIVKWFNNAKGFGFISAEGVDADIFAHYSVIEMDGYRSLKAG
FT                   QKVQFEVLHGDKGSHATKIIPIADTQE"
FT   CDS_pept        complement(739421..739579)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07820"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR005371"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F3"
FT                   /protein_id="CBY80930.1"
FT                   /translation="MFDINLTHEQQQKAVEQIQELMAKGISSGEAIQIVAKALREIHKN
FT                   DKKTPEN"
FT   CDS_pept        complement(739572..740291)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07830"
FT                   /product="tRNA pseudouridine synthase"
FT                   /db_xref="GOA:E7A4F4"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F4"
FT                   /protein_id="CBY80931.1"
FT                   /translation="MLEILYQDEFLVAVNKPAGMLVHRSWLDPHETQFVMQTLRDQIGQ
FT                   HVFPIHRLDRPTSGVLLFALSSEIANLMCEQFEQKYVQKSYLAVVRGYLQGKERIDYPL
FT                   KIQLDKIADKFSQEDKEPQEAITDYEGLKIVEMPYPAGRYQTARYSLVKLIPHTGRKHQ
FT                   LRRHMKHIFHPILGDTQYGDLHQNRALMSHLGCSRLFLHSNSLSFIHPITKEQITITAG
FT                   LDEQWQQLMNQFGWENV"
FT   CDS_pept        complement(740285..740605)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007384"
FT                   /db_xref="InterPro:IPR023376"
FT                   /db_xref="InterPro:IPR036814"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F5"
FT                   /protein_id="CBY80932.1"
FT                   /translation="MRNQTKQHLEQLQITMQQLNLWQTMPPAAEAFLSEEPFSIDTMSA
FT                   EDWLQWVFIPRMQALLESGSALPNKIAISPYIEEAMKEFNELQQLLIPLVALEELLNKN
FT                   QC"
FT   CDS_pept        complement(740620..742077)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07850"
FT                   /product="predicted thiamine biosynthesis ATP
FT                   pyrophosphatase"
FT                   /db_xref="GOA:E7A4F6"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR003720"
FT                   /db_xref="InterPro:IPR004114"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020536"
FT                   /db_xref="InterPro:IPR026340"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F6"
FT                   /protein_id="CBY80933.1"
FT                   /translation="MKFIVKLFPEIMIKSETVRKRFAKILTSNIRNILQKYDEETAVVR
FT                   HWDYIEVRSKNEENREELIALLQRIPGIHHFLEVEEKPFTDLHHIFELTLADVAQQLQD
FT                   KTFCVRVKRKGKHKFSSIEAERYIGGGLNQHIESAKVRLKNPDVTVRIDIEDDKMMLVK
FT                   ARHAGIGGYPIGTQEDVLSLISGGFDSGVSSYMLIRRGSRVHYCFFNLGGTVHEIGVKQ
FT                   MAYHIWQRYSASHKVRFIAINFEGVVGEILEKVDNGQMGVVLKRMMVRAASKVAQRFNI
FT                   EAIVTGEALGQVSSQTLTNLRLIDEAADALVLRPLITHDKEQIIAMAKEIGTDDIAKSM
FT                   PEFCGVISKNPTIKAVREKILEEEGHFNFEILESAVQNAKYLDIRQIAEETEKEVVEVE
FT                   AISVLGKNEVILDIRSPEETDENPFESGTHDVIQMPFYKLSSQFGSLDQSKSYVLYCER
FT                   GVMSKLQALYLKENGFSNVRVFAKNIH"
FT   CDS_pept        742236..742490
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07860"
FT                   /product="exonuclease VII small subunit"
FT                   /db_xref="GOA:E7A4F7"
FT                   /db_xref="InterPro:IPR003761"
FT                   /db_xref="InterPro:IPR037004"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F7"
FT                   /protein_id="CBY80934.1"
FT                   /translation="MARKPASSQDFETTLAKLENIVTHLENGDLPLEEALKEFEQGVQL
FT                   AKLGQERLQQAEQRIQILLQKTEDAPLNDYKGNDYEGNA"
FT   CDS_pept        742490..743380
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07870"
FT                   /product="geranyltranstransferase"
FT                   /db_xref="GOA:E7A4F8"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="InterPro:IPR033749"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F8"
FT                   /protein_id="CBY80935.1"
FT                   /translation="MGHFSEELQQVQIRINRFLEAQFEGIESHNAPLLEAMKYALLLGG
FT                   KRVRPFLVYATGQMLGAEKQTLDYAAAAIEAIHAYSLIHDDLPAMDDDNLRRGHPTCHI
FT                   QFDEATAILAGDALQSFAFEILTKTPNISAEQKLALIQILAQGAGVQGMCLGQSLDLIS
FT                   EHKQISLSELELIHRNKTGALLIAALKLGFICSPHFTDKRLEQSLTQYAEAIGLAFQVQ
FT                   DDILDIEGDSAEIGKQVGADLDLDKSTYPKLLGLSGAKQKAQDLYQSALSELEKIPFDT
FT                   TALRALAEFIITRKS"
FT   CDS_pept        743434..745299
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07880"
FT                   /product="1-deoxy-D-xylulose 5-phosphate synthase"
FT                   /db_xref="GOA:E7A4F9"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005477"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4F9"
FT                   /protein_id="CBY80936.1"
FT                   /translation="MNNYPLLSLINSPEDLRLLNKDQLPQVCQELRAYLLESVSQTSGH
FT                   LASGLGTVELTVALHYVYKTPFDQLIWDVGHQAYPHKILTGRREQMSTIRQKDGIHPFP
FT                   WREESEFDVLSVGHSSTSISAGLGIAVAAERENAGRKTVCVIGDGAITAGMAFEALNHA
FT                   GALHTDMLVILNDNEMSISENVGALNNHLARIFSGSLYSTLRDGSKKILDKVPPIKNFM
FT                   KKTEEHMKGVMFSPESTLFEELGFNYIGPVDGHNIDELVATLTNMRNLKGPQFLHIKTK
FT                   KGKGYAPAEKDPIGFHGVPKFDPISGELPKNNSKPTYSKIFGDWLCEMAEKDAKIIGIT
FT                   PAMREGSGMVEFSQRFPKQYFDVAIAEQHAVTFATGLAIGGYKPVVAIYSTFLQRAYDQ
FT                   LIHDVAIQNLPVLFAIDRAGIVGADGATHQGAFDISFMRCIPNMIIMTPSDENECRQML
FT                   YTGYQCGKPAAVRYPRGNAVGVKLTPLEMLPIGKSRLIRKGQKIAILNFGTLLPSALEL
FT                   SEKLNATVVDMRFVKPIDIEMINVLAQTHDYLVTLEENAIQGGAGSAVAEVLNSSGKST
FT                   ALLQLGLPDYFIPQATQQEALADLGLDTKGIEEKILNFIAKQGNL"
FT   CDS_pept        complement(745335..745787)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07890"
FT                   /product="Stringent starvation protein B"
FT                   /db_xref="InterPro:IPR007481"
FT                   /db_xref="InterPro:IPR036760"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G0"
FT                   /protein_id="CBY80937.1"
FT                   /translation="MEYKSSPKRPYLLRAYYDWLVDNSFTPYLVVDATYLGVNVPVEYV
FT                   KDGQIVLNLSTSATGNLQLTNDFIQFNARFKGVSRELYIPMGATLAIYARENGDGVMFE
FT                   PEEIYDELNIEPDTEQPTGFYEAVDKPKKREEKKKTKSVSHLRIVD"
FT   CDS_pept        complement(745787..746425)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07900"
FT                   /product="stringent starvation protein A"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034341"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G1"
FT                   /protein_id="CBY80938.1"
FT                   /translation="MSSASSKRSVMTLFSNKDDIYCHQVKIVLAEKGVLYENAEVDLQA
FT                   LPEDLMELNPYGTVPTLVDRDLVLFNSRIIMEYLDERFPHPPLMQVYPVSRAKDRLLML
FT                   RIEQDWYPTLAKAENGTEKEKTSALKQLKEELLGIAPIFQQMPYFMNEEFGLVDCYVAP
FT                   LLWKLKHLGVEFTGTGSKAIKAYMERVFTRDSFLQSVGEAAPKNLMDDK"
FT   CDS_pept        complement(746605..746997)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07910"
FT                   /product="30S ribosomal subunit protein S9"
FT                   /db_xref="GOA:E7A4G2"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G2"
FT                   /protein_id="CBY80939.1"
FT                   /translation="MAENQNYGTGRRKSSSARVFIKPGSGKITINQRELDVYFGRETAR
FT                   MVVRQPLELVELTDKLDLYITVKGGGISGQAGAIRHGITRALMEYDETLRPALRAAGFV
FT                   TRDARRVERKKVGLHKARRRPQYSKR"
FT   CDS_pept        complement(747014..747442)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07920"
FT                   /product="50S ribosomal subunit protein L13"
FT                   /db_xref="GOA:E7A4G3"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR023563"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G3"
FT                   /protein_id="CBY80940.1"
FT                   /translation="MKTFVAKPETVKRDWYVVDATGKTLGRLATELARRLRGKHKAEYT
FT                   PHVDTGDYIIVINADKVAVTGRKETDKLYYWHTGYVGGIKQATFKEMIARRPEAVIEIA
FT                   VKGMLPKGPLGRAMFRKLKVYVGAEHQHAAQQPQVLDI"
FT   CDS_pept        747906..748784
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07930"
FT                   /product="5,10-methylenetetrahydrofolate reductase"
FT                   /db_xref="GOA:E7A4G4"
FT                   /db_xref="InterPro:IPR003171"
FT                   /db_xref="InterPro:IPR004620"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G4"
FT                   /protein_id="CBY80941.1"
FT                   /translation="MSYAKEIDTLNQHIADFNKKINVSFEFFPPKNEKMETLLWDSIHR
FT                   LKVLKPKFVSVTYGANSGERDRTHGIVKAIKQETGLEAAPHLTGIDATPEELKQIARDY
FT                   WDSGIRRIVALRGDEPKGYAKKPFYASDLVELLRSVADFDISVAAYPEVHPEAKSAQAD
FT                   LINLKRKIDAGANHVITQFFFDIENYLRFRDRCASIGIDTEIVPGILPVTNFKQLQKMA
FT                   SFTNVKIPAWLVKAYDGLDDDPTTRNLVAASVAMDMVKILSREGVNDFHFYTLNRSELT
FT                   YAICHMLGVRP"
FT   CDS_pept        complement(748873..749601)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07940"
FT                   /product="predicted dethiobiotin synthetase"
FT                   /db_xref="GOA:E7A4G5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G5"
FT                   /protein_id="CBY80942.1"
FT                   /translation="MSSFFVAGTDTNVGKTTAARAMIQALQGQGVQVVGYKPIACCGEE
FT                   SIYPVAQSENTSDYDHFVNADVLTLMHSTKENVSYQDINSYTFSHCAPMLTQDKMRIKL
FT                   DKINCDLTRLNQTYQSVVVEGSFGLMTPMAEGKSFADWITQRKMPVVLVVGIKDGCVNH
FT                   ALLTVKVIQQLGVPLLGWIANRINPLLSHYAEIVDLLVEHIDAPLLGKIPYLHKPEEQE
FT                   LGHYLTNIDRLMYMQTEFIK"
FT   CDS_pept        complement(749704..750027)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR027354"
FT                   /db_xref="InterPro:IPR038068"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G6"
FT                   /protein_id="CBY80943.1"
FT                   /translation="MINCNPHVKCADFYFGKLNMLCAIYKSKKKLGSYLYVANREDFSS
FT                   VPSVLLENFGKPELVMMFNLLGRKALHNVDCNEVLETIKRQGFYLQIAKQDDGLFNSLS
FT                   EIK"
FT   CDS_pept        complement(750031..750687)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07960"
FT                   /product="GTP cyclohydrolase I"
FT                   /db_xref="GOA:E7A4G7"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G7"
FT                   /protein_id="CBY80944.1"
FT                   /translation="MSKISLDALNVRNALIEKGIETPMIDPTQAKDERRESIAKHMHEV
FT                   MKLIGLDLRDDSLEETPNRLAKMFIDEIFSGMDYANFPKMTKIKNQMKVSEMVQVNDIT
FT                   LTSTCEHHFVTIDGKVCVAYYPKDWVIGLSKINRIVSFFAQRPQVQERLTEQLLTAFQT
FT                   ILETGDVAVYVKATHFCVKARGIRDTNSYTVTSAYGGVFLEDRDTRKEFLATVQK"
FT   CDS_pept        750825..752039
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07970"
FT                   /product="molybdopterin biosynthesis protein"
FT                   /db_xref="GOA:E7A4G8"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G8"
FT                   /protein_id="CBY80945.1"
FT                   /translation="MLTLDQARSKILEQIPFPTQTESLNLQEAANRICAEDIISPINVP
FT                   SFDNSAMDGYAVRLSDLQQSLTLSVAGKSFAGNPFQEEWSSKSAVRIMTGAMIPEGTDA
FT                   VIMQEQVTLNEDGTITFSELPKPNQNIRRIGEDVKKGDVVLEQGAPLTPVSLPLLASLG
FT                   IAEVKCYRQLKVGVLSTGDELVEVGKPLQSGQIYDTNRFTVKLLLEKLHCEVIDLGLLP
FT                   DNEAEFEKAFIAAQSQADLVITSGGVSVGEADFTKAVLEKVGKVNFWKIAIKPGKPFAF
FT                   GKLENAWFCGLPGNPVSALVTFYQLVQPLIAKLQGQKQWKKPPHFSAIATMNLKKAVGR
FT                   LDFQRGFYYINEQGQMEVQSVGFQGSHLFSAFVKSNCFIVLKQERGNVSAGETVTIEPF
FT                   NHLLG"
FT   CDS_pept        752043..752774
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07980"
FT                   /product="molybdopterin biosynthesis protein MoeB"
FT                   /db_xref="GOA:E7A4G9"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4G9"
FT                   /protein_id="CBY80946.1"
FT                   /translation="MIELSHEEELRYNRQIILKSVDFDGQEKLKASKMLIVGLGGLGCA
FT                   ASQYLAAAGVGNLTLLDFDTVSLSNLQRQVLHCDARLNMPKVESAKIALKQINPHINVE
FT                   TINAKLDEEKLAEIIPHFDIVLDCTDNVEIRNQLDRQCNHAKIPLISGAAIRMEGQISV
FT                   FTYESNTPTYRDLSKLFGQNVLSCVESGVLAPIVGIVGCIQALEAIKVRLKIGKNLCGR
FT                   LLMIDGFSMNIREIKLPTNME"
FT   CDS_pept        752841..753164
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_07990"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007376"
FT                   /db_xref="InterPro:IPR036763"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H0"
FT                   /protein_id="CBY80947.1"
FT                   /translation="MTTEIKKLDPDTAIDIAYDIFLEMAGENLDPADILLFNLQFEERG
FT                   GVEFVETADDWEEEIGVLIDPEEYAEVWVGLVNEQDEMDDVFAKFLISHREEDREFHVI
FT                   WKK"
FT   CDS_pept        complement(753547..754017)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4H1"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H1"
FT                   /protein_id="CBY80948.1"
FT                   /translation="MKKLLSIFLMAFSLNAFAQTNLADVQLKDLNNQPVTLSQYKGKPV
FT                   YVKMWASWCPICLAGLAEIDDLSAEKNRNFEVITIVSPDHKGEKDTADFIEWYKGLEYK
FT                   NITVLLDEKGEIIDKARVRGYPFNLFLDSDLNLKKTVPGHLGAEQIRVFAEK"
FT   CDS_pept        complement(754060..754701)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08010"
FT                   /product="Conserved hypothetical cytochrome c-type
FT                   biogenesis protein"
FT                   /db_xref="GOA:E7A4H2"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H2"
FT                   /protein_id="CBY80949.1"
FT                   /translation="MLDQQLLIGTVFLAGLASFLSPCIFPIIPIYFGILSKGGKKVLNT
FT                   FLFILGLSLTFVSLGFSFGFLGNILFSNTTRIIAGVIVIILGIHQLGIFKIGLLERTKL
FT                   VEIKTSGKSTALEAFVLGLTFSLGWTPCIGPILASVLALSGDEGSALYGASMMFVYVLG
FT                   LATPFVLFSFLSDSLLKRAKGLNKHLDKFKIGGGILIIVMGILLITNNFS"
FT   CDS_pept        complement(754713..755774)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08020"
FT                   /product="peptide methionine sulfoxide reductase MsrA/MsrB"
FT                   /db_xref="GOA:E7A4H3"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR002579"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="InterPro:IPR028427"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H3"
FT                   /protein_id="CBY80950.1"
FT                   /translation="MKLSKTFLFITALCCAAPTLAIQNSTSSSGEQKMAMENTQNIREI
FT                   YLAGGCFWGMEAYMERIHGVKDAISGYANGNTEKTSYQMIGVTDHAETVKVTYDANQIS
FT                   LDKLLKYYFKVIDPTSVNKQGNDRGRQYRTGIYYQDGADKAVIEQALSQLQTKYKKPVQ
FT                   IEVQPLKNYIVAEEYHQDYLKKNPNGYCHIDITKADEPVIDEKDYPKPSDAELKAKLTP
FT                   LQYSVTQNKHTERSFSNEYWDNFQPGIYVDVTTGEPVFSSNDKFESGCGWPSFTKPIIK
FT                   DVVHYETDNSFNMQRTEVLSRAGNAHLGHVFDDGPKDKGGLRYCINSASIKFIPLAEME
FT                   KAGYGYLIQSIKK"
FT   CDS_pept        complement(755969..756451)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4H4"
FT                   /db_xref="InterPro:IPR016596"
FT                   /db_xref="InterPro:IPR022548"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H4"
FT                   /protein_id="CBY80951.1"
FT                   /translation="MVYVLVSNGYFVKQLFARASIIGVALLLSACATVPMASVEESNSA
FT                   KQFRAPEKGNSGLYIYRDSFIGKALKKDLYIDDKFIGESAPDVFFYKTIKAGEHKISTE
FT                   SEFSNNDLNIKTESGKNYFIRQYIKFGVFVGGANLEQVSEEEGKKAISKLNMAVSH"
FT   CDS_pept        complement(756429..756962)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08040"
FT                   /product="Opacity family porin protein"
FT                   /db_xref="GOA:E7A4H5"
FT                   /db_xref="InterPro:IPR003394"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H5"
FT                   /protein_id="CBY80952.1"
FT                   /translation="MKKLLIVTMLSTLALSAQAQWYVQSDLGASKIDITHVNSSDSLSF
FT                   TQRISVGYAFDKNFRLAVDYTNYGKVTANYADIVDVSLKGKSLGFTSFYDFDLADFKPY
FT                   VGVRVSANEGDVTANARYYRIDFATGTSIGIGALAGVQYKLTDNLALNTNIEYNHLASD
FT                   VSDVGVKAGLRFSF"
FT   CDS_pept        757118..757501
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08050"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4H6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H6"
FT                   /protein_id="CBY80953.1"
FT                   /translation="MGMHDKIRMMRELRQLSQEDIAEKMNMSPSGYAKIERGETRLQYD
FT                   KLVQIAQIFNMNLSELVDENRGVIFLLNENGNNTSTNYYGNNDSLIIEIEKLKLQLIHK
FT                   DELLAQKEKELEMLRKMISLLEK"
FT   CDS_pept        complement(757779..758324)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08060"
FT                   /product="probable RNA polymerase sigma factor 24"
FT                   /db_xref="GOA:E7A4H7"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014289"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H7"
FT                   /protein_id="CBY80954.1"
FT                   /translation="MNVISDLELQQIRTQMLTFAQLQVNQADLAEDLVQEAFLSAFKNL
FT                   ANFKRQSAFKTWIFAILKNKIIDYLRQKGRFVLESELEDENTNNSFFDEKGHWKPEYHP
FT                   SELQGEEETVYSDEFWLIFETCLTCLPAKQAKIFMMREFLELSSEEICQETHLTSSNLH
FT                   TTLYRARLQLQNCLSKKL"
FT   CDS_pept        complement(join(758454..758552,758549..759238))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="tabA9"
FT                   /locus_tag="HIBPF_08080"
FT                   /product="putative trimeric autotransporter
FT                   adhesin,fragment"
FT   CDS_pept        759541..760905
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08090"
FT                   /product="Outer membrane efflux protein"
FT                   /db_xref="GOA:E7A4H8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H8"
FT                   /protein_id="CBY80956.1"
FT                   /translation="MFKMKNITLALLMSGALVGCANIGDSYQASLEDYKQYEEITKQYN
FT                   VKENWWSLYDDAQLNRVIEQALTNNKDLAKAAVAVNRALYSANLVGANLVPAFNGSTSS
FT                   AAQRRVDISTNSAISHKGSLNVSYTLDLWQRLANTVDAAEWSHKATAEDMESARLSLIN
FT                   SVVTTYYQIAYLNDAISTTNETIKYYTDIGNIMQTRLAQGVADTASVDQAQQAILMARN
FT                   NKLNFETQRKTAEQTLRNLLNLKPNEALNITFPHIMNVKIAGVNLNVPVSVIANRPDVK
FT                   AAQFRLSSAFKNAKATQKSWFPEVNLGASLSSTASTVGTALHNPVAAGTVGISLPFLNW
FT                   NTVKWNVKISEADYETARLNYEQRITTALNNVDTNYFAFTQAQSTLSNLQQTHSYNQRI
FT                   TQYYRNRYNAGVSELREWLVAANTEKSSQLAILNAKYQVLQSENAVYSSMAGYYL"
FT   CDS_pept        complement(760983..761525)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08120"
FT                   /product="putative uncharcterised proetin"
FT                   /db_xref="InterPro:IPR004238"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4H9"
FT                   /protein_id="CBY80957.1"
FT                   /translation="MKKLTLALVLGSALAVTGCFDKQEAKQKVEDTKQTVASVASETKD
FT                   AAANTMTEVKEKAQQLSTDVKNKVAEKVEDAKEVIKSATETASEKATEIKEAVSEKASE
FT                   MKEAASEKASEMKEAASEKATEIKEAVSEKASEMKEAASEKVGEMKEAASEKASEMKEA
FT                   ASEKATQAVDAVKEATK"
FT   CDS_pept        complement(761740..762234)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08130"
FT                   /product="phosphohistidine phosphatase SixA homolog"
FT                   /db_xref="GOA:E7A4I0"
FT                   /db_xref="InterPro:IPR004449"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I0"
FT                   /protein_id="CBY80958.1"
FT                   /translation="MNIFIMRHGEAEVMANSDKARRLTAYGIKQAFSQGEWLKQHLSTL
FT                   LINSLDRILVSPYVRAQETFHQVNQAFDLELENKFEIWEGITPYGHAHSVIDYLEVLKD
FT                   EGVKSVLIVSHLPLVGEIVAELYGKRNPISFYPATIAQLLWDGNKSEILMHQASPVIYL
FT                   K"
FT   CDS_pept        complement(762293..763630)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08150"
FT                   /product="predicted phosphomannomutase"
FT                   /db_xref="GOA:E7A4I1"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I1"
FT                   /protein_id="CBY80959.1"
FT                   /translation="MANRKYFGTDGVRGKVGSYPITPDFALKLGWAAGKVLASQGSKMV
FT                   LIGKDTRISGYMLESALEAGLAAAGLSAAFTGPMPTPAIAYLTRTFRAEAGIVISASHN
FT                   PYYDNGIKFFSAKGTKLPDEIEEAIEGMLEQPMDCVESAELGKASRINDAAGRYIEFCK
FT                   GTFPAHLGLEGYKIVVDCANGATYHIAPNVLRELGAEVIEIGTDPNGLNINEKCGATDV
FT                   TALQAKVVEMKADVGLAYDGDGDRIMMVDHLGNKVDGDQILFIIAREALRSGQLKGGVV
FT                   GTLMSNMSLEIALKMLGVPFLRANVGDRYVLEKMVENDWTLGGENSGHIIIADKNTTGD
FT                   GIVASLAVLAAMAQHKLSLNELASAVKLFPQVLINVRFAGGENPLESDAVKSVAAEVEK
FT                   RLEGKGRILLRKSGTEPLIRVMVECQDAELAQQCAEEIAEAVKKIN"
FT   CDS_pept        complement(763668..764495)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08160"
FT                   /product="dihydropteroate synthase"
FT                   /db_xref="GOA:E7A4I2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I2"
FT                   /protein_id="CBY80960.1"
FT                   /translation="MKLYANNKCLDLSVPQIMGILNFTPDSFSDSGQFFSLDKALFQVE
FT                   KMLEEGATIIDIGGESTRQNADEVSEQEELYRVVPVVEAVRSRFDCWISVDSSKAIVIR
FT                   EAASVGMDLINDIRALQEPNALETAVKLALPVCIMHMQGQPRTMQVNPYYENVVQDVLA
FT                   FLQKRTNECLSAGVKKENLIWDMGFGFGKSVQHNYQLLQNLNEFCQNGYPVLAGLSRKS
FT                   MIGAVLDKPVDQRIIGSAVGALIAAQKGAKILRVHDVAATSDMLKIWQATENA"
FT   CDS_pept        complement(764607..766514)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08170"
FT                   /product="protease, ATP-dependent zinc-metallo"
FT                   /db_xref="GOA:E7A4I3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I3"
FT                   /protein_id="CBY80961.1"
FT                   /translation="MVKNLVLWVVVAVIMMTAYQSFNSSLVENSTDYTTFVYDVSNGQV
FT                   TAARFDANEITVTKTDGSKYSTVMPPLEDKKLLDDLLSKKVKVEGTPFEKRGFLSQILI
FT                   SWFPMLFLVGVWVFFMRQMQGGGGKAMSFGKSRAKMLNQDQIKVTFADVAGCDEAKEEV
FT                   GEIVDFLRDPNKFQNLGGKIPKGILMVGPPGTGKTLLARAIAGEAKVPFFTISGSDFVE
FT                   MFVGVGASRVRDMFEQAKKNAPCLIFIDEIDAVGRQRGAGLGGGHDEREQTLNQMLVEM
FT                   DGFSGNDGVIVIAATNRPDVLDPALTRPGRFDRQVVVGLPDVKGREQILKVHMRKVSVA
FT                   QDVDAMTLARGTPGYSGADLANLVNEAALFAARVNKRTVTMLEFEKAKDKINMGPERRT
FT                   MIMTDKQKESTAYHEAGHAIVGYLVPEHDPVHKVTIIPRGRALGVTFFLPEGDQISISQ
FT                   KQLESKLSTLYAGRLAEDLIYGEENISTGASNDIKVATNIARNMVTQWGFSEKLGPILY
FT                   TEDEGEVFLGRSMAKAKHMSDETAHSIDEEVRAIVNRNYARAREILIDNMDILHAMKDA
FT                   LVKYETIEEEQIKQLMNREPVTPPSGWGEPKTQQAAYANSTTNDTKPESAVENTDNFNV
FT                   "
FT   CDS_pept        complement(766605..767234)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08180"
FT                   /product="23S rRNA methyltransferase"
FT                   /db_xref="GOA:E7A4I4"
FT                   /db_xref="InterPro:IPR002877"
FT                   /db_xref="InterPro:IPR004512"
FT                   /db_xref="InterPro:IPR015507"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I4"
FT                   /protein_id="CBY80962.1"
FT                   /translation="MGKKKRSASSSRWLNEHFSDQFVQKAHKQKLRSRAYFKIDEIQQT
FT                   DKLFKQGMTVVDLGAAPGGWSQYVVSQIGGKGRVIACDILEMDPIVGVDFLQGDFRDEN
FT                   VLNALLACVGEDKVDVVMSDMAPNFSGMPSVDIPRAMYLVELALDMCKQVLASKGSFVV
FT                   KVFQGEGFDEYLREIRSLFNVVKVRKPEASRGRSREVYIVATGYKG"
FT   CDS_pept        767363..767662
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08190"
FT                   /product="predicted RNA-binding protein"
FT                   /db_xref="GOA:E7A4I5"
FT                   /db_xref="InterPro:IPR001890"
FT                   /db_xref="InterPro:IPR017924"
FT                   /db_xref="InterPro:IPR035920"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I5"
FT                   /protein_id="CBY80963.1"
FT                   /translation="MTTLSTKQKQFLKGLAHHLNPVVMLGGNGLTEGVLAEIENALNYH
FT                   ELIKVKVAGADRETKQLIIDAIVRETKATQVQTIGHILVLYRPSEEAKIQLPRK"
FT   CDS_pept        complement(767701..768177)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08200"
FT                   /product="transcription elongation factor"
FT                   /db_xref="GOA:E7A4I6"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I6"
FT                   /protein_id="CBY80964.1"
FT                   /translation="MQQIPMTVRGAEQLRQELDFLKNVRRPEIIKAIAEAREHGDLKEN
FT                   AEYHAAREQQGFCEGRIQEIEGKLGNAQVIDVTKMPNNGKVIFGTTVVLVNTDTDEEVT
FT                   YRIVGDDEADIKSGLISVNSPIARGLIGKELDDTVNITTPGGVVEFDIIEVNYI"
FT   CDS_pept        768341..769768
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08210"
FT                   /product="D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="GOA:E7A4I7"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I7"
FT                   /protein_id="CBY80965.1"
FT                   /translation="MKKLSSISTALGSFLLSISFSLPTFANINVSDLTQKLPEGSNAGV
FT                   IAKNINQNQIIADYNGSTFMLPASTQKVFTAVAAKLALGDQFQFETALLSNGKIQNGNL
FT                   DGHLIVRFTGDPDLTSGQLYSLLAELKKQGIKKINGDLVLDTSVFSSHDRGLGWIWNDL
FT                   TMCFNSPPSAANIDNNCFYAELDTNQNPGETVKINVPAQFPIQVFGQVYVVDSNEVPYC
FT                   QLDVIVHDNNRYQVKGCLARQSKPFGLSFAVQDTDAYAAAIIQRQLRQLGIEFNGKVML
FT                   PQKPQQGQLLAKHLSKPLPDLLKKSDNQIADSLFRAVAFNYYKRPASFQLGTLAIKSIL
FT                   QKQGIRFGNSILADGSGLSRHNLVAPKTMLSVLEYIAKNEDKLHLMETFPIAGVDGTIS
FT                   GRGGLISPPLVKNVIAKTGYLKGVYNLAGFMTNARGEKVAFVQFINGYSTGDLESKTKR
FT                   APLVQFERNLYNELYKY"
FT   CDS_pept        complement(770084..770353)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08220"
FT                   /product="30S ribosomal subunit protein S15"
FT                   /db_xref="GOA:E7A4I8"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I8"
FT                   /protein_id="CBY80966.1"
FT                   /translation="MSLSTEKKAAIVAEFGRDAKDTGSSEVQIALLTAQINHLQTHFAE
FT                   HKKDHHGRRGLLRMVSRRRKLLDYLKRTDLALYQSTIARLGLRR"
FT   CDS_pept        complement(770623..771348)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08240"
FT                   /product="30S ribosomal subunit protein S15"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4I9"
FT                   /protein_id="CBY80967.1"
FT                   /translation="MVNDDFQEYVKQLVTKHRDERIYPFQYEGKKYWLKQPEKLKGIWL
FT                   LLKPHPKKSFKNELYTLLKLAEQNAPVPKVSYYSDHFFVLENVGLTVSQWLCNKNIDEQ
FT                   QKFLIIYDACLALIDLHAKNLVHGRPAIRDITWDKGKVTFLDFESRSNSRNQNWVVIRD
FT                   MLFFFDSLCREEDISDTFIQKVALYYQTHCEAKNWQNMIVFLQRFSWIYYLLLPFKPIA
FT                   KTDLIAIYRLFEIFLIKKK"
FT   CDS_pept        complement(771585..772118)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08250"
FT                   /product="beta-hydroxydecanoyl thioester dehydrase"
FT                   /db_xref="GOA:E7A4J0"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J0"
FT                   /protein_id="CBY80968.1"
FT                   /translation="MQNACTLNKKSSYSYDDLLASGRGELFGKEGPQLPAPTMLMMDRI
FT                   IEMNEETGAFGKGYIEAELDIKPELPFFGCHFIGDPVMPGCLGLDAMWQLVGFYLGWIG
FT                   GKGKGRALGVGEVKFTGQILPTAKKVVYRIHMKRVINRKLVMGMADGEVEVDGRVIYTA
FT                   TDLKVGLFQDTSTF"
FT   CDS_pept        complement(772287..774062)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4J1"
FT                   /db_xref="InterPro:IPR008268"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR041699"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J1"
FT                   /protein_id="CBY80969.1"
FT                   /translation="MSSLFSQQQAIEQSLNWQALQPDLVIQDFPLEPVNFWALQPNATQ
FT                   GIDLFLRHPTRSLLMMKVGEPVEYAELLQNFISQNHHKVRSIFGVNYVIEQGDSFSFPH
FT                   VYTEPAKSLDDNFASQGEALSALYCDQFQLFGSFRIHPRSQDIQLVPGLVHKANGGVLI
FT                   LSAATLLSQFDLWGRLKQILQTQTFDWYSAHPFKNLPCDIPSYALNLKVIVLGNRTELA
FT                   TLAELEENLYSFADYAEIESYISVAEVEEQKTWAGYVQQMAQEQNIELDFLALNKLYQL
FT                   LVRESENRFLINASPLKLKEILQDASTFAEKTALSAVDFEGIFQQKLAQYGFLKEQTYA
FT                   DILNEQVYVETQGEIVGQINGLSVIEYPGTPVCFGEPSRISCIVQFGDGEVIDVERKNE
FT                   LAGNIHGKGMMIAQACLSNILDLPSQLPFSASLVFEQSYGEIDGDSASLAIFCVLASAL
FT                   ADLPLPQHIAITGSIDQFGLVHSVGGVNDKIEGFFTICQRRGLTGKQGVIIPMTTIQQL
FT                   SLSDEVKSAVKNGEFFIYPVEDIYQACELLFRRDLLDENKDYTEKTEPLSRLIQRRIEG
FT                   RADSERKSFWHFFRS"
FT   CDS_pept        774189..774635
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4J2"
FT                   /db_xref="InterPro:IPR009390"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="InterPro:IPR035087"
FT                   /db_xref="InterPro:IPR035375"
FT                   /db_xref="InterPro:IPR038339"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J2"
FT                   /protein_id="CBY80970.1"
FT                   /translation="MKYQKLENQEANWKWIYLIRKHREGENITRYEERSLQEAKAQELL
FT                   ESQNYPSQIEEWIKNHLSPALPIKLDQAIRARRKRFFNGEKQHTKKKSIDLEYAVWLRL
FT                   SKYSRKMKMTLSETITYMIDERESKAQFENQMAAMKTSLKNLLK"
FT   CDS_pept        complement(774704..776626)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08280"
FT                   /product="exonuclease V (RecBCD complex), alpha chain"
FT                   /db_xref="GOA:E7A4J3"
FT                   /db_xref="InterPro:IPR006344"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR041851"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J3"
FT                   /protein_id="CBY80971.1"
FT                   /translation="MLSVLQKLKELRILSQGDYYFAKLIADKQCHTDYTEPIKNLAILL
FT                   AALCSWRYTQGNTCSQLDRYLEHNLFGLAYRTTEEDYLAEIHEKIGYLPVEDWQNALCD
FT                   HMAFTQDPVNQIAPMAFQFGALYFYRAWQDEYRIAQYIKNTLKKHRTLAFSYDEIHQKL
FT                   EKYFPEKQEKTDWQKVAVATAIKSPFSIITGGPGTGKTTTVTRLLLVLQELFDCKLHIK
FT                   LVAPTGKAASRLEESIKNALGFMQEKMNLSDSLFNAIPQKASTLHSLLGVNAFNDYTRY
FT                   NSHNPLQLDVLVVDETSMIDLPMMAKLINALKPETRLILLGDQAQLASVEAGAVLGELA
FT                   QFVTQPYSHEQATYLQATTGYKVEGSDCSNPIRDCLCHLTESRRFDKDSGIGKLAEFIQ
FT                   KGKADDSLELFDHYPQELHFNALNDESNAVNQVVKSAVENYRTFLKMLDDLRKQKIDPN
FT                   AKNEQGISYAEAIQAQFNSVRFLTALRNNNLGVENLNKEIALALREQKLLWFRNEQDWY
FT                   IGKPIMITENDHNVRLYNGDIGLCLANGKVWFGNREVLTSRIPAHEPAFMMTIHKSQGS
FT                   EFKHTVMVLPTEVNPVLSRELVFTGVTRAKKELTVFADEKIWKTAIRQTVKRQSGLGKL
FT                   LEDLN"
FT   CDS_pept        complement(776626..780231)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08281"
FT                   /product="Exodeoxyribonuclease V beta chain"
FT                   /db_xref="GOA:E7A4J4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR004586"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="InterPro:IPR038726"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J4"
FT                   /protein_id="CBY80972.1"
FT                   /translation="MVETIPLNPITLPLNQISLIEASAGTGKTYTIGSLYLRLLLKAGE
FT                   NNFSRPLNVEEILVVTFTEMATEELKKKIRERITDAINKLTAFAKTQDKSAFKNDEFLT
FT                   ALCDNLDIFEAIHRLKLAEQNMDLAAIYTIHGFCRRMLMQYAFHSGIHFNLELIKDQSD
FT                   LLVRFANEFWREHFYPLPFEMADFIANELGSPDYVLSLLESNLGKNLIVDLENQQALSI
FT                   SITEFLQQYLGEYFKDIKALKRFWLESAGKISELITEELNKDYAKGEPKSLSRRSYNTS
FT                   RLAKWIEQVNAWANNPRDYLLNKTLMSYFTQSALGEKCEEGASPFIAPIFTELEERANA
FT                   LISPDLLRRIILYHYRQSLQQKLLDYKLNHQEKSFDDLLRLLCEALQDAQGDELAEMIR
FT                   FQYPFAMIDEFQDTDSQQYAIFSKIYRDNPEKNTGFIMIGDPKQAIYRFRGADIFTYLK
FT                   ASDEAQSRFELTKNYRSEKNLVDGVNALFDFPQSPFIYQNIKFTAVDSRDDHLRFYLNG
FT                   KAEPAYRFYLTESDKVNKTEMAKICAVSIQYWLKSAVENQVVFQNEDTCKTLQAANIAV
FT                   LVRDKNEAALVKNELQKLGIASVYLSDQNSVFHSNVAKELAWVLKACLNVAERPILNAI
FT                   ATALFGLNAADIHQIQQNEADWQRWADSFAQYQQTWQRQGILAMLHQILLEQGISERLL
FT                   SQATGERDLTDFLHLAEILQQAATLHESEAALLSWFEKQIQGEGRQEAQIRLESERQLV
FT                   KIVTIHKSKGLEYDLVWLPFLAAPSKDPSKKDINIYYSKERDETLWDIENRNLNALCEE
FT                   TFAEELRLLYVALTRAKYQMAFALPAQFDKKWNALHYVLSQGEIGKEIALSAPKDTETL
FT                   LQAFKEKMRDNVEICTTQNLEALPTLSINTKNDDLKVAEFTGNIEKDWRITSFTSIEQA
FT                   HRRQNYFTERAGKKHAVFDDAKDYDSKNPIEISTALLNESESNILDLPRGKQVGTVLHR
FT                   HFENCYFSDLANTEEIDKLRQSLQLDETFTESLQNWLQQISHTPLSHEIGIELADLANK
FT                   DCIKEMPFYLAIREHFDVEAFNHTLKAHHLPSEPLQFEQIQGMVRGSIDLVFRHNGKYY
FT                   LVDYKSNFLGSTLADYNQEALKKEMLHSHYDWQYLIYTLALHRYLQSVVPHYDYARDFG
FT                   GVFYLFLRGMKGEPQSGVFYDRPSVELITELDGVF"
FT   CDS_pept        complement(780344..780697)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08300"
FT                   /product="50S ribosomal subunit protein L20"
FT                   /db_xref="GOA:E7A4J5"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J5"
FT                   /protein_id="CBY80973.1"
FT                   /translation="MARVKRGVIARARHKKVLKAAKGYYGARSRVYRVAFQAVIKAGQY
FT                   AYRDRRQRKRQFRQLWIARINAAARQNGLSYSKFINGLKKASVEIDRKILADIAVFDKV
FT                   AFAALVEKAKSAL"
FT   CDS_pept        complement(780763..781032)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08310"
FT                   /product="50S ribosomal subunit protein L35"
FT                   /db_xref="GOA:E7A4J6"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J6"
FT                   /protein_id="CBY80974.1"
FT                   /translation="MLPSNFISSPDYVVLNEKCGVILTMPKIKTVRGAAKRFKKTASGG
FT                   FKRKQSHLRHILTKKTTKRKRHLRHKSMVAKADQVLVVACLPYA"
FT   CDS_pept        complement(781171..781578)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08320"
FT                   /product="translation initiation factor IF-3"
FT                   /db_xref="GOA:E7A4J7"
FT                   /db_xref="InterPro:IPR001288"
FT                   /db_xref="InterPro:IPR019813"
FT                   /db_xref="InterPro:IPR019814"
FT                   /db_xref="InterPro:IPR019815"
FT                   /db_xref="InterPro:IPR036787"
FT                   /db_xref="InterPro:IPR036788"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J7"
FT                   /protein_id="CBY80975.1"
FT                   /translation="MAEQAELDLVEISPNAEPPVCRIMNYGKFLYEKSKTAKEQKKKQK
FT                   VVQVKEIKFRPGTDEGDYQVKLRSLIRFLEDGDKAKITVRFRGREMAHQDIGLDVLERV
FT                   KNDLAEISVVESAPGKLEGRQAVMVLAPKKK"
FT   CDS_pept        complement(781846..782658)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08330"
FT                   /product="predicted enzyme related to aldose 1-epimerase"
FT                   /db_xref="GOA:E7A4J8"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR025532"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J8"
FT                   /protein_id="CBY80976.1"
FT                   /translation="MKTTLLKTLTPELNLVQHNDIPVLHLKHAVGTAKISLQGAQLISW
FT                   KPQNAKQDVLWLSEVEPFKNGNAIRGGVPICYPWFGGVKQPAHGTARIRLWQLSHYDIS
FT                   AHKVRLEFELFSDLNIIEAKVSMVFTDKCHLTFTHYGEEPAQAALHTYFNIGDINQVEV
FT                   QGLPETCFNSLNQQQENVPSPRHISENVDCIYSAETMHNQILDKSFNRTIALHHHNASQ
FT                   FVLWNPWHKNTSGMTETGYQTMLCLETARIHHLLEFGESLSVEISLKG"
FT   CDS_pept        complement(782743..784407)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08350"
FT                   /product="predicted arylsulfatase A-like enzyme"
FT                   /db_xref="GOA:E7A4J9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="InterPro:IPR032506"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4J9"
FT                   /protein_id="CBY80977.1"
FT                   /translation="MALTSLSTEQLIGVNAVSYKGNFSVIAWTVPTVIPLCFLALYMLP
FT                   KYLRNGYTTVPEFFESRFDRQTRLIMSTLFLVFYLFIVIPTALYTGAIAFNKIFNLETA
FT                   FGLSYGAAITYTVIAIGVVGAIYAIFTGLIPSSHGIIKNGEKGGIGEISQEKPNIGKLA
FT                   GYNTYVVGKWHVGTKSVPEDYGIKGHNFDGYGYPGSGVYKNLVFNQPPTHSNRYKEWLE
FT                   EKGYEIPEVSRAYFGDNPHLRVQELCGLLSGTKDQTIPYFIIDEAKKYIQESLDEGKPF
FT                   FAWINFWGPHTPCIVPEPYYSMYRKEDVVLDKSFFTPLEGKPDHFRTISKMWGMWEASE
FT                   DHWKEVITKFWGYITLIDDAIGELFDYLQKRGIYDRTFLVATADHGDAMGAHRMIEKGE
FT                   LMFDTTYNIPMIIKDPNSDRVNQEDDNLVYLHDLTSTVFDLANQKVPESFEGQSILPIM
FT                   RQRQDNQRKGVLGQLAGHFVYFEQRMWRRKDYKLVFNATDVCELYNIRNDPEEMHNLFY
FT                   DSQYNSIKKEMLEEMRAEMKRLNDPLENWVYRIIDEI"
FT   CDS_pept        complement(784746..785231)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08370"
FT                   /product="predicted lipoprotein"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K0"
FT                   /protein_id="CBY80978.1"
FT                   /translation="MKVYKSFLIATASLFLFACSSFQNDDYAMNYKGQIGDPIMAIAML
FT                   SEQQHEWAGTPYVLGGVSRRGVDCSGFVQKTFFDRFNLRLPRSTVEQANYGKHVRKEDI
FT                   QTGDLIFFKTGRGPNGYHVGIYVKEDKFLHASTRGGVVYSSMNNPYWSKAFWQVRRI"
FT   CDS_pept        complement(785284..785574)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08380"
FT                   /product="integration host factor (IHF), DNA-binding
FT                   protein, alpha subunit"
FT                   /db_xref="GOA:E7A4K1"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K1"
FT                   /protein_id="CBY80979.1"
FT                   /translation="MATITKLDIIEYLSDKYHLSKQDTKNVVENFLEEIRLSLESGQDV
FT                   KLSGFGNFELRDKSSRPGRNPKTGDVVPVSARRVVTFKPGQKLRARVEKTK"
FT   CDS_pept        complement(785576..787963)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08390"
FT                   /product="phenylalanine tRNA synthetase, beta subunit"
FT                   /db_xref="GOA:E7A4K2"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K2"
FT                   /protein_id="CBY80980.1"
FT                   /translation="MKFSEQWVREWVNPSVSTEQLCEQITMLGLEVDGVEAVAGTFNGV
FT                   VVGEVVECAQHPDADKLRVTKVNVGGDRLLDIVCGAPNCRQGLKVACATEGAVLLGDFK
FT                   IKKTKLRGQPSEGMLCSFSELGIDVEADGIIELPLDAPIGTDLREYLALDDNAIEISLT
FT                   PNRADCLSIAGIAREIGVVNKQPVNQPHFEAVPTTICDKVQIDLQAPDACPRYLLRVVK
FT                   NVNVKPQSPMWIQEKLRRCGIRSIDPIVDITNYILLEFGQPMHAFDAAKVAQPVQVRFA
FT                   KEGEELVLLDGSTAKLQSNTLLIADQNGALAMAGIFGGAESGVNSETKDVILESAFFAP
FT                   LAIAGRARQYGLHTDASHRFERGVDFELARKAMERATALLLEICGGEAGEICEASSETH
FT                   LPKVNTVQLRRSKLDALLGHHIETGSVTEIFHRLGFDVTYANDIWTVTSASWRFDIEIE
FT                   EDLIEEVARIYGYNSIPNNAPLAHLHMREHKESDLDLARIKTALVDADYQEAITYSFVD
FT                   PKIQSLLHPHQEALVLPNPISVEMSAMRVSLISGLLGAVLYNQNRQQSRVRLFETGLRF
FT                   VPDANAEFGVRQEFVLSAVITGTAKSEHWAGKAESVDFFDLKGDLESVLSLTEGGNRVR
FT                   FVAKQFDALHPGQSAAIELDGQEIGFIGAIHPSISQKLGLNGKTFVFEILWNAIAARNV
FT                   VQAKEISKFPANRRDLALVVADSVPAGELIAACKQAGGEKLVQVNLFDVYQGVGIAEGY
FT                   KSLAISLTVQDNEKTLEDEEINAVISAVLAEVKQRFNAELRD"
FT   CDS_pept        complement(787997..788986)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08400"
FT                   /product="phenylalanyl-tRNA synthetase alpha chain"
FT                   /db_xref="GOA:E7A4K3"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K3"
FT                   /protein_id="CBY80981.1"
FT                   /translation="MQHLNELVEKAKLAIESIQDKSLTALDEIRVEYFGKKGHFTQLMQ
FT                   ELRNVSAEERPAMGAKINDAKQAALECLNTKKAEWEQAELNAKLEKERVDVSLPGRKVE
FT                   TGGLHPVTMTINRVTKFFSELGFSVENGPEIESDYYNFDALNIPKHHPARADHDTFWFN
FT                   PELLLRTQTSGVQIRTMEKMQPPIRIMAPGRVYRNDYDQTHTPMFHQIELLYVDKKANF
FT                   TELKGLLHDFLRAFFEEDLQVRFRPSYFPFTEPSAEVDVMGKNGKWLEVLGCGMVHPNV
FT                   LRNVGIDPNEYSGFAVGMGVERLTMLRYNVTDLRSFFENDLRFLKQFK"
FT   CDS_pept        complement(789135..789875)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4K4"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K4"
FT                   /protein_id="CBY80982.1"
FT                   /translation="MKLLIKTSLSQWICLNFAKIPIFKMLGFITALFITACSSISKEPV
FT                   KTVDIYIKPYYSAENGKAENVFVHKEIDPMLRENTLKGYKSAVKFVEENPARISPMTMF
FT                   TLAARAYDFGLRDEAVTWFYRGQNRLITALYVLDLPKQTVQDNTGFSHVVGQFVNAYAF
FT                   CDFDKQSRAAENAVKWTIAHPYEVIFLPALPAKFADRQKALKEAEEKLVQRLQEQARFF
FT                   ANPKNKEKWQKERSENFVNERFCW"
FT   CDS_pept        789921..790169
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08420"
FT                   /product="predicted 2Fe-2S cluster-containing protein"
FT                   /db_xref="GOA:E7A4K5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K5"
FT                   /protein_id="CBY80983.1"
FT                   /translation="MKIHLIRHNTTLEFNNETSLLDHLEKNNIHHEYQCRSGYCGSCRV
FT                   KIKKGKVSYKEMPLAFIQPDEILLCCCHVESDLEIDL"
FT   CDS_pept        complement(790164..790976)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08430"
FT                   /product="dihydrodipicolinate reductase"
FT                   /db_xref="GOA:E7A4K6"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K6"
FT                   /protein_id="CBY80984.1"
FT                   /translation="MTLKIAIAGAGGRMGRQLIQAVHSAEGVELGAAFERKGSSLVGTD
FT                   AGELAGIGHLGVAVSDDLESQKDKFDLLIDFTRPEGTLEHIAFCVANNKKMVIGTTGFD
FT                   ENGKTAIKAASDKIAIVFASNFSVGVNLVFKLLEKAAKVMGDYCDIEVLEAHHRHKVDA
FT                   PSGTALSMGEHIAKTLGRDLKTHGVFCREGITGERKRDEIGFSTIRASDVVGEHTVWFA
FT                   DIGERVEISHKASSRMTFANGAVRAGKWLENKANGLFDMTDVLDLNNL"
FT   CDS_pept        complement(790993..791622)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08440"
FT                   /product="threonine efflux system"
FT                   /db_xref="GOA:E7A4K7"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="InterPro:IPR004778"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K7"
FT                   /protein_id="CBY80985.1"
FT                   /translation="MLNLIIVHLFGLMTPGPDFFYVSRMAASNSRRNTVCGILGITLGI
FT                   AFWGMLSMLGLAVLFVTIPALHGVIMLLGGSYLAYLGFLMARSKKYAKFEPHSDTEFNQ
FT                   QTTIKKEILKGLFVNLSNAKVVVYFSSVMSLVLVNITEMWQIILAFAVIVVETFCYFYV
FT                   ISLIFSRNIAKRLYSQYSRYIDNMAGIVFLFFGCVLVYNGINEIIH"
FT   CDS_pept        complement(791622..792113)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08450"
FT                   /product="phosphatidylglycerophosphatase A"
FT                   /db_xref="GOA:E7A4K8"
FT                   /db_xref="InterPro:IPR007686"
FT                   /db_xref="InterPro:IPR026037"
FT                   /db_xref="InterPro:IPR036681"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K8"
FT                   /protein_id="CBY80986.1"
FT                   /translation="MTENNPLKKISLLNPIHLLAVGFGSGLIHPAPGTWGSLAGTILGV
FT                   ILLSLLGVKIFLIFTALCFLLGCYLCQKTTADMGVHDHGSIVWDEFVGVFIVLAAIPSL
FT                   SWQWILVAFALFRFFDILKPFPIRYLDEKLESGFGIMVDDVLAAIYAVIVVFAIQYWML
FT                   "
FT   CDS_pept        complement(792110..793096)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08460"
FT                   /product="thiamin-monophosphate kinase"
FT                   /db_xref="GOA:E7A4K9"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4K9"
FT                   /protein_id="CBY80987.1"
FT                   /translation="MAMGEFDLIKRYFQQQVLVDDSVQLSIGDDCALVSVPENYQLAIT
FT                   TDTMVENTHFLPTISPEDLAYKAVATNLSDLAAMGAQPKWVSLALTLPNVDENWISTFS
FT                   QSLLHTLKQYNVTLIGGDTTKGNLSITITAQGFVEKNKGICRHKAQIGDLIYVSSTLGD
FT                   SAAGLTQILLGKSAVDSDDVFLQQRHLRPTPRIELGQALIGIAHVAIDLSDGLISDLGH
FT                   ILERSQCSAEVELTALPLSSSILNKYDRTQAEQFALSGGEDYELCFTIPPEYKDELELR
FT                   LKKLNVPCTCIGKINEKCGDFSPRFLRDGKPVNITFSSGFDHFKESK"
FT   CDS_pept        complement(793163..793597)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08470"
FT                   /product="transcription antitermination protein"
FT                   /db_xref="GOA:E7A4L0"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR011605"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L0"
FT                   /protein_id="CBY80988.1"
FT                   /translation="MTEQKQVKKPSARRRARECTVQALYSWAVSGNTAEQVELAFVLDQ
FT                   DMDGVDKPYFRKLFRQTIENIETVDFSISPYIDRAFDELDPIETAILRLAVYELRFELD
FT                   VPYKVVINEAIEVAKVFGADESHKYINGVLDKIAPALGRK"
FT   CDS_pept        complement(793601..794074)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08480"
FT                   /product="riboflavin synthase beta chain"
FT                   /db_xref="GOA:E7A4L1"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L1"
FT                   /protein_id="CBY80989.1"
FT                   /translation="MKVLEGSVAAPNAKVAVAIARFNSFINESLLEGAIDALKRIGQVK
FT                   DENITIVRAPGAYELPLVARRLAESKKFDAIVALGTVIRGGTAHFEYVAGEASSGLGKV
FT                   AMDAEIPVAFGVLTTENIEQAIERAGTKAGNKGAEAALTALEMVNLIQQIDAA"
FT   CDS_pept        794301..795704
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08490"
FT                   /product="asparaginyl tRNA synthetase"
FT                   /db_xref="GOA:E7A4L2"
FT                   /db_xref="InterPro:IPR002312"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR004522"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L2"
FT                   /protein_id="CBY80990.1"
FT                   /translation="MSKVASIVDVLQGKVAIGETVTVRGWVRTRRDSKAGLSFLAVYDG
FT                   SCFDPIQAIINNDIENYESEILRLTTGCSVIVTGKVVESPSEGQAVELQAEKVEVTGFV
FT                   EDPDTYPMAAKRHSIEYLREVAHLRPRTNIIGAVARVRHCLSQAIHRFFHEQGFYWVAT
FT                   PLITASDTEGAGEMFRVSTLDLENLPRGENGKVDFSQDFFGKESFLTVSGQLNGETYAC
FT                   ALSKIYTFGPTFRAENSNTTRHLAEFWMVEPEVAFATLADNAKLAEDMLKYVFRAVLAE
FT                   RKDDLQFFEKHVDKDVITRLENFVNSDFVQIDYTDAIDVLLKSGKKFEFPVSWGIDLSS
FT                   EHERFLAEEYFKSPVVVKNYPKDIKAFYMRLNDDGKTVAAMDVLAPGIGEIIGGSQREE
FT                   RLDVLDKRMEEMGLNPDDYWWYRDLRKYGSVPHSGFGLGFERLIVYVTGVQNIRDVIPF
FT                   PRVPRNANF"
FT   CDS_pept        795723..796469
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08500"
FT                   /product="carbonic anhydrase"
FT   CDS_pept        797575..797991
FT                   /transl_table=11
FT                   /gene="hmcD"
FT                   /locus_tag="HIBPF_08501"
FT                   /product="haemocin bacteriocin D"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L3"
FT                   /protein_id="CBY80992.1"
FT                   /translation="MFNNNLLNYIRIYMKNKILFIFILNPILCYSNNYNFITLNDEFDN
FT                   SGKFTLVTSSSLHLKNSYEFLRRNVFDIQNYDNSYGSEKYQVLSFEQGIRYGLTNKINI
FT                   SGSINSSYSKYSFVSREESRKEQSYDKLRFDLIR"
FT   CDS_pept        798160..798582
FT                   /transl_table=11
FT                   /gene="hmcC"
FT                   /locus_tag="HIBPF_08502"
FT                   /product="haemocin bacteriocin C"
FT                   /db_xref="GOA:E7A4L4"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L4"
FT                   /protein_id="CBY80993.1"
FT                   /translation="MLQSTLTLRKIYNLIILLCISDYISAREIVSYNEFKNFNIIRQTK
FT                   NNSCGAADLATMLKYKFHISEINEDTILYKLKNPNEETSFFELARISKEFNINAIGLAL
FT                   MLKELLNINKPVIAYVNNSLNNDHFIIINGILIKSY"
FT   CDS_pept        798757..799464
FT                   /transl_table=11
FT                   /gene="hmcB"
FT                   /locus_tag="HIBPF_08520"
FT                   /product="haemocin bacteriocin B"
FT                   /db_xref="GOA:E7A4L5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L5"
FT                   /protein_id="CBY80994.1"
FT                   /translation="MYIYEIYRNNKNHFFLDYLFPVKLNKPISIFIGENGVGKSTIMEA
FT                   IAIYLGCPAEGGSKNFNFSTENTHIQIPNMMIKKGTKFPKDIFFYRSETFYTFMSEMKK
FT                   LDAPEFGGGKINSYYGGVELHKLSHGESMNALYMNRFNKNGLYILDEPESSLSLNNQLK
FT                   FIERIVTLSRNGAQFIIATHSPIIMQTPESELLEVTKNGVKTVNFQETNIYYMYREIMQ
FT                   DNSHTYLSSILNL"
FT   CDS_pept        799491..799763
FT                   /transl_table=11
FT                   /gene="hmcA"
FT                   /locus_tag="HIBPF_08530"
FT                   /product="haemocin bacteriocin A"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L6"
FT                   /protein_id="CBY80995.1"
FT                   /translation="MKKFFILLTAIIFSSVSLASSNEVQSLFKSSQSESVTVLSQKELS
FT                   EIKGGARSPVYTCSICGAKHGGVYSPSVCYNCYNKGLRINGIRRP"
FT   CDS_pept        799811..800128
FT                   /transl_table=11
FT                   /gene="hmcI"
FT                   /locus_tag="HIBPF_08540"
FT                   /product="haemocin immunity protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L7"
FT                   /protein_id="CBY80996.1"
FT                   /translation="MLKGLKNLALFYTDYNIPYGFIPYLENGFFKIKKVRTIDSNSNNF
FT                   YYYIIYTKKHKRKAKKLSILLKKSTNCFNLNYERKIGKLLGYSKEDIEFYIKTCISNYI
FT                   N"
FT   CDS_pept        complement(join(800491..801132,801048..801356))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08550"
FT                   /product="ABC transporter, ATP binding domain"
FT   CDS_pept        801394..802320
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08561"
FT                   /product="Predicted selenocysteine lyase"
FT                   /db_xref="GOA:E7A4L8"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L8"
FT                   /protein_id="CBY80998.1"
FT                   /translation="MLPWKSSKKFSNHSIASTSKWLVHQVANFVTWHETAKKCGAKIQV
FT                   LPILDNWLIDENVLISALSEKTKLVALNFVSNVTGTEQPIKRLIQLIRKQSNALVLVDA
FT                   AQAISHIKIDLQDLDADFLAFSAHKIYGPNGLGVLTGKLTALSQLQPLFFGGKMVERVS
FT                   NDRITFAELPYRLEAGTPNIAGVIGFNAILNWLQKWDFTAAEQHAISLAESVKVRLKSY
FT                   ENCRLFNSPQASTVVCFIFDGIDCSDLSTLLSEQNIALRVGEHCAQPYLARLGERTTLR
FT                   LSFAPYNTQEDVEAFFTALDKALDLLQ"
FT   CDS_pept        802317..802697
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08562"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR003808"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4L9"
FT                   /protein_id="CBY80999.1"
FT                   /translation="MIEQLKQAKNWEDRYRLIIQAGKNLSRPSDNELAQMQPITGCEAQ
FT                   MWFQIMPKNDRTFQFSGFSEARIMNGLLWILFNKINGKTADELNTFDVIAFFSELGISQ
FT                   RLSETRLNGLNQIGQQLKNLCI"
FT   CDS_pept        802688..803182
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08563"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR016908"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M0"
FT                   /protein_id="CBY81000.1"
FT                   /translation="MYLIETYFRMTALENNIESQSRLLNAVIDQWRYNGQIIGREIPLY
FT                   LSEEDGAQGFAMRVICPEQDSLFPQNNNAEVNRALQEAAKCGVIFDGFQLVGDDFNSDQ
FT                   TAENTSPAWQVLYTTHLQSCSPIHSGENFAPIPLYKQLKNQPHLSQDLIKWQENGELYR
FT                   Y"
FT   CDS_pept        complement(803284..803769)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08564"
FT                   /product="Phosphoglucosamine mutase"
FT                   /db_xref="GOA:E7A4M1"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M1"
FT                   /protein_id="CBY81001.1"
FT                   /translation="MSNMSLEIALKMLGVPFLRANVGDRYVLEKMVENDWTLGGENSGH
FT                   IIIADKNTTGDGIVASLAVLAAMTQHKLSLNELASAVKLFPQVLINVRFAGGENPLEND
FT                   AVKSVAAEVEKRLEGKGRILLRKSGTEPLIRVMVECQDAELAQQCAEEIAEAVKKIN"
FT   CDS_pept        complement(803962..805041)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08565"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A4M2"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M2"
FT                   /protein_id="CBY81002.1"
FT                   /translation="MLVEMDGFSGNDGVIVIAATNRPDVLDPALTRPGRFDRQVVVGLP
FT                   DVKGREQILKVHMRKVSVAQDVDAMTLARGTPGYSGADLANLVNEAALFAARVNKRTVT
FT                   MLEFEKAKDKINMGPERRTMIMTDKQKESTAYHEAGHAIVGYLVPEHDPVHKVTIIPRG
FT                   RALGVTFFLPEGDQISISQKQLESKLSTLYAGRLAEDLIYGEENISTGASNDIKVATNI
FT                   ARNMVTQWGFSEKLGPILYTEDEGEVFLGRSMAKAKHMSDETAHAIDEEVRAIVNRNYA
FT                   RAREILIDNMDILHAMKDALVKYETIEEEQIKQLMNREPVTPPSGWGEPKTQQAAYANS
FT                   TTNDTKPESAVENTDNFNV"
FT   CDS_pept        805244..806122
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08610"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="GOA:E7A4M3"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M3"
FT                   /protein_id="CBY81003.1"
FT                   /translation="MNFKLSLVYAALFAGISVSALAETQHKANTETIEQINVQDTGIKQ
FT                   NGYQTTGTSVVSKAEVPVFDTPNTVNILSTKLLEDRKPESLIDALYNVSGVSQANTLGG
FT                   MFDAIQKRGFGRNRDNSIMRNGLQAGPAKNFSATTETVEVLKGPASVLYGIQDPGGVVN
FT                   IITKKPQQTPRYVVGGTLGNHSLWGTQLDFTGGLGNGFAYRFIYDKQEKDYWRNFGKVK
FT                   NTTYSPSLSWENDKTKVALSYEHKDILEPFDRGTNLLTATNALPNIPVSRRLDEPNNET
FT                   TAKTDNIDFKV"
FT   CDS_pept        806408..>807331
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08620"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M4"
FT                   /protein_id="CBY81004.1"
FT                   /translation="MRNKMDLGPIYNTRDMNDGKVINIDNPNYTNPVAIKKNENNNAYQ
FT                   FNHLKTLGLYIQNTTYFTDNFIITGGLRYEYFDQVVGRSTLKNIRSGYLAQKDGKLLYQ
FT                   LGSVYKFTPNIATFFNHAESFRPQNNRTLIINGELPAEQGKSFETGLKYENAYLNATVA
FT                   LFNINKRNVAETVNVNGTNELQIVGKQRSRGIEFDLNGQLTDNLSIAANYTYTKVKNLE
FT                   NHNNKLAVGKQLSGVPKHQASLFLAYNIGEFDFGNIRVGGGARYLGSWYAYNNTYTKAY
FT                   KLPQAIVYDAFIAYDTKISGKKVSFQL"
FT   CDS_pept        807516..809285
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08630"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /db_xref="GOA:E7A4M5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M5"
FT                   /protein_id="CBY81005.1"
FT                   /translation="MNWQTELNNSLNWILTALFWVILCFSVTMLALKQTTFGKKFWCIV
FT                   SPSMDKKTSIKLILMLLVLFIMILLEVRFSVLNSFFYNGLYSSMQELNIEKFWFFAKLN
FT                   ALLVVAQVIHAIADYFFQQVFEIRWLESFNATLVKRWLNKKKYYRLKYERDLPDNIDQR
FT                   IEQDAREFITSTVQIVRGVINSVLTTIEFTIILWSLSGVLTLFGFNIEKGVVFFIYAFI
FT                   IFATLMSVWIGRPLIKLNFTKEKLNGDYRYSLIRVRDNAKSIAFYNGEPKEQTFLQHQF
FT                   RQIIHNRWSIVLKMLGLNSFNSGVTRVAKLLPLMLQAPRFFSGQIKLGDMHQTVQAFNR
FT                   LMTALSFFRLFYEQFTLYQARLNRLYGFITKMDELDKQNVHHPFHCSHRVALKNFGIKD
FT                   EQGHVLLNNLNINLENGDALLIQGASGTGKTSLLKAIAGIYPFETIGIAEYPCMGSLFL
FT                   PQRPYMPQGTLREAICYPNINPSHAELEQTMKDCALGKYIHALNVKNDWQAILSPGELQ
FT                   RVAFIRILLTKPDVVFLDETTSALDETTEHLLYQTIKERLPEMIILSVGHRSTLQQFHN
FT                   KQLKLDVCLLCEN"
FT   CDS_pept        complement(810073..810834)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08660"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="GOA:E7A4M6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M6"
FT                   /protein_id="CBY81006.1"
FT                   /translation="MNKVLSVENLGFYYQAENFLFQQLNFELNKGDILAILGQNGCGKS
FT                   TLLDLLLGIHRPIQGKIEVYQSISFVPQFFSSPFAYSVLDIVLMGRSTHINTFAKPKPY
FT                   DYQVAMQALDYLNLTHLAKREFASLSGGQRQLILIARAIASECKLILLDEPTSALDLAN
FT                   QDIVLSLLIDLAQSQNMTVVFTTHQPNQAVAIANKTLLLNKQNFKFGETRNILTSENLT
FT                   ALFHLPMFEQQAQYKESFFTHFVPLYKTLLK"
FT   CDS_pept        complement(810827..811840)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08670"
FT                   /product="vitamin B12 transporter subunit: membrane
FT                   component of ABC superfamily"
FT                   /db_xref="GOA:E7A4M7"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M7"
FT                   /protein_id="CBY81007.1"
FT                   /translation="MQLNSYPKILFGLTLLLVITAVISLGIGRYSLSVPQIGQILWAKA
FT                   TALEIDPVQQQVIFQVRLPRILTALCVGAGLALSGVVLQGIFRNPLVDPHIIGVTSGSA
FT                   FGGTLAIFFGFSLYGLFASTILFGFGTLALVFLFSFKFNQRSLLMLILIGMILSGLFSA
FT                   LVSLLQYISDTEEKLPSIVFWLMGSFATSNWEKLLFFFVPFLLCSSILLSLSWRLNLLS
FT                   LDEKEAKALGVKVAPLRWLVIFLSGSLVACQVAISGSIGWVGLIIPHLSRMLVGANHQR
FT                   LLPCTMLVGATYMLLVDNVARSLSDAEIPISILTALIGAPLFGVLVYKLKRGGMNE"
FT   CDS_pept        complement(811827..812882)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08680"
FT                   /product="periplasmic binding protein"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M8"
FT                   /protein_id="CBY81008.1"
FT                   /translation="MKLKSLLIAGLLSSLSFSALADRIITDQLDRKVTIPDHINRAVVL
FT                   QHQTLNIAVQLDATKQIVGVLSNWKKQLGKNYVRLAPDLENMAMPGDLNSVNIESLLAL
FT                   KPDVVFVTNYAPPEMIKQISDVNIPVVAISLRTGEAGEKGKLNPTLTDEDKAYNDRLKQ
FT                   GIELIAEVFEKKQQGDELVKAAFANRKLLADRLGDVSADKRVRTYMANPDLGTYGSGKY
FT                   TGLMMEHAGAYNVAAATIKGFKQVSLENVLEWNPAVILVQDRYPDVVPQILNDQGWANI
FT                   QALKDKKVFLMPEYAKAWRYPMPEALALGEVWLAKALYPQRFQDVDLDKMVNDYYKKFY
FT                   RTSYKPDNAAK"
FT   CDS_pept        complement(812950..813459)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08690"
FT                   /product="putative pyrophosphorylase modD"
FT                   /db_xref="GOA:E7A4M9"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR006242"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4M9"
FT                   /protein_id="CBY81009.1"
FT                   /translation="MIANAKSVNPNAVVACTRKSIPNTRKLAMNAVLAAGGHIHRQGVS
FT                   ETLLVFTNHRNLLSDPNDWTKIVNRLRQEAPENKITLEADNYAQFEQMYMAEPDIIQLD
FT                   KWSLEDVKKALDLLQSKQKDILLSVAGGVNKNNVSDYAKLGIRLFITSAPYYAPPEDIK
FT                   VVIEKI"
FT   CDS_pept        complement(813805..814404)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08700"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="GOA:E7A4N0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N0"
FT                   /protein_id="CBY81010.1"
FT                   /translation="MLIVQNLQTNILKSISFSIEKSECLSVVGESGSGKTTLLNAIAGY
FT                   IDYSGSILWNNQVLENNPPWKRNFRYLNQRLYLFPHKTVRGNLILANPSASDAEQQILL
FT                   SELKIDHLINRYPHQLSGGEQQRVALARALIYRPDLLLLDEPFSSLDWSSRKDIWKVLK
FT                   NLIQTNEITTILVTHEPKEAEYFSGKQIQLYQGQLI"
FT   CDS_pept        complement(814406..815122)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08710"
FT                   /product="Binding-protein-dependent transport system, inner
FT                   membrane component"
FT                   /db_xref="GOA:E7A4N1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR006469"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N1"
FT                   /protein_id="CBY81011.1"
FT                   /translation="MGSVLSLIAKLDFYFFQQILFNSELHFALLMSLGTSLFSLILALC
FT                   IAIPSAWRMSQVRLPFQSFFDTLFDLPMVLPPLVTGLSLLLLFSSQGILAELLPFISKW
FT                   IFSPVGIIIAQTYIASSILLRSTRGIFSSFESGYRFASYTLGLSPFKTLIKIEIPMCWK
FT                   PLVCASVLAWSRAIGEFGATLMLAGATRFKTETLPMAVYLNISSGDFEIAIGASLWLLF
FT                   ISTCLLLVLRMINRAV"
FT   CDS_pept        complement(815178..815915)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08720"
FT                   /product="Bacterial extracellular solute-binding protein"
FT                   /db_xref="GOA:E7A4N2"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N2"
FT                   /protein_id="CBY81012.1"
FT                   /translation="MKKLVAVTSMILTTFSVQAADLYLYAGAGLKEPVEKIIHQYEQET
FT                   GNKVTVEYGGSGQILARYNTVKSGDLFLAGSEDYVTKLQKTNDVNNIGTIVLHVPVMAI
FT                   RKDKISGIDSFKALAESSLRLGIGDSKAMALGKGAEKMFELSGYQKQLNDKVVVKAATV
FT                   KQLMLYLLNGDVDAAVVGRSGAWKVRDKVELLPSPKGTPEEKVTIGLLSSSKYPKEAQQ
FT                   LFDFFKSPQGVKYFTDEGFLPAK"
FT   CDS_pept        complement(816102..817532)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08730"
FT                   /product="fused heptose 7-phosphate kinase/heptose
FT                   1-phosphate adenyltransferase"
FT                   /db_xref="GOA:E7A4N3"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011913"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023030"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N3"
FT                   /protein_id="CBY81013.1"
FT                   /translation="MAQYSAEFKQAKVLVLGDVMLDRYWFGATNRISPEAPVPVVRVQE
FT                   NEERAGGAANVAMNIASLNVPVQLMGLIGQDETGSALSLLLEKQKIDCNFVALETHPTI
FT                   TKLRILSRHQQLLRLDFEEDFNNVDCKDLLAKLESAVKNYGALILSDYGKGTLKDVQKM
FT                   IQIARKANVPVLIDPKGTDFERYRGATLLTPNMSEFEAVVGKCNTDEEIIEKGLKLISD
FT                   IELTALLVTRSEKGMTLLRPNQEPYHLPTVAKEVFDVTGAGDTVISVLATTLADGRSFE
FT                   ESCYLANVAAGIVVGKLGTSTVSTVELENAIHARPETGFGIMSEAELKDAVAQAKARGE
FT                   KIVMTNGCFDILHPGHISYLENARKLGDRLIVAVNSDDSVKRLKGESRPINNLENRMAV
FT                   LAGLASVDWLVPFTEDTPQRLIGEILPDLLVKGGDYKPEEIAGSKEVWANGGDVKVLNF
FT                   ENGCSTTNVIEKIKLLKD"
FT   CDS_pept        817629..818564
FT                   /transl_table=11
FT                   /gene="htrB"
FT                   /locus_tag="HIBPF_08740"
FT                   /product="lipid A biosynthesis lauroyl acyltransferase"
FT                   /db_xref="GOA:E7A4N4"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR011920"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N4"
FT                   /protein_id="CBY81014.1"
FT                   /translation="MKNEKLPQFQPHFLAPKYWLFWLGVAIWRSILCLPYPILRHIGHG
FT                   FGWLFSHLKVGKRRAAIARRNLELCFPDMPENERETILQENLCSVGMAIIETGMAWFWS
FT                   DSRIKKWSKVEGLHYLKENQKDGIVLVGVHFLTLELGARIIGLHHPGIGVYRPNDNPLL
FT                   DWLQTQGRLRSNKDMLDRKDLRGMIKALRHEETIWYAPDHDYGRKNAVFAPFFAVPDAC
FT                   TTTGSYYLLKSSQNSKVIPFAPLRNKDGSGYTVSISAPVDFTDLQDETAIAARMNQIVE
FT                   KEIMKGISQYMWLHRRFKTRPDENTPSLYD"
FT   CDS_pept        818638..820536
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08750"
FT                   /product="DNA topoisomerase IV, subunit B"
FT                   /db_xref="GOA:E7A4N5"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005737"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N5"
FT                   /protein_id="CBY81015.1"
FT                   /translation="MTTNYSAQEITVLKDLEPVQIRPGMYTDTTRPNHLAQEVIDNSVD
FT                   EALAGFATKIEVILHPDQSIEVTDNGRGMPVDIHPTEGVSGVEVILTKLHAGGKFSNKN
FT                   YEFAGGLHGVGISVVNALSERVDIQVKRNGEVYKIAFENGSKVEELEIIGTCGRRTTGT
FT                   TVHFKPNPKYFDSAKFSVSRLRHLLRAKAVLCSGLEIKFIDKVNNTQDIWLYEDGLSDY
FT                   LIEAVNGFEILPEKPFVGEFKGANEAVSWALLWLPEGGELIGESYVNLIPTIQGGTHVN
FT                   GLRQGLLDAIREFCEFRNLLPRGVKLTADDIWDRCSYILSLKMQDAQFAGQTKERLSSR
FT                   QSAVFVSGVLKDAFSLWLNQNVQDAEKLAEIAISSAQRRLRAAKKVVRKKLVSGPALPG
FT                   KLADCGSQDLEKTELFLVEGDSAGGSAKQARDREYQAILPLRGKILNTWEVSPDQVLGS
FT                   TEIHDIAVALGIDPDSNDLSQLRYGKVCILADADSDGLHIATLLCALFLRHFPKLVQDG
FT                   HVYVAMPPLYRIDLNKEVFYALDENEKEAILDRLKNKKGKPNVQRFKGLGEMNPSQLRE
FT                   TTMDPNTRRLVQLTYDLGEEQGSDTLELMDMLLAKKRSEDRKNWLQAKGDQVDLSV"
FT   CDS_pept        820604..822838
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08760"
FT                   /product="DNA topoisomerase IV, subunit A"
FT                   /db_xref="GOA:E7A4N6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005742"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N6"
FT                   /protein_id="CBY81016.1"
FT                   /translation="MTNINYEGIEQMPLRTFTEKAYLNYSMYVIMDRALPFIGDGLKPV
FT                   QRRIVYAMSELGLNATAKYKKSARTVGDVLGKFHPHGDSACYEAMVLMAQPFSYRYPLV
FT                   DGQGNWGAPDDPKSFAAMRYTESRLSKISEILLNELGQGTVDYQPNFDGTLAEPQYLPA
FT                   RLPHILLNGTTGIAVGMATDIPPHNINEIADATVMLLDNPKAGLDDVLEIVQGPDFPTE
FT                   AEIISPKSEIRKIYEQGRGSIKMRATWKKEDGEIIISALPHQSSPSKVIAQIADQMTAK
FT                   KLPMLEDIRDEADHENPIRIVLVPRSNRVDTDALMAHLFATTDLEKSYRVNMNMIGLDH
FT                   KPAVKGLLEILNEWLTFRRTTVTRRLQYRLDKVLSRLHILEGLMIAFLNIDEVIEIIRH
FT                   EDDPKAELMVRFNLSDEQADAILNLRLRHLAKLEENQLKAEQDELEKERLNLEAILGSE
FT                   RRLNTLIKKEIQEDAKKYASPRMSQLVEREEAKMISESDMTPVTVILSEMGWVRCAKGH
FT                   DIDPKSLSYKAGDNYLAHACGKSNQAVVFIDSTGRSYALDPLSLPSARSQGEPLTGKLN
FT                   LPTGATIEYVVMASEQQELLMASDAGYGFICKFEDLIARNKTGKALISLPENAKVLKPK
FT                   TLINSTALVVAITSAGRMLIFPAQDLPVLSKGKGNKMITIPAANAKDRSELLTKLLLIS
FT                   DQASLEFYSGKRKIVLKPEDLQKFRAERGRKGSTLPRGLHTNLEIMVVEP"
FT   CDS_pept        822880..824094
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08770"
FT                   /product="glutamate transporter"
FT                   /db_xref="GOA:E7A4N7"
FT                   /db_xref="InterPro:IPR004445"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N7"
FT                   /protein_id="CBY81017.1"
FT                   /translation="MSYTFSTYETLALASLVLLLGYFLVKRINVLKTFNIPEPVVGGFI
FT                   VAIGLLIWHKIDGTSFNFDKNLQTTMMLVFFTSIGLSANFSRLIKGGKPLVVFLFIAAL
FT                   LIFGQNVIGIASSMALGIHPAYGLLAGSVTLTGGHGTGAAWADTFAHQFNLQGATEIAI
FT                   ACATFGLVFGGIIGGPVARFLLNRQKQGENPENDEVDDIQEAFEHPTYKRKITARSLIE
FT                   TIAMISVCLLIGQYLDVQTKGTALQLPTFVWCLFTGVIVRNILTNIFRFQVAESAIDVL
FT                   GSVGLSIFLAIALMSLRLWELAGLAIDVLIVLAIQVAFMAAFAIFITYRAMGKDYDAVV
FT                   LSAGHCGFGLGATPTAIANMQAVTSRFGPSHKAFLIVPMVGAFFIDLINAALLKVSFAV
FT                   VNMLA"
FT   CDS_pept        complement(824133..825041)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08780"
FT                   /product="ribosomal protein S6 modification protein"
FT                   /db_xref="GOA:E7A4N8"
FT                   /db_xref="InterPro:IPR004666"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR023533"
FT                   /db_xref="InterPro:IPR041107"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N8"
FT                   /protein_id="CBY81018.1"
FT                   /translation="MKLLMLCREPRLYSCQRLKEAAKHQGHEMDILDPNHCFLKLSQNP
FT                   PHFQIFYQENSESKPYLLPDYDAVLPRFGTTSTQMGCSVLQHFEGKGTFCLNSSQAFLN
FT                   ARDKWKSLQLLLKAGVPVPNSLLGGSEVQAQATTPYISSPTILKTLNGSQGIGVILAEK
FT                   PQSAVSIMEAFKQTNISMLQQDFIEEAGNADIRCFVMGDQVVATMQRIGQNGEFRANCH
FT                   RGGKTEKITLSDEEKQIAIQATKAIGLDVAGVDLIRSKNGLLVLEVNASPGLEMIEKTS
FT                   GIDIAAEIIDYIEINAFINLR"
FT   CDS_pept        825157..825420
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08790"
FT                   /product="glutaredoxin"
FT                   /db_xref="GOA:E7A4N9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR011902"
FT                   /db_xref="InterPro:IPR014025"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4N9"
FT                   /protein_id="CBY81019.1"
FT                   /translation="MFVTIFGRPGCPYCVRAKNLAEKLKGKVADFDYRYVDIHAEGITK
FT                   EDLSKSVGKPVETVPQIFIDEKPIGGCTDFEALMKEQFGIVA"
FT   CDS_pept        complement(825487..826707)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08800"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] synthase I"
FT                   /db_xref="GOA:E7A4P0"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P0"
FT                   /protein_id="CBY81020.1"
FT                   /translation="MRRTVITGFGIISSIGNNKEEVLASLKAGKSGIEVVPEFVEMNMR
FT                   SHVAGTIKLNPSEHIDRKVFRFMGDAAAYAYLSMREAIEDAGLTEDQVSNDRTGLVIGA
FT                   GTGSAHNQLVACDAVRGPRGVKAIGPYAVTKTMASSVSACLATPYKIRGVNYSMSSACA
FT                   TSAHCIGHAVELIQLGKQDVVFAGGAEELSWECATEFDAMGAVSTKYNETPEKASRAYD
FT                   ANRDGFVIAGGGAVVVVEELEHALARGAKIYAEIVGYGATSDGYDMVAPSGEGAERCMK
FT                   QAMATVDTPIDYINVHGTSTPVGDVKELGAIKNVFGDKIPAISSTKSMTGHSLGAAGAH
FT                   EAIYTLLMLDNDFIAPSINIETLDEAAEGCNIVTETKENAGLETVMSNSFGFGGTNATL
FT                   IFKRYNG"
FT   CDS_pept        826856..828868
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08810"
FT                   /product="protein of unknown function, FAD dependent
FT                   oxidoreductase domain"
FT                   /db_xref="GOA:E7A4P1"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR008471"
FT                   /db_xref="InterPro:IPR017610"
FT                   /db_xref="InterPro:IPR023032"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P1"
FT                   /protein_id="CBY81021.1"
FT                   /translation="MTFSVQHAEIHFNQNHIPVSDQFDDVYFSNENGLAETDYVFLQGN
FT                   QLWERWITHKDANFVIAETGFGTGLNFFAVTKLFREFRQQHENHPLKRLNFISFEKYPL
FT                   KITALLQAHLAFPQFEDLSAHLQRYWPSLILGCHRIHFEETTLDLWFGDVSENLPQLGD
FT                   YMNERIDAWFLDGFAPSKNPEMWNDDLYNLMFRFTKPNGSFATFTAASAVRKGLESAGF
FT                   NVTKRKGFGKKRECLSGLKIQSKSTALSTPWYLAQPAKMEQQDVAIIGGGIASLCAAIS
FT                   LVKRGAKVTIYCEDDSLALNASGNKQGAFYPQLSDDNVLTIDFYLHAFSYGRQLLDWAI
FT                   EQNIAFEHEFCGVALCAYNEKSAVKLAKISQLGLPNEIFQMLNAEQLSEKVGLPLNCEG
FT                   GWIEQGAWLAPRQFVQNAFSFLEKQGVIIKTAQKITALSQEEKGWELKNMQGQKYCHEV
FT                   VILANGYKITDFVQTEKLPLYPIRGQVSQIPTSENLLKLKSVLCYDGYLTPANQLKTSH
FT                   CIGASHVRDNVDRHFSEQEQQENQQKLQQNIAQPWTQDVNTSDNLARVGIRCSVRDLAP
FT                   MVGNVPHFEQQQADYYNLFNLRRRKQPIQSAINFQNLFLIAALGSRGLTSAPLLGETLA
FT                   SIIYGEPLPISEGILHNLSANRAWVKKWLKGSKVE"
FT   CDS_pept        828939..829979
FT                   /transl_table=11
FT                   /gene="licA"
FT                   /locus_tag="HIBPF_08820"
FT                   /product="licA, choline kinase involved in LOS
FT                   biosynthesis"
FT                   /db_xref="GOA:E7A4P2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P2"
FT                   /protein_id="CBY81022.1"
FT                   /translation="MNTKMLCNQSINQSINQSINQSINQSINQSINQSINQSINQSINQ
FT                   SINQIVGFVKTCYKPEEVFHFLHQHSIPFSSIGGMTNQNVLLNISGVKFVLRIPNAVNL
FT                   SLINREYEAFNNAQAYRAGLNVETPVLDAKSGVKLTRYLENSKPLSQIQLNEQSCLSQV
FT                   VNNLCRLHNSEFVFRNVFSVFDEFRQYFSLLENKSAFYQADSRMDKLSAVFWQFEEINK
FT                   EIILRPCHNDLVPENMLLQDDRLFFIDWEYSGLNDPLFDIATIIEEAHLSKEAADFLLE
FT                   TYCNQTNKYHKTEFQIAHKRLKIHRFCQNVLWFLWTKVKEEHGENFGDYALKRLDAAFK
FT                   LLEELP"
FT   repeat_region   828959..829082
FT                   /note="CAAT x31"
FT   CDS_pept        829979..830857
FT                   /transl_table=11
FT                   /gene="licB"
FT                   /locus_tag="HIBPF_08821"
FT                   /product="protein licB, nucleotidyl transferase"
FT                   /db_xref="GOA:E7A4P3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P3"
FT                   /protein_id="CBY81023.1"
FT                   /translation="MRGYLFGILSAVFWALSGLLYNELPLSEYTALGKVISLLFLIDFC
FT                   SLLVIGITLWRKSAVDFQGVFWRPALSGVLGGPIGMSAYLLSIHYLTIYYAAPLSSLFP
FT                   VFAALMSYWILKEKITKTAQFGFALAIISSSLLAIEVGQEITFNTIGFIFLIICILGWS
FT                   SEIVISSYTMRSLSGLQVYFLRLCGSTIGYLLILFILSLKNFSLDILSFNYVQIAGVII
FT                   FGALSYCCYYQAIYLLKPIKAMALNITYSVWAIGLGYLLYQQPIKPITLLLTLLLSAGV
FT                   IVTLYYKGEQK"
FT   CDS_pept        830854..831555
FT                   /transl_table=11
FT                   /gene="licC"
FT                   /locus_tag="HIBPF_08830"
FT                   /product="protein licC"
FT                   /db_xref="InterPro:IPR017189"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P4"
FT                   /protein_id="CBY81024.1"
FT                   /translation="MNAIILAAGLGSRFKDITQSTHKSLLDIHGTPNLERTLTFLRQAN
FT                   IDNIVIVTGYLHEQFNYLQEKYNCTLIHNEKYREYNSIYSFSLAQDFFNDCYVIDADVV
FT                   LNRNIFLTKPSHSKYFTVIRSKTHNEWLPILNSNGQVIRIDIGSLNQPSLSGVSYWTTR
FT                   DCNIILTLLKEYTSEVRLKNPKLYWDTIPMEYIEKLNIYTEQLNNDDIFEMDNLDDYQH
FT                   ILQKLTTNKEK"
FT   CDS_pept        831555..832352
FT                   /transl_table=11
FT                   /gene="licD"
FT                   /locus_tag="HIBPF_08840"
FT                   /product="protein licD, phosphorylcholine transferase"
FT                   /db_xref="GOA:E7A4P5"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P5"
FT                   /protein_id="CBY81025.1"
FT                   /translation="MKKLTLREQQLVCLNILDYFHALCEKHQIRYSLGGGTLIGAIRHQ
FT                   GFIPWDDDIDVYMHRDEYQKFVDVWFRETNEYYNMETAEDILAQYTGEMAKIFDCRTQI
FT                   TDTKGRKSPMFMDIFIYDGVPNEPKIIYPLMKKHRRIKLRFSSCKKRWLRSKENTLQRT
FT                   ILDKLSHFLFSKMQKNLAQFQIKYPIKQYDYIGLVLSDYGGWQKSYMPKEYFNHVIYKE
FT                   FEGRQFQVMNGYHEHLTQYYGDYMKLPPEEEQKQHHIQEAYIL"
FT   CDS_pept        complement(832390..834240)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08850"
FT                   /product="protease IV (signal peptide peptidase)"
FT                   /db_xref="GOA:E7A4P6"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR004634"
FT                   /db_xref="InterPro:IPR004635"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P6"
FT                   /protein_id="CBY81026.1"
FT                   /translation="MFRVLKFCWKALCFIRDLVMNVMFLGFVLLLVAIISFSSGGKKST
FT                   TLIGEGALLLNLDGYLADNRDETLRWQDALNELNGKHVPRKISTFDVVFAIQQAEDDPK
FT                   IKGLVLDLNYFEGADLPALDFIGGAIRHFKDAGKAVIAYADNYSQGQYYLASFADEIYL
FT                   NSIGSVDIHGLSQENLYFKEMLDKLAVTPHIFRVGTYKSAVEPFLRNDMSAEAKANMQR
FT                   WLGEMWNNYILSVSENRKIKKDRILPNAKQYLAELKALKGNSTAYAQQRGLVTHVVTRL
FT                   DLEKKLTALFGKNADGEANLVAFDDYLTQFPDRLTPQDNSPNKIAVVNVEGTIIDGESD
FT                   EENAGGDTIARILRKAQDDNSVKAVVLRVNSPGGSAFASEMIRQETENLQKIGKPVIVS
FT                   MGAMAASGGYWISSTADYIIADANTITGSIGIFAMFPTFENSIKKIGVNADGVSTTELA
FT                   NTSAFSPLAKPVQDIYQTEIEYGYDRFLEIVSKGRQLSKTQVDKLAQGQVWLGSDAFQN
FT                   DLVDEIGSFNEAVNKAEQLVNQRQDTAVQDFSVEWFTDDNVSLISTLLRDTKKGTQEQL
FT                   VKWLGLPAPIQKLQKELNVLTKFNDPKGQYLYCLNCGKVK"
FT   CDS_pept        834337..834891
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08860"
FT                   /product="predicted oxidoreductase"
FT                   /db_xref="GOA:E7A4P7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR026021"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P7"
FT                   /protein_id="CBY81027.1"
FT                   /translation="MDSLTLLTTRKSNKKLTAPAPNTEQLELILQAAMHVPDHGKLHPY
FT                   HFVVMENEGLNKLETLLKAAVVEFDLGEEKLKKAENLAHRAPMVIGVVAKIDPTIAKVP
FT                   EWEQMLSAGCATYGLQLAAQAQGFDNVWISGKWVNGSALREAFGCREQDRVIALVMIGT
FT                   GIEKAEREYRVIDTKDFVTYL"
FT   CDS_pept        complement(834938..835492)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08870"
FT                   /product="conserved protein"
FT                   /db_xref="InterPro:IPR026269"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P8"
FT                   /protein_id="CBY81028.1"
FT                   /translation="MSEKQINNFSLISRLFGNLFYRSPTDEVLAGAFAWLQQKGLIQVW
FT                   ALDTDKESALALNSLQVKIDLDLLNQEYQKLFAANGKVITAISAYGIDVEEFVNFRLVR
FT                   NMPEVESADHFALLLLTASWLEDNSDSLVAQQEFFETFLLPCAAKFLTQVETQATLPFY
FT                   RALAILTREILVAMADELEEE"
FT   CDS_pept        complement(835492..836100)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08880"
FT                   /product="putative NAD(P)H oxidoreductase"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P9"
FT                   /protein_id="CBY81029.1"
FT                   /translation="MNHLIIFAHPNSERSFGRAIANRIEQISQANGVNVFFRDLYEMNF
FT                   NSILSFEELQNAHKGIIPEDIKQEHNFILQADLITLVYPLWWMGFPAILKGYLDRVLSH
FT                   GFAYKTENGKSVGLLKNKQMQQFITIGSNLDKYKEFGVDKSLNHCLINGLFNYCGIENV
FT                   EFELFGDIHLIDDGARKAMIELAAQKTKEKLTALLKEKA"
FT   CDS_pept        complement(836221..837465)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08890"
FT                   /product="sodium:serine/threonine symporter"
FT                   /db_xref="GOA:E7A4Q0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q0"
FT                   /protein_id="CBY81030.1"
FT                   /translation="MNTSRLFSLLFRGSLVKRIATGLVLGIIVALISAPLQETIGFNLA
FT                   EKVGVLGTIFVKALRAVAPILIFFLVMAALANRKIGTKSNMKEIVVLYLLATFLAAFVA
FT                   VIAGFLFPTEVVLAAKEDSSSAPQAVGQVLLTLILNVVDNPLNAIFKANFIGVLAWSIG
FT                   LGLALRHASDATKNVLSDFAEGVSKIVHVIISFAPFGVFGLVAETLSDKGLVALGGYVQ
FT                   LLAVLIGTMLFTAFIVNPILVYWKIRRNPYPLVWTCVRESGVTAFFTRSSAANIPVNIE
FT                   LAKRLNLDEETYSVSIPLGANINMAGAAITITILTLAAVHTLGLEVSFVSALLLSIVAA
FT                   LCACGASGVAGGSLLLIPLACSLFGISDDVAAQMIGVGFIIGILQDSTETALNSSTDVL
FT                   FTAAVCMEEERKNAA"
FT   CDS_pept        837750..838190
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08900"
FT                   /product="Peptidase S24, S26A and S26B, C-terminal"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q1"
FT                   /protein_id="CBY81031.1"
FT                   /translation="MNNQTLTARNEMNLSYNPLPFFSDIDDNLKFNKKLDLNLYCIKRP
FT                   KQTCFIHITNPNMLAWGIESGDMLVVEKNDDLYSGDLVVLEENNEFHVYEFMLHNDNYL
FT                   FMALDSSTPNINTKNWSNLPIVGTVTNTIHQMKRRDKIKWAA"
FT   CDS_pept        complement(838269..839357)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08910"
FT                   /product="3-deoxy-D-arabino-heptulosonate-7-phosphate
FT                   synthase, phenylalanine repressible"
FT                   /db_xref="GOA:E7A4Q2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006219"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q2"
FT                   /protein_id="CBY81032.1"
FT                   /translation="MAKEKIEIVVANDDTRIEKVDQVLPPIALLEKYPASEYAAALVKQ
FT                   TRHEAHNIIQAKDDRLLVVIGPCSIHDPKAAIEYATRLKPLRDKYKDSLEIIMRVYFEK
FT                   PRTTVGWKGLINDPYLNDTYRLNDGLRIARKLLSDINDLGVPAAGEFLDMITPQYLADF
FT                   MSWGAIGARTTESQVHRELASGLSCAVGFKNATNGGVKVALDAIGAAEAPHNFLSVTKF
FT                   GHSAIVSTKGNEDCHIILRGGDKGPNYSAEDVEKVCADIEKTGRIPHVMVDFSHANSSK
FT                   QYKKQMEVCQDVCNQVASGSKQIFGVMVESHLVEGRQDLVDGKAQTYGQSITDACIGWE
FT                   DSERLLQQLSDAVIARRKVTSN"
FT   CDS_pept        complement(839574..840824)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08920"
FT                   /product="outer membrane-specific lipoprotein transporter
FT                   subunit"
FT                   /db_xref="GOA:E7A4Q3"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR011926"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q3"
FT                   /protein_id="CBY81033.1"
FT                   /translation="MNTPFFISWRYQRGKQKNPLVALIAKFSAIGIALGVAVLIVGLSA
FT                   MNGFERELNQRILAVVPHIEIFSAHQAKDPTIHHWQNLEKRLQQNPQIKGISPFVSFTA
FT                   LVENGSKLKVVQVKGVEKQAEDKVSSIGNFVQEQGWNKFEKEGGLVLGSGIAKELDVKV
FT                   GDWVTLLISQQNGDEQFAQLTREPVQVTAILRLDGQLDYSYALLPLAQAQTFLTYQPDQ
FT                   ITGVELKLDDPFSVRNLDLSMLNDYPQMLYMQNWISKFGYMYRDIQLIRTVMYIAMVLV
FT                   IGVACFNIVSTLIMAVKDKQGDIAIMRTLGANNAFIKRIFIWYGLQAGMKGCLIGIVLG
FT                   IILALNLTTFIQGIEWVIGKKLLSGDVYFVDFLPSELHWSDVLMVLIAALALSLIASLY
FT                   PASRAAKLQPAQVLSSH"
FT   CDS_pept        complement(840824..841507)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08930"
FT                   /product="outer membrane-specific lipoprotein transporter
FT                   subunit"
FT                   /db_xref="GOA:E7A4Q4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011924"
FT                   /db_xref="InterPro:IPR015854"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q4"
FT                   /protein_id="CBY81034.1"
FT                   /translation="MNNYLLKCENINKFYQEGENQTQVLKGVSFSMEPAELVAIVGSSG
FT                   SGKSTLLHTLGGLDQPSSGEVFINGQSLQKASANELAALRNRYLGFVYQFHHLMADFTA
FT                   LENVMMPMLIGHQNKTEAKDRAEKMLSAVGLSHRITHRPSALSGGERQRVSIARALVNN
FT                   PSLVLADEPTGNLDHKTTESIFELIQQLNQEQNIAFLLVTHDMGLAEKLSRRLVMQDGL
FT                   LKEGA"
FT   CDS_pept        complement(841589..842230)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08940"
FT                   /product="probable dethiobiotin synthetase"
FT                   /db_xref="GOA:E7A4Q5"
FT                   /db_xref="InterPro:IPR004472"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q5"
FT                   /protein_id="CBY81035.1"
FT                   /translation="MGKVIFVSGIDTDVGKTVATGIYAKKLMEQGFSVITQKMIQTGCK
FT                   NIADDLLVHRKIQGIDLTEEDLQGKTCPYVFEYPCSPHLAAKRESRKIEAKIIEKSTAL
FT                   LAEKYDYVLLEGAGGLMVPYCKEETTLDYIQLNNYPLILVTSGKLGSINHTLLSLEACR
FT                   TRGISVLSVMYNGYPEYDPIISQETQRYVKRYLEKHFPETGFEYFGCIEI"
FT   CDS_pept        complement(842243..843022)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08950"
FT                   /product="Biotin synthesis protein BioC"
FT                   /db_xref="GOA:E7A4Q6"
FT                   /db_xref="InterPro:IPR011814"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q6"
FT                   /protein_id="CBY81036.1"
FT                   /translation="MESLTSVDKSRIQHAFQKALNSYDEHALIQQKMNIKLMTHLQDYL
FT                   PNGSLDSVLELGCGSGMLSSLLQKQISADYWLFNDLCDVQAKLAEKLPQSFDFYCGDAE
FT                   HFLFLQQFDLIASASAVQWFHQPDAFIAHCKTGLKTNGLLAVATFGEDNLKEVRQITNI
FT                   GLNYPTLSQWQTWLAKDFELLWCEDFKVILDFDTPLDVLKHLKYTGVTATNQKNWTRKN
FT                   LNKFIDDYLQAFSLPSGKVRLTYHPLFFIARYSRAGN"
FT   CDS_pept        complement(843010..843657)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007398"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q7"
FT                   /protein_id="CBY81037.1"
FT                   /translation="MKTKFYDHQGEHLIVYFAGWGTPLDAVAHLILPTDHDLLICYDYQ
FT                   DLNLDFDFSAYRHIRLVAWSMGVWAAERALQGIRLKSATAVNGTGLPCDDNFGIPDTIF
FT                   KATLGNLTENTRLKFERRICGDKASFERYRLFPARPFDEIHQELTAIFAMIQQDKRTDL
FT                   IHWANAWVSSRDKIFTPANQHQYWASRCAVQEIEGEHYVFSRFTHWSALWNH"
FT   CDS_pept        complement(843667..844809)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08970"
FT                   /product="8-amino-7-oxononanoate synthase"
FT                   /db_xref="GOA:E7A4Q8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004723"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q8"
FT                   /protein_id="CBY81038.1"
FT                   /translation="MDAFKQQLEQLSAKNQYRSIPDLVHQGRYITRENRKMLNMSSNDY
FT                   LGLASNENLRQSFLQQYGGNFPSFTSSSSRLLTGNFPIYTDLEELVAQRFQRESALLFN
FT                   SGYHANLGILPALTTTKSLILADKLVHASMIDGIRLSQCEFFRYRHNDYEHLKNLLEKN
FT                   VGKFDRTFIVTESVFSMDGDVADLKQLVQLKKQFPNTYLYVDEAHAIGVYGKSGLGIAE
FT                   RANVIADIDLLVGTFGKALASVGAYAVCSQVLKECLINQMRPLIFSTALPPFNVAWTHF
FT                   IFERLPQLSKERTHLERLSAFLRQEVEHRTQIMPSQTCIVPYILGGNEATLAKAEYLQR
FT                   QGYYCLPIRPPTVPKGTSRIRLSLTADMTMDEVKQFVACL"
FT   CDS_pept        complement(844818..846107)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08980"
FT                   /product="adenosylmethionine-8-amino-7-oxononanoate
FT                   aminotransferase"
FT                   /db_xref="GOA:E7A4Q9"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR005815"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4Q9"
FT                   /protein_id="CBY81039.1"
FT                   /translation="MDEQSLLAFDTQHIWHPYSSVSSDMPLYAVERADGVMITLKDGRR
FT                   LIDGMSSWWAALHGYNHPRLNAAAQNQLAKMSHIMFGGFTHDPVVELAQLLVQILPNGL
FT                   DKIFFADSGSVAVEVAMKMAIQYQHAKGEVQRQKFATIRSGYHGDTWNAMSVCDPTTGM
FT                   HHLFHHSLPVQYFLPQPNISFNESWNDCVIEPLADLLERKGNEIAALILEPVVQGAGGM
FT                   YFYSPTYLVKAQALCKQYGVLLIFDEIATGFGRTGKLFAAEHAGISPDIMCIGKALTGG
FT                   YLTLSASITTTEIAQIICSGEAKCFMHGPTFMANPLACAIASESIRLLLESPWQQNIQR
FT                   IEHSLKQQLSPLSEKDYVKEVRVLGAIGVVEMKSAVNMKTLVPRFVEQGVWIRPFGKLV
FT                   YVMPPFVIKDDELQKLTEGMILALIQEYEH"
FT   CDS_pept        complement(846122..847303)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_08990"
FT                   /product="outer membrane-specific lipoprotein transporter
FT                   subunit"
FT                   /db_xref="GOA:E7A4R0"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR011925"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R0"
FT                   /protein_id="CBY81040.1"
FT                   /translation="MNFPISLYIALRYWRAKSADRFGRLVTNLASLGIVLGVMALIIVL
FT                   SVMNGLEGYQKQQVLSSIPHAIVSEEQPISTEKTLENLPHFVQKAVPINTTNVIYQTAK
FT                   GVSAGQIIGIQSFSDDPLVESFEQTKFNEILPSGEFKLVIGDQLAQKLGVNIGDKIRLM
FT                   ITENSQYTPFGRAPMQRLFTVSDIYYDYGEASGYEAFANITDIGRLMRIQPQQAQGYRL
FT                   FLNDPFQITELPQHFPIQKITDWRVQKGEFFQAVRMEKNMMGLLISLIIVVAISNIVTS
FT                   LSLMVVDKQGEIAILQTQGLTKSQVRSVFIYQGLLVGFVGTLLGAILGVLATLNLTEIL
FT                   SAVNPQGVFLPTELSFVQMIFVIGFSLLLSLLSTLYPAYRAAKVEPAAALRYE"
FT   CDS_pept        complement(847303..848250)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09000"
FT                   /product="putative 2-hydroxyacid dehydrogenase"
FT                   /db_xref="GOA:E7A4R1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R1"
FT                   /protein_id="CBY81041.1"
FT                   /translation="MKIVFLDSTAIPKHISIPRPSFEHTWTEYEHTSAEQTIERAKDAD
FT                   IVITSKVIFDRETLQQLPKLKLIAITATGTNNVDLVAAEEMGIAVRNVTGYSSTTVPEH
FT                   VIGLIFSLKHSLAGWLRDQTEAKWAESKQFCYFDYPITDVRGSTLGVFGKGCLGTEVGR
FT                   LANAVGMKVLYAEHKDATVCREGYTPFDEVLKQADIVTLHCPLTETTKNLINTETLSKM
FT                   KKGAFLINTGRGPLIDELALVDALKTGHLGGAALDVMVKEPPEKDNPLILAAKTMPNLI
FT                   ITPHIAWASDSAVTTLVGKVMQNIEEFVQQLHQK"
FT   CDS_pept        complement(848310..849164)
FT                   /transl_table=11
FT                   /gene="kdsA"
FT                   /locus_tag="HIBPF_09010"
FT                   /product="3-deoxy-D-manno-octulosonate 8-phosphate
FT                   synthase"
FT                   /db_xref="GOA:E7A4R2"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R2"
FT                   /protein_id="CBY81042.1"
FT                   /translation="MQNKIVKIGNIDVANDKPFVLFGGMNVLESRDMAMQVCEAYVKVT
FT                   EKLGVPYVFKASFDKANRSSIHSYRGPGMEEGLKIFQELKDTFGVKIITDVHEIYQCQP
FT                   VADVVDIIQLPAFLARQTDLVEAMAKTGAVINVKKPQFLSPSQMGNIVEKIEECGNDKI
FT                   ILCDRGTNFGYDNLIVDMLGFSVMKKASKGSPVIFDVTHSLQCRDPFGAASSGRRAQVT
FT                   ELARSGLAVGIAGLFLEAHPNPNQAKCDGPSALPLSALEGFVFQMKAIDDLVKSFPELD
FT                   TSI"
FT   CDS_pept        complement(849179..849982)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09020"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R3"
FT                   /protein_id="CBY81043.1"
FT                   /translation="MKYYRRALYDKFVHFYLVISDDGSSEAQLRGKMGGLVRKARKKIS
FT                   PDWPKEKQIHQLLQLFYGDWGFHCDPEDYFYARNLYLPYVFEHRQGMPVTLGAMVFYLA
FT                   EALDLPIYPVNFPTQLILRAEVRDEVAFIDPWDGTYISQEKLQQLYEGAFGFGAKIQPE
FT                   ELDRADLSLLYSRFEQLAKNALIREEHNDMAYHYIKNLMITDAENPYHIRDRGLVLAQM
FT                   GAYPSALKDLEFFVEHCPKDPTAAFIRTQLLELKGEINKDTFPLH"
FT   CDS_pept        complement(849982..850860)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09030"
FT                   /product="N5-glutamine methyltransferase, modifies release
FT                   factors RF-1 and RF-2"
FT                   /db_xref="GOA:E7A4R4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R4"
FT                   /protein_id="CBY81044.1"
FT                   /translation="MNYKEWLAQAMADLAQKNPTENSKIDALVLLQHATGKSRTQILAF
FT                   DDTEIDEKVRLKLIALLDRRLKGEPIAYILGEKEFWSLPLNVSKSTLIPRPDTEILVEK
FT                   ALQIALEKLEENPPHFRILDLGTGTGAIALALASELSSICQKRLISLEIIGVDLMPDVV
FT                   ALAQSNAERNQLNVEFLQSCWFDNITGKFDLIVSNPPYIDAQDEHLHQGDVRFEPLSAL
FT                   VANDEGYADLRHIIELASSYLNSNGVLLLEHGWQQGEKVRSIFQENHWEMVETVRDYGD
FT                   NERVTLGFWKK"
FT   CDS_pept        complement(850860..851300)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4R5"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R5"
FT                   /protein_id="CBY81045.1"
FT                   /translation="MIIENQKDAEFSSTFKPSQLAQASRFKRWLASMINGLVLWVMVGL
FT                   GFALGDFAGVVGTIVYIGFQLYFMKTYGQTMAKRWLGLCVFNYHTNQPVEFGKYIGREI
FT                   IDILLAWTSFLLIISGIVALVRDDRRSLTDLLAGTIVLKDEK"
FT   CDS_pept        complement(851353..852438)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09050"
FT                   /product="peptide chain release factor RF-1"
FT                   /db_xref="GOA:E7A4R6"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R6"
FT                   /protein_id="CBY81046.1"
FT                   /translation="MMKDSIIAKLESLKERYEELEALLGDVSVISDQDKFRAYSKEYSQ
FT                   LEEVVKCFNRWTQLNQNIEEAEILLDDPEMKEMAQMEIEESKAEIEEVEQQLQILLLPK
FT                   DPNDEYNCYLEIRAGTGGDEAGIFAGDLFRMYSRYAESKRWRVEMLSANESEQGGYKEV
FT                   IVKVTGEGVYGQLKFESGGHRVQRVPKTESQGRIHTSACTVAVMPELPESEMPEINPAD
FT                   LRIDTYRSSGAGGQHVNTTDSAVRITHIPTGIVVECQDERSQHKNKAKAMSVLASRIVQ
FT                   AEQERQAAEQTDMRRNLLGSGDRSDKIRTYNYPQGRVTDHRINLTIYRLDEVMNGKIDE
FT                   LIQPIITEYQADQLAALSEQN"
FT   CDS_pept        complement(852714..853265)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R7"
FT                   /protein_id="CBY81047.1"
FT                   /translation="MRFTKTLFTTALFGASIFSFQSTTWADTLEQQFQQGLTAYEQSDY
FT                   QTAFKLWLPLAEQGDAQAQGGLGMMYERGLGVKQDYFKAVNWYRKAAEQGDADAQLNLG
FT                   MMYAIGRGVKQDDVESVKWFRKAAEQGYAPAQFALGALYLLGQGVQVNKSLAKEWFGKA
FT                   CDNGEQRGCEYYGKLNRGER"
FT   CDS_pept        complement(853464..854000)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR007411"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R8"
FT                   /protein_id="CBY81048.1"
FT                   /translation="MEHKLEDIIAIFNQCFEEEYNTRLVKGGDEPIYLPANDEVPYNAI
FT                   YFARGFYSSALHEIAHWLVAGKERRKLEDFGYWYEPDGRSEERQRDFEKVEVKPQALEW
FT                   ILATAAGFRYFASADNLNGNPGDTQPFKQAVYEQVKIYAEKGLPKRAEMLRKALVAFYG
FT                   TEDEIDLAKFDVARI"
FT   CDS_pept        join(854500..854535,854528..855520)
FT                   /transl_table=11
FT                   /gene="licA"
FT                   /locus_tag="HIBPF_09080"
FT                   /product="licA protein, choline kinase involved in LOS
FT                   biosynthesis"
FT                   /db_xref="GOA:E7A4R9"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4R9"
FT                   /protein_id="CBY81049.1"
FT                   /translation="MNTKMLCNQSINQSINQSINQSINQSINQSINQSINQSINQSINQ
FT                   IVGFVKTCYKPEEVFHFLHQHSIPFSSIGGMTNQNVLLNISGVKFVLRIPNAVNLSLIN
FT                   REYEAFNNAQAYRAGLNVETPVLDAKSGVKLTRYLENSKPLSQIQLNEQSCLSQVVNNL
FT                   CRLHNSEFVFRNVFSVFDEFRQYFSLLENKSAFYQADSRMDKLSAVFWQFEEINKEIIL
FT                   RPCHNDLVPENMLLQDDRLFFIDWEYSGLNDPLFDIATIIEEAHLSKEAADFLLETYCN
FT                   QTNKYHKTEFQIAHKRLKIHRFCQNVLWFLWTKVKEEHGENFGDYALKRLDAAFKLLEE
FT                   LP"
FT   repeat_region   854520..854623
FT                   /note="CAAT x26"
FT   CDS_pept        855520..856398
FT                   /transl_table=11
FT                   /gene="lic2B"
FT                   /locus_tag="HIBPF_09081"
FT                   /product="licB protein"
FT                   /db_xref="GOA:E7A4P3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P3"
FT                   /protein_id="CBY81050.1"
FT                   /translation="MRGYLFGILSAVFWALSGLLYNELPLSEYTALGKVISLLFLIDFC
FT                   SLLVIGITLWRKSAVDFQGVFWRPALSGVLGGPIGMSAYLLSIHYLTIYYAAPLSSLFP
FT                   VFAALMSYWILKEKITKTAQFGFALAIISSSLLAIEVGQEITFNTIGFIFLIICILGWS
FT                   SEIVISSYTMRSLSGLQVYFLRLCGSTIGYLLILFILSLKNFSLDILSFNYVQIAGVII
FT                   FGALSYCCYYQAIYLLKPIKAMALNITYSVWAIGLGYLLYQQPIKPITLLLTLLLSAGV
FT                   IVTLYYKGEQK"
FT   CDS_pept        856395..857096
FT                   /transl_table=11
FT                   /gene="licC"
FT                   /locus_tag="HIBPF_09090"
FT                   /product="licC protein"
FT                   /db_xref="InterPro:IPR017189"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4P4"
FT                   /protein_id="CBY81051.1"
FT                   /translation="MNAIILAAGLGSRFKDITQSTHKSLLDIHGTPNLERTLTFLRQAN
FT                   IDNIVIVTGYLHEQFNYLQEKYNCTLIHNEKYREYNSIYSFSLAQDFFNDCYVIDADVV
FT                   LNRNIFLTKPSHSKYFTVIRSKTHNEWLPILNSNGQVIRIDIGSLNQPSLSGVSYWTTR
FT                   DCNIILTLLKEYTSEVRLKNPKLYWDTIPMEYIEKLNIYTEQLNNDDIFEMDNLDDYQH
FT                   ILQKLTTNKEK"
FT   CDS_pept        857096..857893
FT                   /transl_table=11
FT                   /gene="lic2D"
FT                   /locus_tag="HIBPF_09100"
FT                   /product="licD protein, phosphorylcholine transferase"
FT                   /db_xref="GOA:E7A4S2"
FT                   /db_xref="InterPro:IPR007074"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S2"
FT                   /protein_id="CBY81052.1"
FT                   /translation="MKKLTLREQQLVCLNILDYFHALCEKHQIRYSLGGGTLIGAIRHQ
FT                   GFIPWDDDIDVYMHRDEYQKFINAWLHEKHERYSIGTAEDILASNTGEMTKIFDNKTKT
FT                   IDINGNENKIFIDIFIYDGIPNNKKIIYTIIKKYRKRKNRFASCKKRWIRASQNSLKYT
FT                   ILNWLSNLLFHRMQNYLSEIQKLHPINTSENIGLLMTEYRNWNKAYMPRAYFNHVIYKE
FT                   FEGRQFQVMNGYHEHLTQYYGDYMKLPPEEDQKPHHIQEAYIL"
FT   CDS_pept        complement(858267..858683)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09110"
FT                   /product="phage virion morphogenesis (putative tail
FT                   completion) protein"
FT                   /db_xref="InterPro:IPR006522"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S3"
FT                   /protein_id="CBY81053.1"
FT                   /translation="MIEIEINNAQEIASALERLAQATAHRAPLMRSIAGTMESAVAQNF
FT                   EVGGRPAWKKLKIRQGTPLVDTENLMASITSEYNNNEAIVGTNEPYAAIHQFGGKAGRG
FT                   RKVAIPARPFLILTPQDEADILEDIQDYFQRLIN"
FT   CDS_pept        complement(858807..859514)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR041301"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S4"
FT                   /protein_id="CBY81054.1"
FT                   /translation="MKRREIDKPDDSSEFLVEVERPADKQGNREKTVGFKLSDGTIRVT
FT                   DKGFDYNVGRLNYKSNLDLYPEKLAHAFAKVEMKGGEFKHDFELLAKHMAEMKQTLSLD
FT                   GKKLTADQMLQVRDSLTKNFKFAAGVLSAESKDLLKSKTGTVWLSDDTLIKQFNSRDGQ
FT                   DFGIDEYESLPDIINALEHLLQVKDFADRYTFIRQGKMLVVKILPKEIFVLSFRRIKDK
FT                   ELKKLLEKDYALR"
FT   CDS_pept        complement(859526..859765)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09121"
FT                   /product="Mu-like prophage protein gp29"
FT                   /db_xref="InterPro:IPR009279"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S5"
FT                   /protein_id="CBY81055.1"
FT                   /translation="MSLCHLVQTITQQIILPYLQINVDPNIAPHRIPYFEFDTKEYEDL
FT                   SVFADAIPKLTGIGVQISESWVRDKLGIPEPQEG"
FT   CDS_pept        859759..860229
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09140"
FT                   /product="putative phage protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S6"
FT                   /protein_id="CBY81056.1"
FT                   /translation="MTKRCDQPICIEYEECEPNKYGEIRKKIVGVKNRFTEKKIITKLK
FT                   NWVIKSAKSALGSTALNSESTETNKAHRAAWTCVNNCNRLKIEQQMKELMLPIGSPLKP
FT                   SQIELLMRHGRLRLNDYRWICCENDEVFIKEEKIPLAQAFGWGESLGDFRVN"
FT   CDS_pept        860809..861120
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09122"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S7"
FT                   /protein_id="CBY81057.1"
FT                   /translation="MLECPFLVIGKKAVRFSKLILFQVKLAISPALIAVSIAKRNAAPC
FT                   NFVRFLAVQYVRHINLTQKSDAQFHVHYIDEFLVLVLLVSQDILGGFCYKIPFNRFGH"
FT   CDS_pept        complement(861184..861501)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09141"
FT                   /product="putative integrase"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S8"
FT                   /protein_id="CBY81058.1"
FT                   /translation="MATIIKNGKRWHAQVHKFGVSKSATFLTQADAKKWAEMLEKQLES
FT                   GKYNEIPDITLDELIDKYLKEVTVTKHRKREERIRLLRLSRTPLAAISLQEIGKAHFRE
FT                   W"
FT   CDS_pept        complement(861951..862442)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4S9"
FT                   /protein_id="CBY81059.1"
FT                   /translation="MIGTKIYLALYKGKKSGKKPKDLLARFSDWLTRKFTKGIYSHCEL
FT                   IVRKEEFLTGHHYEVEVIYDCYSSSIRDGGVRCKQIDVYDREKWDLIELEGVTEAQIKA
FT                   YFDRTLGCKYDWWSALGIVLGIKQKRSKYFCSEWCFNAICGGENGWRFSPNQLAVIFQK
FT                   "
FT   CDS_pept        complement(862439..863041)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09143"
FT                   /product="phage tail collar-like protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A3P3"
FT                   /protein_id="CBY81060.1"
FT                   /translation="MKVYFLKENLNSYQIFPIPQNLNDFVEMEAENESELETKQLIDFK
FT                   SQYILVDRQPTELHKWNGNSWVVDKKKKTEIKRELIKNLVDSIDDTAANISARWTRFAE
FT                   EYKEREAAAIAFKEANFAGEVSVYISSFATVAGLDNQSASLLILQQAESLRTLQQQLAV
FT                   QRMRKYELKHEALSDEELQRIHDDIIGKMQALAEAQQ"
FT   CDS_pept        complement(863053..865296)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09180"
FT                   /product="probable tail fiber protein"
FT                   /db_xref="GOA:E7A4T1"
FT                   /db_xref="InterPro:IPR003610"
FT                   /db_xref="InterPro:IPR005068"
FT                   /db_xref="InterPro:IPR011083"
FT                   /db_xref="InterPro:IPR036573"
FT                   /db_xref="InterPro:IPR037053"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T1"
FT                   /protein_id="CBY81061.1"
FT                   /translation="MALVNKPDESIFASSAKQGEVDNFPDLLRGWGITLDQTQGIPPME
FT                   WFNFLFKRLDEKHTYLMQRGLPEWSATQDYTKGSCVQFNGISYRALKNSKNNSPNESDS
FT                   QYWVRWGFALSEIARATLQQYGIVQLSSATNSDSETEAATSKAVKTAYDKAVEAKTTAD
FT                   GKVGLNGNESINGEKTFENRIVAKRNIRISDSPHYASRGDYLNIGANDGDCWFEYKSSN
FT                   REIGTLRMHANGDLTYKRQKIYHAGAKPQFNTDIEGKPNTLAGYGIGNFKVEEFRGNLN
FT                   TLKTDGIYAITQASRSQNLPVSTSCHIQVIAGGDGAWCRQLAYVAYSTDMYERHQTSYQ
FT                   TDSWSAWKKLNTDGIPTGAVVSFPRAVTNPVGFLKANGATFNQQTFPDLYRTLGNSNQL
FT                   PDLTRSDVGMTAYFAVDNIPTGWIAFDSIRTTVTQQNYPELYRYLVGKYGSISNVPLAE
FT                   DRFIRNASNNLSVGETQSDEIKKHVHKVRTHWVNSSDSNIFYDKTKTVIDSRLRTSTTT
FT                   DDNLSDNGFMHPLLDSPMATGGAETRPRAIALKLCIKAKNTFDDVQFWVKAFGVVENAG
FT                   ALDAGTLAQNMQALSESVEQKIEENKQSTLLEITNAKADINQQFLQAQENLSQIGTLKT
FT                   VWQGNVGSGQITISEKCFGKTLILYLQSSESHSLDDNNNIEIVSFEVGAEIEGKKGGRV
FT                   RWLDVREVNAHSNGGRATYYVEVKRFDVTVDRNGTTIQIQDLAGRFVKRIDIR"
FT   CDS_pept        complement(865306..865881)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09190"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR021283"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T2"
FT                   /protein_id="CBY81062.1"
FT                   /translation="MGYSDLLIWQYRNKPKAVSTIKLFESIIGQGFIDLYRLQDVLNIE
FT                   TATGHQLDLVGKHVGQFRVINGYQLRKFFGFRNSPNALGFSQKRLGGAQWYRKRDPLSD
FT                   SVRLSDDDYRFLIKCRILKNYQIGTLPNLIEACLFIFGEDCHIVDNYDMTVSISVPSAS
FT                   TSDFKRFAINHLDILPRQAGVQYLFNLI"
FT   CDS_pept        complement(865881..867023)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09200"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T3"
FT                   /protein_id="CBY81063.1"
FT                   /translation="MAKLIETGIQIERLNEIVARFEDGFRQIYGQNIDLSPNSPDGQMV
FT                   GLLAQMKMDIEELAENVYRQLDPDVATGAWLDQRVAYAGLRRRAASYSYLRSVILTGEP
FT                   LTHLYAGIVVSDPHKVRWVLTADVQLDSNGSARADFRSEELGAFNLIKNTNLTIETVTL
FT                   GLNSATTFENAEIGEEEETDLQLRERFFISRTKNAQNSADAIQSKIAALPDVRQVKVLE
FT                   NNTKQRDKYGVEPNSLNIIVDGGADEQIAHVIYENKGAGVGLQGATETTLTVNGERRAL
FT                   RFDRATPVDVQVSMRCVRYEDFTEVDKDEIKRLLSIQHFEIGQNLSLSRLYSPINEVGG
FT                   FWVKELKIGRKGRSLTTENITAQPRELIRILATDITIEVE"
FT   CDS_pept        complement(867066..867584)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09220"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR018875"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T4"
FT                   /protein_id="CBY81064.1"
FT                   /translation="MQTLTAEFLGKEVTLVDNNGVAYVAMREIVEGIGLDWKGQHKKLM
FT                   EQSEKFNCGHITTVAKDGKNREMLCIPIKKLNGWLFGLNPNKVRADLKERLENYQEECF
FT                   LALWDYWTEGIARRDEVKNKLALWQQKKAEYTQRATERGKLLQQCKSEKQALERELLQI
FT                   KQLDLFVNL"
FT   CDS_pept        complement(867769..868122)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09230"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T5"
FT                   /protein_id="CBY81065.1"
FT                   /translation="MSVRRLNKEHDWTFGQGFSNYASESDAIVQNVQTRLWSFANDWFL
FT                   DLEHGLPWLEQMGRGVNMAGWEIKIKRYVLETEGVSRITDYQANFDTDTRKLTISIDYQ
FT                   DIYGQQQTARYDA"
FT   CDS_pept        complement(868119..868763)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09240"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="InterPro:IPR041599"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T6"
FT                   /protein_id="CBY81066.1"
FT                   /translation="MNYAQILATPETATDHQIQQNQLNLHTALPAKVVSFDPAKQTVSL
FT                   AIQIKMQLVDGSGADIPPLLDVPVSFPRGGGFAVTFPLKAGDEGIAIFSERCIDGWWQN
FT                   GSVSTPLDFRLHDLSDAMFIPGICSVPKAIGGFFTDGLSMQTLDGSTYIRIKNGSILIK
FT                   GNIEHQGDTSQTGSHSSTGVISSDTDVTAGGISGKTHKHTGDSGGKTGVPE"
FT   CDS_pept        complement(868760..869632)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09250"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T7"
FT                   /protein_id="CBY81067.1"
FT                   /translation="MKQFGRRWKLDISNDQETLSIEQLRVAFEIDKTINEKPNPAKIQV
FT                   WNLNRDHINQLLSQDYKKVALSVGYGELRQIYAGDITKTRIQREGLDFVLTLECSDGHQ
FT                   AYTQSRAKTTLKAGATDKQIVEELQKTMPKVQSGAIDIPNQRKLPRGRVLNGNSRDILN
FT                   KIARNNKADWSIQDGALIFLPKDKVLNDDAVLISQDTGMINAPEQTDEGLELTCLLNPA
FT                   LQIGGLVKVESIIEYFNGEYKIVKLAHSGDGIGGDWHSKMTVVGGKFQKVEKEKGSQTS
FT                   NKQSKDKNK"
FT   CDS_pept        complement(869909..870217)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09260"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T8"
FT                   /protein_id="CBY81068.1"
FT                   /translation="MLKIPLTQHPYQEQTFEFNGIKIRLTLRFNSIGQFWAMDVFESVN
FT                   QKQICRGHAIACGVPLLARTTQPYFFYLDDESGAELDPMSMEDLGTRCFLYIGEKAS"
FT   CDS_pept        complement(870223..870999)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09270"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4T9"
FT                   /protein_id="CBY81069.1"
FT                   /translation="MLNFAQVSNRKIGKITFDVVTTEDHQSDLFITENPIESGAAIADH
FT                   AVIQPKQVTINGVMVDHDHSTFGLDLPFIGNIRGGIDFLNNFPLPVKVITQTSQSIARA
FT                   GRVISQVSGAYSQAKRTLNQARIIAPFLPDFGLGGLLDSSAGDSRVQKCYADLVACQKS
FT                   GETIDIQTGINLYKNMLIQSVAVNQSQDGSATFTITAREIFIVETQTAQSKSSASGKRK
FT                   SGRSSIQSATKSQQGSTQPKNDTPKRTSSLFNLFKW"
FT   CDS_pept        complement(871005..873095)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09280"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A4U0"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U0"
FT                   /protein_id="CBY81070.1"
FT                   /translation="MLLDELLIKIGIDADSQAMQQFEQFLNVIGDGTESAAENLGTFAE
FT                   VLERAVDDATEQIKAAPEFESFFDSLEKLQAETENLSEDDALDEWVQKLIEGDKLLSEF
FT                   GESFLQNTEQLSKELQEAGLSAEQVEKVIGKLKSAIEQKTDATEKDTKAVEDNAKSTEN
FT                   LSDNIIDLWATQYGAVGLLNKFELLGISINKTTLKVAAFGAAFYAATIGVKNFVDANLD
FT                   ALDEIKQLSAVTGESADQIYNLGKVAEVNGSSAQAAQSSIEGLSRVIGEAAAGIGRGAK
FT                   SFEQYGLSAKKANGEVKTSSEMLGEISDKMKAMGEQEQIAMLAKLGIDSSMIQTLRLGN
FT                   DELKEQIALASVLTLGVGNAENAKTAASFKDALTQVSQAFRAIGEYVSLRVAPSIQRLA
FT                   ERFTKWFTENNDFIKATLNGFGKILSFLFELAAAIDNVVEHTIGWKNLIYALGAALLWF
FT                   SRRMLLAFATNPVTLIIAAIAGLFLLVDDFITYLESGETALGEFWKPFKTALLWVKSTW
FT                   KNFVDNFSVDPIGETLSLITDMLELPFKLGLALVVGLWNLFTGEQLDLDVIETKFAQVT
FT                   DWIKKPFQSAFDWVKGYYDQYIAPIVDTVKGWFIDSGEKVGTASQNTKAYDTMMYDPSY
FT                   TSAPQVAAVGAKSQTSNADNRVTNSNNKITITQHIQGTDNPKAVADQSVRVINHQLSSV
FT                   VG"
FT   CDS_pept        complement(873246..873656)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09290"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR020351"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U1"
FT                   /protein_id="CBY81071.1"
FT                   /translation="MESKQINIENVTYTMTPANAMTAWTALKNAMKLLQSVDLSSLGNN
FT                   KKLGASVLTTVLANLGDTSIKELEDIVLKHTSCEQDGKLYRLSERFDSHFNQHRGHLIP
FT                   VLKEGLMYQFADFFIGGGGLLSNIQPNLKATK"
FT   CDS_pept        complement(<873791..874087)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09300"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR021695"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U2"
FT                   /protein_id="CBY81072.1"
FT                   /translation="MAVFDPKQVVVLLDGKEMSDWADGSDVINATNQVDAGQMVIGANG
FT                   TGVFIANPDQSGKLTLKIKQHSEDNAYLSKLFNQQKTSIKTYLPMTLAIRDLIN"
FT   CDS_pept        complement(874332..875840)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09310"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR021808"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U3"
FT                   /protein_id="CBY81073.1"
FT                   /translation="MALSISQIVNVQLNTMPKSAARKSFGIVALFTPEAGQAFADATTR
FT                   YVYVENQRDVEQLFGTNSETAKAAQPFFAQSPRAKQLIIARWQKEPATIDATKNTLSGA
FT                   TLSDDLERFKAVVNGRFTLTIGAETKKVNGLSFADASDFNAIATKIQAKLTALSSSLSI
FT                   SYDSVGQRFIITSNTSGEDKATEIHYAFNGGGDGEYIGSLLKLENGQASRKVGKASISL
FT                   KKETVAEALFNVAEVNNAWYGFTFAAQLTDGEVESAAKYAQANTKMFGANVIRVEQLEW
FT                   SANNIYKKLYDAGLDHTLAMFDKNDMYPASSALARLLSTNFAANNSTLTLKFKQQPTIT
FT                   ADEITATEFSKAKRLGINVYTYFDDVAMIAEGTVMGGKFADEIVILDWFTDAVQKEVFA
FT                   RLYKSPTKIPLTDKGQAVLIAAVEKVCLEGVNNGAFAPGQWTGDSFGNLTTGDYLEKGY
FT                   YVWAAPMDTLSDSDREQRRATPIQTAVKLAGAIHSSDVIVNYNR"
FT   CDS_pept        complement(875845..876207)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09320"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U4"
FT                   /protein_id="CBY81074.1"
FT                   /translation="MMSNEIGQATREFDGKRERIIQSMQSTVSLSCFGRNSLAQCYKLK
FT                   AIFQSSAFLSFLKSNHWGVIRFSDVRNLTATVGADYEERGQFDVVFSHHHIVDTPLDPI
FT                   ANVEQRTNHLIQQIGG"
FT   CDS_pept        complement(876272..876643)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09330"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U5"
FT                   /protein_id="CBY81075.1"
FT                   /translation="MSLINQYPRFLNSKFSQAVTVKHLQGKHSSDGFGASYTDENVTAI
FT                   VMPTSPNDVLLLPEGERFIPSIKIYTIKPLKIGDLVIYEGETYKIKTVANWGKYGYHNN
FT                   IGVRHSQTAKVDSTGFTVT"
FT   CDS_pept        complement(876640..877086)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09340"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U6"
FT                   /protein_id="CBY81076.1"
FT                   /translation="MAVQITGNLAQAKALIERLRADKDKAVYIGFPAEFDKPVEGAENF
FT                   NLASLAAVLEFGNERIPSRPFLRQTLSENQEKYTALFTQLFKQGLQIERIYEQLALVAQ
FT                   GDVQLNIARGNWVANAKSTIKQKGSSKPLIDTGKMRQSVKGIVK"
FT   CDS_pept        complement(877087..877449)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09350"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR025127"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U7"
FT                   /protein_id="CBY81077.1"
FT                   /translation="MPTFETYVFIERYPEFKEVDYEKIDLFLSDAEMEVSQSRWGKLYQ
FT                   RGVLTLTAHLLRLSLWTTEGGGGANRNLASESAGELSVSYAVPTLTGTDADYQLTAYGQ
FT                   EYLRLRKLVGIGVMVA"
FT   CDS_pept        complement(877459..878373)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09360"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR020049"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U8"
FT                   /protein_id="CBY81078.1"
FT                   /translation="MSLLTYVQNGLTAVSKEISETKYPEIVFPQFVYVDQQAAVGITEK
FT                   LHYGADEHGSLDDGLISTGTSTLDQVEVGFTPTRSYIVQWAKSVTWATPELEQGKLLGL
FT                   ALDTAKIMVLNQNAQQTLQKVAFLGHAKDTRLTGLLNNPSVEVYNIKGTSANTKVQAMD
FT                   FDKSVAFFKEMFLAGMEKTKRIEAPNTFAIDLLDLAHLALTQRNNTDTTALEFLTKSLS
FT                   AAAGRDVAIKALPSNFGNRVTSGKTRAMVYVNSKEHVIFDVPMSPTVLAAQPKGLLAYE
FT                   SGLRMAFGGVTFMEPDSALYVDY"
FT   CDS_pept        complement(878383..878823)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09370"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4U9"
FT                   /protein_id="CBY81079.1"
FT                   /translation="MSYAYEQAPARAGELGKGNLASAKTTAEKVTGKVKAGEFVALNPT
FT                   GGVKALSAKKDILAGVVLASRIRDEWPEGELVDVMHIGAGDAIWVNIASEKTVSRGSKV
FT                   FVLTTGGEGKAGAIQGETDANAIETGYTVIDVKGQLAMITKL"
FT   CDS_pept        complement(<878980..879936)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09380"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR016913"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V0"
FT                   /protein_id="CBY81080.1"
FT                   /translation="MKFTDKTTQAVTQRTITKDGFLVVPATISKVGVFDYLATELGLKE
FT                   DGIKKVARTEKSLFSDETIKSFENATLTVGHPKDGVNAKNWKQLSVGVVRNVKRVGDEL
FT                   TAEAWIYDEQAIKTVQEHGVEQLSCGYDCDIKPSTVQDADFEMSPMIGNHVAIVAKGRC
FT                   GGSVKLADEDKTIMGKTAKILDAFLGAFGIKLSDEQKKQIEDEEKSGSEEGKEPKGEQP
FT                   TEPKEKQSKPEDKKDEEVNKEEFEKQLKAKDAEIQQLKDAQAKRDAEVKQAAVLADAKT
FT                   AFKEVNFADNATVREIQESAVVAQGIFTKDEAAKLSDE"
FT   CDS_pept        complement(879998..880354)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09390"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="InterPro:IPR019650"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V1"
FT                   /protein_id="CBY81081.1"
FT                   /translation="MKRNWDLIRSILLKLESQSEARGSLLPDGFTGFDSETVSYHFKLL
FT                   QSAELIEAIDYSSLNEMSLIARSLTWQGHELLDKIRNDTVWNSLKTTIKSKSLDLSLDT
FT                   IKQVAQTIISQMLA"
FT   CDS_pept        complement(880633..882066)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09400"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="GOA:E7A4V2"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006528"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V2"
FT                   /protein_id="CBY81082.1"
FT                   /translation="MTDDVERALQQPQGSFFMDDAKGFQAISAKALMKVLEKYEKSDRT
FT                   SQAENIANGFVGRGDAQNHAEVSTNLKNQTGIDLSAYLRNSPNIAERVNALTAGNIQLI
FT                   KSIRSQYLDKVQNAVMQAMVRGSLNKDLTAQIKDLGKTTEKRAMFIARDQSSKLNAALT
FT                   QARHEEVGIKKYMWSASLDERVRESHAEKDGQIFEYSNPPADTGHPGHDFNCRCVQIPV
FT                   LDNNEQIVKNSPIVSQQEKQQMRSEWSDDFPDTIIDRKLGDATSHPLYENAKKGSIEDA
FT                   YQLAKDLVTDDAVNKLKQLVGNKNAILIPVHAEEAVGQNMIPVAIATVLSKKLHIPVDL
FT                   SIVQATKVSRTGGDGWHRLVYSPAFDGIVPKDKYAIILDDTQTQGGTLASLKGYIEENK
FT                   GKVIASYALTGKQYSVQLRLSKDTLAELRSKYGELESWWKKEFGYDFSRFTEWEARFII
FT                   NSRKTPDEVRNTILARKQA"
FT   CDS_pept        complement(882095..883426)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR006445"
FT                   /db_xref="InterPro:IPR024459"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V3"
FT                   /protein_id="CBY81083.1"
FT                   /translation="MNILDGIKSLALKLGSKQDQTYYARGLSLTDDLMQIEALWRDNWI
FT                   ANKVCIKRSEDMVRNWRDIFSNDLKSEQLDEFTKLERRLKLRETLTKALQWSSLYGAVG
FT                   LLVVTDTINITSPLQPTERLKRLIILPKWKISPTGQRDDDVFSPNFGRYSEYTIIGGTQ
FT                   SVLVHHSRLLIINANDAPLSDNDVWGVSDLEKIIDVLKRFDSASANVGDLIFESKIDIF
FT                   KIAGLSDKISAGLENDVAHVISAVQSIKSATNSLLLDAENEYDRKELSFGGLKDLLTEF
FT                   RNAVAGAADMPVTILFGQSVSGLASGDEDIQNYHESIHRLQETRLRPVLEVLDTLLCNE
FT                   LFGGQPDDWWFEFLPLTVVKQEQQVNMLNTFATAANTLIQNGVVNEYQVANELRESGLF
FT                   ANISADDIEEMKNADELARNFEEPEGESTQVQASEDEQENGALV"
FT   CDS_pept        complement(883428..884771)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09420"
FT                   /product="predicted phage terminase large subunit"
FT                   /db_xref="GOA:E7A4V4"
FT                   /db_xref="InterPro:IPR006437"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035412"
FT                   /db_xref="InterPro:IPR035413"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V4"
FT                   /protein_id="CBY81084.1"
FT                   /translation="MSQLNIQFPTKFRPLFESIWRFIIFYGGRGSGKSFSIARALVLRA
FT                   YQSPVRVLCCREIQKSISDSVIQMLADQIEMLGLQAFFDVQKTQIIGQNGSRFTFAGLK
FT                   TNITSIKSMTGIDVVWVEEGENVSKESWDILIPTIREDGSQIIVSFNPKNILDDTYQRF
FT                   VIHPPERCKSVLVNWQDNPYFPKELMEDMEQMRERDYELYRHVYEGEPVADSDLAIIKP
FT                   VWIESAVDAHLKLGFTTKGMKKVGFDVADEGADANANAFVHGSVVLGVEVWKNGDVIDS
FT                   ANRTNQSAVKFKADLIIFDSIGVGAGVKAHFKRLPKSLQVEGFNAGGAVAYPEREYIKD
FT                   KKNQDMFSNIKAQSWWALRDRFYKTYRAVKYGDVYPDDELISLSSKIKELEYLKAELSR
FT                   PRVDYDNNGRVKVESKKDMKKRGIPSPNMADALVMCYAPTKPKSLLDL"
FT   CDS_pept        complement(884758..885273)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09430"
FT                   /product="Terminase small subunit"
FT                   /db_xref="GOA:E7A4V5"
FT                   /db_xref="InterPro:IPR005335"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V5"
FT                   /protein_id="CBY81085.1"
FT                   /translation="MSDVKGKSTSGRGLTPKQEKFCQLYIELGNASEAYRQSYDCSKMT
FT                   TEVINVKASELLNKNGKITVRVEELRQAHQQRHNLTLDNIIADLQEYRDICMGRKPLTI
FT                   TTVVKNAQEGTAQSVNTECFVFEPTGANKALELLGKHLGMFTNKVDVTTDGKPLPTVIN
FT                   VTFSDEPA"
FT   CDS_pept        885571..885918
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09440"
FT                   /product="Transcriptional regulator"
FT                   /db_xref="GOA:E7A4V6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V6"
FT                   /protein_id="CBY81086.1"
FT                   /translation="MNALTNIQYINNEQGVPAFAVMPIATLNWLKEKANFSDPIETGIP
FT                   ESVAKLALLNDYSALRAWREHLGLTQAEVASRLGISQAAYSQHENSQTLRKSTRIKIAT
FT                   ALGINSAQLDF"
FT   CDS_pept        complement(885920..886201)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09470"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V7"
FT                   /protein_id="CBY81087.1"
FT                   /translation="MLNQLKQSLRLNLVLTLVCLSLFLTACTNKITTKPEYIYPLQAYT
FT                   APCVKTAFTGETYGDVVIQLVKVTAERDKCASQVDHLNKWINQAKGGK"
FT   CDS_pept        complement(886429..887031)
FT                   /transl_table=11
FT                   /locus_tag="HIBPF_09510"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="GOA:E7A4V8"
FT                   /db_xref="InterPro:IPR000726"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:E7A4V8"
FT                   /protein_id="CBY81088.1"
FT                   /translation="MTMMISEETFNKIFPHAVKGVYQAISTQIEKAGCVNKMQQAMFLA
FT                   QCGHESGGFTRFKENLNYSWLGLSKTFRKYFPDPLIAKKYERKPELIANRVYANRLGNG
FT                   DEKSGDGWKYRGRGLIQITGKDNYAAFRKWLGRDIEPEDVAGNLDLSVKTAVWYWKCYE
FT                   LAELNSVEKVTRRINGGLNGIDERCKLYRALMVTDND"
FT   CDS_pept        complement(887000..887356)
FT                   /transl_t