(data stored in ACNUC7421 zone)

EMBL: FQ670204

ID   FQ670204; SV 1; circular; genomic DNA; STD; PRO; 2007018 BP.
XX
AC   FQ670204;
XX
PR   Project:PRJEA61001;
XX
DT   10-JAN-2011 (Rel. 107, Created)
DT   27-FEB-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Haemophilus influenzae F3047 complete genome
XX
KW   complete genome.
XX
OS   Haemophilus influenzae F3047
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Pasteurellales;
OC   Pasteurellaceae; Haemophilus.
XX
RN   [1]
RX   DOI; 10.3201/eid1803.110728.
RX   PUBMED; 22377449.
RA   Strouts F.R., Power P., Croucher N.J., Corton N., van Tonder A.,
RA   Quail M.A., Langford P.R., Hudson M.J., Parkhill J., Kroll J.S.,
RA   Bentley S.D.;
RT   "Lineage-specific Virulence Determinants of Haemophilus influenzae Biogroup
RT   aegyptius";
RL   Emerg. Infect. Dis. 18(3):449-457(2012).
XX
RN   [2]
RA   Aslett M.;
RT   ;
RL   Submitted (04-JAN-2011) to the INSDC.
RL   Sanger Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10
RL   1SA, United Kingdom.
XX
DR   MD5; f4ef86c608dd2fad86761947f49733a0.
DR   BioSample; SAMEA2272570.
DR   EnsemblGenomes-Gn; EBG00000038959.
DR   EnsemblGenomes-Gn; EBG00000038960.
DR   EnsemblGenomes-Gn; EBG00000038961.
DR   EnsemblGenomes-Gn; EBG00000038962.
DR   EnsemblGenomes-Gn; EBG00000038963.
DR   EnsemblGenomes-Gn; EBG00000038964.
DR   EnsemblGenomes-Gn; EBG00000038965.
DR   EnsemblGenomes-Gn; EBG00000038966.
DR   EnsemblGenomes-Gn; EBG00000038967.
DR   EnsemblGenomes-Gn; EBG00000038968.
DR   EnsemblGenomes-Gn; EBG00000038969.
DR   EnsemblGenomes-Gn; EBG00000038970.
DR   EnsemblGenomes-Gn; EBG00000038971.
DR   EnsemblGenomes-Gn; EBG00000038972.
DR   EnsemblGenomes-Gn; EBG00000038973.
DR   EnsemblGenomes-Gn; EBG00000038974.
DR   EnsemblGenomes-Gn; EBG00000038975.
DR   EnsemblGenomes-Gn; EBG00000038976.
DR   EnsemblGenomes-Gn; EBG00000038977.
DR   EnsemblGenomes-Gn; EBG00000038978.
DR   EnsemblGenomes-Gn; EBG00000038979.
DR   EnsemblGenomes-Gn; EBG00000038980.
DR   EnsemblGenomes-Gn; EBG00000038981.
DR   EnsemblGenomes-Gn; EBG00000038982.
DR   EnsemblGenomes-Gn; EBG00000038983.
DR   EnsemblGenomes-Gn; EBG00000038984.
DR   EnsemblGenomes-Gn; EBG00000038985.
DR   EnsemblGenomes-Gn; EBG00000038986.
DR   EnsemblGenomes-Gn; EBG00000038987.
DR   EnsemblGenomes-Gn; EBG00000038988.
DR   EnsemblGenomes-Gn; EBG00000038989.
DR   EnsemblGenomes-Gn; EBG00000038990.
DR   EnsemblGenomes-Gn; EBG00000038991.
DR   EnsemblGenomes-Gn; EBG00000038992.
DR   EnsemblGenomes-Gn; EBG00000038993.
DR   EnsemblGenomes-Gn; EBG00000038994.
DR   EnsemblGenomes-Gn; EBG00000038995.
DR   EnsemblGenomes-Gn; EBG00000038996.
DR   EnsemblGenomes-Gn; EBG00000038997.
DR   EnsemblGenomes-Gn; EBG00000038998.
DR   EnsemblGenomes-Gn; EBG00000038999.
DR   EnsemblGenomes-Gn; EBG00000039000.
DR   EnsemblGenomes-Gn; EBG00000039001.
DR   EnsemblGenomes-Gn; EBG00000039002.
DR   EnsemblGenomes-Gn; EBG00000039003.
DR   EnsemblGenomes-Gn; EBG00000039004.
DR   EnsemblGenomes-Gn; EBG00000039005.
DR   EnsemblGenomes-Gn; EBG00000039006.
DR   EnsemblGenomes-Gn; EBG00000039007.
DR   EnsemblGenomes-Gn; EBG00000039008.
DR   EnsemblGenomes-Gn; EBG00000039009.
DR   EnsemblGenomes-Gn; EBG00000039010.
DR   EnsemblGenomes-Gn; EBG00000039011.
DR   EnsemblGenomes-Gn; EBG00000039012.
DR   EnsemblGenomes-Gn; EBG00000039013.
DR   EnsemblGenomes-Gn; EBG00000039014.
DR   EnsemblGenomes-Gn; EBG00000039015.
DR   EnsemblGenomes-Gn; EBG00001217156.
DR   EnsemblGenomes-Gn; EBG00001217157.
DR   EnsemblGenomes-Gn; EBG00001217158.
DR   EnsemblGenomes-Gn; EBG00001217159.
DR   EnsemblGenomes-Gn; EBG00001217160.
DR   EnsemblGenomes-Gn; EBG00001217161.
DR   EnsemblGenomes-Gn; EBG00001217162.
DR   EnsemblGenomes-Gn; EBG00001217163.
DR   EnsemblGenomes-Gn; EBG00001217164.
DR   EnsemblGenomes-Gn; EBG00001217165.
DR   EnsemblGenomes-Gn; EBG00001217166.
DR   EnsemblGenomes-Gn; EBG00001217167.
DR   EnsemblGenomes-Gn; EBG00001217168.
DR   EnsemblGenomes-Gn; EBG00001217169.
DR   EnsemblGenomes-Gn; EBG00001217170.
DR   EnsemblGenomes-Gn; EBG00001217171.
DR   EnsemblGenomes-Gn; EBG00001217172.
DR   EnsemblGenomes-Gn; EBG00001217173.
DR   EnsemblGenomes-Gn; EBG00001217174.
DR   EnsemblGenomes-Gn; EBG00001217175.
DR   EnsemblGenomes-Gn; EBG00001217176.
DR   EnsemblGenomes-Gn; EBG00001217177.
DR   EnsemblGenomes-Gn; EBG00001217178.
DR   EnsemblGenomes-Gn; EBG00001217179.
DR   EnsemblGenomes-Gn; EBG00001217180.
DR   EnsemblGenomes-Gn; EBG00001217181.
DR   EnsemblGenomes-Gn; EBG00001217182.
DR   EnsemblGenomes-Gn; EBG00001217183.
DR   EnsemblGenomes-Gn; EBG00001217184.
DR   EnsemblGenomes-Gn; EBG00001217185.
DR   EnsemblGenomes-Gn; EBG00001217186.
DR   EnsemblGenomes-Gn; EBG00001217187.
DR   EnsemblGenomes-Gn; EBG00001217188.
DR   EnsemblGenomes-Gn; EBG00001217189.
DR   EnsemblGenomes-Gn; EBG00001217190.
DR   EnsemblGenomes-Gn; EBG00001217191.
DR   EnsemblGenomes-Gn; EBG00001217192.
DR   EnsemblGenomes-Gn; EBG00001217193.
DR   EnsemblGenomes-Gn; EBG00001217194.
DR   EnsemblGenomes-Gn; EBG00001217195.
DR   EnsemblGenomes-Gn; EBG00001217196.
DR   EnsemblGenomes-Gn; EBG00001217197.
DR   EnsemblGenomes-Gn; EBG00001217198.
DR   EnsemblGenomes-Gn; EBG00001217199.
DR   EnsemblGenomes-Gn; EBG00001217201.
DR   EnsemblGenomes-Gn; EBG00001217202.
DR   EnsemblGenomes-Gn; EBG00001217203.
DR   EnsemblGenomes-Gn; EBG00001217204.
DR   EnsemblGenomes-Gn; EBG00001217205.
DR   EnsemblGenomes-Gn; EBG00001217206.
DR   EnsemblGenomes-Gn; EBG00001217207.
DR   EnsemblGenomes-Gn; EBG00001217208.
DR   EnsemblGenomes-Gn; EBG00001217209.
DR   EnsemblGenomes-Gn; EBG00001217210.
DR   EnsemblGenomes-Gn; EBG00001217211.
DR   EnsemblGenomes-Gn; EBG00001217212.
DR   EnsemblGenomes-Gn; EBG00001217213.
DR   EnsemblGenomes-Gn; EBG00001217214.
DR   EnsemblGenomes-Gn; EBG00001217215.
DR   EnsemblGenomes-Gn; EBG00001217216.
DR   EnsemblGenomes-Gn; EBG00001217217.
DR   EnsemblGenomes-Gn; EBG00001217218.
DR   EnsemblGenomes-Gn; EBG00001217219.
DR   EnsemblGenomes-Gn; EBG00001217220.
DR   EnsemblGenomes-Gn; EBG00001217221.
DR   EnsemblGenomes-Gn; EBG00001217222.
DR   EnsemblGenomes-Gn; EBG00001217223.
DR   EnsemblGenomes-Gn; EBG00001217224.
DR   EnsemblGenomes-Gn; EBG00001217225.
DR   EnsemblGenomes-Gn; EBG00001217226.
DR   EnsemblGenomes-Gn; EBG00001217227.
DR   EnsemblGenomes-Gn; EBG00001217228.
DR   EnsemblGenomes-Gn; EBG00001217229.
DR   EnsemblGenomes-Gn; EBG00001217230.
DR   EnsemblGenomes-Gn; EBG00001217231.
DR   EnsemblGenomes-Gn; EBG00001217232.
DR   EnsemblGenomes-Gn; EBG00001217233.
DR   EnsemblGenomes-Gn; EBG00001217234.
DR   EnsemblGenomes-Gn; EBG00001217235.
DR   EnsemblGenomes-Gn; EBG00001217236.
DR   EnsemblGenomes-Gn; EBG00001217237.
DR   EnsemblGenomes-Gn; EBG00001217238.
DR   EnsemblGenomes-Gn; EBG00001217239.
DR   EnsemblGenomes-Gn; EBG00001217240.
DR   EnsemblGenomes-Gn; EBG00001217241.
DR   EnsemblGenomes-Gn; EBG00001217242.
DR   EnsemblGenomes-Gn; EBG00001217243.
DR   EnsemblGenomes-Gn; EBG00001217244.
DR   EnsemblGenomes-Gn; EBG00001217245.
DR   EnsemblGenomes-Gn; EBG00001217246.
DR   EnsemblGenomes-Gn; EBG00001217247.
DR   EnsemblGenomes-Gn; EBG00001217248.
DR   EnsemblGenomes-Gn; EBG00001217249.
DR   EnsemblGenomes-Gn; EBG00001217250.
DR   EnsemblGenomes-Gn; EBG00001217251.
DR   EnsemblGenomes-Gn; EBG00001217252.
DR   EnsemblGenomes-Gn; EBG00001217253.
DR   EnsemblGenomes-Gn; EBG00001217254.
DR   EnsemblGenomes-Gn; EBG00001217255.
DR   EnsemblGenomes-Gn; EBG00001217256.
DR   EnsemblGenomes-Gn; EBG00001217257.
DR   EnsemblGenomes-Gn; EBG00001217258.
DR   EnsemblGenomes-Gn; EBG00001217259.
DR   EnsemblGenomes-Gn; EBG00001217260.
DR   EnsemblGenomes-Gn; EBG00001217261.
DR   EnsemblGenomes-Gn; HICON_00030.
DR   EnsemblGenomes-Gn; HICON_01920.
DR   EnsemblGenomes-Gn; HICON_02280.
DR   EnsemblGenomes-Gn; HICON_02340.
DR   EnsemblGenomes-Gn; HICON_02360.
DR   EnsemblGenomes-Gn; HICON_02530.
DR   EnsemblGenomes-Gn; HICON_02890.
DR   EnsemblGenomes-Gn; HICON_03520.
DR   EnsemblGenomes-Gn; HICON_04240.
DR   EnsemblGenomes-Gn; HICON_05360.
DR   EnsemblGenomes-Gn; HICON_05830.
DR   EnsemblGenomes-Gn; HICON_05910.
DR   EnsemblGenomes-Gn; HICON_05980.
DR   EnsemblGenomes-Gn; HICON_06350.
DR   EnsemblGenomes-Gn; HICON_07460.
DR   EnsemblGenomes-Gn; HICON_07640.
DR   EnsemblGenomes-Gn; HICON_09230.
DR   EnsemblGenomes-Gn; HICON_09250.
DR   EnsemblGenomes-Gn; HICON_12250.
DR   EnsemblGenomes-Gn; HICON_13590.
DR   EnsemblGenomes-Gn; HICON_13630.
DR   EnsemblGenomes-Gn; HICON_13720.
DR   EnsemblGenomes-Gn; HICON_15150.
DR   EnsemblGenomes-Gn; HICON_15380.
DR   EnsemblGenomes-Gn; HICON_15720.
DR   EnsemblGenomes-Gn; HICON_16060.
DR   EnsemblGenomes-Gn; HICON_16410.
DR   EnsemblGenomes-Gn; HICON_16520.
DR   EnsemblGenomes-Gn; HICON_16560.
DR   EnsemblGenomes-Gn; HICON_16820.
DR   EnsemblGenomes-Gn; HICON_17260.
DR   EnsemblGenomes-Gn; HICON_17550.
DR   EnsemblGenomes-Gn; HICON_17910.
DR   EnsemblGenomes-Gn; HICON_18060.
DR   EnsemblGenomes-Tr; EBG00000038959-1.
DR   EnsemblGenomes-Tr; EBG00000038960-1.
DR   EnsemblGenomes-Tr; EBG00000038961-1.
DR   EnsemblGenomes-Tr; EBG00000038962-1.
DR   EnsemblGenomes-Tr; EBG00000038963-1.
DR   EnsemblGenomes-Tr; EBG00000038964-1.
DR   EnsemblGenomes-Tr; EBG00000038965-1.
DR   EnsemblGenomes-Tr; EBG00000038966-1.
DR   EnsemblGenomes-Tr; EBG00000038967-1.
DR   EnsemblGenomes-Tr; EBG00000038968-1.
DR   EnsemblGenomes-Tr; EBG00000038969-1.
DR   EnsemblGenomes-Tr; EBG00000038970-1.
DR   EnsemblGenomes-Tr; EBG00000038971-1.
DR   EnsemblGenomes-Tr; EBG00000038972-1.
DR   EnsemblGenomes-Tr; EBG00000038973-1.
DR   EnsemblGenomes-Tr; EBG00000038974-1.
DR   EnsemblGenomes-Tr; EBG00000038975-1.
DR   EnsemblGenomes-Tr; EBG00000038976-1.
DR   EnsemblGenomes-Tr; EBG00000038977-1.
DR   EnsemblGenomes-Tr; EBG00000038978-1.
DR   EnsemblGenomes-Tr; EBG00000038979-1.
DR   EnsemblGenomes-Tr; EBG00000038980-1.
DR   EnsemblGenomes-Tr; EBG00000038981-1.
DR   EnsemblGenomes-Tr; EBG00000038982-1.
DR   EnsemblGenomes-Tr; EBG00000038983-1.
DR   EnsemblGenomes-Tr; EBG00000038984-1.
DR   EnsemblGenomes-Tr; EBG00000038985-1.
DR   EnsemblGenomes-Tr; EBG00000038986-1.
DR   EnsemblGenomes-Tr; EBG00000038987-1.
DR   EnsemblGenomes-Tr; EBG00000038988-1.
DR   EnsemblGenomes-Tr; EBG00000038989-1.
DR   EnsemblGenomes-Tr; EBG00000038990-1.
DR   EnsemblGenomes-Tr; EBG00000038991-1.
DR   EnsemblGenomes-Tr; EBG00000038992-1.
DR   EnsemblGenomes-Tr; EBG00000038993-1.
DR   EnsemblGenomes-Tr; EBG00000038994-1.
DR   EnsemblGenomes-Tr; EBG00000038995-1.
DR   EnsemblGenomes-Tr; EBG00000038996-1.
DR   EnsemblGenomes-Tr; EBG00000038997-1.
DR   EnsemblGenomes-Tr; EBG00000038998-1.
DR   EnsemblGenomes-Tr; EBG00000038999-1.
DR   EnsemblGenomes-Tr; EBG00000039000-1.
DR   EnsemblGenomes-Tr; EBG00000039001-1.
DR   EnsemblGenomes-Tr; EBG00000039002-1.
DR   EnsemblGenomes-Tr; EBG00000039003-1.
DR   EnsemblGenomes-Tr; EBG00000039004-1.
DR   EnsemblGenomes-Tr; EBG00000039005-1.
DR   EnsemblGenomes-Tr; EBG00000039006-1.
DR   EnsemblGenomes-Tr; EBG00000039007-1.
DR   EnsemblGenomes-Tr; EBG00000039008-1.
DR   EnsemblGenomes-Tr; EBG00000039009-1.
DR   EnsemblGenomes-Tr; EBG00000039010-1.
DR   EnsemblGenomes-Tr; EBG00000039011-1.
DR   EnsemblGenomes-Tr; EBG00000039012-1.
DR   EnsemblGenomes-Tr; EBG00000039013-1.
DR   EnsemblGenomes-Tr; EBG00000039014-1.
DR   EnsemblGenomes-Tr; EBG00000039015-1.
DR   EnsemblGenomes-Tr; EBT00001786167.
DR   EnsemblGenomes-Tr; EBT00001786168.
DR   EnsemblGenomes-Tr; EBT00001786169.
DR   EnsemblGenomes-Tr; EBT00001786170.
DR   EnsemblGenomes-Tr; EBT00001786171.
DR   EnsemblGenomes-Tr; EBT00001786172.
DR   EnsemblGenomes-Tr; EBT00001786173.
DR   EnsemblGenomes-Tr; EBT00001786174.
DR   EnsemblGenomes-Tr; EBT00001786175.
DR   EnsemblGenomes-Tr; EBT00001786176.
DR   EnsemblGenomes-Tr; EBT00001786177.
DR   EnsemblGenomes-Tr; EBT00001786178.
DR   EnsemblGenomes-Tr; EBT00001786179.
DR   EnsemblGenomes-Tr; EBT00001786180.
DR   EnsemblGenomes-Tr; EBT00001786181.
DR   EnsemblGenomes-Tr; EBT00001786182.
DR   EnsemblGenomes-Tr; EBT00001786183.
DR   EnsemblGenomes-Tr; EBT00001786184.
DR   EnsemblGenomes-Tr; EBT00001786185.
DR   EnsemblGenomes-Tr; EBT00001786186.
DR   EnsemblGenomes-Tr; EBT00001786187.
DR   EnsemblGenomes-Tr; EBT00001786188.
DR   EnsemblGenomes-Tr; EBT00001786189.
DR   EnsemblGenomes-Tr; EBT00001786190.
DR   EnsemblGenomes-Tr; EBT00001786191.
DR   EnsemblGenomes-Tr; EBT00001786192.
DR   EnsemblGenomes-Tr; EBT00001786193.
DR   EnsemblGenomes-Tr; EBT00001786194.
DR   EnsemblGenomes-Tr; EBT00001786195.
DR   EnsemblGenomes-Tr; EBT00001786196.
DR   EnsemblGenomes-Tr; EBT00001786197.
DR   EnsemblGenomes-Tr; EBT00001786198.
DR   EnsemblGenomes-Tr; EBT00001786199.
DR   EnsemblGenomes-Tr; EBT00001786200.
DR   EnsemblGenomes-Tr; EBT00001786201.
DR   EnsemblGenomes-Tr; EBT00001786202.
DR   EnsemblGenomes-Tr; EBT00001786203.
DR   EnsemblGenomes-Tr; EBT00001786204.
DR   EnsemblGenomes-Tr; EBT00001786205.
DR   EnsemblGenomes-Tr; EBT00001786206.
DR   EnsemblGenomes-Tr; EBT00001786207.
DR   EnsemblGenomes-Tr; EBT00001786208.
DR   EnsemblGenomes-Tr; EBT00001786209.
DR   EnsemblGenomes-Tr; EBT00001786210.
DR   EnsemblGenomes-Tr; EBT00001786211.
DR   EnsemblGenomes-Tr; EBT00001786212.
DR   EnsemblGenomes-Tr; EBT00001786213.
DR   EnsemblGenomes-Tr; EBT00001786214.
DR   EnsemblGenomes-Tr; EBT00001786215.
DR   EnsemblGenomes-Tr; EBT00001786216.
DR   EnsemblGenomes-Tr; EBT00001786217.
DR   EnsemblGenomes-Tr; EBT00001786218.
DR   EnsemblGenomes-Tr; EBT00001786219.
DR   EnsemblGenomes-Tr; EBT00001786220.
DR   EnsemblGenomes-Tr; EBT00001786221.
DR   EnsemblGenomes-Tr; EBT00001786222.
DR   EnsemblGenomes-Tr; EBT00001786223.
DR   EnsemblGenomes-Tr; EBT00001786224.
DR   EnsemblGenomes-Tr; EBT00001786225.
DR   EnsemblGenomes-Tr; EBT00001786226.
DR   EnsemblGenomes-Tr; EBT00001786227.
DR   EnsemblGenomes-Tr; EBT00001786228.
DR   EnsemblGenomes-Tr; EBT00001786229.
DR   EnsemblGenomes-Tr; EBT00001786230.
DR   EnsemblGenomes-Tr; EBT00001786231.
DR   EnsemblGenomes-Tr; EBT00001786232.
DR   EnsemblGenomes-Tr; EBT00001786233.
DR   EnsemblGenomes-Tr; EBT00001786234.
DR   EnsemblGenomes-Tr; EBT00001786235.
DR   EnsemblGenomes-Tr; EBT00001786236.
DR   EnsemblGenomes-Tr; EBT00001786237.
DR   EnsemblGenomes-Tr; EBT00001786238.
DR   EnsemblGenomes-Tr; EBT00001786239.
DR   EnsemblGenomes-Tr; EBT00001786240.
DR   EnsemblGenomes-Tr; EBT00001786241.
DR   EnsemblGenomes-Tr; EBT00001786243.
DR   EnsemblGenomes-Tr; EBT00001786244.
DR   EnsemblGenomes-Tr; EBT00001786245.
DR   EnsemblGenomes-Tr; EBT00001786246.
DR   EnsemblGenomes-Tr; EBT00001786247.
DR   EnsemblGenomes-Tr; EBT00001786248.
DR   EnsemblGenomes-Tr; EBT00001786249.
DR   EnsemblGenomes-Tr; EBT00001786250.
DR   EnsemblGenomes-Tr; EBT00001786251.
DR   EnsemblGenomes-Tr; EBT00001786252.
DR   EnsemblGenomes-Tr; EBT00001786253.
DR   EnsemblGenomes-Tr; EBT00001786254.
DR   EnsemblGenomes-Tr; EBT00001786255.
DR   EnsemblGenomes-Tr; EBT00001786256.
DR   EnsemblGenomes-Tr; EBT00001786257.
DR   EnsemblGenomes-Tr; EBT00001786258.
DR   EnsemblGenomes-Tr; EBT00001786259.
DR   EnsemblGenomes-Tr; EBT00001786260.
DR   EnsemblGenomes-Tr; EBT00001786261.
DR   EnsemblGenomes-Tr; EBT00001786262.
DR   EnsemblGenomes-Tr; EBT00001786263.
DR   EnsemblGenomes-Tr; EBT00001786264.
DR   EnsemblGenomes-Tr; EBT00001786265.
DR   EnsemblGenomes-Tr; EBT00001786266.
DR   EnsemblGenomes-Tr; EBT00001786267.
DR   EnsemblGenomes-Tr; EBT00001786268.
DR   EnsemblGenomes-Tr; EBT00001786269.
DR   EnsemblGenomes-Tr; EBT00001786270.
DR   EnsemblGenomes-Tr; EBT00001786271.
DR   EnsemblGenomes-Tr; EBT00001786272.
DR   EnsemblGenomes-Tr; HICON_00030.
DR   EnsemblGenomes-Tr; HICON_01920.
DR   EnsemblGenomes-Tr; HICON_02280.
DR   EnsemblGenomes-Tr; HICON_02340.
DR   EnsemblGenomes-Tr; HICON_02360.
DR   EnsemblGenomes-Tr; HICON_02530.
DR   EnsemblGenomes-Tr; HICON_02890.
DR   EnsemblGenomes-Tr; HICON_03520.
DR   EnsemblGenomes-Tr; HICON_04240.
DR   EnsemblGenomes-Tr; HICON_05360.
DR   EnsemblGenomes-Tr; HICON_05830.
DR   EnsemblGenomes-Tr; HICON_05910.
DR   EnsemblGenomes-Tr; HICON_05980.
DR   EnsemblGenomes-Tr; HICON_06350.
DR   EnsemblGenomes-Tr; HICON_07460.
DR   EnsemblGenomes-Tr; HICON_07640.
DR   EnsemblGenomes-Tr; HICON_09230.
DR   EnsemblGenomes-Tr; HICON_09250.
DR   EnsemblGenomes-Tr; HICON_12250.
DR   EnsemblGenomes-Tr; HICON_13590.
DR   EnsemblGenomes-Tr; HICON_13630.
DR   EnsemblGenomes-Tr; HICON_13720.
DR   EnsemblGenomes-Tr; HICON_15150.
DR   EnsemblGenomes-Tr; HICON_15380.
DR   EnsemblGenomes-Tr; HICON_15720.
DR   EnsemblGenomes-Tr; HICON_16060.
DR   EnsemblGenomes-Tr; HICON_16410.
DR   EnsemblGenomes-Tr; HICON_16520.
DR   EnsemblGenomes-Tr; HICON_16560.
DR   EnsemblGenomes-Tr; HICON_16820.
DR   EnsemblGenomes-Tr; HICON_17260.
DR   EnsemblGenomes-Tr; HICON_17550.
DR   EnsemblGenomes-Tr; HICON_17910.
DR   EnsemblGenomes-Tr; HICON_18060.
DR   EuropePMC; PMC3309571; 22377449.
DR   EuropePMC; PMC6094979; 30140675.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00022; GcvB.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00514; His_leader.
DR   RFAM; RF00632; sxy.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01695; C4.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02221; sRNA-Xcc1.
DR   SILVA-LSU; FQ670204.
DR   SILVA-SSU; FQ670204.
XX
CC   Data release policy http://www.sanger.ac.uk/legal/#t_2
CC   DNA source: unknown
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2007018
FT                   /organism="Haemophilus influenzae F3047"
FT                   /strain="F3047"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:935897"
FT   CDS_pept        2..1021
FT                   /transl_table=11
FT                   /locus_tag="HICON_02840"
FT                   /product="glyceraldehyde 3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85747"
FT                   /protein_id="CBY85747.1"
FT                   /translation="MAIKIGINGFGRIGRIVFRAAQHRDDIEVVGINDLIDVEYMAYML
FT                   KYDSTHGRFDGTVEVKDGNLVVNGKTIRVTAERDPANLNWGAIGVDIAVEATGLFLTDE
FT                   TARKHITAGAKKVVLTGPSKDATPMFVRGVNFNAYAGQDIVSNASCTTNCLAPLARVVH
FT                   ETFGIKDGLMTTVHATTATQKTVDGPSAKDWRGGRGASQNIIPSSTGAAKAVGKVLPAL
FT                   NGKLTGMAFRVPTPNVSVVDLTVNLEKPASYDAIKQAIKDAAEGKTFNGELKGVLGYTE
FT                   DAVVSTDFNGCALTSIFDAEAGIALTDSFVKLVSWYDNETGYSNKVLDLVAHIYNYKG"
FT   CDS_pept        1215..3014
FT                   /transl_table=11
FT                   /locus_tag="HICON_02850"
FT                   /product="putative long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85748"
FT                   /protein_id="CBY85748.1"
FT                   /translation="MNLDLHFVHRIQQQAKTRTNMTALRYKEHGLWRDISWKNFQEQLN
FT                   QLSRALLAHNIDVQDKIAIFAHNMERWTIADIATLQIRAITVPIYATNTAQQAEFILNH
FT                   ADVKILFVGDQEQYDQALEIAHHCPKLQKIVAMKPTIQLQQDPLSCTWESFIKTGSNAQ
FT                   QNELTQRLNQKQLSDLFTIIYTSGTTGEPKGVMLDYANLAHQLETHDLSLNVTDQDISL
FT                   SFLPFSHIFERAWAAYILHRGAILCYLEDTNQVRSALTEIRPTLMCAVPRFYEKIYAAV
FT                   LDKVQKAPKLRQIMFHWAISVGQKYFDLRANNKAIPFLLKKLFALADKLVLSKLRQLLG
FT                   GRIKMMPCGGAKLEPAIGLFFHAIGINIKLGYGMTETTATVSCWHDFQFNPNSIGTLMP
FT                   KAKVKIGENNEILVRGGMVMKGYYKKPEETAQAFTEDGFLKTGDAGEFDEQGNLFITDR
FT                   IKELMKTSNGKYIAPQYIESKIGKDKFIEQIAIIADAKKYVSALIVPCFDSLEEYAKQL
FT                   NIKYHDRLELLKNSDILKMFEQRINAVQKELAHFEQVKKFTLLSQAFSIKLGEITPTLK
FT                   LRRKVILERYRKQIEAMYHSQEA"
FT   CDS_pept        complement(3051..3836)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02860"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85749"
FT                   /protein_id="CBY85749.1"
FT                   /translation="MYKAVFSDFDGTLLTSQHTISPRTVTVIKRLTANGIPFVPISARS
FT                   PLGILPYWKQLETNNVLVAFSGALILNQHLEPIYSVQIEPKDILEINTVLADHPLLGVN
FT                   YYTNNDCHARDVENKWVIFERSVTKIEIHPFDDVATRSPHKIQIIGEAEEIIEIEVLLK
FT                   KKFPHLSICRSHANFLEVMHKSATKGSAVRFLEDYFGVQTNEVIAFGDNFNDLDMLEHA
FT                   GLGVAMGNAPNEIKQAANVVTTTNNEDGLALILEEKFPE"
FT   CDS_pept        complement(3855..4319)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02870"
FT                   /product="conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85750"
FT                   /protein_id="CBY85750.1"
FT                   /translation="MGSVLVDLQIATENIEGLPTEEQIVQWATVAIQPEGNEVEMTVRI
FT                   VDEAESHELNLTYRGKDRPTNVLSFPFECPDEVELPLLGDLVICRQVVEREAAEQEKPL
FT                   MAHWAHMVVHGCLHLLGYDHIEDDEAEEMESLETQIMQGLGFDDPYLAEK"
FT   CDS_pept        complement(4581..5231)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02880"
FT                   /product="formate dehydrogenase formation protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85751"
FT                   /protein_id="CBY85751.1"
FT                   /translation="MPVWLLNELQGLPVLYNNIPQLTAQYVQVLRDSNARNNLYSRGAA
FT                   NTFAGAKPNIAADVPAIPPAQILKNFLLDKTFPKLDCTFQFDLNLLDSCLIDLQKNQLL
FT                   GCKTGATHACAFFDLYGSMLAIYEDVGRHVALDKLLGWHAKSGKPRGFILASSRASYEM
FT                   VQKTVACGVEMLVTISAATDLAVTMAEKHNLTLIGFAREGKGNIYSGHLRLHN"
FT   CDS_pept        join(5002..7890,7895..8161,8160..8345)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_02890"
FT                   /product="formate dehydrogenase-N, alpha subunit,
FT                   nitrate-inducible, fragment"
FT   CDS_pept        8418..9326
FT                   /transl_table=11
FT                   /locus_tag="HICON_02900"
FT                   /product="Protein fdhE homolog"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85753"
FT                   /protein_id="CBY85753.1"
FT                   /translation="MCIKILSESEIKQVANSYQAPAVLFANPKNLYQHRAKRLRDLAQN
FT                   YPLSDYLLFAADIVESQLSTLEKNPLPPQQLEQLNAIEPLNTKTFKRDSIWREYLTEIL
FT                   DEIKPKANEQVSATIEFLEKASSAELEEMANKLLAQEFNLVSSDKAVFIWAALSLYWLQ
FT                   AAQQIPHNSQVENAENLHHCPICGSLPVASIVQIGTSQGLRYLHCNLCESEWNLVRAQC
FT                   TNCNSHDKLEMWSLNEELALVRAETSGSCESYLKMMFQEKDPYVEPVADDLASIFLDIE
FT                   MEEKGFARSGLNPFIFPAEEA"
FT   CDS_pept        complement(9366..9806)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02910"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85754"
FT                   /protein_id="CBY85754.1"
FT                   /translation="MSIISQIEACDFERLYEIEQQAHLVPWSLGTLKNNQGERYLNLKL
FT                   IENNQIIGFAICQTVLDEATLFNIAILPTYQGCGFGKLLLGKLIFQLKEKGVQTLWLEV
FT                   RESNPARFLYEKIGFNEVDIRKNYYPKPSGGRENAVVMACYL"
FT   CDS_pept        complement(9809..10213)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02920"
FT                   /product="DNA polymerase III, psi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85755"
FT                   /protein_id="CBY85755.1"
FT                   /translation="MNRRDLLLQEMGISQWELYRPEVLQGSVGISVAENIRFITVSDEN
FT                   ISNSPLLADVLLSLNLKKENCLCLNYDQIQYMECKQPIRYWLLSENSDQIDRTLPFCKQ
FT                   AEQVYRSPSWQQFQSNHQAKRALWQQIQQP"
FT   CDS_pept        10319..11311
FT                   /transl_table=11
FT                   /locus_tag="HICON_02930"
FT                   /product="ribosomal RNA small subunit methyltransferase C"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85756"
FT                   /protein_id="CBY85756.1"
FT                   /translation="MISLESQVLERHLSFFDGKSVLFAGGISDSFPQTLASKCPSIQIW
FT                   SCYFDYARTQSAVNFSVEFQGQADLIVYYWTKNKQEVNFQLLQLLAQASIGQEILIIGE
FT                   NRCGVRSVEKTLAPYGEIAKIDSARRCGLYHFSLQNKPHFELKNFWKTYQHSTLENLTI
FT                   YSLPGVFSAAELDTGTELLLSTIDNKIKGKVIDLGCGAGVIGSMIKKRAPNAQITMTDI
FT                   HAMALESARKTLSENQLQGEVYASDVFSNIEGKFDLIISNPPFHDGIDTAYRTVKELIT
FT                   QAKWHLNQGGELRIVANAFLPYPELLKQHFNDYQVLAQTGKFKVYSVKN"
FT   CDS_pept        complement(11375..12283)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02940"
FT                   /product="GTP-binding protein era homolog"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85757"
FT                   /protein_id="CBY85757.1"
FT                   /translation="MTEQFDKTYCGFIAIVGRPNVGKSTLLNKILGQKISITSRKAQTT
FT                   RHRIVGIKTEGAYQEIYVDTPGLHIEEKRAINRLMNRAASSAIGDVDLIIFVVDGTHWN
FT                   ADDEMVLNKLRNAKAPVVLAINKVDNIKNKDDLLPFITDLSSKFNFAHIVPISAQRGNN
FT                   VHELETIVRQSLREGVHHFPEDYVTDRSQRFMASEIIREKLMRFTGEELPYSVTVEIEQ
FT                   FKVNERGTYEINGLILVEREGQKKMVIGAGGQKIKTIGMEARADMERLFDNKVHLELWV
FT                   KVKSGWADDERALRSLGYMDE"
FT   CDS_pept        complement(12280..12963)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02950"
FT                   /product="Ribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85758"
FT                   /protein_id="CBY85758.1"
FT                   /translation="MNHLDRLERKIGYCFNDIVLLKQALTHRSAATQHNERLEFLGDSI
FT                   LNFTIAEALYHQFPRCNEGELSRMRATLVRESTLAILARQFELGDYMSLGSGELKNGGF
FT                   RRESILADCVEAIIGAMSLDQGLAVTTQVIRNWYQQLLAEIKPGDNQKDAKTRLQEYLQ
FT                   GKHLPLPTYEVINIQGEAHCQIFTVKCKVKSAGKIDRTFVAKGSSRRKAEQAAAEQILK
FT                   ELDIK"
FT   CDS_pept        complement(12965..14014)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02960"
FT                   /product="Signal peptidase I"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85759"
FT                   /protein_id="CBY85759.1"
FT                   /translation="MSNLFFVILLAVGFGVWKVLDYFQLPNTFSILLLILTALSGVLWC
FT                   YHRFVVLPKRHRQVARAEQRSGKTLSEEEKAKIEPISEASEFLSSLFPVLAVVFLVRSF
FT                   LFEPFQIPSGSMESTLRVGDFLVVNKYAYGVKDPIFQNTIIAGEKPQRGDVIVFKAPQQ
FT                   ALIRTGLGATRAAFAENLALSSKDNMSGVDYIKRIIGRGGDRVIFDVEQKTLKVVYGKE
FT                   GKPCEVDCETKVFEYTQNPTNPAFPNELELTEKGDVTHNVLISEYRRYSGLEFFPQEGM
FT                   QTAEWLVPEGQYFVMGDHRDHSDDSRFWGFVPEKNIVGKATYIWMSLEKEANEWPTGFR
FT                   FERFFTAIK"
FT   CDS_pept        complement(14023..15819)
FT                   /transl_table=11
FT                   /locus_tag="HICON_02970"
FT                   /product="GTP-binding protein LepA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85760"
FT                   /protein_id="CBY85760.1"
FT                   /translation="MKNIRNFSIIAHIDHGKSTLSDRLIQTCGGLSDREMEAQVLDSMD
FT                   LERERGITIKAQSVTLNYKAKDGETYQLNFIDTPGHVDFSYEVSRSLAACEGALLVVDA
FT                   GQGVEAQTLANCYTAIEMDLEVVPILNKIDLPAADPERVAEEIEDIVGIDAMEAVRCSA
FT                   KTGVGIEDVLEEIVAKIPPPEGDPNAPLQALIIDSWFDNYLGVVSLVRIKNGVLRKGDK
FT                   IKVMSTGQAYNVDRLGIFTPKQEDTAVLECGEVGWVVCAIKDILGAPVGDTLTHQHNSA
FT                   TEVLPGFKKVKPQVYAGLFPVSSDDYEAFRDALGKLSLNDASLFYEPENSTALGFGFRC
FT                   GFLGLLHMEIIQERLEREYDLDLITTAPTVIYEVQLTNGEVVYVDSPVKLPPLNNIAEI
FT                   REPIAECNMLVPQEYLGNVITLCVEKRGVQTNMVYHGNQIALTYEIPMGEVVLDFFDRL
FT                   KSTSRGYASLDYGFKRFQAADMVRVDIMINSERVDALALIVHKDNSQYRGRELVEKMRE
FT                   LIPRQQFDIAIQAAIGNHIIARSTVKQLRKNVLAKCYGGDVSRKKKLLQKQKEGKKRMK
FT                   SLGNVEVPQEAFLAILHVGKDK"
FT   CDS_pept        16126..16707
FT                   /transl_table=11
FT                   /gene="aef1A"
FT                   /locus_tag="HICON_02980"
FT                   /product="Fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85761"
FT                   /protein_id="CBY85761.1"
FT                   /translation="MKKLTLAAGLLFSLGGISSAFGAPDGTITFNGRVVDQTCTVSTGT
FT                   NGNFDVTLPTVNKTLLTNGAIAGRTKFDIQLKGCKQATAQGTSNVRAYFLPNTEYVDPT
FT                   THNLKNTANTPATNVQIQLTHADTSKVIAVGENVDTQENKPYNSWFNFENDVATTAKAT
FT                   LTYHAQYIAVGGDAGEGVVQSKVEYNIIYK"
FT   CDS_pept        16776..17471
FT                   /transl_table=11
FT                   /gene="aef1B"
FT                   /locus_tag="HICON_02990"
FT                   /product="Putative fimbrial chaperone protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_02990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85762"
FT                   /protein_id="CBY85762.1"
FT                   /translation="MLKKIFLFLTALPFFAQANVVITGTRIIYPAEQKNISIQLSNVGD
FT                   SPALVQSWLDKGDINSSPNSTKVPFVIAPPIVRVEGNSGQSLRVNFTGTEALPQDRESI
FT                   FYFNLLDIPPKPKAESLAINPNYLQLAIRSRLKFFYRPTGLAISINDAYQKVNFSTDGS
FT                   SLRVDNPTPYFITYDQIKINGKSVKNVDMVAPYSQQTYPFKGAHANETVQWTVVNDYGG
FT                   DQKGESILH"
FT   CDS_pept        17527..20037
FT                   /transl_table=11
FT                   /gene="aef1C"
FT                   /locus_tag="HICON_03000"
FT                   /product="Fimbrial usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85763"
FT                   /protein_id="CBY85763.1"
FT                   /translation="MRKLIMLQKYQLHPIYCGLALCFSLPFYVHADDEFDAGFLRQSEN
FT                   APVVDIRRFNEKNAVLAGHYPAEIFVNNINKGHLQLRFDDTENGISLCLTPELAEILDL
FT                   QPKAFLQSPSNAICVPVNTAISQVKTEFDTGLLRLNVEIPQALTVQRPRGYISPSRWQD
FT                   GEPAVFLNYNANHYRYNNGNNTLAQSYLGIRAGANIGSWALRHSGSKNWQKSVDQNQNS
FT                   HYESTETYLQKDFAAIRGIVTLGDFYTSGELVEGMSLRGLKVASDDRMLPSSMRGYAPI
FT                   VQGVANSNANVTIRQNGSIIYQTSVPAGAFTITDLYPSGYSGDLVVEITESNGQIRTFT
FT                   VPFANIAPLIRMGQFRYQTAYGRYRYGSEIYPDNVLQSTLQYGLLNNFTINSGITLHKN
FT                   YRAELLGASLNTPIGAFSADATFAQSIFDETREKKNGYSLHASYSVNVLSTKTNVTLAA
FT                   YRYYSKDFYTLRDVIWAKNNDYNLANEALRNSLFSRPKNQYQLSINQNLGEKWGVLYLI
FT                   GSTYSYWGKSGVRNEYQLSYSNNWKRLNYQIGFSQSVDQERKTRDNSLYLSFSIPLGEQ
FT                   YVSSTFTHNRRYNNAQSSVSGSTGQYNQFNYALSAASNNQNNRSVSANVGYRADVGDYQ
FT                   FSVGQDNQHNRQVSMTASGSVVAHSYGVTLGQTVGDNFAIIHAKGAKGALVTATGMGQT
FT                   LDYFGNAIVPYTSPYSINYIGIDPTHLPINIEFDSTEQQIVPRANSINLVNFDTKKTTM
FT                   VLFNVATPKGVILPMATEAKDDKGNLVGYVGQGGVLFANNLTKAKGTLAVSWGLGKNEQ
FT                   CYFDYQVNLDNESETMQIYDVKCK"
FT   CDS_pept        20052..21176
FT                   /transl_table=11
FT                   /gene="aef1D"
FT                   /locus_tag="HICON_03010"
FT                   /product="Fimbrial adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85764"
FT                   /protein_id="CBY85764.1"
FT                   /translation="MWKKIIFLTGLCCYSLSSLSFERRPNGDGYHYRGSSMEYDIVAPF
FT                   ELGAKMADGTIPLYSRHYSADDLPRKFDNFANAFFTNDPYKYTFIQGHNNGDNFCTELY
FT                   ARSNLPVIGTIDNQSIYDIGNEYIGILVYAGDTNRPVAVNGNSWQKVFKGWCTTSSQGA
FT                   SAKVIPVLLKQPPLGEYTIPRTEIGEIEPRRRSDSRYGEYTGNKITKFILNSFRFRVTP
FT                   HTCVLTTPKDITLKLLTISQRSIATQGDEVYGGKFEIGLRCDNSSRSGLWGGIRVYSTL
FT                   TDQSNVNNRSDILSLTADSSAKGIGIKLYNNWNTPALKYGPESSAKGTENQWAFSSGVQ
FT                   NNPSVLFRAYYVNTNGNVKPGTVKAIATYTFSYQ"
FT   CDS_pept        complement(21258..21641)
FT                   /transl_table=11
FT                   /gene="grcA"
FT                   /locus_tag="HICON_03020"
FT                   /product="conserved hypothetical acid-induced glycyl
FT                   radical enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85765"
FT                   /protein_id="CBY85765.1"
FT                   /translation="MIKGIQITQAANDNLLNSFWLLDSEKNEARCLCAKGEFAEDQVVA
FT                   VSELGQIEYRELPVNVAPTVKVEGGQHLNVNVLRRETLEDAVNNPDKYPQLTIRVSGYA
FT                   VRFNSLTPEQQRDVITRTFTESL"
FT   CDS_pept        21899..22558
FT                   /transl_table=11
FT                   /locus_tag="HICON_03030"
FT                   /product="uracil-DNA-glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85766"
FT                   /protein_id="CBY85766.1"
FT                   /translation="MKNWTDVIGTEKAQPYFQHTLQQVHLARANGKTIYPPQEEVFNAF
FT                   KYTAFEDVKVVILGQDPYHGPNQAHGLAFSVKPEVAIPPSLLNIYKELTQDISGFQMPS
FT                   NGYLVKWAEQGVLLLNTVLTVEQGMAHSHANLGWERFTDKVIAVLNEHREKLVFLLWGS
FT                   HAQKKGQIIDRTRHFVLTAPHPSPLSAHRGFFGCHHFSKTNSYLESHGIKPIDWQI"
FT   CDS_pept        complement(22629..24053)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03040"
FT                   /product="isopentenyl-adenosine A37 tRNA methylthiolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85767"
FT                   /protein_id="CBY85767.1"
FT                   /translation="MTQKLHIKTWGCQMNEYDSSKMADLLLSTHGLELTEAPEEADVLL
FT                   LNTCSIREKAQEKVFHQLGRWKELKKNNPNLVIGVGGCVASQEGEHIRHRAPYVDIIFG
FT                   PQTLHRLPEMINQIRGGKSSVVDVSFPEIEKFDRLPEPRAEGPTAFVSIMEGCNKYCTF
FT                   CVVPYTRGEEVSRPVDDVLFEIAQLAEQGVREVNLLGQNVNAYRGPTHDGQICSFAELL
FT                   RLVASIDGIDRLRFTTSHPIEFTDDIIDVYRDTPELVSFLHLPVQAGSDRVLTMMKRGH
FT                   TALEYKSIIRKLRAVRPDIQISSDFIVGFPGETAEDFEQTMNLIAQVNFDMSFSFVYSA
FT                   RPGTPAADMPDDVTEDEKKQRLYVLQERINQQAAQFSRRMLGTEQRVLVEGPSKKDIME
FT                   LTGRTETNRIVNFQGSPEMIGKFVDVKITDVYTNSLRGEVVRTEDEMGLRIAQSPQEVM
FT                   NRTRKEDELGVGRYHG"
FT   CDS_pept        complement(24472..25911)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03050"
FT                   /product="predicted transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85768"
FT                   /protein_id="CBY85768.1"
FT                   /translation="MALSKNTKLVILMAIPLITFLLPAPDGLSLIAWRLLGVYIATIVG
FT                   LVLKPYGEPVILLAAIAVSGVIIGNTEGAKELVKVGNMLDGYKSGTTWLIFTAFTLSSA
FT                   FVITGLGKRIAYHMIGAMGSTTLRLGYVTMFLDLLLSPATPSNTARSGGIIFPIINSVV
FT                   VALGSDPEKSPKKAGRYLMMNVYMVVKTTSYIFLTAMAPNALALSLMAPILGFETTWIK
FT                   WFLAASVPGLLCLFLIPLICYWVSPPELKKVDNKAIAKKGLEELGPMSFREKALSLLFV
FT                   IALFGWIFSNSLHINATIVAIIVMVLCIVLSIVTWDDILKSKGAWNTLVWYGGIIGMSG
FT                   LLEKSGFFKWLANTLSTILQFEGHGMIALIVILTLSVSVRYLFASGGAYVAAMVPVFAT
FT                   VGHVTGAPTELLALGLAFANSYGGSVTHYGGGPGPIAFGAGYNDIKSWWITGAIIAFGS
FT                   LIIHLTIGMAWWKLLMSLGWL"
FT   CDS_pept        complement(25913..27310)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03060"
FT                   /product="CitXG"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85769"
FT                   /protein_id="CBY85769.1"
FT                   /translation="MQHFFTTFSTEGSKISLEALLNAREERAILQQQLITQYGQTLLCI
FT                   TLTAVGGVKKNALLDYVFTKALENLTALFTQLNITAVKEIVRPLETGHEAYFVVPIDAR
FT                   TLKVLMIELEESIPLARLWDLDVFNAKGNLLSRTDFDLSPRTCLVCGENAKICARTRKH
FT                   EIDEIVDKIQSLAQKHDFAEHIGEQVYLALIQEARLSPKPGLVDAINNGSHKDMNLHTF
FT                   EQSAISLKPFFTQFVLKGMMTAHLSENQILSEIRPLGLLAEKAMFKVTDGVNTHKGAIF
FT                   SFGLVCTAIGRLLAQKSLVQSAVDFDVKLICSLVAQFTQGLTDELKNYPEHLPSTAGVR
FT                   LFQKYGLTGVRGEAENGFNLIQTLLPQFDEYHQLEWEHRLLILLLNLMAINSDTNVVHR
FT                   GGLAGLHFIQQTAQELLTDQHLVTDKTALTQALMKFDTACIERNLSSGGSADLLALTIF
FT                   FLSFRGN"
FT   CDS_pept        complement(27491..28993)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03070"
FT                   /product="citrate lyase alpha chain"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85770"
FT                   /protein_id="CBY85770.1"
FT                   /translation="MTTREQRIEKYHAARSVYQAVPKSESLSRTAKDRKLCTSLEEAIK
FT                   RSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFNNLTLASSSLIDSHFPIVEHIKNG
FT                   VVTKIYSSGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTF
FT                   GNANGFTGKSKCGSLGYARVDAEYADKVVLLTEEFVEYPHHPISIAQDQVDLIVQVEAV
FT                   GDPKKIGGGATRMTTKPRELLIARKCAEVIFASGYFKDGFSLQTGSGGAALAVTRFLEE
FT                   KMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLARNPNHIEVSANQ
FT                   YANYSSKGASVERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAII
FT                   VAPLVRGRIPTVVENVITCVTPGENVDILVTDHGVAVNPKRPDLIEALSKTDIPLFTIE
FT                   QLCERAYSITGKPKEIEFTNKPVAVVRYRDGSVIDTVYQVKD"
FT   CDS_pept        complement(29007..29882)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03080"
FT                   /product="citrate lyase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85771"
FT                   /protein_id="CBY85771.1"
FT                   /translation="MKLRRSMLFVPGSNAAMLSNSFIYKPDSIMFDLEDAVALKEKDSA
FT                   RLLVAHALQHPLYKEIETVVRVNPLDSEFGLLDLNSVVCAGVDVVRMPKTESAQDVLDM
FT                   DHAITEIEKACGREAGSTKMLAAIESPLGITQANQIAFASKRLIGIALGAEDYVRNLKT
FT                   ERSPEGIELLFARCSILQAARAAGIQAFDTVYSNANNEEGFLKEAALIKQLGFDGKSLI
FT                   NPRQIELLHNLFAPTQKDVEQAKRIIEAAAEAERQGAGVVSLNGKMIDAPIIDRAKLVL
FT                   ERAKSGVREE"
FT   CDS_pept        complement(29879..30166)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03090"
FT                   /product="citrate lyase acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85772"
FT                   /protein_id="CBY85772.1"
FT                   /translation="MKITKVAVAGTLESSDVQVRVQPFDSLDIEINSSVAKQFGEQIEA
FT                   TVREVLAKLGITAAQVIVEDKGALDCVLQARVKAAAMRATDEAINWEAVL"
FT   CDS_pept        complement(30204..31211)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03100"
FT                   /product="[citrate [pro-3S]-lyase] ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85773"
FT                   /protein_id="CBY85773.1"
FT                   /translation="MQFERISTEQKKLSLIQTFLHQNALKLDEQIEYFVVGYNDNEQIV
FT                   VCGGLAGNIIKCVAIDESLRGSGVALQLITELVDLAYTLKRPHLFIYTKPEYATLFKSC
FT                   GFYIISDANPYVVLLENSATRLQKQCSLWEKMRVVGNRIGSIVMNANPFTLGHRYLIEQ
FT                   ALQQCDHLHLFIVGEDASQFSYAERFEMVKQGIFDLSNITLHSGSDYIISRATFPNYFL
FT                   KDQLITDESYFEVDLKLFRLHIAQALGITHRFVGTELNCPVTAEYNRQMHYWLRDAEMN
FT                   AAKINVIEIPRKTASNQIISASTVRKHLAEKNWAQLAEFVPMTTLNYLQKCGRF"
FT   CDS_pept        complement(31462..32424)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03110"
FT                   /product="Lipoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85774"
FT                   /protein_id="CBY85774.1"
FT                   /translation="MSTPFKMERGVKYRDAAKTSIIPVKNIDPDQELLKKPEWMKIKLP
FT                   ASSVKIENIKKGMRRHGLHSVCEEASCPNLHECFNHGTATFMILGAICTRRCPFCDVAH
FT                   GKPLPPDPEEPQKLAETIQDMKLKYVVITSVDRDDLPDRGAGHFAECVKAVRELNPSIK
FT                   IEILVPDFRGRITQALEKLKDNPPDVFNHNLENVPRLYKEIRPGADYEWSLKLLREFKE
FT                   MFPNIPTKSGLMVGLGETNEEILQVMQDLRDNGVTMLTLGQYLQPSRHHLPVARYVPPT
FT                   EFDIFRDKANEMGFEHAACGPFVRSSYHADLQASGGLVK"
FT   CDS_pept        complement(32478..33116)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03120"
FT                   /product="lipoate-protein ligase B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85775"
FT                   /protein_id="CBY85775.1"
FT                   /translation="MNNSLIVRQLGLQDYQEIWHKMQNFTDSRTEETQDEIWLVQHPPV
FT                   FTQGQAGKPEHLLQRSEIPVVQSDRGGQITYHAPGQQVMYVLIDIKRHENLNVRQLVTA
FT                   LEQTVVKTLAEYGIESYPKPDAPGVYVDGKKICSLGLRIRRGCSFHGLALNINMDLNPF
FT                   HYINPCGYAGLEMCQLADFVNQDEANCDKVSPKLIKHFTELLGYNVTTL"
FT   CDS_pept        complement(33118..33396)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85776"
FT                   /protein_id="CBY85776.1"
FT                   /translation="MTTENDYAILKELMEFPAKMTFKVAGINREGLAQDLIQVVQKYIK
FT                   GDYIPKEKRSSKGTYNSVSIDIIAENFEQVETLYKELAKVEGVKMVI"
FT   CDS_pept        complement(33493..34674)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03140"
FT                   /product="penicillin-binding protein 5 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85777"
FT                   /protein_id="CBY85777.1"
FT                   /translation="MLKRTTKIAFLSSFVALSAFSVSAEDMQFGVTPPQITAQTYVLMD
FT                   YNSGAILTALNPDQRQYPASLTKMMTSYVVGVALKQGKIHNTDMVTIGESAWGRNFPDS
FT                   SKMFLDLNTQVSVADLNRGVIVVSGNDATVALAEHISGNVPNFVETMNKYVQQFGLKNT
FT                   NFTTPHGLDDPNQYSSARDMAIIGAHIIRDLPEEYKIYSEKDFTFNKIKQANRNGLLWD
FT                   KTINVDGMKTGHTSQAGYNLVASATTSNNMRLISVVMGVPTYKGREVESKKLLQWGFAN
FT                   FETFKTLEAGKVISEQPVYYGDKGSVKLGTLQDRFITIPKGKQNELKAHYELEGKNLQA
FT                   PLAKGQIVGKVVYQLEGKDIAAVNLQVMDEVGEAGIFGKAWDWLVLTVKGLFA"
FT   CDS_pept        complement(34690..35553)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03150"
FT                   /product="RlpA-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85778"
FT                   /protein_id="CBY85778.1"
FT                   /translation="MKLKTGLNLTALLLFMISVAFPVQADTQKMYGIRGDNLSIATQMP
FT                   APRTYSVKGQTYTTKSGNEAKSYIKEGLASYYHLKFDGRKTASGDVYNSKQFTAAHKTL
FT                   PINSYALVTNLHNNRKVIVRINDRGPFSDKRLIDLSHAAAKEIGLISRGIGQVRIEALH
FT                   VAKNGNLSGAATKTLAKQAKTQEAADRLVLKSNTLFDNASKSINALKGTEFYCLKMLEL
FT                   TSRSQANKLITQLALANIQTEVNRSGNKYEIYIGPFDDKTKMAQVRTKLQKMANNKPLI
FT                   VYTYKN"
FT   CDS_pept        complement(35606..36721)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03160"
FT                   /product="Rod shape-determining protein RodA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85779"
FT                   /protein_id="CBY85779.1"
FT                   /translation="MEDKIPFWLRVWQRLHIDFWLFIGLLAITAYGMLVLYSASGASET
FT                   MFNSRIIQVLLGFIVMLLMAQFPPRFYQRIAPYLYLIGFVLLILVDVIGTTSKGAQRWL
FT                   DLGFIRFQPSEIVKLAVPLMVAVYLGNRPLPPKLSETFIAIAMILLPTLLVAIQPDLGT
FT                   AILVSASGLFVVFLAGMSWWLILAAVIGLAGFIPIMWLYLMHDYQRTRVLTLLDPEKDP
FT                   LGAGYHILQSKIAIGSGGLSGKGWMQGTQSQLEFLPEPHTDFIFAVMGEEHGMIGFLIL
FT                   MAIYLFIIVRGLMIAVNAQTSFGRILAGATTLIFFVYVFVNIGMVSGILPVVGVPLPLF
FT                   SYGGTSYVAIMASFGLLMSIHTHKSQFMKRS"
FT   CDS_pept        complement(36711..38666)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03170"
FT                   /product="penicillin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85780"
FT                   /protein_id="CBY85780.1"
FT                   /translation="MNLKKFFNTPTHEPFRDKKAERNLFARRTLVAFLGILLLTGVLFT
FT                   NIYQLQIVNFDTYQTRSNGNRIKLLPLPPTRGLIYDRYGKLLAENLTFFGLYIVPEKTE
FT                   NLDRTLDELRYIVGLTDNDIENFKKERRRGTRYTPILLKPNLTEEQISRFAVNGYQYPS
FT                   LDVRPYFKRHYLYGETMAHILGYVGKMNDKDVERLKREDKFANYAGTNDIGKLGIERYY
FT                   EDILQGTTGFEEVEINNLGKVIRTLRSRPAVAGKSIHLTIDLALQRYITELLSGLKGAV
FT                   VVLDPKDSSVLAMVSTPSYDNNLFVDGISSEDYKRLLNDLARPLYSRATQGAYPPASTV
FT                   KPFIAVAAQTENVITPNTTIFDLGYWVLPNSTKRFRDWKKTGHGDTDLNKAITESSDTY
FT                   FYQVAYNMGIDRLSNWMKDFGFGMPTGIEIQEETAANMPTREWKQKRYKRPWVQGDTIS
FT                   VGIGQGYWTATPLQVAKATTILVNNGKVNTPHLMKAIEGAVLEPYEDPLIYPDISTPKA
FT                   VAWEAAKRGMYNVVNAVNGTGRKAFADANYRVAGKSGTAQVFSLKENEKYNAVGLKKEL
FT                   HDHAWFTAYAPYENPRLVVTVILENAGGGSSNAAPLARKVMDYYLNQRLPQVEKYNVPI
FT                   QQKKDLSQESEQINGR"
FT   CDS_pept        complement(38688..39155)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85781"
FT                   /protein_id="CBY85781.1"
FT                   /translation="MKITLIAVGTKMPSWVTTGFEEYQRRFPKDMPFELIEIPAGKRGK
FT                   NADIKRILEQEGKAMLAACGKGKVVTLDIPGKPWTTPQLAEQLEAWKNDGRDVCLLIGG
FT                   PEGLSPECKAAAEQSWSLSPLTLPHPLVRVVVAESLYRAWSLTTNHPYHRE"
FT   CDS_pept        complement(39209..39517)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03190"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85782"
FT                   /protein_id="CBY85782.1"
FT                   /translation="MALVEFLMETLDGLKGTDIVHFDVRGKSSITDNMIICTGTSSRQV
FT                   SAMADNLITECKKAGFETFGEEGKNTADWIVVDLGQAIVHIMQPDAREMYQLEKLWA"
FT   CDS_pept        complement(39642..41297)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03200"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85783"
FT                   /protein_id="CBY85783.1"
FT                   /translation="MSDIAITISLLALVAVIGLWIGHWKIRGVGLGIGGVLFGGIIVAH
FT                   FTNQYGLKLDAHTLHFVQEFGLILFVYTIGIQVGPGFFSSLRKSGLKLNAFAILIIVLG
FT                   SIAVVLVHKIADVPLDIALGIYSGAVTNTPALGAGQQILAELGVPQTTVTMGVSYAMAY
FT                   PFGICGILLAMWLIRLFFNVKVDDEAARFNAESSQDKESLHNISLKVTNQNLDGLTLIQ
FT                   IPGFSDEEVVCSRLKRDDMEIVPKASTEIRTNDILRLVGDDNSLAKMRLIIGHEVDAPT
FT                   VAYSGEIRSERVVVTNEKVLGKKIRALGIHQKYGVVISRLNRAGIELVPTGNTTLQFGD
FT                   VLHMVGRSDVLNQAISVIGNAQQKLLQVQMLPVFIGIGLGVLVGSIPFYIPGFPVALKL
FT                   GLAGGPLVVALILARIGTIGKLYWFMPPSANLALREIGIVLFLAVVGLKSGGSFFDTLV
FT                   NGSGLEWMGYGIFITFVPLIIVGTIARLYGKLNYLTICGLLAGSMTDPPALAFANEIKE
FT                   DNGAAALSYATVYPLVMFLRIMSPQLLAVLLWAA"
FT   CDS_pept        41410..43281
FT                   /transl_table=11
FT                   /locus_tag="HICON_03210"
FT                   /product="conserved hypothetical ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85784"
FT                   /protein_id="CBY85784.1"
FT                   /translation="MSIASTIPKIFDPFTKSAVIFHRTFISDGIFMDYSQEAITSLIWI
FT                   LQTLAITSVVFSFGIFLLVRFTQWGKQFWMFAGGYLSPKRSIKPILFFLLIVAMTLLSV
FT                   RISLVNSEWYKNMYTSLQEFNEHVFWQQMGLFCVIAASSVSAALVSYYLEQRFVINWIE
FT                   WLNEQLVNKWMAHRAYYKTQYLSENLDNPDQRIQQDVQSYVKTTLSLSTGVIDAVTSMI
FT                   SYTILLWGLAGPMIVLGVEIPHMMVFLVFGYVIFTTLIAFWLGRPLISLNFINERLNAN
FT                   YRYSLIRIKEYAESIAFYAGEKVEKNQLYQQFNAVIHNMWVIIFRTLKFSGFNLVVSQI
FT                   SVVFPLLIQVGRYFEKQIKLGDLMQTLQVFGQLHANLSFFRSTYDNFASYKATLDRLTG
FT                   FCYAIEKANNKSQTQIHNHPTDVIFKNLSIQNPLGHTLIKHLNITLPQGTSLLIQGKSG
FT                   AGKTTLLRTIAGLWSYAEGEINCPTQNQLFLSQKPYVPQGNLMSALAYPNNADNISHTQ
FT                   AVEILNKVQLGHLAEQLEKEQDWTRILSLGEQQRLAFARLILHKPAVAFLDETTASMDE
FT                   GLEFSMYQLLQQELPQTTIISVGHRSTLKTLHQQQLILQDKGQWQVL"
FT   CDS_pept        43413..44468
FT                   /transl_table=11
FT                   /locus_tag="HICON_03220"
FT                   /product="rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85785"
FT                   /protein_id="CBY85785.1"
FT                   /translation="MLFKKIRGLFSNDLSIDLGTANTLIYVKRQGIVLDEPSVVAIRQD
FT                   RVGKLKSITAVGKEAKLMLGRTPKSIVAIRPMKDGVIADFFVTEKMLQYFIKQVHSGNF
FT                   MRPSPRVLVCVPAGATQVERRAIKESAIGAGARAVYLIEEPMAAAIGAKLPVSTAVGSM
FT                   VIDIGGGTTEVAVISLNGIVYSSSVRIGGDRFDEAIISYIRRTFGSVIGEPTAERIKQE
FT                   IGSAYIQEGDEIKEMEVHGHNLAEGAPRSFTLTSRDLLEALQQPLNGIVAAVRTALEEC
FT                   QPEHAADIFERGMVLTGGGALLRNIDILLSKESGVPVIIAEDPLTCVARGGGEALEMID
FT                   MHGGDIFSDEI"
FT   CDS_pept        44548..45603
FT                   /transl_table=11
FT                   /locus_tag="HICON_03230"
FT                   /product="rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85786"
FT                   /protein_id="CBY85786.1"
FT                   /translation="MKPIFGKAPPLGIRLLIAIFASIALILADGRNSSITKARSAMETA
FT                   IGGLYYLANSPRSILDGISENLVDTNKLQIENKVLRQQLLEKNADLLLLDQLKVENQRL
FT                   RLLLNSPLRTDEYKKIAEVLTAETDIYRQQIVINQGKKDGAYVGQPVIDEKGVIGQIIS
FT                   VSENTSRVLLLTDVTHSIPVQVLRNDVRVIASGTGYTDELSLDNVPRSIDIEKGDLLVT
FT                   SGLGGRFLEGYPVAVVQSVSRDSSNYFAIVKAKPLSLLERLRYVLLLWPSNLDISKVKS
FT                   MSPEEVRNLVQKRLESQANEANYRVKKTRLTEKDFPENEEKTIIEPDIPTDFLQNEEDL
FT                   PIEQQEERIED"
FT   CDS_pept        45603..46091
FT                   /transl_table=11
FT                   /locus_tag="HICON_03240"
FT                   /product="rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85787"
FT                   /protein_id="CBY85787.1"
FT                   /translation="MQTRFILQWFTILSFFVIAFVLELAPWPVGFQMLKPAWLVLVLLY
FT                   WVLAIPNKVSIGWSFLLGLTWDLILGSTLGVHALVLSTSMYIIAKNYLILRNLSLWFQS
FT                   LLVVLFVFIIRLLIFLVEFSLHTAFFHWQAILGAFASGLLWPWVFLLMRKIRRKVKLH"
FT   CDS_pept        complement(46142..46918)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85788"
FT                   /protein_id="CBY85788.1"
FT                   /translation="MDMANWQNYRSTVNGMPAVFTANIEDVEKYHGKGLDKIVQFTIDY
FT                   QADDETGLPSEVEYDKLINRVFKILTQLTALPNVFFAGHFICNSQIKIHFYCKHENLIV
FT                   ETLQQIDFVKDINVQKDLIWDTYFDFLLASPLEIKLNATEELLDLLKSKGRNLSDTYLV
FT                   EHSFHFDEEQRMFPFMDELSLGDYSFTTLQYSAQAIQFNEDDEPYFLVKLEQEISLENG
FT                   EIFEQVERFEKLAEQFSGEYIGWECDSLLDSNKPLN"
FT   CDS_pept        complement(46928..47731)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03260"
FT                   /product="exodeoxyribonuclease III"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85789"
FT                   /protein_id="CBY85789.1"
FT                   /translation="MKFISFNINGLRARPHQLEAIIEKYQPDVIGLQEIKVADEAFPYE
FT                   ITENLGYHVFHHGQKGHYGVALLTKQEPKVVRRGFPTDNEDAQKRIIMADLETEFGLLT
FT                   VINGYFPQGESRTHETKFPAKEKFYADLQQYLEKEHDKSNPILIMGDMNISPSDLDIGI
FT                   GDENRKRWLSTGKCSFLPEERAWYQRLYDYGLEDSFRKLNPTANDKFSWFDYRSKGFDD
FT                   NRGLRIDHILVSQKLAERCVDVGIALDIRAMEKPSDHAPIWAEFK"
FT   CDS_pept        complement(47779..48453)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03270"
FT                   /product="conserved hypothetical pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85790"
FT                   /protein_id="CBY85790.1"
FT                   /translation="MEIEVVYQHSDFIIINKSEGISVHKDQEEQGLTELVAKQLNVPKV
FT                   WLVHRLDKVTSGLLILALNAESAAEFSRLFSEHKIHKTYLALSNQKPKKKQGLIIGDMK
FT                   KAREGAWKLCQTKENPAITRFESVSCEPNLRLFILKPQTGKTHQLRVAMKSLGSPILGD
FT                   GLYAKNTEKIDRTYLHATQLEFDYLNNFISVTCLPSQGQFWIKPTVFEQIQVYLTKPFL
FT                   SK"
FT   CDS_pept        complement(48453..49517)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03280"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85791"
FT                   /protein_id="CBY85791.1"
FT                   /translation="MEKQIFEHSVNVEEEHYQPKQEFHNMEAKLDEALDGELLDAQLEQ
FT                   ALKPKSSFRKTLLKFTALLFGLATVAQSVQWIWDSYQQHQWIYLAFALVSLIIILLGIK
FT                   EIICEWRRLVRLKKREQWQQQSQQIWLESAVKNGDVFSFHNAEKSKILCLDIAKSLGLE
FT                   NDSPAVIQWQRQLNEAYSAQEITYLFSRNVLSSFDAQAKKLISKMAAESAVIVAISPLA
FT                   VVDMFFIAWRNLRLMNKIAEIYGIELGYFSRIRLLRMVLVNIAFAGATEVAQDIGMDWL
FT                   SQDVTAKLSTRIAQGIGVGLLTARLGVKAMELCRPLAFQLNEKLKLSHIQQELLSSVKD
FT                   IVLGKNKIYKKEQI"
FT   CDS_pept        complement(49578..50240)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03290"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85792"
FT                   /protein_id="CBY85792.1"
FT                   /translation="MQSRLIVDAQKESLLSTHKVLRNTYFLLGLTMAFSAVVAFISMSL
FT                   NLPYPNIIVLLVGFYGLLFLTNKLADRPAGILAAFAFTGFMGYTIGPILNMYVARGMED
FT                   LIMLAFAGTAIVFFACSAYVLTTKKDMSFLSSAMFALFIVLLLGMVASFFFQIPALSVA
FT                   ISALFVVFSTMTILYETSNIIHGGETNYIRATVNIYVSIYNLFLSLLRLLSIFSSDE"
FT   tRNA            50421..50507
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:50455..50457,aa:Ser)"
FT   CDS_pept        complement(50567..51127)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03300"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85793"
FT                   /protein_id="CBY85793.1"
FT                   /translation="MKKQILALALVCGVMFSSSIWAHNLQLEQSLPSVKVSEYGEIVFS
FT                   GKDTVFQPWGSAELAGKVRVVHHLAGRTAAKEKNQSMIDAIKASHFNPVKYQTTTIING
FT                   DDAIVGTGMFVKNSAQKGKQENPHSQVVLDDKSAVKNAWGLNPKDSAIIVLDKTGKVKF
FT                   VKEGKLSDSDIQTVISLVNGLTK"
FT   CDS_pept        51231..51557
FT                   /transl_table=11
FT                   /locus_tag="HICON_03310"
FT                   /product="PhnA homologue"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85794"
FT                   /protein_id="CBY85794.1"
FT                   /translation="MDQMPNCPKCQSEYVYHDSINFVCPDCGNEWDNNEIQESDDDQLI
FT                   VKDSNGNLLADGDNVLLIKDLKLKGSSEVLKKGTKFKNIRLVNGDHNVDCGKIMLKSEF
FT                   LKKA"
FT   CDS_pept        complement(51595..52308)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03320"
FT                   /product="putative membrane protein TerC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85795"
FT                   /protein_id="CBY85795.1"
FT                   /translation="MFEWIADPEAWVSLTTLAALEIVLGVDNIIFISILVGRLPESQRQ
FT                   SGRIVGLGLAMLTRILLLMSLAWMMKLTAPLFTAFNQEISGRDLILLIGGLFLIVKSSG
FT                   EIKEAINHQGHHESERKNKVSYLGVLIQIAVLDIVFSLDSVITAVGMASHLPVMILAII
FT                   IAVSVMMFAAKPIGDFVDTHPTLKILALAFLVLVGISLIAESLDIHIPKGYIYFAMGFS
FT                   VVVEMINIRMRRLMK"
FT   CDS_pept        complement(52406..54235)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03330"
FT                   /product="UvrABC system protein C"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85796"
FT                   /protein_id="CBY85796.1"
FT                   /translation="MFNYKKFLADVSHEPGVYRMYDDKDQVIYVGKAKDLKKRLSSYFR
FT                   KNLSSKKTEALVASIHHIDTMLTSSETEALLLEHNFIKLYQPRYNVLLRDDKSYPFILL
FT                   TKERHPRITSYRGSKKFAGEYFGPYPHAGAVRETLSLLQKLFPVRQCENSVYSNRSRPC
FT                   LQYQIGRCSAPCVQGYVSDEEYNQQVELARLFLQGKDQLVLDYLIGKMEQASRNLDFEQ
FT                   AARYRDQIQAVRSVIEKQFVSNERLDDMDIMSIAYQHGLACVQVMFIRQGKVLGNRSYF
FT                   PKVPANTDLSELTETFVGQFYLQGHQGRSIPNSIIVDRQLAEKSELEQLLTDQAGRKVT
FT                   IQESVKGDKSKYLQLAQVNAKAALNVQLKQSSRMSERYQALCDLLNLPEIKRMECFDIS
FT                   HTMGNQTVASCVVFNQEGPLKSDYRRFNIEGITGGDDYAAMEQALQKRYERDLEEDKIP
FT                   DIIFIDGGKGQLNRALNVFQHLQVKWDKNRPHLIGVAKGVDRRAGQEVLIISKQDREIH
FT                   LPDDSLALHLIQHIRDESHNHAISGHRKKRQKAFTQSGLETIEGVGAKRRQALLKYLGG
FT                   LQGVKKATLDEIASVPGISLKLAERIFETLKND"
FT   CDS_pept        complement(54382..55146)
FT                   /transl_table=11
FT                   /gene="kdsB"
FT                   /locus_tag="HICON_03340"
FT                   /product="3-deoxy-D-manno-octulosonic acid
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85797"
FT                   /protein_id="CBY85797.1"
FT                   /translation="MSFTVIIPARFASSRLPGKPLADIAGKPMIQHVFEKALQSGASRV
FT                   IIATDNENVADVAKNFGAEVCMTSVNHNSGTERLAEVVEKLAIPDNEIIVNIQGDEPLI
FT                   PPVIVRQVADNLAKFNVNMASLAVKIHDAEELFNPNAVKVLTDKDGYVLYFSRSVIPYD
FT                   RDQFLNLQDVQKVQLADAYLRHIGIYAYRAGFIKQYVQWAPTQLENLEKLEQLRVLYNG
FT                   ERIHVELAKEVPTVGVDTAEDLEKVRLILAKD"
FT   CDS_pept        complement(55217..56215)
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="HICON_03350"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85798"
FT                   /protein_id="CBY85798.1"
FT                   /translation="MPFWYSNSKLIWLLSPFSLLFWLISQLRRALFSLGLKSSYRAPKP
FT                   VIIVGNLSVGGNGKTPVVVWLVEELKKRGFRVGVISRGYGSKSKTYPLFVTENTHPIEG
FT                   GDEPVLIAKRTNVLVVISPNRQQAIELLLSQAECDIIVSDDGLQHYQLQRDLEIVVMDA
FT                   ERALGNGFVLPAGPLRELPSRLKSVDFVITNGGKNQYSDAVMYLVPHFAINLKTNEKRQ
FT                   LNEFQSGVAIAGIGNPQRFFTMLEKLGIQLERTQAFQDHQYFEASQLEKLAENQPLFMT
FT                   EKDAVKCQSFANDNWWYVPVDAEIIEAEKRCENLPHFWDKIDKLVAQYRNG"
FT   CDS_pept        complement(56288..58051)
FT                   /transl_table=11
FT                   /gene="msbA"
FT                   /locus_tag="HICON_03360"
FT                   /product="lipid A export ATP-binding protein MsbA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85799"
FT                   /protein_id="CBY85799.1"
FT                   /translation="MQEQKLQENDFSTLQTFKRLWPMIKPFKAGLIASGIALVFNALAD
FT                   SGLIYLLKPLLDDGFGKANHSFLKIMAFVVVGMIILRGVTNFISNYCLAWVSGKVVMTM
FT                   RRRLFKHLMFMPVSFFDQNSTGRLLSRITYDSQMIASSSSGSLITIVREGAYIISLFAV
FT                   MFYTSWELTIVLFIIGPIIAVLIRLVSKIFRRLSKNLQDSMGELTSATEQMLKGHKVVL
FT                   SFGGQHVEEVHFNHVSNDMRRKSMKMVTANSISDPVVQVIASLALATVLYLATTPLIAE
FT                   DNLSAGSFTVVFSSMLAMMRPLKSLTAVNAQFQSGMAACQTLFAILDLEPEKDDGDYKA
FT                   EPAKGELEFKNVSFAYQGKDELALNNISFSVPAGKTVALVGRSGSGKSTIANLVTRFYD
FT                   IEQGEILLDGVNIQDYRLSNLRENCAVVSQQVHLFNDTIANNIAYAAQDKYSREEIIAA
FT                   AKAAYALEFIEKLPQGFDTVIGENGASLSGGQRQRLAIARALLRNSPVLILDEATSALD
FT                   TESERAIQSALEELKKDRTVVVIAHRLSTIENADEILVIDHGEIRERGNHKTLLEQNGA
FT                   YKQLHSMQFTG"
FT   CDS_pept        complement(58092..60458)
FT                   /transl_table=11
FT                   /gene="rec-2"
FT                   /locus_tag="HICON_03370"
FT                   /product="recombination protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85800"
FT                   /protein_id="CBY85800.1"
FT                   /translation="MKLNLITLAVLLIVADLTLLFLPQPLLLPWQVALVIALVLIFLFI
FT                   FLRRNFLVSLAFFVASLGYFHYSALSLLQQAQNITAQKQVVTFKIQEILHQQDYQTLIA
FT                   TATLANNLQEQRIFLNWKAKEVPLLSEIWQAEISLRPLSARLNFGGFDRQQWYFSKGIT
FT                   AFGTVKSAVKIANVSSLRAEKLQQVRKQTEGLSLQGLLIALAFGERAWLDKTTWSIYQQ
FT                   TNTAHLIAISGLHIGLAMGIGFCLARVVQVFCPTRFIHPYFPLVFGVLFALIYAYLAGF
FT                   SVPTFRAISALVFVLFIQIMRRHYSPLQLFTVVVGFLLFCNPLMPLSVSFWLSCGAVGC
FT                   LILWYRYVPFSLFQWKNRPFSPKVRWILSLFHLQFGLLLFFTPLQLFLFNGLSLSGFLA
FT                   NLMAVPIYSFLLVPLILFAVFTNGTMFSWQLANKLAEGITGLISVFQGNWLTVSFNLAL
FT                   FLTALCAGIFMLIIWRIYREPEASSSTWKIKRPRFFTLNLSKPLLKNDRINVLRCSFGI
FT                   ILLCFTILLFKQFSKPAWQVDTLDVGQGLATLIVKNGKGILYDTGSSWRGGSMAELEIL
FT                   PYLQREGIVLEKLILSHDDNDHAGGASTILKAYPNVELITPSWKNYGENYRTFCTAGRD
FT                   WHWQGLHFQILSPHNVVTRADNPHSCVILVDDGKNSVLLTGDAEAKNEQIFARTLGKID
FT                   VLQVGHHGSKTSTSEYLLSQVRPDVAIISSGRWNPWKFPHYSVMERLHRYKSAVENTAV
FT                   SGQVRVNFFQDRLEIQQARTKFSPWYARVIGLSKE"
FT   CDS_pept        60717..61154
FT                   /transl_table=11
FT                   /locus_tag="HICON_03380"
FT                   /product="DnaK suppressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85801"
FT                   /protein_id="CBY85801.1"
FT                   /translation="MSRASLSLLDLAGVKPYQMKKDEEYMNEEQILHFRKILNAWHEQI
FT                   VEEASRTVAHMQDEVTNFPDPADRATQEEEFSLELRNRDRERKLMKKIEATLKKLDTDD
FT                   FGYCDCCGEEIGIRRLEARPTADLCIDCKTLAEIREKQVAG"
FT   CDS_pept        61402..62760
FT                   /transl_table=11
FT                   /locus_tag="HICON_03390"
FT                   /product="probable poly polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85802"
FT                   /protein_id="CBY85802.1"
FT                   /translation="MPKARAKKSEQTRRYDKNVIKAAQFDISPRDFSRNALNVVEKLQR
FT                   QGFEAYIVGGCIRDLLLGKKPKDFDVATNARPEQIQNIFQRQCRLVGRRFRLAHIMFGR
FT                   DIIEVATFRANHSDARNENQAKQSNEGMLLRDNVYGTIEQDAARRDFTVNALYYNPQDN
FT                   TLRDYFEGIKDLKAGKLRLIGDPVTRYQEDPVRMLRSIRFMAKLDMFLEKPSEQPIREL
FT                   APLLKNIPPARLFDESLKLLQAGRGVKTYRLLRQYGLFEQLFPALSSYFTEKEDSFAER
FT                   MIVTALSSTDERVADKLRINPAFLFAAFFWYPLREKVEILKNEGGLNNHDAYALAGNEV
FT                   LDLFCRALAAPRRHTAVIRDIWFLQLQLLKRTGSAPMRTMEHPKFRAGFDLLAMRAEIE
FT                   GGETIELAKWWHEYQLSNGEQREQLIQEQQRLHPKPKKKYYRPRRRKITRSAE"
FT   CDS_pept        62769..63251
FT                   /transl_table=11
FT                   /locus_tag="HICON_03400"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropter
FT                   ridine pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85803"
FT                   /protein_id="CBY85803.1"
FT                   /translation="MITAYIALGSNLNTPVEQLHAALKAISQLPNTHLVTTSSFYKSKP
FT                   LGPQDQPDYVNAVAKIETELSPLKLLDELQRIENEQGRVRLRLWGERTLDLDILLYGNE
FT                   IIQNERLTIPHYDMHNREFVIVPLFEIASDLVLPNSQIITELVKQFADHKMIKLNP"
FT   CDS_pept        63327..63803
FT                   /transl_table=11
FT                   /locus_tag="HICON_03410"
FT                   /product="conserved hypothetical protein, ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85804"
FT                   /protein_id="CBY85804.1"
FT                   /translation="MESLTQYIPDEFSMLRFGKKFAEILLKLHTEKAIMVYLNGDLGAG
FT                   KTTLTRGMLQGIGHQGNVKSPTYTLVEEYNIAGKMIYHFDLYRLADPEELEFMGIRDYF
FT                   NTDSICLIEWSEKGQGILPEADILVNIDYYDDARNIELIAQTNLGKNIISAFSN"
FT   CDS_pept        63811..65109
FT                   /transl_table=11
FT                   /locus_tag="HICON_03420"
FT                   /product="probable N-acetylmuramoyl-L-alanine amidase AmiB
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85805"
FT                   /protein_id="CBY85805.1"
FT                   /translation="MKTKILFFLFFSTFSFSIFAAPITIAIDPGHGGKDPGAIGRNLGI
FT                   YEKNVTLSIAKELKALLDKDPHFRGVLTRKSDYYISVPERSEIARKFKANYLISIHADS
FT                   SESPDRRGASVWVLSNRRANDEMGQWLEDDEKRSELLGGAGKVLSHNNDKYLDQTVLDL
FT                   QFGHSQRTGYVLGEHILHHFAKVTTLSRSTPQHASLGVLRSPDIPSVLVETGFLSNSEE
FT                   EKKLNSQTYRRRIAYMIYEGLVAFHSGKTNTLVKDNLVQNIKQNDIKKSGKNNRTSEQN
FT                   INEDNIKDSGIRHIVKKGESLGSLSNKYHVKVSDIIKLNQLKRKTLWLNESIKIPDNVE
FT                   IKNKSLTIKENDFHKKQNSSVNNTNKDLKKEKNTQTNNQKNIIPLYHKVTKNQTLYAIS
FT                   REYNIPVNILLSLNPHLKNGKVITGQKIKLREK"
FT   CDS_pept        65110..>66444
FT                   /transl_table=11
FT                   /locus_tag="HICON_03430"
FT                   /product="DNA mismatch repair protein MutL"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85806"
FT                   /protein_id="CBY85806.1"
FT                   /translation="MPIKILSPQLANQIAAGEVVERPASVVKELVENSLDAGANKIQID
FT                   IENGGANLIRIRDNGCGIPKEELSLALARHATSKIADLDDLEAILSLGFRGEALASISS
FT                   VSRLTLTSRTEEQTEAWQVYAQGRDMETTIKPASHPVGTTVEVANLFFNTPARRKFLRT
FT                   DKTEFAHIDEVIRRIALTKFNTAFTLTHNGKIIRQYRPAEAINQQLKRVAAICGDDFVK
FT                   NALRIEWKHDDLHLSGWVATPNFSRTQNDLSYCYINGRMVRDKVISHAIRQAYAQYLPT
FT                   DVYPAFVLFIDLNPHDVDVNVHPTKHEVRFHQQRLIHDFIYEGISHALNNQEQLNWHTD
FT                   QSAVENREENTVREPQPNYSIRPNRAAAGQNSFAPKYHEKSQQNQPHFSNTPVFPNHVS
FT                   TGYRDYRSDAPSKTEQRLYAELLRTLPPTEQRDISNTAQQNISDTA"
FT   CDS_pept        67007..67942
FT                   /transl_table=11
FT                   /locus_tag="HICON_03440"
FT                   /product="tRNA delta-isopentenylpyrophosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85807"
FT                   /protein_id="CBY85807.1"
FT                   /translation="MKPTAIFLMGPTASGKTDLAIQLRSQLPVEVISVDSALIYKGMDI
FT                   GTAKPSKEELALAPHRLIDILDPSESYSAMNFRDDALREMADITAQGKIPLLVGGTMLY
FT                   YKALIEGLSPLPSADENIRAELEQKAAQQGWAALHTELAKIDPISAARINPSDSQRINR
FT                   ALEVFYITGKSLTELTEEKGEALPYDFVQFAIAPQDRHVLHERIEQRFHKMIELGFQAE
FT                   VEKLYARGDLNINLPSIRCVGYRQMWEYLQGDYAYEEMIFRGICATRQLAKRQLTWLRG
FT                   WKTPIQWLDSLQPQQAKETVLRHLDSYQKG"
FT   CDS_pept        67948..70893
FT                   /transl_table=11
FT                   /locus_tag="HICON_03450"
FT                   /product="glutamate-ammonia ligase adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85808"
FT                   /protein_id="CBY85808.1"
FT                   /translation="MTALSALIEQKLQSLGTILCQSFPELSPEKIHEAIQQNSNHPELP
FT                   VYQLGYAIAMSDFVEKVLQKYPHLVKQWWEKSPCFADCTAYIERLNRELANVHDETALY
FT                   QTLRQFRNIEMAKLSFCQSLNLATVEEIFVQLSQLAESLIIAARDWLYHQACAEIGTPM
FT                   DEQGNQQQLYILGMGKLGGFELNFSSDIDLIFTYPSQGETSVENTNARRSVDNTKFFTR
FT                   LGQRLISALDEFTSDGFVYRTDMRLRPFGDSGGLVLSFAAMEQYYQDQGRDWERYAMIK
FT                   GRVLGVQTKDPNVSKLQKMLRPFVYRRYIDFSVIQSLREMKGKIEREVRRRGLKDNIKL
FT                   GAGGIREVEFIVQVFQLIRGGREINLQQHSLLKILPEITKLGLITEQQFHDLRESYIFL
FT                   RRVENILQAINDQQTQTLPTDEIDQIRLVKACKTFTCLNENNQTIEKHYPIENWDDFYR
FT                   TLQQKQEKVRAVFTQLIGDEQDEPSQTDSQWQDFLEADFEDIEQTLLESGVSENNIDEV
FT                   LEKLAQFKNGLNHRVIGSRGRDVLSHLMPTVLALIFEQENYRTLLPRILNIIEKISSRT
FT                   TYLELLLENPRALQQVIELCAQSQLISEQLARHPILLDELLNTEALRHPLPFTQYPAEL
FT                   HQYLLRLPPDDEEQLIDALRQFKQATLLKVAAADILGALPVMKVSDHLTYLAEAIIEVV
FT                   VNLTWKQVSSRFGVPEHLQNNEKGFLVIGYGKLGGIELGYKSDLDLVFLYDAVESQTTG
FT                   GKKVIDSNQFYLRLAQKIVSIFSINTSAGVLYEADMRLRPSGDAGLIGCSLSAFSHYQL
FT                   NDAWTWEKQALVRARPVFGESSLKAKFEHIRQQVLSASRDIEQLKQDVIEMRKKMFTHL
FT                   SHSKHSEFNLKTDRGGITDIEFIAQYLMLANAPKKPQLTKWSDNVRIFDDMAEAKIISQ
FT                   TDCDTLKQCYVDLRNAIHHLNLIGKSPVVDETEFVKERSFIQAFWDRLFVS"
FT   CDS_pept        complement(70978..72654)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03460"
FT                   /product="DNA repair protein RecN"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85809"
FT                   /protein_id="CBY85809.1"
FT                   /translation="MLTQLTINNFAIVRQLDIEFAKGMSVITGETGAGKSIAIDALGLC
FT                   FGQRVETSMVREGQERAEICATFQLESQNPAYHWLSEQELQDPDNPTECILRRIINADG
FT                   RSKAFINSTPVSASQLKEIAQYLVHINGQHASQLLLKNDYQLQLVDNFAAHPELLVKMR
FT                   EDYQTWKNLQNQVKTFQQKVAENEARKQLLQYQVDELDEFNLRPNEYLELEDEQRRLSS
FT                   SEQLTQLSQSALQILSENDTVNIDSLLYRATQYIDELAELDPQYAEVQNMLNDALIQVQ
FT                   EATSEVQNLSSNIEQDPRLLQEIEQRISQALQLARKHQVKPEDLVEQHKKLKAELTALL
FT                   DFSESEEMLIEQEKRAFEQMQATATALTASRQQSATRLAQNVTQSIKQLAMENAEFYVE
FT                   LNTDLDKMSANGADNVIFTLRSNLGQQPQPLAKIASGGELSRISLAIQVLTSDQSAIPT
FT                   LIFDEVDVGISGKTASVVGKLLRQLSERCQVLCVTHLPQVACHGHHQFNVEKFTVDNKT
FT                   ETKMTALSQAERVPALARLLGGSEITELALANAQEMLDLVH"
FT   CDS_pept        complement(72766..73656)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03470"
FT                   /product="probable inorganic polyphosphate/ATP-NAD kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85810"
FT                   /protein_id="CBY85810.1"
FT                   /translation="MNHLYRSFKTIALVGKPRNDINLQMHKNLFHWLMERGYQVLVEKE
FT                   VAITLELPFEHLATLEEIGRRAQLAIVIGGDGNMLGRARVLAKYDIPLIGINRGNLGFL
FT                   TDIDPKNAYSQLEACLERGEFFVEERFLLEAKIERASEIVSTSNAVNEAVIHPAKIAHM
FT                   IDFHVYINDKFAFSQRSDGLIVSTPTGSTAYSLSAGGPILTPNLNAIALVPMFPHTLTS
FT                   RPLVIDGDSKISIRFAEHNTSQLEVGCDSQITLSFTPDDVVHIQKSEHKIRLLHLKNYN
FT                   YYNVLSSKLGWLKSF"
FT   CDS_pept        73648..74352
FT                   /transl_table=11
FT                   /locus_tag="HICON_03480"
FT                   /product="GrpE nucleotide exchange factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85811"
FT                   /protein_id="CBY85811.1"
FT                   /translation="MIHKMTALEFNIFVIISFFATLCPITINQFCFTEKKMSEQEQKVK
FT                   NPEVENQEEVVVEEAQQADPSQEFDPLEEAIARVQELEEQLKTQIEEAANKEQDILLRS
FT                   RAEIENLRRRTEQDVEKAHKFALEKFSKDILNTIDNLERALATPANKEDESVKALFDGV
FT                   ELTLKELVSTVGRFGVEAVGVVGEAFNPDLHQAISMQPAEGFETNQISVVLQKGYTLNG
FT                   RVIRPAMVMVAT"
FT   CDS_pept        complement(74365..74709)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85812"
FT                   /protein_id="CBY85812.1"
FT                   /translation="MTSFAQLDIKSEELAIVKTILQQLVPDYTVWAFGSRVKGKAKKYS
FT                   DLDLAIISEEPLDFLARDRLKEAFSESDLPWRVDLLDWATTSEDFREIIRKVYVVIQEK
FT                   EKTVEKPTAL"
FT   CDS_pept        complement(74711..75142)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85813"
FT                   /protein_id="CBY85813.1"
FT                   /translation="MMTDKLNLNVLDAAFYSLEQTVVQISDRNWFDMQPSIVQDTLIAG
FT                   AIQKFEFVYELSLKMMKRQLQQDAINTDDIGAYGFKDILREALRFGLIEDMSKWVAYRD
FT                   MRNITSHTYDQEKAMAVYAQIDDFLIESRFLLEQLRQRN"
FT   CDS_pept        75423..77546
FT                   /transl_table=11
FT                   /locus_tag="HICON_03510"
FT                   /product="anaerobic ribonucleoside-triphosphate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85814"
FT                   /protein_id="CBY85814.1"
FT                   /translation="MSNFGVIKRDGSRSEFEIQRIINAIKKAASAVNISDEFYCHQIGQ
FT                   EVGNEIFTRHQGEIDINQIQKIVEDKLMASRYPEIARAYIEYRHDRDLAREKRSQLTKE
FT                   IEGLIEQSNVELLNENANKDAKVIPTQRDLLAGIVAKHYAKHHILPRDVVEAHEKGEIH
FT                   YHDLDYAPFFPMFNCMLVDLEGMLSRGFKMGNAEIEPPKSIGTATAVTAQIIAQVASHI
FT                   YGGTTINRIDEVLSPYVQISYEKHLKHAQEWNVPDVEGYAKALIEKECFDAFQSLEYEV
FT                   NTLHTSNGQTPFVTFGFGLGTSWQSRLIQQAILKNRIRGLGKNHKTPVFPKLVFTIKKS
FT                   LNQNKGDPNYDIKQLALECASKRMYPDILNYEQVVKITGSFKAPMGCRSFLGAYEEKGH
FT                   EIHDGRNNLGVVSLNLPRIALESKNEEDFYRTLDERLAIAKKALMTRVARLENTKARVA
FT                   PILYMEGACGVRLKADENVAQIFKNGRASISLGYIGIHETINALYNKGHIFDDEQLREK
FT                   GIAIVRHLSEAVKRWQKETGYAFSLYSTPSENLCDRFCRLDTKKFGVIEGVTDKGYYTN
FT                   SYHLDVEKKVNPYDKLDFEMAYPPLASGGFICYGEYPNIQHNLKALEDVWDYSYDRVPY
FT                   YGTNTPIDECYECGFTGEFECTSKGFVCPKCGNHDSTKVSVTRRVCGYLGSPDARPFNA
FT                   GKQEEVKRRVKHL"
FT   CDS_pept        77665..78525
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_03520"
FT                   /product="acyl-CoA thioesterase II"
FT   CDS_pept        complement(78686..80065)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03530"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85816"
FT                   /protein_id="CBY85816.1"
FT                   /translation="MLKIFNTLTREKEIFKPIHENKVGMYVCGVTVYDLCHIGHGRTFV
FT                   CFDVIARYLRSLGYDLTYVRNITDVDDKIIKRALENKETCDQLVDRMVQEMYKDFDALN
FT                   VLRPDFEPRATHHIPEIIEIVEKLIKRGHAYVADNGDVMFDVESFKEYGKLSRQDLEQL
FT                   QAGSRIEINEIKKNPMDFVLWKMSKENEPSWASPWGAGRPGWHIECSAMNCKQLGEHFD
FT                   IHGGGSDLMFPHHENEIAQSCCAHGGQYVNYWIHSGMIMVDKEKMSKSLGNFFTIRDVL
FT                   NHYNAEAVRYFLLTAHYRSQLNYSEENLNLAQGALERLYTALRGTDQSAVVFGGENFVE
FT                   TFREAMDDDFNTPNALSVLFEMAREINKLKTEDVEKANGLAARLRELGAILGLLQQDPE
FT                   KFLQAGSDDDEVAKIEALIKQRNEARAAKDWATADAARNELTAMGIVLEDGANGTTWRK
FT                   Q"
FT   CDS_pept        80168..80677
FT                   /transl_table=11
FT                   /locus_tag="HICON_03540"
FT                   /product="peptidyl-prolyl cis-trans isomerase B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85817"
FT                   /protein_id="CBY85817.1"
FT                   /translation="MVTLHTNFGDIKIKLDFDKAPVTAENFLNYCKEGFYNNTIFHRVI
FT                   DGFMIQGGGMESGMREKATKAPIQNEANNRLSNKRGTIAMARTSDPHSATAQFFINVAD
FT                   NDFLNYRSKEMFGREVVQEWGYAVFGEVVEGMDVVDKIKKVKTGNKGFHQDVPTEDVVI
FT                   TLVSVE"
FT   CDS_pept        80732..81520
FT                   /transl_table=11
FT                   /locus_tag="HICON_03550"
FT                   /product="putative deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85818"
FT                   /protein_id="CBY85818.1"
FT                   /translation="MPFFDTHTHLDYLQQFTGEPLSQLIDNAKQADVQKILVVAVKEAD
FT                   FKTIQNMTALFPDNLYYGLGLHPLYIQEHAENDLILLEQALKNRDANCTAVAEIGLERA
FT                   IPDLLTDELWAKQCHFFESQLYLAKQFNLPVNIHSRKTHDQIFTFLKRIPLSKLGVVHG
FT                   FSGSYDQTKRFVDLGYKIGVGGTITYERANKTRQAIAKLPLDALVLETDSPDMPVFGFQ
FT                   GQPNRPERIVESFKALCTLRNEPAELIKKLTWENACQIFS"
FT   CDS_pept        81874..82116
FT                   /transl_table=11
FT                   /locus_tag="HICON_03560"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85819"
FT                   /protein_id="CBY85819.1"
FT                   /translation="MDLFESALPDILMLEFSTPRAGELSSLLASEILRQKCILGLGVIN
FT                   PRSDEVETVAQIVQRAEKALNYLPPEQISKFQTKK"
FT   CDS_pept        complement(82175..82498)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03570"
FT                   /product="thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85820"
FT                   /protein_id="CBY85820.1"
FT                   /translation="MSEVLHINDADFESVVVNSDIPVLLDFWAPWCGPCKMIAPVLDEL
FT                   APEFAGKVKIVKMNVDDNQATPAQFGVRSIPTLLLIKNGQVVATQVGALAKTQLANFIN
FT                   QHI"
FT   CDS_pept        complement(82618..83613)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03580"
FT                   /product="fermentative D-lactate dehydrogenase,
FT                   NAD-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85821"
FT                   /protein_id="CBY85821.1"
FT                   /translation="MKIAIYSTKSYDRKYIELINAKYNFDLEFFDFMLNESTVRLAEHC
FT                   EVVCIFVNDNGSRKVLEKLAALGVKIVALRCAGFNNVDLKAAQDLGIQVVRVPAYSPEA
FT                   VAEHTIGLMMTLNRRIHRAYQRTREANFSLEGLIGFNMYGRTVGVIGTGKIGIAVMRIL
FT                   KGFGMNILAYDPFKNPVVEELGGQYVELDELYAKSHVITLHCPATPENYHLLNREAFAK
FT                   MKDGVMIVNTSRGSLIDTQAAIDALKQRKIGALGMDVYENERDLFFEDKSNEVIQDDIF
FT                   RRLSSCHNVLLTGHQAFLTEEALTNIADVTLSNVYKLKSGKVCENIVLPS"
FT   CDS_pept        complement(83626..84735)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03590"
FT                   /product="cystathionine gamma-synthase, PLP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85822"
FT                   /protein_id="CBY85822.1"
FT                   /translation="MTQQYAIDTLLAQAGNRSDERTGAVSAPIFLSTAYGHCGIGESTG
FT                   FDYTRTKNPTRTVLEETIAKLENGDRGFAFSSGMAAIQVLMTLFTAPDEWIVSSDVYGG
FT                   TYRLLDFSYKNNNSVKPVYVNTASASEIEAAINPNTKAIFIETPSNPLMEECDVVEIAK
FT                   LAKKHNLMLIVDNTFLTPVLSRPLDLGADVVIHSGTKYIAGHNDALVGLIVAKGQALCD
FT                   RIAYIQNGAGAVLSPFDSWLTIRGMKTLSLRMKRHQENAQAIAEFLRAQPQVESVLYPN
FT                   KGGMLSFRLQDEAWVNTFLKSIKLITFAESLGGTESFITYPATQTHMDIPEPERVARGI
FT                   TNTLLRFSVGIEDVEDIKADLLQAFANLK"
FT   tRNA            84982..85054
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:85015..85017,aa:Gly)"
FT   tRNA            85064..85134
FT                   /product="transfer RNA-Cys"
FT                   /anticodon="(pos:85096..85098,aa:Cys)"
FT   tRNA            85165..85248
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:85199..85201,aa:Leu)"
FT   tRNA            85302..85374
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:85335..85337,aa:Lys)"
FT   CDS_pept        complement(85585..86862)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03600"
FT                   /product="threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85823"
FT                   /protein_id="CBY85823.1"
FT                   /translation="MNLYNIKHPEEQVTFSQAVRQGLGRDQGLFFPEVIPKLNNINELL
FT                   ELPLVERSQKILGALIDGELPQATLDAMVKNAFTFPAPLEKVEDNIYALELFHGPTLAF
FT                   KDFGGRFMAQALAAVRGDGKITILTATSGDTGAAVAHAFYGLENINVVILYPKGKISPL
FT                   QEKLFCTLGGNIRTVAINADFDACQALVKQAFDDVELRQAIGLNSANSINISRLLAQVC
FT                   YYFEAVAQLPKEERDNVVVSVPSGNFGNLTAGLIAKTLGLPIKRFVASTNANDTVPRYL
FT                   KSGNWEPKTTVATLSNAMDVSRPNNWPRVEELFKRNGWDLTDLGSGMLSDSETEDSLKA
FT                   MQSKGYLCEPHGAIAYQVLKDQLKASETGIFLCTAHPAKFKESVERILGIQLPLPETLD
FT                   KHNQLPLLSDEMDNDFAQLRAYLLKS"
FT   CDS_pept        complement(86905..87849)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03610"
FT                   /product="homoserine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85824"
FT                   /protein_id="CBY85824.1"
FT                   /translation="MLRIYAPASSANISVGFDTLGAAISPIDGSLLGDVVQIESISTGF
FT                   ELESAGYFVRKLPKEPQKNIVYQAYVLFSEQLKLRGANVKPLRLTLEKNMPIGSGLGSS
FT                   ACSIVAALVALNQFHNEPFSKMELLEMMGELEGRISGSIHYDNVAPCYLGGVQFMVQSL
FT                   GNICQKLPFFDNWYWVLAYPGIEVSTAEARAILPKSYTRQNVIAHGRHLGGFVHACHTH
FT                   QENLAAIMMKDVIAEPYRESLLPNFAEVKQATRDLGALATGISGSGPTIFSIAPDLQTA
FT                   IKLSSYLESHYLQNNEGFVHVCKVDNEGTREIK"
FT   CDS_pept        complement(87862..90309)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03620"
FT                   /product="aspartokinase/homoserine dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85825"
FT                   /protein_id="CBY85825.1"
FT                   /translation="MRVLKFGGTSLANPERFSQAAKLIEQAHLEEQAAGVLSAPAKITN
FT                   HLVALSEKAVLNQSTDTHFNEAIEIFYNIINGLHTENNQFDLNGTKALIDAEFAQIKGL
FT                   LEEIRQAGKVEDAVKATIDCRGEKLSIAMMKAWFEARGYSVHIVDPVKQLLAKGGYLES
FT                   SVEIEESTKRVDAANIAKDKVVLMAGFTAGNEKGELVLLGRNGSDYSAACLAACLGASV
FT                   CEIWTDVDGVYTCDPRLVPDARLLPTLSYREAMELSYFGAKVIHPRTIGPLLPQNIPCV
FT                   IKNTGNPSAPGSIIDGNVKSESLQVKGITNLDNLAMFNVSGPGMQGMVGMASRVFSAMS
FT                   GAGISVILITQSSSEYSISFCVPVKSAEVAKTVLETEFANELNEHQLESIEVIKDLSII
FT                   SVVGDGMKQAKGIAARFFSALAQANISIVAIAQGSSERSISAVVPQNKAIEAVKATHQA
FT                   LFNNKKVVDMFLVGVGGVGGELIEQVKRQKEYLAKKNVEIRVCAIANSNRMLLDENGLN
FT                   LEDWKNDLENATQPSDFDVLLSFIKLHHVVNPVFVDCTSAESVAGLYARALKEGFHVVT
FT                   PNKKANTRELVYYNELRQNAQASQHKFLYETNVGAGLPVIENLQNLLAAGDELEYFEGI
FT                   LSGSLSFIFGKLEEGLSLSEVTALAREKGFTEPDPRDDLSGQDVARKLLILARESGIEL
FT                   ELSDVEVEGVLPKGFSDGKSADEFMAMLPQLDEEFKTRVATAKAEGKVLRYVGKISEGK
FT                   CKVSIVAVDLNNPLYKVKDGENALAFYTRYYQPIPLLLRGYGAGNAVTAAGIFADILRT
FT                   LQH"
FT   CDS_pept        90633..91346
FT                   /transl_table=11
FT                   /locus_tag="HICON_03630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85826"
FT                   /protein_id="CBY85826.1"
FT                   /translation="MNIQHNLNLIQQKIETACKEENRNQNTVKLLAVSKTKPISAILSA
FT                   YQAGQTAFGENYVQEGVEKIQYFESQEVNLEWHFIGPLQSNKTRLVAEHFDWMQTLDRA
FT                   KIADRLNEQRPTNKAPLNVLIQINISDEESKSGIQPEEMLTLAKHIENLPHLCLRGLMA
FT                   IPAPTDKIAEQEAMFRKMSDLFEQLKQALPNQQIDTLSMGMTDDMPSAIKCGSTMVRIG
FT                   TAIFGARNYSTSQNK"
FT   CDS_pept        complement(91386..92522)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03640"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85827"
FT                   /protein_id="CBY85827.1"
FT                   /translation="MKFVIAPDSFKESLTALEVATAIETGFKRVFPDADYVKLPMADGG
FT                   EGTVQSLVDATQGKLIECEVTAPLGDKVKSFFGLSGDGKTAIIEMAAASGLHLVPPEKR
FT                   NPLLTTSYGTGELIKLALDLGVESFILGIGGSATNDGGVGMLQALGMQCLDSQDKPIGF
FT                   GGAELANIVKIDVQQLDPRLQQVHIEVACDVNNPLCGECGASAIFGPQKGATPEMVKQL
FT                   DAALSHFVEIAERDCGKQIRDQAGAGAAGGMGGGLLLLPSVQLKAGIQIVLDRLHLIDY
FT                   VKDADVVITGEGRIDAQSIMGKTPIGVARTAKQFNKPVIAIAGCLREDYDVVFDHGIDV
FT                   VFPIIHQLGDLSDILKQGEQNLISTAQNVARVLAFKFH"
FT   CDS_pept        complement(92531..93790)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03650"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85828"
FT                   /protein_id="CBY85828.1"
FT                   /translation="MTTVSAIGALVALIVAIFLILKKVSPAYGMLVGALVGGLIGGADL
FT                   SQTVSLMIGGAQGITTAVMRILAAGVLAGVLIESGAANSIAETITNKLGETRALLALAL
FT                   ATMILTAVGVFVDVAVITVSPIALALSRRSDLSKAAILLAMIGGGKAGNIMSPNPNAIA
FT                   AADTFHLPLTSVMMAGIIPALFGLILTYFLAKRLINKGSKVTDKEVIVLETQNLPSFLT
FT                   ALVAPLVAILLLALRPLFDIKVDPLIALPLGGLIGALCMGKLRNINSYAINGLSKMTPV
FT                   AIMLLGTGALAGIIANSGLKEVLIQGLEHSGLPSYILAPISGVLMSLATASTTAGTAVA
FT                   SNVFSSTLLELGVSSLAGAAMIHAGATVFDHMPHGSFFHATGGSVNMDIKERLKLIPYE
FT                   SAVGLMMTIVSTLIFGVFKF"
FT   CDS_pept        complement(93912..95093)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03660"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85829"
FT                   /protein_id="CBY85829.1"
FT                   /translation="MQIKQYLTNFLFLNILSSFIFFITNMQLDKYTAKKIVKRAMKIIH
FT                   HSVNVMDHDGVIIASGNSTRLNQRHTGAVLALRENRVVEIDQALAQKWNFEAQPGINLP
FT                   IHYLGKNIGVVGISGEPTQVKQYAELVKMTAELIVEQQALLEQESWHRRYKEEFILQLL
FT                   HCNLNWKEMEQQAKFFSFDLNKSRVVVLIKLLNPALDNLQHLINYLEQSEFAQDVAILS
FT                   LDQVVVLKTWQNSTVLSAQMKTLLPADYSKQDYKIAVGACLNLPLFEQLPLSFQSAQST
FT                   LSYGLKHHPRKGIYVFDEHRLPVLLAGLSHSWQGNELIKPLSPLFSEENSILYKTLQQY
FT                   FLSNCDLYLTAEKLFVHPNTLRYRLNKIEQITGLFFNKIDDKLTLYLGTLLEH"
FT   CDS_pept        complement(95220..95540)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03670"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85830"
FT                   /protein_id="CBY85830.1"
FT                   /translation="MSELLINDYTRKGFVDGLCVRLPTICIRPGKPNKAASSFVSSIIR
FT                   EPLHGETSICPVAEKMAFSFIKFLGKKKEEWALAITGYVVSIPIVLPILLIFIKAILDL
FT                   GK"
FT   CDS_pept        complement(95891..96646)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85831"
FT                   /protein_id="CBY85831.1"
FT                   /translation="MAKDEVGHNFLARLGKTRLRPGGKKATDWLIANGDFSQDKKVLEV
FT                   ACNMGTTAIGLAKQFGCHIEGVDLDENALAKAQANIEANGLQEKIHVQRANAMKLPFED
FT                   ESFDIVINEAMLTMLPVEAKKKAIAEYFRVLKSNGLLLTHDVMLVGNDHQTILENMRKA
FT                   INVTVTPLTKDGWKGIFQESGFRYVDTFSGEMTLLSPKGMIYDEGIFGTLKIIRNAMKA
FT                   ENREQFKRMFKTFNDPEHKLHFIAVCSQK"
FT   CDS_pept        complement(join(96755..97504,97503..97598))
FT                   /transl_table=11
FT                   /locus_tag="HICON_03690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85832"
FT                   /protein_id="CBY85832.1"
FT                   /translation="MKIIKQASKQASKQASKQASKQASKQASKQVKNSLTRLSLITLLI
FT                   FHFFLSCSVFSADPKWTSEYGIAPSNVIWGIALGYESEAAAYNSVALGASSLANRPNTV
FT                   SVGDGDYNLYRQIINVADGVYDFDAVNVRQLNRLSKRVNHVGASAAALASLKAQLGEND
FT                   KFAFSLGFGSYKNAQAMAIGAVFKPAENVLLNVAGSFSGSEKIVGAGVSWKFGNKSKPA
FT                   VSTQSAVNSAEVLQLRQEVVMMRSQQAETDKKLYKQAEMESELKQLRRELLEFKKALKK
FT                   "
FT   repeat_region   complement(97509..97584)
FT                   /note="GCAA x19"
FT   CDS_pept        join(97948..98037,98039..99580)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03700"
FT                   /product="unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85833"
FT                   /protein_id="CBY85833.1"
FT                   /translation="MANQSINQSINQSINQSINQSINQSINQSINQHNPYDELGYYSKP
FT                   FSYTSIVLLEGNATFWGLKPPALKGAKVLELGSSFGGNLISQAVYYPDTEFIGVDLADS
FT                   QITQGNEIIQSMGLTNVRLETKNILDITPEFGMFDYILVHGIYSWVPDNVKDKILEICR
FT                   ENLTPNGIAYISYNTYPGWKSREVARDIMLYANKYTQDLPLAEQTRRGKTVVQLFSDAI
FT                   KSIDSEKIKNHSRVDNFDSIQTDSDHYIAHEYLAYHNHPIYLHQFVDSVNQHQLAYIGD
FT                   TSFQLSYISWMPYHLREMIDQLSETDYVVREQCLDYLYDVAFRRSLLCHQHLQESINRT
FT                   ENVEKHLLDKFTFINTNYTNNLSHQFNNQALVRLLEYFIYQVGSFTIQSLTQHIEENKE
FT                   FANITENELYSAVLSLVILGYVYVYLTPYPIYSFEDNKTYIPKRFTQYVKTLVEGANQY
FT                   IGTGDMYNGSVEDLNKLHLYIMSQMEKPTTKAELKSALQGYLIQNEYQDMNNNDKLIDE
FT                   TYDCTELFNALCDVLTRLGYIQPVNL"
FT   repeat_region   97957..98041
FT                   /note="CAAT x21"
FT   CDS_pept        99732..100730
FT                   /transl_table=11
FT                   /locus_tag="HICON_03710"
FT                   /product="iron-utilization periplasmic protein hFbpA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85834"
FT                   /protein_id="CBY85834.1"
FT                   /translation="MQFKHFKLATLVAALAFSANSFADITVYNGQHKEAATAVAKAFEQ
FT                   ETGIKVTLNSGKSEQLAGQLKEEGDKTPADVFYTEQTATFAALSEAGLLAPISEQTIKQ
FT                   TAQKGVPLAPKKDWVALSGRSRVVVYDHTKLSEKDMEKSVLDYATPKWKGKIGYVSTSG
FT                   AFLEQVVALSKMKGDKVALNWLKGLKENGKLYAKNSVALQAVENGEVPAALINNYYWYN
FT                   LAKEKGVENLKSRLYFVRHQDPGALVSYSGAAVLKASKNQAEAQKFVDFLASKKGQEAL
FT                   VAARAEYPLRADVVSPFNLEPYEKLEAPVVSATTAQDKEHAIKLIEEAGLK"
FT   CDS_pept        100848..102368
FT                   /transl_table=11
FT                   /locus_tag="HICON_03720"
FT                   /product="iron(III)-transport system permease protein
FT                   hFbpB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85835"
FT                   /protein_id="CBY85835.1"
FT                   /translation="MPRRPPFWLTLLIILIGLPLCLPFLYVILRATEVGLTRSVELLFR
FT                   PRMAELLSNTMLLMVCVTIGAISLGTFCAFLLERYRFFGKAFFEVAMTLPLCIPAFVSC
FT                   FTWISLTFCVEGFWGTIGIMTLSSFPLAYLPVSAILKRLDRSLEEVSLSLGKSPVYTFW
FT                   YAIFPQLKPAIGSSILLIALHMLVEFGAVSILNYQTFTTAIFQEYEMSFNNSTAALLSA
FT                   VLMAICILIVFGEIFFRGKQTLYHSGKGVTRPYLVKTLSFGKQCLTFGFFSSIFILSIG
FT                   VPVIMLIYWLIVGTSLESAGDFSEFLSAFSNSFIISGLGALLTVMCALPLVWAAVRYRS
FT                   YLTIWIDRLPYLLHAVPGLVIALSLVYFSIHYANDLYQTFFVIIIAYFMLYLPMAQTTL
FT                   RASLEQLSDQIEKVGQSLGRSPFYIFRTLTLPAILPGVAAAFALVFLNLMKELTATLLL
FT                   TPNDIKTLSISVWEHTSDAQYAAATPYALMLVLFSGIPVFLLKKYAFK"
FT   CDS_pept        102355..103425
FT                   /transl_table=11
FT                   /locus_tag="HICON_03730"
FT                   /product="iron-utilization ATP-binding protein hFbpC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85836"
FT                   /protein_id="CBY85836.1"
FT                   /translation="MRLNKMINNPLLTVKNLNKFFNEQQVLHDISFSLQRGEILFLLGS
FT                   SGCGKTTLLRAIAGFEQPSNGEIWLKERLIFGENFNLPTQQRHLGYVVQEGILFPHLNV
FT                   YRNIAYGLGNGKGKNSEEKMRIEQIMQLTGIFELADRFPHQLSGGQQQRVALARALAPN
FT                   PELILLDEPFSALDEHLRQQIRQEMLQALRQSGASAIFVTHDRDESLRYADKIAIIQQG
FT                   KILQIDTPRTLYWSPNHLETAKFMGESIVLPANLLDENTAQCQLGNIPIKNKSISQNQG
FT                   RILLRPEQFSLFKTSENPTALFNGQIKQIEFKGKITSIQIEINGYAIWIENVISPDLSI
FT                   GDNLPVYLHRKGLFYA"
FT   CDS_pept        complement(103460..104140)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03740"
FT                   /product="putative D-alanyl-D-alanine carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85837"
FT                   /protein_id="CBY85837.1"
FT                   /translation="MKLTPEMLTGKSREHLVNLPATHSSNHFLQTQAVQAFQALQQSAA
FT                   KNGFNLQPASSFRDFERQQLIWNSKFKGERKVHDDAGKALDLNQLDDWQKCQAILRWSA
FT                   LPAASRHHWGTEVDIFDPDLLPQGQSLQLEPWEYEKGGYFFELSEFLAENLPHFDFALP
FT                   FMNMQSNKKVGREPWHISYLPLAELASQQFSPEILQQAWKGENILGTDCLISHLEQIFS
FT                   EYIV"
FT   CDS_pept        complement(104142..105275)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03750"
FT                   /product="Putative succinyl-diaminopimelate desuccinylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85838"
FT                   /protein_id="CBY85838.1"
FT                   /translation="MREKVVSLAQDLIRLPSISPNDEGCQQIIAERLEKLGFQIEWMPF
FT                   NDTLNLWAKHGTSEPVIAFAGHTDVVPTGDENQWSSPPFSAEIIDGMLYGRGAADMKGS
FT                   LAAMIVAAEEYVKANPNHKGTIALLITSDEEAAAKDGTVRVVETLMARDEKITYCMVGE
FT                   PSSAKNLGDVVKNGRRGSITGNLYIQGIQGHVAYPHLAENPIHKAAPFLQELTTYQWDK
FT                   GNEFFPPTSLQIANIHAGTGSNNVIPAELYIQFNLRYCTEVTDEIIKQKVAEMLEKHNL
FT                   KYRIEWNLSGKPFLTKPGKLLDSITSAIEETIGITPKAETGGGTSDGRFIALMGAEVVE
FT                   FGPLNSTIHKVNECVSVEDLGKCGEIYHKMLVNLLDS"
FT   CDS_pept        complement(105303..105647)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85839"
FT                   /protein_id="CBY85839.1"
FT                   /translation="MITVYGIKNCDTVKKALKWLADHNIEHKLHDYRVDGLDLNFLTQA
FT                   ETQFGWDVLVNKRSTTWRNLNEQVKNSLDKTTALSVLAENPTLIKRPIILQDGKALIGF
FT                   NEKEYQAAFA"
FT   CDS_pept        complement(105726..107606)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03770"
FT                   /product="chaperone protein HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85840"
FT                   /protein_id="CBY85840.1"
FT                   /translation="MSQNQETRGFQSEVKQLLQLMIHSLYSNKEIFLRELISNASDAAD
FT                   KLRFKALSNPALYEGDGDLRVRVSFDADKGTITISDNGIGMTREQVIDHLGTIAKSGTK
FT                   EFLTALGQDQAKNSQLIGQFGVGFYSAFIVADKVTVKTRAAGEEADKAVLWESAGEGEY
FT                   SVADIEKKSRGTDVILHLREDEKEFLNEWRLREIIGKYSDHIGLPVEMLTKEYDDEGKE
FT                   CGEKWEKINKSDALWTRSKNDVSDEEYKAFYKHLSHDFVDPVTWAHNKVEGNQAYTSLL
FT                   YVPAKAPWDLFNREHKHGLKLYVQRVFIMDDAEQFMPNYLRFMRGLIDSNDLPLNVSRE
FT                   ILQDNKITAALRKALTKRSLQMLEKLAKDDAEKYLQFWKEFGLVLKEGPAEDFANKETI
FT                   AKLLRFASTHNDGSEQTVSLEDYILRMKEGQKAIYYITADSYVAAKNSPHLELFNKKGI
FT                   EVLLLSDRIDEWMLSYLTEFDGKQLQSITKADLDLGDLADKESETQKQQDEAFGSFIER
FT                   VKNLLGERVKTVRLTHNLTDTPAVVSTDNDQMTTQMAKLFAAAGQPVPEVKYTFELNPE
FT                   HHLVKKVADIADETEFADWVELLLEQAMLAERGSLENPAAFIKRINKLLG"
FT   CDS_pept        107916..108671
FT                   /transl_table=11
FT                   /locus_tag="HICON_03780"
FT                   /product="conserved hypothetical NIF3-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85841"
FT                   /protein_id="CBY85841.1"
FT                   /translation="MNNLELEQLINQKLSSDKINDYAPNGLQVEGKTEIKKIITGVTAS
FT                   QALIDYAISQNADAILVHHGYFWKSENPCIRGMKGKRIKALLVNDINLYGYHLPLDVHP
FT                   ELGNNAQLAKLLDIENLQPLEKGSVSIPVWGEFKEPMTGKDFAEKIEKVLNRKPLICIE
FT                   NGPHLIRKIGICTGGGQGYIDLAAEQGCDAFITGEVSEQTIHSAREQGLHFFSAGHHAT
FT                   ERYGIKALGEWLANEYGFDVEFKDIDNPA"
FT   CDS_pept        108847..111219
FT                   /transl_table=11
FT                   /locus_tag="HICON_03790"
FT                   /product="putative type I restriction-modification system,
FT                   methyltransferase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85842"
FT                   /protein_id="CBY85842.1"
FT                   /translation="MDHSVHNKLVSFIWSIADDCLRDVYVRGKYRDVILPMFVLRRLDT
FT                   LLEPSKDAVLEEMRFQKEELAFTELDDLPLKKITGHVFYNTSKWTLKSLYQTASNTPQY
FT                   MLANFEEYLDGFSTNVHEIINCFKLREQIRHMSHKNVLLSVLEKFVSPYINLTPKEQQD
FT                   TEGNKLPALTNLGMGYVFEELIRKFNEENNEEAGEHFTPREVIELMTHLVFDPLKDQIP
FT                   AIITIYDPACGSGGMLTESQNFIEQKYPLSESQGERSIFLFGKETNDETYAICKSDMMI
FT                   KGDNPENIKVGSTLATDSFQGNHFDFMLSNPPYGKSWSKDQAYIKDGNEVIDSRFKVTL
FT                   PDYWGNVETLDATPRSSDGQLLFLMEMVNKMKSPKNNKIGSRVASVHNGSSLFTGDAGS
FT                   GESNIRRHIIENDLLEAIVQLPNNLFYNTGITTYIWLLSNNKPEARKGKVQLIDASLLF
FT                   RKLRKNLGDKNCEFVPEHISEITQNYLDFTAKARETDSQNEAVGLASQIFDNQDFGYYK
FT                   VTIERPDRRSAQFTVENIASLRFDKALFEPMQYLYRQYGGQVYNAGFLTQTEQEITAWC
FT                   EAQGIALNNKNKAKLLDVKTWEKAAALFQTASKLLEHFGEQQFDDFNQFKQAVECRLKT
FT                   EKIPLSATEKKAIFNAVSWYDENSAKVIAKTLKLKPNELDALCQRYQCQADGLADFGYY
FT                   TTGKAGEYILYETSSDLRDSESIPLKQNIHDYFKAEVQAHISEAWLNMESVKIGYEISF
FT                   NKYFYRHKPLRSLAEVAQDILALEKQADGLISEILEA"
FT   CDS_pept        111348..112811
FT                   /transl_table=11
FT                   /locus_tag="HICON_03800"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85843"
FT                   /protein_id="CBY85843.1"
FT                   /translation="MTEPLSKINGIITKNYLEMQPENQYFERKGLGEKDIKPTKIAEEL
FT                   VGMLNADGGVLAFGVADNGEIQDLNSLGDKLDDYRKLVFDFIAPPCRIGLEEILVDGKL
FT                   VFLFHVEQDLERIYCRKDNENVFLRVADSNRGPLTREQIKNLEYDKNIRLFEDEIVPDF
FT                   NEEDLDQELLELYKKKVNFTSDNILDLLYKRNLLTKKEGCYQFKKSAILLFSTMPERYI
FT                   PSASVRYVRYEGTVAKVGTEHNVIKDQRFENNIPKLIEELTYFLRASLRDYYFLDINQG
FT                   KFIKVPEYPEEAWLEGVVNALCHRSYNVQGNVIYIKHFDDRLEISNSGPLPAQVTIENI
FT                   KTERFARNPRIARVLEDLGYVRQLNEGVSRIYESMEKSLLAKPEYREQHNNVYLTLRNR
FT                   VTAHEKTVSTATMLQIEKEWTNYNDTQKAILLYLFTNGTAILSELVDYTKINQNSIRAY
FT                   LNAFIQQGIIERQSVKQRDPNAKYAFRKD"
FT   CDS_pept        112984..114243
FT                   /transl_table=11
FT                   /locus_tag="HICON_03810"
FT                   /product="Putative type I site-specific
FT                   restriction-modification system, S subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85844"
FT                   /protein_id="CBY85844.1"
FT                   /translation="MRRYESYKDSGVDWLGEVPSHWELKRLKQLFVEKKHKQSLSLNCG
FT                   AISFGKVIEKSDDKVTEATKRSYQEVLKGEFLINPLNLNYDLISLRIALSEIDVVVSAG
FT                   YIVLKEKQIINKKYFSYLLHRYDVAYMKLLGSGVRQTINYGHISDSILVIPPLSEQQKI
FT                   AQFLDDKTAKIDQAVDLAEKQIALLKEHKQILIQNAVTRGLNPDVPLKDSGVEWIGQVP
FT                   EHWEVVSMKRVVKEHSGNGFPIDLQGNNGNIPFLKVSNFSENQDKYIFKWNNSVTNKVI
FT                   KQKKWNIVPKNSIVTAKIGEALRKNHRKILSIDSIIDNNCLGIEIKKADVLFGYYLHCA
FT                   LDFDLFTNPGTIPSLAMDKYRNQKIVLPPFQEQQEIADYLEQQTAKIDQAIALKTAHIE
FT                   KLKEYKSVLINDVVTGKVQV"
FT   CDS_pept        114344..117364
FT                   /transl_table=11
FT                   /locus_tag="HICON_03820"
FT                   /product="restriction endonuclease, type I, R subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85845"
FT                   /protein_id="CBY85845.1"
FT                   /translation="MVSGTKEKDLEIAIEKALTGTWRENMENKLGEPKAEYLPRHHGFE
FT                   LAFSQDFDAQFAIDTRLSWQFLQTSQEAELGRFQQLNPNDWQRKILERLDRQIKKNGVL
FT                   HLLKKGLDIDSAHFDLLYPVPLASSGEKVKQRFEQNLFSCMRQVPYSASSNETVDMVLF
FT                   VNGLPIITLELKNHWTGQTAIDAQKQYRNRDLSQTLFHFGRCLAHFALDTEEAYMTTKL
FT                   AGPATFFLPFNLGNNCGKGNPPNPNGHRTAYLWQEVFGKASLANIIQHFMRLDGSTKDP
FT                   LDKRTLFFPRYHQLEVVRHLIADVSEQGVGKRYLIQHSAGSGKSNSITWLAYQLIEAYP
FT                   RNKQAANGREADRPIFDSVIVVTDRRLLDKQLRDNIKDFSEVKNIVAPALSSAELRQSL
FT                   EQGKKIIITTIQKFPFIVDGIADLGDKQFAVIIDEAHSSQSGSAHDNMNRAIGKTEDLD
FT                   AEDVQDLILQTIQSRKMHGNASYFAFTATPKNSTLEKFGEKQADGKFKPFHLYSMKQAI
FT                   EEGFILDVIANYTTYKSFYEITKSIEDNPEFDSKKAQSRLKAYVERSQQTIDTKAEIML
FT                   DHFIRQIFNRKKLKGKAKGMVVTQNIETAIRYFQALKHLLAGRGNPFKIAIAFSGSKVV
FT                   DGVEYTEAEMNGFAESETKEYFDQDEYRLLVVANKYLTGFDQPKLCAMYVDKKLSGVLC
FT                   VQALSRLNRSANKLSKRTEDLFVLDFFNSVEDIQQAFKPFYTSTSLSQATDVNVLHDLK
FT                   DRLDETGVYEQAEVNDFTEGYFANKDAQQLSSMIDVAVQRFDDELDLDRNEKVDFKIKA
FT                   KQFLKIYGQTASIINFENIAWEKLYWFLKFLVPKLKVQDPMDEFDEILDAVDLSSYGLA
FT                   RTKLNYSIKLDDEETGLDPQNPNPRGTHGEDKEKDPIDEIIRVFNERWFQGWSAMPDEQ
FT                   RVKFINITERIRNHKDFEQKYQNNPDIHTRELAFQAILRDVMSERHRDELELYKLFAKD
FT                   AAFRTAWTQSLQRALAG"
FT   CDS_pept        complement(117575..118777)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03830"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85846"
FT                   /protein_id="CBY85846.1"
FT                   /translation="MSKTMISRENYLQQLIQFKDTDFIKVISGVRRSGKSVLLMQYRDY
FT                   LQQQGISPENILYLNFESFEYQWVKDAQDFQQLIQEKMPSSQEKIYFLIDEIQFVEGWQ
FT                   KIVNALRVSFNTDIVITGSNANLLSGELATLLSGRYVEIKIYPLSFKEFLRSQNVDSQS
FT                   RLVDKLYSEYEKYGGFPSVVMADEPLKETILSGIFDSIVLNDIAHRAGVKDTHILKSVI
FT                   LFLADNVGQLVNPSKISNTLTSERVPTSNHTISKYLDLLENAFLFYKAKQYDIRGKGYL
FT                   KTNAKYFIVDNGLRRHAIGKKGANYANRLENIVFIELLRRGYTVDVGKLDSKEIDFIAR
FT                   KADEILYVQVAFEIPENTHETDNLLYIQDNYKKILITGKYYEQTEIDGIEVIYVVDWLL
FT                   Q"
FT   CDS_pept        119155..120039
FT                   /transl_table=11
FT                   /locus_tag="HICON_03840"
FT                   /product="predicted glutamine amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85847"
FT                   /protein_id="CBY85847.1"
FT                   /translation="MVLNRSNIVRLYLIKVMCQLLGMNCNTPTDIVFSFEGFRRRAGLT
FT                   DCHSDGFGIAFFEGRGVRIFRDNQAASLSPIADCIKQYNIKSLNVIAHIRKATQGEVNI
FT                   ENTHPFIREIWGQNWVFAHNGNLKNLPDMTDHFLQPIGSTDSEAAFCYMAEYLKNTFRK
FT                   KPSEMEIFEAIQKVTKELAQHGTFNFILSNGEWMIAHCSTNLHYVMRKAPFGKAHRIDD
FT                   DGVIDFSYYAKAGDKVNIITTFPLTKNESWTKMENGGFVFFKNGEKIAEVIGTPKEAID
FT                   DGTLGNRTINSAI"
FT   CDS_pept        complement(120220..120765)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03850"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85848"
FT                   /protein_id="CBY85848.1"
FT                   /translation="MELSQTALFIGSIINLYALVLILRAWLQFARVDYYSPVSTFAVKM
FT                   TDPVLKPLRKVMPTVKNIDTSALLLVFIIGMLKGIIYFGLSVNVLLVLGVLTVLKSIGL
FT                   AIFYVLFIGAVLSWFNRGNNSISYAFYQLSEPLLKPIRRLLPTLGMIDFSPMVVVFILL
FT                   FLNNFMLDLLGGLWIIAG"
FT   CDS_pept        complement(120765..121712)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03860"
FT                   /product="magnesium and cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85849"
FT                   /protein_id="CBY85849.1"
FT                   /translation="MINAFAINDSRLVRIDEDQTDLNTAIWLDLLEPTGEEREILQEGL
FT                   GQSLASFLELEDIEASARFFEDEDGLHLHSFFYCEDEDNYADLASVAFTIRDGRLFTLR
FT                   DRELPAFRLYRMRSRSQRLLECNSYEVLLDLFETKIEQLADVIENIYADLEELSRVILN
FT                   GKQDEAFDEALNTLTEQEDTSSKVRLCLMDTQRALGFLVRKTRLPTNQLEQAREILRDI
FT                   ESLQPHNESLFQKVNFLMQAAMGYINIEQNKIMKFFSVVSVMFLPATLVASTYGMNFDF
FT                   MPELHFKYGYPMAIGLMIAAALTPYIYFRRKGWL"
FT   CDS_pept        complement(122008..122499)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85850"
FT                   /protein_id="CBY85850.1"
FT                   /translation="MPSFDIVSEITLHEVRNAVENANRVLSTRYDFRGVEAVIELNEKN
FT                   ETIKITTESDFQLEQLIEILIGSCIKRGIEHSSLDIPAESEHHGKLYSKEIKLKQGIET
FT                   EMAKKITKLVKDSKIKVQTQIQGEQVRVTGKSRDDLQAVIQLVKSAELGQPFQFNNFRD
FT                   "
FT   CDS_pept        complement(122517..123461)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03880"
FT                   /product="phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85851"
FT                   /protein_id="CBY85851.1"
FT                   /translation="MQIQRFESITQKYPQFPTALLSNKALTQGQDFFILYGTKLDITKL
FT                   EKFQQKCGQNFQIFDVWMVAKNIIVLLKGQWFADFIKFAHDVEVDIAKLDFSPKLSQAG
FT                   LLVMDMDSTAIQIECIDEIAKLAGVGELVSAITESAMRGELDFEQSLRRRVGTLKGAPE
FT                   SILQQVRENLPLMPGLVETIQTLQKYGWKTAIASGGFTYFANYLKALLQLDFAASNQFD
FT                   IEDGKLTGLVKGDVVDTQYKAKTLQHLLEKYGIDSQYSIAIGDGANDLAMMNVAGLGVA
FT                   FHAKPKVQQQAQIVVNFADLTALLCLLSANDRI"
FT   CDS_pept        123848..125845
FT                   /transl_table=11
FT                   /locus_tag="HICON_03890"
FT                   /product="transketolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85852"
FT                   /protein_id="CBY85852.1"
FT                   /translation="MATRRQLANAIRVLAMDSVQKAKSGHPGAPMGMADIAEVLWRDFL
FT                   KHNPTNPKWADRDRFVLSNGHGSMLIYSLLHLTGYDLSIEDLKQFRQLHSKTPGHPEYG
FT                   YAPGVETTTGPLGQGITNAVGMAIAEKTLAGQFNREGHEIVDHHTYVFLGDGCLMEGIS
FT                   HEACSLAGTLGLGKLIAFYDDNNISIDGHVDGWFSDDTAERFEAYGWQVIRNVDGHDAE
FT                   QIRAATVLAQAEKEKPTLIICKTIIGFGSPNKSGSHDSHGAPLGDEEIALTRKALGWEY
FT                   APFEIPAEYYAEWSAKEKGAAAEKSWEEKFAAYAKAYPELAAEFKRRVSGELPTNWAAE
FT                   SKAFIEKLQANPASIASRKASQNAIEAYAHVLPEFLGGSADLASSNLTLWSGSKPIRAH
FT                   ENVGGNYINYGVREFGMSAIMNGIALHGGFIPYGATFLMFYEYAHNAVRMAALMKQRTL
FT                   FVYTHDSIGLGEDGPTHQPVEQTASLRLIPNLETWRPCDQVESAIAWQQAVERQDGPSA
FT                   LIFTRQNLAQMNRTSAQLDAVKRGAYVLKDCDGTPELIFIATGSEVELAVKAADVLSAE
FT                   GKKVRVVSMPSTNRFDKQDAAYRESVLPTAVTKRVAIEAGIADFWYKYVGFNGRVVGMN
FT                   SFGESAPADQLFKLFGFTVENVVAKAKEIL"
FT   CDS_pept        complement(125970..126971)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03900"
FT                   /product="biotin synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85853"
FT                   /protein_id="CBY85853.1"
FT                   /translation="MLAEKLQINSITPHPSVEYWSVCKVEALFETPFLELVYRAAQVHR
FT                   KHFNPRAIQLSTLMSIKTGGCPEDCGYCPQSARYHTGVQNQQLLDVDEIVAKAKIAKAR
FT                   GAGRFCMGAAWRGPKPKDIEKVTEIIKAVKSLGLETCGTFGLLQDGMAEDLKEAGLDYY
FT                   NHNLDTAPEHYAEVIGTRRFDDRLSTLGKVRKAGLKVCCGGIVGMNETRKERAGLIASL
FT                   ANLDPQPESVPINQLVKVEGTPLADAEELDWTEFVRTIAVARITMPKSYVRLSAGRSGM
FT                   TEEMQAMCFMAGANSIFYGDKLLVTDNPEEDGDQLLMAKLDLEPETAENKKL"
FT   CDS_pept        complement(127083..127730)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03910"
FT                   /product="thiamin transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85854"
FT                   /protein_id="CBY85854.1"
FT                   /translation="MIYLNNVILNDKTLPICFNLNVKAGERIAIIGESGAGKSTLLNLI
FT                   SGFEFPHQGEIWLNDKNYTRSAPYERPVSMLFQENNLFPHLTVQQNLALGIKPSLKLTA
FT                   LEQEKIEQVACSVGLGDYLERLPNSLSGGQKQRVALARCLLRDKPILLLDEPFSALDQK
FT                   LRVEMLALIAKLCDEKDLTLLLVTHQPSELVGMIDRVLVVGNGQISQLRKGM"
FT   CDS_pept        complement(127714..129330)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03920"
FT                   /product="thiamine transport system permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85855"
FT                   /protein_id="CBY85855.1"
FT                   /translation="MFSLFHHPQLRPRHYAGGVVVISFIILFYGSALSSIFALGDELQW
FT                   RAWFTDDYLQHLILFSFGQALLSTVLSIFFGLLLARALFYKPFLGKKWLLKLMSLTFVL
FT                   PALVVIFGLIGIYGSSGWLAWLANLFGMSWQGHIYGLSGILIAHLFFNIPLAAQLFLQS
FT                   LQSIPYQQRQLAAQLNLQGWQFVKLVEWPVFRQQCLPTFSLIFMLCFTSFTVVLTLGGG
FT                   PQYTTLETAIYQAILFEFDLPKAALFAMLQFVFCLILFSLTSRFSLSNQNGLSNSNIWF
FT                   EKPKSAVKIFHILVLLVFVFFLFSPVLNILISALSSSNLLTVWHNSQLWRALGYSLSIA
FT                   PLSALLALTMAIALLLLSRRLEWLNYQKISQFIINAGMVILAIPILVLAMGLFLLLQDR
FT                   DFSNIDLFVIVVFCNALSAMPFVLRILSAPFHNNMRYYENLCNSLGIVGWQRFYLIEWQ
FT                   TLRAPLRYAFALGLALSLGDFTAIALFGNQEFTSLPHLLYQQLGNYRNQDAAVTAGILL
FT                   LLCGILFAFIHTHRDADDLSK"
FT   CDS_pept        complement(129335..130333)
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="HICON_03930"
FT                   /product="thiamine-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85856"
FT                   /protein_id="CBY85856.1"
FT                   /translation="MKLLKLTLISTALFSTAALAQAQQSVNVYSYDSFTSEWGAGPKVK
FT                   QDFEKAHPQCTINFTPFESVGVLLNRVRLEGKKTKADIVLGLDNFFLEQAEKTGIFVPN
FT                   NVDLTQLDLPTKWANKTFLPFDFGNYAFVYDKTKLQNPPKSLKELVERQDLSVIYQDPR
FT                   TSSVGRGLLVWMNAVYPADKIQSAWKELDKHTVTVGKGWSDTYGAFLKGEADLVLSYST
FT                   SPLYHQLFEKKDNYAATDFAEGHITQVELAARVANHPNQCADDFMAFLISPTAQKHIVT
FT                   ANIMLPVIQGEIEPHFDALKVQQKTQTSINPTVNAEQLKNWISTWQTTLTK"
FT   CDS_pept        complement(130580..130927)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85857"
FT                   /protein_id="CBY85857.1"
FT                   /translation="MKLMKTLFTSVVLCGALVVSSSFAEEKATEQTAQPVVATQAEAQI
FT                   ALAVVSDKLNINTATASEIQKSLTGIGAKKAEAIVQYREKHGNFTNAEQLLEVQGIGKA
FT                   TLEKNRDRIIF"
FT   CDS_pept        complement(131096..132040)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03950"
FT                   /product="4-hydroxy-3-methylbut-2-enyl diphosphate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85858"
FT                   /protein_id="CBY85858.1"
FT                   /translation="MKIILANPRGFCAGVDRAISIVELALEIHGAPIYVRHEVVHNRFV
FT                   VNGLRERGAIFVEELSEVPDGAIVIFSAHGVSQAVRQEAKDRNLKVFDATCPLVTKVHM
FT                   QVARASRKGTKAILIGHKGHPEVEGTMGQYSNEDGGIFLIEKVEDIARLPMQENDNLTF
FT                   MTQTTLSLDDTAETIAALKEKYPAIQGPHKNDICYATTNRQEAVRELAKLSDLVLVVGS
FT                   KNSSNSNRLAELASRMGVKSQLLDDPANIQADWFNDVKTIGITAGASAPEELVQSIISR
FT                   LKRFGANSIEELQGLEENMFFEVPKELRIKEVN"
FT   CDS_pept        complement(132037..132552)
FT                   /transl_table=11
FT                   /gene="lspA"
FT                   /locus_tag="HICON_03960"
FT                   /product="lipoprotein signal peptidase"
FT                   /EC_number="3.4.23.36"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85859"
FT                   /protein_id="CBY85859.1"
FT                   /translation="MSKKSGLSFLWLSAVAFVVDLLTKYIVVQKFDLYESVNVLPVFNL
FT                   TYVRNYGAAFSFLADHSGWQQYFFILLALAISGMLVYFLAKNNAEQKIQNSAYALIIGG
FT                   ALANMVDRAYNGFVVDFFDFYWDIYHYPVFNIADIAICIGAGLLVLDAFKSEKKKVQDK
FT                   QVEKCGQK"
FT   CDS_pept        complement(132622..134181)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03970"
FT                   /product="predicted hydrolase, inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85860"
FT                   /protein_id="CBY85860.1"
FT                   /translation="MMFGKKIIHSKTIWFYFLLFLFSIFTNMGLGNVLSENIPVSDYAI
FT                   LFVITAISFYFTPWLGRILITVLFLSALFYCSAGFFYGIPSLGIIASVYETNINETLEY
FT                   YTTIPFWIFLFQVSYIILFVALMKLSFYVKQQAFKWLNMAVISLLLVFSYNQFSNWNYA
FT                   YKFRFYPVLFYSELDRMNDLYLEQRDFLNQSVNAPSQWDIQSFTPKYKNYILIIGESMR
FT                   KDYMSLYGFPLKTTPFLERVKGTIFENYYSAAPNTQPSLQRTLYRAEKEETVYTDNIIS
FT                   LAKKAGVKTYWISNQGKIGEFDTMASRIGQSADETIFMKPLGYNSKKVYDDEMLPVLDK
FT                   VLKENISNSKLIVIHLIGSHPAFCERLPYEVKNYFINQSMSCYLESIKYTDQFLEKLNS
FT                   QLVAQNESYSVIYFSDHGLAHYNDSKGLSLHPNNLYKQDYEIPFIMFSSDSQKVEKIKT
FT                   PQSAFNFVYGFADWMGIKEKHLQGVDFFHPEKQEIKVFDWNNVVNVKELADDPAKLPET
FT                   VQ"
FT   CDS_pept        complement(134269..136137)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03980"
FT                   /product="peptidyl-prolyl cis-trans isomerase D"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85861"
FT                   /protein_id="CBY85861.1"
FT                   /translation="MLIEKMHNLTNSKISKFILGLITVSFLVGGMSGYLFSSNDTYAAK
FT                   VNGEVISQQDFLNRYNQEFEIRAQREGEAFVAQSDSPEFVTALRQNIVNLMIDQELLRQ
FT                   YVKELKLGVSDEMIKRAIVTDPNFQVKGKFDNAVYQRILQQNHLTSDGYASILRASLPL
FT                   EQIQNGVANSEFIVPAQVKNSAEVFFQKRLARLATLSLADEMAKQSVSDDEIKTYYEAN
FT                   QKSFVQPEQVKVQYIDLSADNISRNLQVTDVEIAQYYQDNKAQFMTQHLAHIQFANEQD
FT                   AKVAYEELQKGANFADVAKAKSLDKISGENGGDLGWVNENELPKAFEDAAAALQVGQYS
FT                   QPINVDGNYHIVLVQERKAQSLENVKAQIADLVRKSLMESRYFSLEKQASDKAFEDSKF
FT                   LNTAAQAAGVKVQESDYFSRQNVPAGLNFPNVIYTIFESDTTNVGMNSEPINVGDYHTI
FT                   IVRVLDRKAEGVKSLEEAKIDIETFLKRQKAENSLNEKAQQAVKKLNENPESKVDGINF
FT                   SSEQTFTLSENKDPILTNGIFSIAKPESSKALYQVVHNSNGDVVVVALNKVEQGSLSEK
FT                   ELSQFGMQLLRSHQSELQLQLIQGLRERAKIEVNDSFINQDDEVQQ"
FT   CDS_pept        complement(136326..137684)
FT                   /transl_table=11
FT                   /locus_tag="HICON_03990"
FT                   /product="tRNA modification GTPase mnmE"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_03990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85862"
FT                   /protein_id="CBY85862.1"
FT                   /translation="MKETIVAQATAPGRGGIGILRVSGPLATKVAQAILGKCPKPRMAD
FT                   YLPFKDADGTILDQGIALYFKSPNSFTGEDVLELQGHGGQVVLDLLLKRILQIDGIRLA
FT                   RPGEFSEQAFLNDKLDLAQAEAIADLIDATSEQAVRSALKSLQGEFSKKVNELVDSVIY
FT                   LRTYVEASIDFPDEEIDFLADGKIEANLRGIINQLEDVRSEAKQGSILREGMKVVIAGR
FT                   PNAGKSSLLNALAGHEAAIVTDIAGTTRDVLREHIHIDGMPLHIIDTAGLRNATDEVER
FT                   IGISRAWTEIEQADRIILMLDSSDPESADLSKVRSEFLAKLPSTLPVTIVRNKIDLNGE
FT                   QASESEQGGYQMISLSAQTHDGVQLLREHLKQAMGFQTGMEGGFLARRRHLDALDKAAE
FT                   HLQIGLVQLTEFHAGELLAEELRLVQSYLSEITGQFTSDDLLGNIFSSFCIGK"
FT   CDS_pept        complement(137843..139468)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04000"
FT                   /product="Inner membrane protein oxaA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85863"
FT                   /protein_id="CBY85863.1"
FT                   /translation="MDSRRSLLVLALIFISFLVYQQWQLDKNPPVQTEQTTSITATSDV
FT                   PASSPSNSQAIADSQTRGRIITLENDVFRLKIDTLGGDVISSELLKYDAELDSKTPFEL
FT                   LKDTKEHIYIAQSGLIGKNGIDTRSGRAQYQIEGDNFKLAEGQESLSVPLLFEKDGVTY
FT                   QKIFVLKRGSYDLGVDYKIDNQSGQAIEVEPYGQLKHSIIESSGNVAMPTYTGGAYSSS
FT                   ETNYKKYSFSDMQDNNLSIDTKAGWVAVLQHYFVSAWIPNQDVNNQLYTITDSKNNVAS
FT                   IGYRGSVVTIPAGSQETITSSLWTGPKLQNQMATVANNLDLTVDYGWAWFIAKPLFWLL
FT                   TFIQGIVSNWGLAIICVTIVVKAILYPLTKAQYTSMAKMRILQPKMQEMRECFGDDRQR
FT                   MSQEMMKLYKEEKVNPLGGCLPILLQMPIFIALYWTFLEAVELRHAPFFGWIQDLSAQD
FT                   PYYILPILMGISMFLLQKMSPTPVTDPTQQKVMNFMPLVFMFFFLWFPSGLVLYWLVSN
FT                   LITIAQQQLIYRGLEKKGLHSRKK"
FT   CDS_pept        complement(139468..139728)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85864"
FT                   /protein_id="CBY85864.1"
FT                   /translation="MAETHSLGTKILIKIIRLYQIMISPFIGARCRFVPTCSCYGIEAL
FT                   KTHGLLKGGWLTLKRVLKCHPLNAGGFDPVPPKTNNNDEKK"
FT   CDS_pept        complement(139692..140051)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04020"
FT                   /product="Ribonuclease P protein component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85865"
FT                   /protein_id="CBY85865.1"
FT                   /translation="MVKLNFSRELRLLTPIQFKNVFEQPFRASTPEITILARKNNLEHP
FT                   RLGLTVAKKHLKRAHERNRIKRLVRESFRLSQHRLPAYDFVFVAKNGIGKLDNSAFAQI
FT                   LEKLWQRHIRLAQKS"
FT   CDS_pept        complement(140064..140198)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04030"
FT                   /product="50S ribosomal subunit protein L34"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85866"
FT                   /protein_id="CBY85866.1"
FT                   /translation="MKRTFQPSVLKRSRTHGFRARMATKNGRQVLARRRAKGRKSLSA"
FT   CDS_pept        complement(140374..141834)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04040"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85867"
FT                   /protein_id="CBY85867.1"
FT                   /translation="MKNGVKQISFLSLIGLSLIGLSLTNVAWAKVARPKNDTLTNTIQS
FT                   AELKTSSFSSMPKKEIPNRHIISLSKSQLAQHPRLVLRGLILALYQNNTQAVQLLLPLY
FT                   KQFPQQDNFLLTWAKAIEAREQGDLTQSIAYYRELFALNASLLPLRYQLAQALFFNYEN
FT                   ESAKIQFEKLRTEVDDEKFLGVIDHYLLTLNQRNQWIWQVGLNFLNDDNLNNAPKSGTK
FT                   IGNWTAWEKESGKGVGYSLSVEKKWPWADHFFSKTMFNGNGKYYWDNKKYNEATFRIGG
FT                   GLGYQTALVEVSLFPFQEKRWYAGGSSGTNTMKQYADKLGIRLENVDWLSKTWQISTAL
FT                   EYGKSRYKIRKHLDGDYYFISSTLFYLPKSTQFWFVGMDFHRENTQALDNAYQQKTLRF
FT                   GWGQDWSYGISSRLTFSYANRVYREKDLIGIQQKNREYTTTITLWHRNIHFMGLTPKLS
FT                   WDYQKSTSNHAFYRYDKNRIYLEIGKIF"
FT   CDS_pept        141931..143853
FT                   /transl_table=11
FT                   /locus_tag="HICON_04050"
FT                   /product="Transferrin-binding protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85868"
FT                   /protein_id="CBY85868.1"
FT                   /translation="MKSVPLITGGLSFLLSACSGGGSFDVDNVSNPSSSKPRYQDDTSN
FT                   QRTKSKLEKLSIPSLGGGMKLVAQNIHPNSSKEPSLLNDYSVLTDPSLIMNDVEKNNKN
FT                   GATLIGSIDEPKAQNPTKNLHGQQYVYSGLYYSQSWDLKDYSKKKWYSGFYGYAYYFGK
FT                   QTATTLPVDGVATYKGTWDFITATENRKSYPLFSNARSQAYSRRSAIPEDIDLENDPKN
FT                   EREKGLVSEFSANFGTKKLTGELFYTKRKTNNQEYKKEKLYDIDANIYSNRFRGKVIPK
FT                   ESTSNDHPFTSEGTLEGGFYGPNAEELGGKFLAGDNRVFGVFSAKENPENKALSRETLI
FT                   DGKLITFSTKKTDAKTNKTTNTTTDVKTDEKNFTTENISSFGEADYLLIDNYPVPLLPE
FT                   EKTDDFVTSKHHDIGNKRYKVEACCKNLSYVKFGMYYEDPLNGENGKEKQKDKEEKDKQ
FT                   TTTSIKTYYQFLLGHRTPSSEIPTMGNVKYHGSWFGYIGDGTTSYSATGNKQQNNNAVA
FT                   EFNVNFADKKLTGELKRHDNGNTVFKITADLQSGKNDFTGTATATNFVIDGNNSQTKST
FT                   PINITTEVNGAFYGPNATELGGYFTYNGNSTAKNSPAVSSSPNSQNARAAVVFGAKKQV
FT                   ETNNK"
FT   CDS_pept        143881..146628
FT                   /transl_table=11
FT                   /gene="tbpA"
FT                   /locus_tag="HICON_04060"
FT                   /product="transferrin-binding protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85869"
FT                   /protein_id="CBY85869.1"
FT                   /translation="MTKKPYFRLSIISCLLISCYVKAETQSIKDTKEAISSEVDTQSTE
FT                   DSELETISVTAEKVRDRKDNEVTGLGKIIKTSESISREQVLNIRDLTRYDPGISVVEQG
FT                   RGASSGYSIRGMDRNRVALLVDGLPQTQSYVVQSPLVARSGYSGTGAINEIEYENVKAV
FT                   EISKGGSSSEYGNGALAGSVTFQSKSAADILEGDKSWGIQTKNAYSSKNKGLTHSLAVA
FT                   GKQGGFEGVAIYTQRNSEETQIHPDALKGVQSYDRLIAKTDTSSGYFVMENECPNGYDN
FT                   CKTSAKPPATLSSQRETTSVSDYTGANRIKPNPMKYESQSWFLRGGYHFSEQHYIGGIF
FT                   EFTQQKFDIRDMTFPAYLSPTEDKDLERPSFYPKQDYGAYQRIGDGRGVKYASGLYFDE
FT                   HHRKQRVGIEYIYENKNKAGIIDKAVLSANQQNIILDSYMQHTHCSLYPNPSKNCRPTL
FT                   DKPYSYYHSDRNVYKEKHNMLQLNLEKKIQQNWLTHQIVFNLGFDDFTSALQHKDYLTR
FT                   RVTATAKSIPGKVGKNNQLRNGYKDRPYLYPKPTVSFVGQDHCNYQGNSSNYRDCKVRL
FT                   IKGKNYYFAARNNMALGKYVDLGLGIRYDVSRTKANESTISVGKFKNFSWNTGIVIKPT
FT                   EWLDLSYRLSTGFRNPSFAEMYGWRYGGKNDEVYVGKFKPETSRNQEFGLALKGDFGNI
FT                   EISHFSNAYRNLIAFAEELSKNGTTGKGNYGYHNAQNAKLVGVNITAQLDFNGLWKRIP
FT                   YGWYATFAYNRVKVKDQKINAGLASVSSYLFDAIQPSRYIIGLGYDHISNTWGVNATFT
FT                   QSKAKSQNELLGKRALGNNSRDVKSTRKLTRAWHILDVSGYYMVNKNIMLRLGIYNLFN
FT                   YRYVTWEAVRQTAQGAVNQHQNIGNYTRYAASGRNYTLTLEMKF"
FT   CDS_pept        146820..148184
FT                   /transl_table=11
FT                   /locus_tag="HICON_04070"
FT                   /product="chromosomal replication initiator protein DnaA,
FT                   DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85870"
FT                   /protein_id="CBY85870.1"
FT                   /translation="MNLSNLWQSCLLQLQDQVSASDLSTWLRPLQADVVADNHIVLYAS
FT                   NMFVKGWVETHYLAQIQQICQTLAQNPELRISLKEGVKPAPKVVENAPSDTPKTESAVD
FT                   FQAESSASVKFESHLNTKHLFDNFVEGKSNQLARAVGQKLAQAPGEPSANPFFLYGGTG
FT                   LGKTHLLHAIGNGILADKPNARVLYIHANNFMQHMVKAVRDNKMDQFKKFYRSLDALLV
FT                   DDIQFFAEKEKTQEEFFHIFNNLFETGRQIILTSDRYPKEIEKIEERLKSRFGWGLTTA
FT                   IEPPDLETRVAILLKKAEEHNMNLPEEVAFFIAQRLRTNVRELEGALNRVKAMQDFKGG
FT                   DIDIDFVRDTLKDILALQERLVTIENIQKVVAEYYRIKVSDLKSKSRARSVTRPRQIAM
FT                   ALAKELTNRSLPEIGRAFDRDHTTVLNACREVPKFREQDNSIQEDWANLIRTLSA"
FT   CDS_pept        148197..149297
FT                   /transl_table=11
FT                   /locus_tag="HICON_04080"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85871"
FT                   /protein_id="CBY85871.1"
FT                   /translation="MQFSISRENLLKPLQQVCGVLSNRPNIPVLNNVLLQIEDNRLTIT
FT                   GTDLEVELSSQTQLSSSSENGTFTIPAKKFLDICRTLSDESEITVTFEQDRALVQSGRS
FT                   RFTLTTQPAEEYPNLTDWQSEVDFELPQNTLRRLIEATQFSMANQDARYFLNGMKFETE
FT                   GNLLRTVATDGHRLAVCTISLEQELQNHSVILPRKGVLELVRLLETNDEPARLQIGTNN
FT                   LRVHLKNTVFTSKLIDGRFPDYRRVLPRNATKIVEGNWEMLKQAFVRASILSNERARSV
FT                   RLSLKENQLKITASNTEHEEAEEIVDVNYNGEELEVGFNVTYILDVLNTLKCNQVRMCL
FT                   TDAFSSCLIENCEDSSCEYVIMPMRL"
FT   CDS_pept        149299..150378
FT                   /transl_table=11
FT                   /locus_tag="HICON_04090"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85872"
FT                   /protein_id="CBY85872.1"
FT                   /translation="MAISRLLVEKFRNLTAVDLDFDPCFNFLIGNNGSGKTSLLEAIFY
FT                   LGHGRSFKSAVTNRIISYDEPHFTLFGQIQESQHQWSVGLQKLRQGNTLVKINGEDGNK
FT                   ISDLAHLLPMQLITPEGLTLLNGGPSYRRAFLDWGLFHHQTSFYSAWSNLNRLLKQRNA
FT                   ALAQNQPYSAIKIWDVELAKLAHQVSQWRAEYAEALSPEIEQTCQLFLPELEINVSFHQ
FT                   GWEKNADYYEILQQNFERDRALNYTFAGPQKADFRFKAQGLPVEDVLSRGQLKLLMCAL
FT                   RLAQGEHLMKEKQRHCIFLIDDFASELDQYKRALLAERLQQSGSQVFVTAITQRQLKEM
FT                   QVENKKMFSVHNGIINALN"
FT   CDS_pept        150620..156028
FT                   /transl_table=11
FT                   /locus_tag="HICON_04100"
FT                   /product="Iga1 protease type 2"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85873"
FT                   /protein_id="CBY85873.1"
FT                   /translation="MLNKKFKLNFIALTVAYALTPYTEAALVRDDVDYQIFRDFAENKG
FT                   RFSVGATNVEVRDKDNHSLGNALPNGIPMIDFSVVDVDKRIATLINPQYVVGVKHVSNG
FT                   VSELHFGNLNGNMNNGNAKAHRDVSSEENRYFSVEKNEYPTKLNGKAVTTEDQTQKRRE
FT                   DYYMPRLDKFVTEVAPIEASTASSDAGTYNDQNKYPAFVRLGSGSQFIYKKGDNYSLIL
FT                   NNHEVGGNNLKLVGDAYTYGIAGTPYKVNHENNGLIGFGNSKEEHSDPKGILSQDPLTN
FT                   YAVLGDSGSPLFVYDREKGKWLFLGSYDFWAGYNKKSWQEWNIYKPEFAEKIYQQYSAG
FT                   SLTGSNTQYNWNPTGKTSVISNGSESLNVDLFDSSQDTDSKKNNHGKTVILRGSGTLTL
FT                   NNNIDQGAGGLFFEGDYEVKGTSDSTTWKGAGVSVADGKTVTWKVHNPQSDRLAKIGKG
FT                   TLIVEGKGENKGLLKVGDGTVILKQQADANNKVQAFSQVGIVSGRSTVVLNDDKQVDPN
FT                   SIYFGFRGGRLDLNGNSLKFDHIRNIDEGARLVNHNTSKSSTVTITGDNLITDPNTVSI
FT                   YYVKPRDEDAPYYTFRQIQYGYQLYFNEENRTYYALKKGASIRSEFPQNRGESNDSWLY
FT                   MGTEKLDAQKNVMNHINNERMNGFNGYFGEEENKADQNGKLNVTFSGKTDQNRFLLTGG
FT                   TNLNGELKVEKGTLFLSGRPTPHARDIAGISSTNKDPHFAENNEVVVEDDWINRNFKAT
FT                   NINVTNNATLYSGRNVANITSNITASNKAQVHIGYKTGDTVCVRSDYTGYVTCHNGTLS
FT                   TKALNSFNPTNLRGNVNLTESASFTLGKANLFGTISSTGNSQVRLTENSHWYLTGDSNV
FT                   NQLNLDKGHIHLNSADNSNNVTKYNTLTLNSLSGNGSFYYWVDFTNNKNDKVVVTKSAT
FT                   GNFTLQVADKTGEPTKNELTIFDASKATRNDLKVTLANGKVDRGAWSYTLKETDGRYDL
FT                   YNPEVEKRNLTTVDTPSIATPNNMQADAPSVPSNNEEIARVEAPVPLPAPATPSETTET
FT                   VSENSPQESKTIAKNEQDATETTAQNGEVAQEAKPSVEANTQTNEVAQSGSETEETQTT
FT                   ETARQPEINSTEETAVENGLTSSEPRTEETATVEKDEIQEAPQMASQASPKQAEPAPEK
FT                   VSTDTKVEETQVQAQPQTQPTTVAAAEATSPNSKPAEETQPNEKTNAEPVTPVVSENQA
FT                   EKKVSQPTETEKTAKVETEKTQEAPKVTSQVSPKQEQSETVQPQAELESEKVPTVNNAE
FT                   AQPQTQPSATVSTEQPAPENSINTGSATAIKETAEKSDKPKTETVATTEDDRQPEANTV
FT                   ADNSVANNSTSVKPTENSSTKAERPVTESTTVNTGNSVVENPENTTQPAVNSKSSEPKS
FT                   RRKRSISQPQETSTEETTVTSTEKTTVTSTEKTTIADNSESSNKPNNRRRRSISQPKVT
FT                   SAEEATATSTDETTVADNSKSSKPNRRSRRSVRSKPTVTSGSDRSAMPLSNLTSTNTNA
FT                   VISDAMAKAQFVALNVGKAVSQHISQLEMNNEGQYNVWVSNTSMNENYSSSQYRRFSSK
FT                   STQTQLGWDQTISNNVQLGGVFTYVRNSNNFDKASSKNTLAQVNFYSKYYADNHWYLAV
FT                   DLGYGKFQSNLQTNNNAKFARHTAQFGLTAGKAFNLGNFGITPIVGVRYSYLSNANFAL
FT                   DQDRIKVNPISVKTAFAQVDLSYTYHLGEFSVTPILSARYDANQGSGKINVNQYDFAYN
FT                   VENQQQYNAGLKLKYHNVKLSLIGGLTKAKQAEKQKTAELKLSFSF"
FT   CDS_pept        complement(156142..156744)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04110"
FT                   /product="3-isopropylmalate isomerase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85874"
FT                   /protein_id="CBY85874.1"
FT                   /translation="MAGFKQLSGLVVPLDAANVDTDAIIPKQFLQAITRVGFGKHLFHE
FT                   WRYLDVDGTKPNPEFVLNYPQYQGATILLARKNLGCGSSREHAPWALADYGFKVMIAPS
FT                   FADIFYNNSLNNHMLPIRLSEEEVEEIFQWVWANESKQIHVDLEAMTVTVGDKVYTFEL
FT                   DEFRRHCLLNGLDNIGLTLQHEDKISAYEKNIPAFLR"
FT   CDS_pept        complement(156768..158177)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04120"
FT                   /product="3-isopropylmalate isomerase subunit, dehydratase
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85875"
FT                   /protein_id="CBY85875.1"
FT                   /translation="MAKTLYEKLFDSHIVYEAEGETPILYINRHLIHEVTSPQAFDGLR
FT                   VANRQVRQVNKTFGTMDHSISTQVRDVNKLEGQAKIQVLELDKNTKATGIKLFDITTKE
FT                   QGIVHVMGPEQGLTLPGMTIVCGDSHTATHGAFGALAFGIGTSEVEHVLATQTLKQARA
FT                   KSMKIEVHGKVASGITAKDIILAIIGKTTMAGGTGHVVEFCGEAIQDLSMEGRMTVCNM
FT                   AIEMGAKAGLIAPDETTFAYLKDRPHAPKGKDWEDAVAYWKTLKSDDDAQFDTVVTLEA
FT                   KDIAPQVTWGTNPGQVISVNETIPNPQEMADPVQRASAEKALHYIGLEAGTNLKDIKVD
FT                   QVFIGSCTNSRIEDLRAAAAVMKGRKKADNVKRILVVPGSGLVKEQAEKEGLDKIFIAA
FT                   GAEWRNPGCSMCLGMNDDRLGEWERCASTSNRNFEGRQGRNGRTHLVSPAMAAAAGVFG
FT                   KFVDIRDVTLN"
FT   CDS_pept        complement(158353..159429)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04130"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85876"
FT                   /protein_id="CBY85876.1"
FT                   /translation="MQSYNIAVLAGDGIGPEVMAEAIKVLNRVQEKFGFKLNFNEFYVG
FT                   GAAIDHCGYPLPAETLKGCDQADAILFGSVGGPKWTNLPPDQQPERGALLPLRKHFKLF
FT                   CNLRPATLYKGLEKFCPLRADIAAKGFDMVVVRELTGGIYFGQPKGREGDGAQTKAFDT
FT                   EVYYKYEIERIARAAFEAAMKRNKKVTSVDKANVLQSSILWRETVTEMAKEYPEVTLEH
FT                   IYIDNATMQLIKSPESFDVLLCSNIFGDIISDEAAMITGSMGMLPSASLNEEGFGLYEP
FT                   AGGSAPDIAGKGIANPIAQILSAAMMLRYSFNLNEAADAIESAVQKVLASGHRTADLAD
FT                   TSTPVSTAEMGTLITQAI"
FT   CDS_pept        complement(159515..161062)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04140"
FT                   /product="2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85877"
FT                   /protein_id="CBY85877.1"
FT                   /translation="MTDRVIIFDTTLRDGEQALKASLTVKEKLQIALALERLGVDVMEV
FT                   GFPVSSQGDFESVQTIARHIKNARVAALSRAVDKDIDAAYEALKVAEAFRIHTFIASSA
FT                   LHVEAKLKRSFDDVVGMAVAAVKRARNYTDDVEFSCEDAGRTGIDNICRIVEAAINAGA
FT                   TTVNIPDTVGFCLPNEYGNIIAQVRNCVPNIDKAVISVHCHNDLGMATANSLTAVQNGA
FT                   RQIECTINGIGERAGNTSLEEVVMAMKVRQDFMGVDTRINTQEIHRVSQMVSQLCNMPI
FT                   QPNKAIVGSNAFAHSSGIHQDGMLKNKNTYEIMSPETIGLKKEKLNLTARSGRAAVKGH
FT                   MADMGYNEQDYDLDKLYDEFLKLADKKGQVFDYDLEALAFIDMQQGDEDRLVLDKLSAH
FT                   STKEYPATAFVQLKLDGEKLSTSSIGGNGPVDAVYNAILNLTGLEIKMSHYNLTAKGEG
FT                   AEALGQVDIVVEHKGRKFHGVGLATDIVESSALALVHAINAIYRAHKVADIKNHKQH"
FT   CDS_pept        161622..162743
FT                   /transl_table=11
FT                   /locus_tag="HICON_04150"
FT                   /product="Protein Smf"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85878"
FT                   /protein_id="CBY85878.1"
FT                   /translation="MNDITYTLLRLMQVPKLGGVGIDKILSNITLNELLNYDDVAFRQM
FT                   GWGAIQIRRWFKPEAKFIEPALVWSQKEGNHLVNYFSPFYPFLLKQTASFPPLLFVKGN
FT                   LTALSQRQMAMVGSRYCTTYGEYWAKHFATELSLAGFTITSGLALGIDGHCHQAVVNIQ
FT                   GQTIAVLGSGLEQIYPSKHQRLSAQIIENNGALVSEFLPNQAPIAANFPRRNRIISGLS
FT                   VGTLVVEATEKSGSLITARYALEQNREVFAVQGNIQNESSQGCHRLIKQGAMLVENAKD
FT                   ILETLYQHSIHSQTEIDFDQIAVPNYMPPPDPRRLLEAPSHPKLYSRIGYTPVSIDDLA
FT                   EEFNLSVDVLLVQLLDLELQDLIMSENGLYKRV"
FT   CDS_pept        162796..163572
FT                   /transl_table=11
FT                   /locus_tag="HICON_04160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85879"
FT                   /protein_id="CBY85879.1"
FT                   /translation="MLAIISPAKTLDFESAVKNFPVSQPHFTDYSEQLIEVCRKLSPQD
FT                   LSSLMSISDKLAGLNAARFAEWTKIHNENNSRPALFAFKGDVYTGLDAASLSEDDVIFA
FT                   QSHLRMLSGLYGLLKPLDLMQPYRLEMGTKLANPKGKDLYAFWGNVITQAVQQAIDEQG
FT                   DNVLINLASDEYYKSVKENQLKAKIIKPIFLDNKNGKYKVISFYAKKARGLMCRYLIQN
FT                   RLTNIEQLKEFDLGGYWFDSASSTETEFVFKRDINE"
FT   CDS_pept        163565..164146
FT                   /transl_table=11
FT                   /locus_tag="HICON_04170"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85880"
FT                   /protein_id="CBY85880.1"
FT                   /translation="MNKIFVILTTLILSGCATKLTQLNVPTQLEYNGKHYVLTGSQDFE
FT                   TIARYVYIAKPDTLENWQSEIEILFDRNQSERSIKERIALRERIYRNTGVKDFHFDAIP
FT                   KNSTNPNELNGYVIYSPTKENPSWQVNVMKGRQLSQCGFVQFQYSQKIQQPMRSKHLSV
FT                   NKVQRHLQKYIVDIERKHLQNLKWQLFCEK"
FT   CDS_pept        164242..165207
FT                   /transl_table=11
FT                   /locus_tag="HICON_04180"
FT                   /product="6-phosphofructokinase I"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85881"
FT                   /protein_id="CBY85881.1"
FT                   /translation="MIKKIAVLTSGGDAPGMNAAIRGVVRSALAEGLEVFGIYDGYQGL
FT                   YNNKIKQLNRYSVSDVINRGGTFLGSARFPEFKDPNIRAKCAEILRSHGIDALVVIGGD
FT                   GSYMGAKLLTEEHSFPCVGLPGTIDNDVAGTDYTIGYQTALQTAVDAIDRLRDTSSSHQ
FT                   RISIVEIMGRHCSDLTISAGIAGGCEYIVASEIEFNREELIQQIERSIIRGKRHAIIAI
FT                   TELLTDVHSLAKEIEARVGHETRATVLGHIQRGGSPCAFDRILASRMGAYAVDLLLQGK
FT                   GGYCVGIQNEQLVHHDIIDAINNMQRVFKADWLKVAKRLE"
FT   CDS_pept        165446..165931
FT                   /transl_table=11
FT                   /locus_tag="HICON_04190"
FT                   /product="SsrA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85882"
FT                   /protein_id="CBY85882.1"
FT                   /translation="MTKKKVKPNSNTIALNKRARHDYFIEDEIEAGLELQGWEVKSMRA
FT                   GKANISDSYVIFKNGEAFLFGASIQPLNVASTHIVCDPTRTRKLLLNKRELASLFGKAN
FT                   RDGFTIVALSLYWKSAWAKVKIGLAKGKKQQDKRDDIKEREWKVTKDRIMKNAHRRS"
FT   CDS_pept        complement(166026..166325)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04200"
FT                   /product="DNA-binding protein fis"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85883"
FT                   /protein_id="CBY85883.1"
FT                   /translation="MLEQQRNSADALTVSVLNAQSQVTSKPLRDSVKQALRNYLAQLEG
FT                   QDVNDLYELVLAEVEHPMLDMIMQYTRGNQTRAANMLGINRGTLRKKLKKYGMG"
FT   CDS_pept        complement(166319..167299)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04210"
FT                   /product="tRNA-dihydrouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85884"
FT                   /protein_id="CBY85884.1"
FT                   /translation="MRIGSYQLKNRVLLAPMAGITDQPFRRLCAYYGAGLTFSEMMSTN
FT                   PQVWHTEKSKLRLAHSEDLGLNAVQIAGSDPLEMAQAAAINVEYGAQIIDINMGCPAKK
FT                   VNRKLAGSALLQFPDLVEKILREVVSAVNVPVTLKIRTGWDKSNRNCVQIGKIAEQCGI
FT                   QALTVHGRTRACLFEGEAEYDNIKAVKQAIAIPVIANGDIDSARKAKFVLDYTGADAIM
FT                   IGRAALGNPWLFQAVENLIEHNSISQMPSLKEKCGQILRHIQELHQFYGEQKGYRIARK
FT                   HVAWYLQGIQPDSVFKQTFNAISDPKEQLIVLEDFFNLILDKEKC"
FT   CDS_pept        complement(167447..168229)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04220"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85885"
FT                   /protein_id="CBY85885.1"
FT                   /translation="MKYYTNKLVALYRTVFIIFLIYIPIDIYFNVERVVSDLSLKSILM
FT                   NLIGFHFNYNGEWWFLFPYVLFVLITPILNKFRYYLASLFAVGIILHNMQGNGIVGEFF
FT                   TWSVAYILGFIFGVLSPKLAHFKSNAIISLFLSIVCYFIIKYGMDNFGIESSLFLVPFV
FT                   IFIIKTLYNIIPLILRKGISSIGKKCLIIWLVHSFYCYHFAGEFIYSPKYSILILLNLL
FT                   LISYLSAVLITFIEKKLVIVFVKIRNIIFQKVNKVSTM"
FT   repeat_region   complement(168470..168588)
FT   CDS_pept        complement(168610..169494)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04230"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85886"
FT                   /protein_id="CBY85886.1"
FT                   /translation="MAWVQIRLNSTNEKAEQISDFLEEIGSVSVTFMDSQDTPIFEPLP
FT                   GETRLWGNTDVIALFDAETDMAEIVRLLKEVKHLDSNTAYKIEQIEDKDWEREWMDNFY
FT                   PMQFGKRLWICPSWCDVPDENAVNVMLDPGLAFGTGTHPTTALCLEWLDGLDLKDKTVI
FT                   DFGCGSGILAIAALKLGAKSAVGIDIDPQAILASRNNAEQNGVADRLQLFLSDEKPSDL
FT                   KADVVVANILAGPLKELYPIISQLVKPNGNLGLSGILETQAQFVCDTYAQTFLLEPVAV
FT                   KEEWCRITAKCGD"
FT   CDS_pept        complement(169536..170111)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_04240"
FT                   /product="Sodium/panthothenate symporter"
FT   CDS_pept        complement(170113..170982)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85888"
FT                   /protein_id="CBY85888.1"
FT                   /translation="MLYQILALLIWSSSLIVGKLTYSMMDPVLVVQVRLIIAMIIVMPL
FT                   FLRRWKKIDKSMRKQLWWLAFFNYTAVFLLQFIGLKYTSASSAVTMIGLEPLLVVFVGH
FT                   FFFKDKAKWFHWLFGAMAFIGVAILINGGKNNEVDNISLFGCLLVLSAGIIFAAVLRWT
FT                   QRVVAKVSTQAYTSVSIVLGTITTLPFTLLLTENWQISLNSTGIAGLLYLAIGCSWLAY
FT                   WLWNKGLNSVDANISGVLVALEPLFGILFAVSLLGETLSFSAALGITIIMLATLGSTLL
FT                   PKLLKKSV"
FT   CDS_pept        complement(171102..172556)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04260"
FT                   /product="Sodium/pantothenate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85889"
FT                   /protein_id="CBY85889.1"
FT                   /translation="MNLGIILPLIIYLTFVFGAAIFAYVKRTKGDFLTEYYVGNRSMTG
FT                   FVLAMTTASTYASASSFVGGPGAAYKYGLGWVLLAMIQVPVVWLALGALGKKFALLSRE
FT                   TNALTINDLFFYRYKNKYLVWLSSLALLLAFFAAMTVQFIGGARLLETTIGISYTQALL
FT                   LFALTVGIYTFIGGFRAVVLTDTIQGTVMIFGTIILLIGTIYALGGVESAVNKLTEIDP
FT                   DLVTPYGPNGMLDFQFMASFWILVCFGVVGLPHTAVRCMAFKDSKALHRGMLIGTIVLS
FT                   IIMLGMHLAGALGRAVIPNLTVSDQVIPTLMLKVLPPIVAGIFLAAPMSAIMSTIDAQL
FT                   IQSSSIFVKDLYLSAKPEAAKNEKKVSYFSSIITLILTALLIFAALNPPDMIIWLNLFA
FT                   FGGLEAAFLWVIVLGIYWDKANAYGALSSMIIGLGSYILLTQLGIKLFNFHQIVPSLVF
FT                   GLIAFLVGNKLGERRIEKTQLKVTAL"
FT   CDS_pept        complement(172553..172810)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04270"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85890"
FT                   /protein_id="CBY85890.1"
FT                   /translation="MTLKQRYQQAAKEASWALSLSILYVIGWCLCAYLPKETQGPIGFP
FT                   LWFELSCIYLPILFIVIGHWIIKIIFQDISLEINDQESQK"
FT   CDS_pept        complement(173015..174361)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04280"
FT                   /product="acetyl-CoA carboxylase, biotin carboxylase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85891"
FT                   /protein_id="CBY85891.1"
FT                   /translation="MLEKVVIANRGEIALRILRACKELGIKTVAVHSTADRDLKHVLLA
FT                   DETVCIGPAPSAKSYLNIPAIIAAAEVTGADAIHPGYGFLSENADFAEQVERSGFTFIG
FT                   PTADVIRLMGDKVSAIKAMKKAGVPCVPGSDGPVSNDIAKNKEIAKRIGYPIIIKASGG
FT                   GGGRGMRVVRSEDALEESIAMTKAEAKAAFNNDMVYMEKYLENPRHVEIQVLADTHGNA
FT                   VYLAERDCSMQRRHQKVVEEAPAPGITEEVRRDIGSRCANACVEIGYRGAGTFEFLYEN
FT                   GEFYFIEMNTRIQVEHPVTEMITGVDLVKEQLRIAAGLPISFKQEDIKVKGHAMECRIN
FT                   AEDPKTFLPSPGKVNHLHSPGGLGVRWDSHVYGGYTVPPHYDSMIAKLITYGDTREVAI
FT                   RRMQNALSETIIDGIKTNIPLHELILEDENFQKGGTNIHYLEKKLGMNE"
FT   CDS_pept        complement(174539..175006)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04290"
FT                   /product="acetyl CoA carboxylase, BCCP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85892"
FT                   /protein_id="CBY85892.1"
FT                   /translation="MDIRKIKKLIELVEESGITELEVQEEEGTVRISRAAPVIAPAAVQ
FT                   YAAAPVVAPTPAAAPAQAPAVATTAPAASDELSGHLVRSPMVGTFYRSPSPEAKAFVEV
FT                   GQSVKVGDALCIVEAMKMMNRIEADKAGIVKAILINDGNAVEFDEPLIVIE"
FT   CDS_pept        complement(175159..175608)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04300"
FT                   /product="3-dehydroquinate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85893"
FT                   /protein_id="CBY85893.1"
FT                   /translation="MSQTHRILLLNGPNLNMLGAREPKHYGSISLESIEEKIQTLATQH
FT                   NVKVECFQANSEEKLINKIHESFQQVDFILINPAAYTHTSVALRDALLAVSIPFVEIHL
FT                   SNVHKREPFRHHSYFSDVAEGVICGLGAKGYEFAFLFAMDYLAKK"
FT   CDS_pept        complement(175665..176654)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04310"
FT                   /product="O-succinylbenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85894"
FT                   /protein_id="CBY85894.1"
FT                   /translation="MAEKSFNLYRYSIPVDSQLILRDRFLKRREGLIVRVSCSRDGWGE
FT                   IAPLPGFSEETLDQAQKQAIEWLTTWCYASCDAPRVPLDGTYPSVAFGISCAMDEMKGY
FT                   LQAVGNYHTVPLCYGDPDELYAKLASIEGEKVAKMKVGIYEANRDGLIADMFLEAIPDL
FT                   QLRLDANRHWSLEKALQFAAKVKPQHRKRIQFLEEPCKTQALSREFAAQTDIAIAWDES
FT                   VREPNFCLEKEPHLSAVVIKPTLIGSIQRCAELINQAHSLGLKAVISSSIESSLGLSQL
FT                   ARIAQQYTPNVTPGLDTLDLMEYQVLRAWPSSDLPIVDLESEFITKII"
FT   CDS_pept        complement(176723..177580)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04320"
FT                   /product="dihydroxynaphthoic acid synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85895"
FT                   /protein_id="CBY85895.1"
FT                   /translation="MQNPKDDVLYAPVEWVDHSEGYSDIRYHKSTDGIAKITINRPEVR
FT                   NAFRPQTVKEMITAFSDARFDENIGVIVLTGEGEKAFCSGGDQKVRGDYGGYKDDSGVH
FT                   HLNVLDFQRDIRSCPKPVVAMVAGYAIGGGHVLHMLCDLTIAAENAIFGQTGPKVGSFD
FT                   GGWGASYMARLVGQKKAREIWFLCRQYNAQEALDMGLVNTVVPYADLEKETVRWCREML
FT                   RNSPIAIRCLKAALNADCDGQAGLQELAGNATMLFYMTEEGQEGRNAFNEKRAPDFSKF
FT                   RRNP"
FT   CDS_pept        177726..178292
FT                   /transl_table=11
FT                   /locus_tag="HICON_04330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85896"
FT                   /protein_id="CBY85896.1"
FT                   /translation="MKLIATLGMAALLSGCSMFDSQQSAIPAEFAGADYQLSDQHAKQW
FT                   AIASKQVEQCVYPNLTRILQQHFSKEDSYIHSQYVFFYPLEKIIGEQYVKIIQADEKSM
FT                   NYASYQFKKFRTRVSNVEPLTKQSCLKLRNEARDDLAVVKGQYKNGMVEVQKNEDGTPK
FT                   NSDGIATNQNKFFFDIIKWGSMLLL"
FT   CDS_pept        complement(178365..178628)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04340"
FT                   /product="30S ribosomal subunit protein S20"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85897"
FT                   /protein_id="CBY85897.1"
FT                   /translation="MANIKSAKKRAVQSEKRRQHNASQRSMMRTYIKKVYAQVAAGEKS
FT                   AAEAAFVEMQKVVDRMASKGLIHANKAANHKSKLAAQIKKLA"
FT   CDS_pept        178892..180469
FT                   /transl_table=11
FT                   /locus_tag="HICON_04350"
FT                   /product="Putative virulence factor MviN"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85898"
FT                   /protein_id="CBY85898.1"
FT                   /translation="MLSKRLLKSSIVVSSMTLLSRVLGLVRDVVIAHLIGAGAAADVFL
FT                   FANRIPNFLRRLFAEGAFSQAFVPVLAEYQQSGDINKTREFIGKVSGTLGGLVSIVTIL
FT                   AMVGSPVVAALFGMGWFTDWMNDGPDAHKFEQASLLLKITFPYLWFVTFVAFSGAVLNT
FT                   IGKFGVMSFSPVLLNIAMIATALFLAPQMDSPDLALAIGIFLGGLLQFLFQIPFMKQAG
FT                   LLVKPKWAWRDEGVTKIRKLMIPALFGVSVSQINLLLDTVIASFLMTGSISWLYYSDRL
FT                   LEFPLGLFGIAISTVILPTLARHHVNREGDSAKSAVDFRNTMDWGVRMILLLGVPAAIG
FT                   IAVLAQPMLLTLFMRGNFMLNDVYAASYSLWAFNAGLLSFMLIKILANGYYARQDTKTP
FT                   VKIGIIAMVSNMGFNLLAIPFSYVGLAIASAMSATLNAYLLYRGLAKADVYHFSRKSAV
FT                   FFVKVLLAAIAMGAAVWYYVPEINQWAKMDFFMRVYWLVWLIVLAAIVYGATLILLGVR
FT                   KHHLLTKN"
FT   CDS_pept        180516..181442
FT                   /transl_table=11
FT                   /locus_tag="HICON_04360"
FT                   /product="bifunctional riboflavin kinase/FAD synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85899"
FT                   /protein_id="CBY85899.1"
FT                   /translation="MQLIRGLHNANRVLQGCALTIGNFDGVHLGHQTVLRHLRQKADEL
FT                   NLPMAVLLFESQPREYFMGKNAPARLMRLRDKIYYLEKAKVDVVIVAKFDRTFAEQPAD
FT                   VFIEQTLVNHLHVKFLSIGDDFKFGSKRQGNFAMLQAASKRFGFIVEDNRSFCLDAQRI
FT                   SSTAIREALANDDLQLAENLLGKPYRIFGRVIHGNKLGRTIGFPTANIRLHRQVNPIKG
FT                   VYAVKVRLKSGEIFNGVANMGKRPTINGLMQLLEVHLFDFSQNIYGQMVEVEFCHKIRN
FT                   EIKFPSFDDLKVQIEKDVETAKAFLNS"
FT   CDS_pept        181522..184296
FT                   /transl_table=11
FT                   /locus_tag="HICON_04370"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85900"
FT                   /protein_id="CBY85900.1"
FT                   /translation="MRGDLAKREPDMLKNWYEKNLYQKIREASKGKKSFILHDGPPYAN
FT                   GNIHIGHAVNKILKDIIIKSKTALGFDSPYIPGWDCHGLPIELKVEGLVGKPNEKISAA
FT                   EFRQKCREYAAEQVEGQKKDFIRLGVLGDWDNPYLTMNFDTEANIIRTLGKVIENGHLY
FT                   KGSKPVHWCLDCGSSLAEAEVEYEDKVSPSIYVRFPAESADEIEAKFSAQGRGQGKLSA
FT                   IIWTTTPWTMPSNRAIAVNADLEYNLVQLGDERVILAAELVESVAKAVGIEHIEILGSV
FT                   KGADLELSRFHHPFYDFTVPVILGDHVTTDGGTGLVHTAPDHGLDDFIVGKQYDLPMAG
FT                   LVSNDGKFISTTEFFAGKGVFEANPLVIEKLQEVGNLLKVEKIKHSYPHCWRHKTPIIF
FT                   RATPQWFIGMETQGLRQQALGEIKQVRWIPDWGQARIEKMVENRPDWCISRQRTWGVPM
FT                   TLFVHKETEELHPRTLDLLEEVAKRVERAGIQAWWDLDEKELLGADAETYRKVPDTLDV
FT                   WFDSGSTYSSVVANRPEFNGQNIDMYLEGSDQHRGWFMSSLMLSTATDSKAPYKQVLTH
FT                   GFTVDGQGRKMSKSIGNIVTPQEVMDKFGGDILRLWVASTDYTGEMTVSDEILKRAADS
FT                   YRRIRNTARFLLANLNGFDPKRDLVKPEEMISLDRWAVACALDAQNEIKDAYDNYQFHT
FT                   VVQRLMRFCSVEMGSFYLDIIKDRQYTTKADSLARRSCQTALWHIAEALVRWMAPILSF
FT                   TADEIWQHLPQTESARAEFVFTEEFYQGLFGLGEDEKLDDAYWQQLIKVRSEVNRVLEI
FT                   SRNNKEIGGGLEAEVTVYANDEYRALLAQLGNELRFVLITSKVDVKSLSEKPADLADSE
FT                   LEGIAVSVTRSNAEKCPRCWHYSDKIGVSPEHPTLCARCVENVVGNGEVRHFA"
FT   CDS_pept        184414..184764
FT                   /transl_table=11
FT                   /locus_tag="HICON_04380"
FT                   /product="HIT-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85901"
FT                   /protein_id="CBY85901.1"
FT                   /translation="MAEETIFSKIIRKEIPANIVYQDELVTAFRDISPQAKTHILIIPN
FT                   KVIPTVNDVTEQDEVALGRLFSVAAKLAKEEGVAEDGYRLIVNCNKHGGQEVFHLHMHL
FT                   VGGEPLGRMLAK"
FT   CDS_pept        184764..185114
FT                   /transl_table=11
FT                   /locus_tag="HICON_04390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85902"
FT                   /protein_id="CBY85902.1"
FT                   /translation="MKKYFLILASFMLVACSSSEQNLTYSTKPILNITSSLSPLIQVET
FT                   TQKSAVIKNKSQQLLNISYHLYWYDHLGVTQIWENQQESYSAQFLLKPQEQKSIDLTKP
FT                   TVESKNYRLYLK"
FT   CDS_pept        185118..186170
FT                   /transl_table=11
FT                   /locus_tag="HICON_04400"
FT                   /product="beta N-acetyl-glucosaminidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85903"
FT                   /protein_id="CBY85903.1"
FT                   /translation="MSSLLIDLNGKELEQEEVELLSHPLVAGLILFTRNFENREQIQEL
FT                   IRSVRQRVKKPLLITVDQEGGRVQRFRDGFTMLPSMQAFQETLSATEQVSFAKEAGWQM
FT                   AAEMIALDIDLSFAPVLDLGHECRAIGDRSFSSDVKSAVNLATAFIDGMHQAGMASTGK
FT                   HFPGHGHVLAGSHLETPYDDRTKDEIFSGDLQPFQQLISQNKLDAIMPAHVIYSQCDSQ
FT                   PASGSKYWLKEILRKKLNFQGTIFSDDLGMKGAGVMGNFVERSKKALNAGCDLLLLCNE
FT                   REGVIQVVDNLKLAKNQPHFMARQARLQSLFKRRVISWNDLISDQRWKLNYQKLADIQH
FT                   RWLDIQAAKK"
FT   CDS_pept        186167..187345
FT                   /transl_table=11
FT                   /locus_tag="HICON_04410"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase rumB,
FT                   fragment (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85904"
FT                   /protein_id="CBY85904.1"
FT                   /translation="MIDCRYYQQNECRSCQWLEIPYSQQLTEKQYHLKQQLISINYDEA
FT                   QWVAPFQSNEQGFRNKAKMVVSGSVERPILGILKNPNDPQSAIDLCDCPLYPTHFSAIF
FT                   SILKDFIGRAGLVPYNIAKQKGELKYILLTESIATEKLMLRFVLRTENKLPLIRRELPK
FT                   LLKKLPHLEVISINLQPQHAAILEGEQEIFLTEQQFLPENFNGIPLFIRPQGFFQTNPK
FT                   VAAGLYATAQQWVAEFPIYNLWDLFCGVGGFGLHCAKALQEKWGKPIKLTGIEISSSAI
FT                   LAASNSAKILGLEHVNFQSLDAASVIENKNENKPDLVIVNPPRRGIGKELSEFLNQIQP
FT                   HFILYSSCNAMTMGKDLQHLTCYKPLKIQLFDMFPQTSHYEVLVLLERKKIN"
FT   CDS_pept        complement(187710..188384)
FT                   /transl_table=11
FT                   /gene="crp"
FT                   /locus_tag="HICON_04420"
FT                   /product="cAMP-regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85905"
FT                   /protein_id="CBY85905.1"
FT                   /translation="MSNELTEIDEVVTSSQEEATQRDPVLDWFLTHCHLHKYPAKSTLI
FT                   HAGEDATTLYYVIKGSVMVSSKDDEGKEMILTYLGAGQFFGEAGLFDEGSKRSAWVKTK
FT                   TTCEIAEISYKKYRQLIQANPEILMFLTAQLARRLQNTSRQVTNLAFLDVAGRIAQTLM
FT                   NLAKQPEAMTHPDGMQIKITRQEIGQMVGCSRETVGRIIKMLEDQNLIHAHGKTIVVYG
FT                   AR"
FT   CDS_pept        complement(188369..188620)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04430"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85906"
FT                   /protein_id="CBY85906.1"
FT                   /translation="MIIPWQELEAETLDNIVESVILREGTDYGIEELSLNQKKQLLLTQ
FT                   IRNGIALIVWSELHESIDIKNKTEFLKQECKEQECQMN"
FT   CDS_pept        complement(188642..189298)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04440"
FT                   /product="HTH-type protein slmA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85907"
FT                   /protein_id="CBY85907.1"
FT                   /translation="MVEEQLSLSGVEEIAPKIETPKIEKRTVKERRQQVLTVLIHMLHS
FT                   ERGMERMTTARLAKEVGVSEAALYRYFPSKTKMFEALIEHIESTLLSRITASMRNETQT
FT                   MNRIHDILQTILDFARKNPGLTRVLTGHALMFEEAQLQARVAQFFDRLEMQFVNILQMR
FT                   KLREGRAFNVDERIIASHLVTLCEGQFMRYVRTNFRLNSSQSFEQQWRFIEPLFA"
FT   CDS_pept        complement(189305..189757)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04450"
FT                   /product="deoxyuridinetriphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85908"
FT                   /protein_id="CBY85908.1"
FT                   /translation="MKKIDVKILDSRIGNEFPLPTYATEGSAGLDLRALIDESFEIQPG
FT                   ETKLIPTGLSIYIADPNLAAVILPRSGLGHKHCIVLGNLVGLIDSDYQGPLMVSMWNRG
FT                   NEPFKIEVGDRIAQLVFVPVVQAEFNIVEDFQQTERGEGGFGHSGK"
FT   CDS_pept        complement(189805..191007)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04460"
FT                   /product="phosphopantothenoylcysteine
FT                   synthetase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85909"
FT                   /protein_id="CBY85909.1"
FT                   /translation="MKLNGKHIVVGITGGIAAYKTIELIRLLRKAEAEVRVVLTPAAAE
FT                   FVTSLTLQAISGNAVSQSLLDPQAELAMGHIELAKWADAIIIAPASADFIARLTIGMAN
FT                   DLLSTICLATDTPIFLAPAMNQQMYYQSITQQNLTTLQTRGIMLIGPNSGFQACGDMGK
FT                   GRMSEPEEIFTALSDFFSQKQDLQGLNVAITAGPTREAIDPVRYISNHSSGKMGFAIAE
FT                   AFAERGANVTLISGPVNLTTPKNVNRINVISAQEMWQASLESAVKNQIFIGCAAVADYR
FT                   VSEVAEQKIKKSGDEISIKLIKNPDIISDVGHLKTHRPFTVGFAAETQNVDDYAKDKLE
FT                   RKNLDMICANDVSGGQVFNADENALQLFWKNGHKKLSLKSKVELATDLVNEIIERYQKT
FT                   L"
FT   CDS_pept        191171..191836
FT                   /transl_table=11
FT                   /locus_tag="HICON_04470"
FT                   /product="DNA repair protein RadC homolog"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85910"
FT                   /protein_id="CBY85910.1"
FT                   /translation="MENNDELMPREKLLAFGAKALSDYELLAIFLRTGIKGCPVMSLSK
FT                   NVLTHFGSLHALLSADKKAFCSVKGLGITQFIQLQAITEMTKRYLKQDMLSTPIINDPE
FT                   TVKLFLLTELQHEEREVFMVLFLDNQHRLIKKERLFLGTINVSAVYPREIIKEALYCNA
FT                   AALILAHNHPSGITEPSYSDQLITKKIQDAAELMEIRVLDHLIVGKSDCYSFAENCLL"
FT   CDS_pept        192050..192286
FT                   /transl_table=11
FT                   /locus_tag="HICON_04480"
FT                   /product="50S ribosomal subunit protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85911"
FT                   /protein_id="CBY85911.1"
FT                   /translation="MSRVCQVTGKRPAVGNNRSHAMNAARRRFLPNLHTHRFWVESENR
FT                   FVTLRLTAKGMRIIDKKGIDAVLAEIRARGEKI"
FT   CDS_pept        192298..192468
FT                   /transl_table=11
FT                   /locus_tag="HICON_04490"
FT                   /product="50S ribosomal subunit protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85912"
FT                   /protein_id="CBY85912.1"
FT                   /translation="MAAKGAREKIRLVSTAETGHFYTTDKNKRNMPEKMEIKKFDPVVR
FT                   KHVIYKEAKIK"
FT   CDS_pept        192815..194179
FT                   /transl_table=11
FT                   /locus_tag="HICON_04500"
FT                   /product="GABA aminotransferase, PLP-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85913"
FT                   /protein_id="CBY85913.1"
FT                   /translation="MTMITPVQAILASNQHFLDRQDVMESNVRSYPRKLPFAYAKAQGC
FT                   WVTDVEGNEYLDFLAGAGTLALGHNHPILMQAIKDVLDSGLPLHTLDLTTPLKDAFSEE
FT                   LLSFFPKDKYILQFTGPSGADANEAAIKLAKTYTGRGNIIAFSGGFHGMTQGALALTGN
FT                   LSAKNAVENLMPGVQFMPYPHEYRCPFGIGGEAGAKAVEQYFENFIEDVESGVVKPAAV
FT                   ILEAIQGEGGVVSAPISFLQKVREVTQKHGILMIVDEVQAGFCRSGRMFAFEHAGIEPD
FT                   IIVMSKAVGGSLPLAVLAIRKEFDAWQPAGHTGTFRGNQLAMATGYASLKIMRDENLAQ
FT                   NAQERGEYLTNALRELSKEYPCIGNVRGRGLMMGIDIVDERQSKDATGAYPRDCELAAA
FT                   IQKACFKNKLLLERGGRGGNVVRVLCAVNINQVECEEFIKRFKQSVVDALKVVRS"
FT   CDS_pept        194326..194559
FT                   /transl_table=11
FT                   /locus_tag="HICON_04510"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85914"
FT                   /protein_id="CBY85914.1"
FT                   /translation="MIEASVFMTNRSQAVRLPAEVRFSEEIKKLSVRVSGSDRILSPLN
FT                   QSWDSFFLNDQAVSDDFMNEREIAFQPEREAL"
FT   CDS_pept        194571..194957
FT                   /transl_table=11
FT                   /locus_tag="HICON_04520"
FT                   /product="Predicted nucleic acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85915"
FT                   /protein_id="CBY85915.1"
FT                   /translation="MLDTNIVIYVIKRRPLEILSRFNQNAGKMCVSSITVAELYYGAEK
FT                   SEYPERNIAVIEDFLSRLTILDYQPKHAAHFGNIKAELSKQGKLIGENDIHIAAHARSE
FT                   GLILVSNNLREFERVIALRTENWV"
FT   CDS_pept        194977..196512
FT                   /transl_table=11
FT                   /locus_tag="HICON_04530"
FT                   /product="L-2,4-diaminobutyrate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85916"
FT                   /protein_id="CBY85916.1"
FT                   /translation="MSNLKQHKQALFCNDNEAINDYETAMHNAVQAVSAWLKNEKMYTG
FT                   GSIKQMRALISGFNPTKEGMGVQKSLDHLVEIFLNPSLKVHHPHSLAHLHCPTMVTSQI
FT                   AEVLINATNQSMDSWDQSPAGSIMEEHLINWLRQKAGYGEGTSGVFTSGGTQSNLMGVL
FT                   LARDWAIANHWKNEDGSEWSVQRDGIPAEAMQKVKVICSENAHFSVQKNMAMMGMGFQS
FT                   VVTVPSNANAQMDLIALKQTLAQLKAEGKIAACIVATAGTTDAGAIDDLKAIRKLADEY
FT                   QAWLHVDAAWGGALLLSKDYRYFLDGIELTDSITLDFHKHFFQTISCGAFLLKDPANYR
FT                   FIDYKADYLNSEYDEAHGVPNLVAKSLQTTRRFDALKLWFTLEALGEDLYASMIDHGVK
FT                   LTKEVEQYINDTPALEMLVPSQFASVLFRVVPKDYPAEFIDALNQNVADELFARGEANI
FT                   GVTKVGDKQSLKMTTLSPIATLENVKALLTQVLTEANRIKDDIKNGTYTPPID"
FT   CDS_pept        196771..197586
FT                   /transl_table=11
FT                   /locus_tag="HICON_04540"
FT                   /product="formamidopyrimidine-DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85917"
FT                   /protein_id="CBY85917.1"
FT                   /translation="MPELPEVETALRGISPYLKNFTIEKVVVRQPKLRWAVSEELITLK
FT                   NVKIVDLTRRAKYLIIHTEKGYIIGHLGMSGSVRIVPQDSAIDKHDHIDIVVNNGKLLR
FT                   YNDPRRFGAWLWTENLDDFHLFLKLGPEPLSDEFNAEYLFKKSRQKSTALKTFLMDNAV
FT                   VVGVGNIYANESLFICGIHPLKLAKNLTRNQCFSLVNTIKDVLRKAIIQGGTTLKDFLQ
FT                   PDGRPGYFAQELLVYGNKDKPCPKCGGKIESLIIGQRNSFFCPKCQKRG"
FT   CDS_pept        complement(197660..198682)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04550"
FT                   /product="serine endoprotease, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85918"
FT                   /protein_id="CBY85918.1"
FT                   /translation="MLKKLFHSALWGLAAAGVILFAVPRLNNSNIFTSDDIVSFKNAVR
FT                   IASPAVVNVYNRSFSSASINDNDQLQVNNLGSGVIMSKDGYILTNKHVIQNADQIVVAL
FT                   QNGNIFEASLVGSDDLTDLAVLKIRANNLSTIPQNSARQAHVGDVVLAIGNPYNLGQSV
FT                   SQGIISAIGRNAVGDSVGRQNFIQTDASINRGNSGGALINSAGELVGISTLSIGKTANE
FT                   IAEGLNFAIPIDIANDVLRKIMRDGRVIRGYFGVQSDISSSSEEGIVITDVSPNSPAAK
FT                   SGIQVGDVILKLNNQEGISAREMMQIIANTKPNSKVLVTILRLGKILQIPVVIEEFPVN
FT                   "
FT   CDS_pept        complement(198683..199801)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04560"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85919"
FT                   /protein_id="CBY85919.1"
FT                   /translation="MLEFSSQDCVFMQRALDLAAKGQYTTTPNPSVGCVLVKNGEIVGE
FT                   GFHFKAGQPHAERVALAQAGENAKGATAYVTLEPCSHYGRTPPCALGLIEAGVVKVIAA
FT                   MQDPNPQVAGKGLKMLSDAGIESAVNLLNDQAEKINKGFLKRMRQGMPFVQLKLAMSLD
FT                   GRTAMASGESKWITGPDARSDVQKMRAKSSALLSTSTTVIADDPSLNIRWDEFPENLKT
FT                   EYKKEGLRQPVRVILDSQHRIQPTHKLFLTHSPVWLVSSEPRDLTGFPDFCEQIILPKE
FT                   NLLKELMRELGKRQINTLWVEAGANLAGSLIDAKLVDELIIYIAPKLLGDNARGLCQLP
FT                   NLTKLADAPLWQLNELEQIGDDIKLTYTPKGV"
FT   CDS_pept        complement(199804..200253)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04570"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85920"
FT                   /protein_id="CBY85920.1"
FT                   /translation="MHCPFCDTEETKVIDSRLVSDGYQVRRRRECGHCHERFTTFEMAE
FT                   LIIPKIIKTDGTREPFNEDKLRNGIQHALEKRPVSADDVEKAINHIILQLRATGEREVP
FT                   SKLVGKLAMNELKKLDKVAYIRFASVYLSFDDIDQFTIEIEKLKD"
FT   CDS_pept        complement(200308..203565)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04580"
FT                   /product="exonuclease V (RecBCD complex), gamma chain"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85921"
FT                   /protein_id="CBY85921.1"
FT                   /translation="MAQWLQIELAKETGISANLKFPMPASFIWQLYAQNLPATALENPF
FT                   DKDSMTWRLMRLIPIFLEKENFSPLRNYLSSSPHSEQYKLYQLSSKIADLFDQYLVYRP
FT                   EWIFAWEKGEDEQITDQIQKQQPNLNATLFAQIQGNTKWQGELWRALVVDVKSDVNEAT
FT                   HRAALHNQFLALLADKKAPKKLPSRIFIFGIPALPTAYLNILQAISSEVDIHLFFNNPC
FT                   QEYWGDISDLLLDYLRSRKRYQLNKQDENQPLFSEDQLSQLENAQFDVTYQKENLQLGN
FT                   LLLAAWGKMGRDFLYTLVRDEEHIPTYPVNAYQEIESNSLLGQLQSQILHLENKPLNIA
FT                   KNDRTLTLHSCHSAMREVEVLHDYLLDLFNQDPSLTPKDVVVMMADINQYTPYIQAVFG
FT                   QKNGDAPQIPFSLSDNKLSESDALVSSYLTLLGLKESNFSAEDVLALLDIPAMRERFNI
FT                   SLADLPLVREWVADSGIRVGLQKNQDGINFNSWQAGLERMILGYAMREEQGIWQDSLGL
FT                   NSSYGLKGELAGNLSHFFTALSALHETLQQAHSIEKWQEILTALLSDFFVRNEDTSDMI
FT                   FYIQEKINELAEHLKTLHFTEKLQAEVIADVITMKLEDAPNSLKFLAGKVNFCTLLPMR
FT                   SVPFKVVCLLGMNDADYPRTQTPNSFDLMQYHYQKGDRVRRDDDRYLFLEALLAARDYC
FT                   YISYVGRSITDNQPKEPSVLVSQLLDYINQGQKENVLTVIEHPMTAFSPDNFKYNEKFT
FT                   RSFATKWLPIAQFDASSNNSEFAVTMTENPEKIEEVELDSLVSFVENPVKFFFEKQLGV
FT                   YFRDKDERIADSENFTLSGLDNYSLNNDLIYLDEQNFADYFRQAEVKGVLPHAEFGKVY
FT                   AENIRDNVLEFKEKIADLGEPKQASIDFNIAVDWQNENQKIRLFGYMEALFGDDSQVIH
FT                   WHFAKYKDRYCIRPWIYYLIQCVTQEKAVPAKLITQDKVLELPPIEREVALAQLQTYVK
FT                   DYLQSQIEIQLVPTIRNINDFIVDDESAVDFDNVFEKLQALTESNGFGSKADPYWSRVL
FT                   AQTSRFKQPENIAKLLKQTKAWFGLLFAQKKTRKAQS"
FT   CDS_pept        complement(203734..204021)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85922"
FT                   /protein_id="CBY85922.1"
FT                   /translation="MNKGMSFITLLFSLTLFSVLFLVFNQWTASQRKSAVKTYQDFQAI
FT                   QIAENQAQRQFLGLACEQLIQQNGLTFRIQCENERIIVRYPTSEILIKTQ"
FT   CDS_pept        complement(204014..204697)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85923"
FT                   /protein_id="CBY85923.1"
FT                   /translation="MTIQKGIITLTILIFISGLLTVILLLDDSHLSFFRAQQNQRKHYV
FT                   ERTLQLQNMTEEKKQTACIDLPLNNNESVKQISIALEGAADAIQYFLWCERMSLFKKSP
FT                   KKGDNQGALKDFVSGEKLAYFRPHFSSPRRILNANKMPKLYWFSDSQAEVEINGTVYAV
FT                   LIAEGDLKLTGKGRISGAVITSGNLTLDGVTLAYGKKTVVALVQQYSQWQLAEKSWSDF
FT                   NVQDE"
FT   CDS_pept        complement(204712..205425)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85924"
FT                   /protein_id="CBY85924.1"
FT                   /translation="MKTLLKGQTLLALMISLALSSLLLLSISHFYVQIQTQNQHMLLHL
FT                   KLQAELQRTLQLIGKDLRRLGFRALNAKLTESNLSLFELDEQGTAIFISQEDNAPPNSC
FT                   VLFFYDLNKNGCIGKGSPKTCMKKGKNTSKSSTEELFGYKVSNKMIKTKLTYQSVIPTN
FT                   CTAETCKRAFQQTACNAGGGWADLLDNNEYEITRLQFNWLIEGKGLEIKLKGNLKQTPN
FT                   ISYETSLVVALWNQK"
FT   CDS_pept        complement(205422..205940)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85925"
FT                   /protein_id="CBY85925.1"
FT                   /translation="MQKGMTLVELLIGLAIISIVLNFAVPLWKTDSPKTILAKEQHRLY
FT                   LFLRQIQARAENSSEVWFLLINRNLATQQWCLTAQVKNDQTCDCLNPTNCPKEAYAHFY
FT                   YPYFPKKTMIQSHYIYPKEITRFYGARNTSVTRCFILQAENERTLFSFFNVGSIRLKTN
FT                   QAASACNQS"
FT   CDS_pept        206140..206943
FT                   /transl_table=11
FT                   /locus_tag="HICON_04630"
FT                   /product="inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85926"
FT                   /protein_id="CBY85926.1"
FT                   /translation="MNPMLNIAIRAARKAGNVIAKNYERRDAIESTQKGINDYVTNVDK
FT                   ASEAEIIEVIRKSYPDHTIITEETGAIEGKDSDVQWIIDPLDGTRNFMTGLPHFSVSIA
FT                   VRVKNRTEVGVVYDPIRNELFTAVRGEGAKLNEVRLRVDSKREIQGSILATGFPFKQPK
FT                   LMPAQFAMMNALIEDAADFRRTGSAALDLCYVASNRIDGYFEMGLKAWDCAAGDLIVRE
FT                   AGGLVCDFDAGNGYLRSGNIIAAPSRVIKEMLNKIRPCLGAEFNH"
FT   CDS_pept        207052..208959
FT                   /transl_table=11
FT                   /locus_tag="HICON_04640"
FT                   /product="cytochrome c-type biogenesis protein NrfE"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85927"
FT                   /protein_id="CBY85927.1"
FT                   /translation="MLPELGFFLLLLATASAFFLALVPQFGLFKKNSTLINAAWPLSYI
FT                   FTLATTFSIGLLAYSFAVDDFTLEYVAAHSNSQLPTFFKVAATWGGHEGSMLFWLFSLS
FT                   LWLAAFAFFNRKNDRTFSAQSLSLLGLICFGFAVFILFYSNPFGRIFPAPAEGRDLNPM
FT                   LQDVGLIFHPPLLYVGYVGFAVNFAMSLSALIYNQSARQIARSMRGWVLVSWLFLTIGI
FT                   VLGAWWAYYELGWGGWWFWDPVENASLMPWLLGLALLHSLMATEKQGVFSYWTTLFSLL
FT                   AFAFSVLGTFIVRSGALTSVHAFALDNTRGYVLLLIFFVLTALAFGLFALRAGSSSESA
FT                   VKFQFVSKSGGILLLNILLTIATVSTFLGTFYPMLFQAMNWGSISVGSPYFNSIFFPII
FT                   TAILILMVIVLSIRKEQFDRTLLIRCGWLLIPSLILACLMIWQQLRHNSALNFHAFAFV
FT                   LLTLAIWLLFVTLWQNWRQIRLSQFGMILAHCGVAIVTIGAVMTGYFGSEIGVRLAPQQ
FT                   SQTLGQYEFHYRQFSNEIGPNFTAEVAFFDVTKNGKPYAEIIPERRYYDVRTMTISEVG
FT                   LDGGFWGDLYIVMGDSLGKGEFTFRLHYKPLIRWLWAGGILMAFGALFSVFGLRRKQEK
FT                   "
FT   CDS_pept        208959..209489
FT                   /transl_table=11
FT                   /locus_tag="HICON_04650"
FT                   /product="Thiol-disulfide interchange protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85928"
FT                   /protein_id="CBY85928.1"
FT                   /translation="MNKKLIFFTPLFVLLGVCILLIAGLNQDPKKIASALIDKPVPEFY
FT                   QANLHEPSQIVSPKEFPKQPFLLNVWGSWCGYCKEEHPLLIEIAKTLPIVGVDYRDNPQ
FT                   NGIKMLKRMGNPFILTIDDSHGELGLKLGVDGAPETYLVDENGVIRYRHSGLLDKETWQ
FT                   TVFLPKIEALKNK"
FT   CDS_pept        209486..210640
FT                   /transl_table=11
FT                   /locus_tag="HICON_04660"
FT                   /product="Cytochrome C-type biogenesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85929"
FT                   /protein_id="CBY85929.1"
FT                   /translation="MKSILDIFTRGFIQVQKTVFFATALLFAFSLFTQAEMVDTYQFQN
FT                   QDDRTRAVELAKSLRCPQCQNQNLVESNSPIAYDLRLEVYKMVDEGKSNQQIIDKMTAR
FT                   FGDFVNYKPPFKWNTALLWLLPVALLILAAVLLYFSNRKKQFSEKVVAQQLENDEIISL
FT                   PSTFGSSPRKQGEPSKLSKGKVNSKIYFVLFTLLIAIPTAYYFSLDRFSRVQQGEQSMI
FT                   EQHNQNVEMNDEHKSQNVIEKLQNKLRTDPNNAETWLQLGEAYVQNNEFDSALVAYSNA
FT                   EKLSGSKPNILGLAATALYYQAGQQMTQKVEQLLNEALAKDKNEVSSLSLLATIALENR
FT                   QYQQAGMYLQQLLDSGNAAVDRRSVIQRMKMLDFLQRGEKGQNP"
FT   CDS_pept        210769..>211662
FT                   /transl_table=11
FT                   /locus_tag="HICON_04670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85930"
FT                   /protein_id="CBY85930.1"
FT                   /translation="MSGGGFCNFTNLEVTPAHYLSQNPHFVKSALARYTNWDFISLVAE
FT                   QGIAYHEKELGQLFCDEGAEQIVEMLKSECDKYGAKILLRSEVSQVERIQNDEKVRFVL
FT                   QLNSTQWQCKNLIVATGGLSMPGLGATPFGYQIAEQFGIPVIPPRASLVPFTYRETDKF
FT                   LTALSGVSLPVTITAQCGKSFYNQLLFTHRGISGPAVLQISNYWQPTESVEIDLLPNHN
FT                   VEEEINQAKQHSPKQILKTILVRLLPKKLVELWIEQGLVQDEVIANISKVRVKNLVDFI
FT                   HHWEFTPNGTEGYRTAE"
FT   CDS_pept        211963..213273
FT                   /transl_table=11
FT                   /locus_tag="HICON_04680"
FT                   /product="enolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85931"
FT                   /protein_id="CBY85931.1"
FT                   /translation="MAKIVKVIGREIIDSRGNPTVEAEVHLEGGFVGLAAAPSGASTGS
FT                   REALELRDGDKSRFLGKGVLKAVAAVNNKIAQAIVGKDATNQAEIDQIMIDLDGTENKS
FT                   NFGANAILAVSLANAKAAAASKGLPLYAYIAELNGTAGVYSMPLPMMNIINGGEHADNN
FT                   VDIQEFMIQPVGAKTLREALRIGAEVFHNLAKVLKSKGMSTAVGDEGGFAPNLASNADA
FT                   LACIKEAVEKAGYVLGKDVTLAMDCASSEFYNKENGMYEMKGEGKSFTSQEFTHYLEEL
FT                   TKQYPIVSIEDGQDESDWEGFAYQTKVLGDRVQLVGDDLFVTNTKILKEGIEKGIANSI
FT                   LIKFNQIGSLTETLAAIKMAKDAGYTAVISHRSGETEDATIADLAVGTAAGQIKTGSMS
FT                   RSDRIAKYNQLIRIEEALERAGTPAAFLGLKAVKGQA"
FT   CDS_pept        213357..213776
FT                   /transl_table=11
FT                   /locus_tag="HICON_04690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85932"
FT                   /protein_id="CBY85932.1"
FT                   /translation="MLHLTLEDELFLGTPKQVGTHSTVFEHFAVMFEDDGETGYFYALD
FT                   IRQNAQPIVDMLHVYNVDSTSNHHEARKLEICWDESGYLALLLINGYPHAVFDFARLVG
FT                   YNSNKYPQPDLMSMWTREEITNKQTEQWLGVKTIR"
FT   CDS_pept        213789..214370
FT                   /transl_table=11
FT                   /locus_tag="HICON_04700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85933"
FT                   /protein_id="CBY85933.1"
FT                   /translation="MKKKNQILVSLSIVALLGGCSEEQVQRDVYQSLDDCLADWKKIEL
FT                   CEADKNTESTQKTATTPQQGLGLNIRDNGNAESAVKNPAENNVQANQSENNAESTTKAE
FT                   STDPSLGAAIAGGVIGYMAARAISSFLGPSYHPGNRAVTTPTGQVVQPQTNRSVGKPML
FT                   VKGNAGSMNSKPVSRGGFSSPNNTHRSSGG"
FT   CDS_pept        214371..215552
FT                   /transl_table=11
FT                   /locus_tag="HICON_04710"
FT                   /product="predicted glutathionylspermidine synthase"
FT                   /product="predicted enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85934"
FT                   /protein_id="CBY85934.1"
FT                   /translation="MKRVTGFPTRPDMVQQLLNVGFDYYNLPSSDGSHYWSDNVAYEFT
FT                   LAEIDRIEDTTNELHSMCLDFAADEIKKGDYENYRFTELQKQLIETSWRNQDPYLYGRF
FT                   DFGYDGDNLKMFEYNADTPTSLLEAAVVQWLWLEQIEGLKHRDQFNWIHEELIKHFQFL
FT                   KQQSGKTDFHLSAMQDADREDWGNVDYLADVAYNAGWNIHQLAVEDIGYNSETKKFVDL
FT                   NDQPIEMLFKLYPLEWLSHAEFARHITTAETRFIEPAWKMLLSNKALLAKLWARYPNHP
FT                   NLLPTYFTPFELPKDLSMWVKKPLLGREGANVFYYEKNNGVEFAAKGSEHSTFYGNSGY
FT                   VYQQKFELPSFDGMYPIIGSWVVGDVACGMGLREDFTAVTGNDSHFIPHYFVP"
FT   CDS_pept        complement(215785..217311)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04720"
FT                   /product="catalase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85935"
FT                   /protein_id="CBY85935.1"
FT                   /translation="MSSQCPFSHLAATNLTMGNGAPVADNQNSLTAGPRGPLLSQDLWL
FT                   NEKLADFVREVIPERRMHAKGSGAFGTFTVTHDITKYTRAKIFSEVGKKTEMFARFTTV
FT                   AGERGAADAERDIRGFALKFYTEEGNWDLVGNNTPVFFLRDPRKFPDLNKAVKRDPRTN
FT                   MRSATNNWDFWTLLPEALHQVTVVMSDRGIPASYRHMHGFGSHTYSFWNEAGERFWVKF
FT                   HFRTQQGIKNLTDAEAAEIIANDRESHQRDLYEAIERGDFPKWTLFVQIMPEADAEKVP
FT                   YHPFDLTKVWPKKDYPLIEVGEFELNRNPENFFADVEQSAFAPSNLVPGIGASPDRMLQ
FT                   ARLFNYADAQRYRLGVNYRQIPVNRPRCPVHSNQRDGQGRVDGNYGSLPHYEPNSFSQW
FT                   QQQPDFAEPPLRINGDAAHWDYRNDDNDYFSQPRALFNLMNAEQKQSLFNNTAAAMGDA
FT                   PDFIKYRHIRNCHWCDPVYGEGVAKALGLTVEDALKARNTDPALGQGGLL"
FT   CDS_pept        217577..218485
FT                   /transl_table=11
FT                   /locus_tag="HICON_04730"
FT                   /product="glycine tRNA synthetase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85936"
FT                   /protein_id="CBY85936.1"
FT                   /translation="MSTKFNVKTFQGMILALQEYWANQGCTIVQPFDMEVGAGTSHPMT
FT                   ALRALGPEPMAFAYVQPSRRPTDGRYGENPNRLQHYYQFQVVIKPSPDNIQELYLGSLE
FT                   MLGFDPTQNDIRFVEDNWENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECKPVTGE
FT                   VTYGLERLAMYIQGVDSVYDLVWSDGPLGKTTYGDVFHQNEVEQSTYNFEHANTDFLFY
FT                   CFDQYEKEAQELLALEKPLPLPAYERILKAAHSFNLLDARKAISVTERQRYILRIRALT
FT                   KGVAEAYYASREALGFPGCKK"
FT   CDS_pept        218544..218804
FT                   /transl_table=11
FT                   /locus_tag="HICON_04740"
FT                   /product="glutaredoxin-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85937"
FT                   /protein_id="CBY85937.1"
FT                   /translation="MSKPILFYAETCPDTAPFVAELDRLGVDYDEVEIMTSLPNLKQFI
FT                   RLRDSNAEFDNSKANGYLGIPALLLPNGDVVLDPSKLKAIF"
FT   CDS_pept        219391..221457
FT                   /transl_table=11
FT                   /locus_tag="HICON_04750"
FT                   /product="glycine tRNA synthetase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85938"
FT                   /protein_id="CBY85938.1"
FT                   /translation="MTTQNFLVEIGTEELPPKALKTLATSFADNVEAELNQAGLSFDKI
FT                   EWFAAPRRLAVKVLNLATQQPSKEIEKRGPAVSAAFDAEGKPTKAAEGWARGCGITVEQ
FT                   AERIATDKGEWLVHRAKIEGQPTKNLLNDIVANALAKLPIPKPMRWADKTVQFIRPVHT
FT                   VTMLLGDELIEGEILGVASARTIRGHRFLGEKEFEIQHADQYPQLLREKGSVVADFNER
FT                   KAEILAKSQAKATALGGVADIEESLLEEVTSLVEYPNVLAAKFEEHFLAVPAEALVYTM
FT                   KGDQKYFPIYDKDGKLLPHFIFVSNINPEDPTAIIEGNEKVVRPRLTDAEFFFKTDLKQ
FT                   KLVDRLPRLETVLFQQQLGTLKDKTDRIEQLAGEIAKQIGADEAKAKRAGLLSKCDLMT
FT                   NMVFEFTDTQGVMGMHYARHDGEDEEVAVALNEQYMPRFAGDELPKSLVASAVALADKF
FT                   DTLTGIFGIGQAPKGSADPFALRRAALGALRIIVEKNLPLDLEDLVKKSAALFGDKLTN
FT                   QNVVADVVDFMLGRFRAWYQDEGIEVDVIQAVLARRPTRPADFDARVRAVSHFRTLDSA
FT                   EALAAANKRVSNILAKADAAIGEINLTVCVEQAEKALAEAVLALRTEVQPLIAQGDYTT
FT                   VLDKLANLRAPVDSFFDNVMVNAEDPALRQNRLAILNTLQGLFLQVADISVLQ"
FT   tRNA            221543..221616
FT                   /product="transfer RNA-Met"
FT                   /anticodon="(pos:221577..221579,aa:Met)"
FT   CDS_pept        221975..222283
FT                   /transl_table=11
FT                   /locus_tag="HICON_04760"
FT                   /product="putative major capsid protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85939"
FT                   /protein_id="CBY85939.1"
FT                   /translation="MLSSALVNLDAKQLNSQNGVLITAQNLIGGLRAISAPFFPADCIL
FT                   ITTLSNLAIYFKQNTARLFFKQEPRQNNVQIYFSVMLDYLLENHRYAVLIESIDEVQ"
FT   CDS_pept        222662..222949
FT                   /transl_table=11
FT                   /locus_tag="HICON_04770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85940"
FT                   /protein_id="CBY85940.1"
FT                   /translation="MIYPQRISMNIVNWTKDALRQLLKIDGRYQKAIREKANALSEFPS
FT                   EALDTKKLKGEEGKWRLRVGNYRIIFEVINGQPKIINIQAIKRRSERTYS"
FT   CDS_pept        222961..223353
FT                   /transl_table=11
FT                   /locus_tag="HICON_04780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85941"
FT                   /protein_id="CBY85941.1"
FT                   /translation="MNLNHRYINNSQGQPEFVILPIAEYEDLIMKASPFDDENAEEWEN
FT                   IPVEASEDGDKLIPNDVVNIMFEQEVSLLAAWRIYRSLSQAEVAKHTGLTQSAISQAER
FT                   KESKPQKKTREKLAKIYQCKPEQLEL"
FT   CDS_pept        223414..223791
FT                   /transl_table=11
FT                   /locus_tag="HICON_04790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85942"
FT                   /protein_id="CBY85942.1"
FT                   /translation="MAKNKPTLPPRKWYSLQQAADKLTREFGEPVTVDDLLHYYQIDLL
FT                   PFSIYINHNVERTCINDLVFRAPQKSENSMPISILKFDILNKLEELIIGKILYIEFPKK
FT                   ETESLILDSYKFKKSLHHVGN"
FT   CDS_pept        complement(224433..225467)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04800"
FT                   /product="DNA polymerase III, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85943"
FT                   /protein_id="CBY85943.1"
FT                   /translation="MNRIFPEQLNHHLAQGLARVYLLQGQDPLLLSETEDTICQVANQQ
FT                   GFDEKNTIQVDSQTDWAQLIESCQSIGLFFSKQILSLNLPENFTALLQKNLQELISVLH
FT                   KDVLLILQVAKFAKGIEKQTWFITLNQYEPNAILINCQTPTVENLPRWVKNRTKAMGLD
FT                   ADNEAIQQLCYSYENNLLALKQALQLLDLLYPDHKLNYNRVISVVEQSSIFTPFQWIDA
FT                   LLMGKANRAKRILKGLQAEDVQPVILLRTLQRELFTLLELTKPQQRIVTTEKLPIQQIK
FT                   TEFDRLKIWQNRRPLFLSAIQRLTYQTLYEIIQELANIERLTKQEFSDEVWIKLADLSV
FT                   KICL"
FT   CDS_pept        complement(225467..225970)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04810"
FT                   /product="conserved predicted lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85944"
FT                   /protein_id="CBY85944.1"
FT                   /translation="MINSIKTLLLIATLAILSACGWHFQQSVTMPNEWRTLALESDDSY
FT                   NDFTVIMRRKLQENQVNVVNLEQNIPILRINKQITSDQVASIFKHGREAEKLLMLEVEA
FT                   TFRLANGESYPINAKVNRTFFDNARAALAKSEEREVIWNDMREQVARQLIVKIIALQNQ
FT                   IKRK"
FT   CDS_pept        complement(226065..228650)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04820"
FT                   /product="leucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85945"
FT                   /protein_id="CBY85945.1"
FT                   /translation="MQEQYRPDMIEPKVQQYWAENKVFKAIKDESKEKYYCLSMFPYPS
FT                   GRLHMGHVRNYTIGDVISRYQRMLGKNVLQPFGWDAFGLPAEGAAIKNKTAPAKWTYEN
FT                   IAYMKKQLQLLGFGFDWDREIATCKPDYYKWEQWFFTELYKKGLVYKKTSTVNWCPNDE
FT                   TVLANEQVHEGCCWRCDTPVEQKEIPQWFIKITDYAEQLLGGLDNLPQWPDMVKTMQRN
FT                   WIGRSEGVEITFDVADTNEKVAVYTTRPDTFYGVSYLGIAAAHPLASLAAQNNSELAAF
FT                   IQEAKNAKVAEADLATMEKKGMATGLFAIHPLTGEELPIWVANFVLMHYGTGAVMAVPA
FT                   HDQRDFEFAQKYSLPIKQVIAPLANEEIDLTKQAFVEHGKLVNSAEFDGLDFDGAFNGI
FT                   ADKLEKLGVGKRQVNYRLRDWGVSRQRYWGAPIPMLTLENGDVVPAPMEDLPIILPEDV
FT                   VMDGVKSPIKADPNWAKTTFNGAPALKETDTFDTFMESSWYYARYTCPQYQNGMLDAEE
FT                   ANYWLPVDQYIGGIEHATMHLLYFRFFHKLLRDAGFVTSDEPADKLLCQGMVLADAFYY
FT                   TSPTNERIWVSPTQVTLERDEKGRIIKATDPEGRELVHSGMTKMSKSKNNGIDPQEMVE
FT                   KYGADTVRLFMMFASPAEMTLEWQESGVEGAKRFLGRVWNLVYQYQQNPAKTSLDITAL
FT                   SATQKALRREVHKTIAKVSDDIGRRQTFNTAIAAVMELMNKLTKASLESDQDRAVMAEA
FT                   LSAVVRMLYPITPHICFELWQALGNESNIDTAEWVKADEAAMVEDEKLIVVQVNGKVRG
FT                   KVTVATDADEDTVKTIAFADENVKKFIDNQHIVKVIYVVGKLLNVVVKP"
FT   CDS_pept        228947..229618
FT                   /transl_table=11
FT                   /locus_tag="HICON_04830"
FT                   /product="undecaprenyl pyrophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85946"
FT                   /protein_id="CBY85946.1"
FT                   /translation="MDGNGRWAKQKNKMRIFGHTNGVTAVRKAVAYARQIGVEVLTLYA
FT                   FSSENWSRPEQEISALMSLFMQALDREVKKLHKNNICLKIIGDVSRFSETLQEKIKKAE
FT                   NLTEKNTALTLNIAANYGGCWDIIQAAKQIAEKVKKEEMSVSDINNSTFQHHLATQNAP
FT                   PVDLLIRTSGEQRISNFLLWQIAYAELYFSDVLWPDFNQLEFNHAIASYQQRHRRFGGT
FT                   E"
FT   CDS_pept        229636..230502
FT                   /transl_table=11
FT                   /locus_tag="HICON_04840"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85947"
FT                   /protein_id="CBY85947.1"
FT                   /translation="MLKQRVLSAIVLIAAVLCALFLFTPFYFALALGAVAILGIWEWTQ
FT                   FARLKQPLIRFFVATFLGVFIFLWLYTEGNYLDAGRVFEQHLQLLLINAVSWWGLALLL
FT                   VISYPKSAKFWSKNPLLQLLFAFSTLIPFIAGVLRLRLEHYTHDPYHGLFLLLYVFILV
FT                   WAADSGAYFSGRAFGKRKLAPKVSPGKSWEGVIGGLITALVLAFIFIHFSNNTLVGDRN
FT                   ITGFIILSVATVAISVLGDLTESMFKRESGVKDSSQLIPGHGGVLDRIDSLTAAVPFFS
FT                   YFYFFVL"
FT   CDS_pept        230512..231843
FT                   /transl_table=11
FT                   /locus_tag="HICON_04850"
FT                   /product="predicted membrane bound zinc metalloprotease
FT                   with PDZ domain"
FT                   /product="zinc metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85948"
FT                   /protein_id="CBY85948.1"
FT                   /translation="MSFLWSLGSFIIAIAVLVSVHEYGHFWAARKCGIKVHRFSIGFGK
FT                   VIWKRIDKYGTEFAVSMIPLGGYVKMLDGRNEVVPAEQKSQAFDSKSVLQRAFVIIAGP
FT                   LANFIFAIFAYWVIYLYGMPTVKPVIESITPSSIAAQAHIEPNTQILAVDGEETQDWET
FT                   INMLLATKMGEPNVEITLSPFGSNIEQQRTLNLTNWIFDPEKESAFEALGIMPMRPQVE
FT                   MVLSKVVQNSPAEKAGLQIGDKILKENLTALPWQDFIKQVEQGETFTIKIERNGETFDK
FT                   VLTPVRNQNGKWFVGVSPTLTKLADEYRTELKYGILESLQKGIEKTGQLSLLTLKILGK
FT                   LLTGDLSLNNLSGPISIAKGAGASANIGLVYFLSFMALISVNLGIMNLFPLPVLDGGHL
FT                   VFLTMEAVKGKPVSERVQSICYRIGAALLLSLTVFALFNDFLRL"
FT   CDS_pept        231863..>233860
FT                   /transl_table=11
FT                   /locus_tag="HICON_04860"
FT                   /product="protective surface antigen"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85949"
FT                   /protein_id="CBY85949.1"
FT                   /translation="MKKLLIASLLFGTTTTVFAAPFVAKDIRVDGVQGDLEQQIRASLP
FT                   VRAGQRVTDNDVANIVRSLFVSGRFDDVKAHQEGDVLVVSVVAKSIISDVKIKGNSIIP
FT                   TEALKQNLDANGFKIGDVLIREKLNEFAKSVKEHYASVGRYNATVEPIVNTLPNNRAEI
FT                   LIQINEDDKAKLASLTFKGNESVSSSTLQEQMELQPDSWWKLWGNKFEGAQFEKDLQAI
FT                   RDYYLNNGYAKAQITKTDVQLNDEKTKVNVTIDVNEGLQYDLRSARIIGNLGGMSAELE
FT                   PLLSALHLNDTFRRSDIADVENAIKAKLGERGYGNATVNSVPDFDDANKTLAITFVVDP
FT                   GRRLTVRQLRFEGNTVSADSTLRQEMRQQEGTWYNSQLVELGKIRLDRTGFFETVENRI
FT                   DPINGSNDEVDVVYKVKERNTGSINFGIGYGTESGISYQASVKQDNFLGTGAAVSIAGT
FT                   KNDYGTSVNLGYTEPYFTKDGVSLGGNVFFENYDNSKSDTSSNYKRTTYGSNVTLGFPV
FT                   NENNSYYVGLGHTYNKISNFALEYNRNLYIQSMKFKGNGIKTNDFDFSFGWNYNNLNRG
FT                   YFPTKGVKASLGGRVTIPGSDNKYYKLSADVQGFYPLDRDHRWVVSAKASAGYANGFGN
FT                   KRLPFYQTYTAGGIGSLRGFAYGSIGPNAIY"
FT   CDS_pept        234349..234942
FT                   /transl_table=11
FT                   /locus_tag="HICON_04870"
FT                   /product="outer membrane chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85950"
FT                   /protein_id="CBY85950.1"
FT                   /translation="MKNIAKVTALALGIALASGYASAEEKIAFINAGYIFQHHPDRQAV
FT                   ADKLDAEFKPVAEKLAANKKEVDDKIAAARKKVEAKVAALEKDAPRLRQADIQKRQQEI
FT                   NKLGAAEDAELQKLMQEQDKKVQEFQAQNEKRQAEERGKLLDSIQTATNNLAKAKGYTY
FT                   VLDANSVVFAVEGKDITEEVLKSIPASEKAQEKK"
FT   CDS_pept        234955..235980
FT                   /transl_table=11
FT                   /gene="lpxD"
FT                   /locus_tag="HICON_04880"
FT                   /product="UDP-3-O-(3-hydroxymyristoyl)-glucosamine
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85951"
FT                   /protein_id="CBY85951.1"
FT                   /translation="MQKSYSLQELATQIGATVRGNADVVVENIAPLDKAQSNQLTFISN
FT                   VKFRALLKDSKAGILVVSEEDVEHCSPESNLLIVKDPYVAYAILAQYMDSTPKAAQGIA
FT                   KSAVIFDDVLLGENVSIGANAVIEEGVVLGDNVIIGANCFVGKNTKIGSGTQLWANVTV
FT                   YHNVEIGANCLIQSGTVIGSDGFGYANDRGRWIKIPQVGQVIIGNNVEIGANTCIDRGA
FT                   LDATIIEDNVIIDNLCQIAHNVHIGTGTAVAGGVIMAGSLTVGRYCLIGGASVINGHME
FT                   ICDKVTITGMGMVMRPITEPGVYSSGIPLQTNKEWRKTAALTLGIDGIHKRLKALEKKI
FT                   S"
FT   CDS_pept        complement(236149..237000)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04890"
FT                   /product="protein chain elongation factor EF-Ts"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85952"
FT                   /protein_id="CBY85952.1"
FT                   /translation="MAEITASLVKELRDRTGAGMMECKKALVEANGDIELAIDNMRKSG
FT                   QAKAAKKAGRVAAEGVILARVENGFGVLVEMNCETDFVAKDAGFLGLANEVADFAAANK
FT                   GTTIEALQAQFEEKRAALVAKIGENMNIRRVAYLDGQVIAQYLHGAKIGVLVAGEGSAD
FT                   ELKKVAMHVAASKPEFVNPEDVSAEVVEHERQIQIDIAINSGKPKEIAEKMVEGRMKKF
FT                   TGEVSLTGQAFVMDPSVSVGDFLKSVNTSVSNFIRLEVGEGIEKKEEDFAAEVAKITGG
FT                   NA"
FT   CDS_pept        complement(237134..237856)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04900"
FT                   /product="30S ribosomal subunit protein S2"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85953"
FT                   /protein_id="CBY85953.1"
FT                   /translation="MAQVSMRDMINAGVHFGHQTRYWNPQMKPFIFGARNGVHIINLEK
FT                   TLPLFNEALAELTRIASNNGKVLFVGTKRAASEAVQAAALDCQQYYVNHRWLGGMLTNW
FT                   KTVRQSIKRLKDLETQSQDGTFDKLTKKEALMRSREMEKLELSLGGIKDMGGLPDALFV
FT                   IGADHEHIAVKEANNLGIPVFAIVDTNSTPAGVDFVIPGNDDATRAIQLYVSAAAAAVK
FT                   EGRGNEAQVAEELAADAE"
FT   CDS_pept        complement(238034..238798)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04910"
FT                   /product="conserved SAM dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85954"
FT                   /protein_id="CBY85954.1"
FT                   /translation="MNNKISVYDKDNFFELYQKLRANPISLNEIIEKPTMLSLLPNLKG
FT                   KKLLDLGCGTGGHLQLYLERGAAKVIGTDLSEKMLEQAEKDLQKCGQFSGRFSLYHLPI
FT                   EKLAELPESHFDVITSSFVFHYIENFPTLLSTIHDKLSSNGTLIFSQEHPITTCHKEGE
FT                   RWEKNDKKQQVAYRLNHYREEGKRNRNWFKQPFQTYHRTTATIINNLIHARFQIEQMEE
FT                   PMLADQPQWHNEFKDLSHRPPLLFIKARKVEK"
FT   CDS_pept        complement(238899..240755)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04920"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85955"
FT                   /protein_id="CBY85955.1"
FT                   /translation="MSQLANPELMKVVILLASSVTIVPLFKRLGLGSVLGYLVAGCLIG
FT                   PSVFGIVQDPTAVVHLAELGVVMFLFIIGLEMYPERLWAMRKAIFGRGLLQVGLCGCLL
FT                   TFSGIYLLGLTKEVSFIAGMGFTLSSTAIVMQSLEERGLTSTSKGQRVISTLIFEDIAI
FT                   VPLLASVAFLAPHSKESTPHTDWVSIGIALSAVVGLIVTGKWLMNPLFRLISKARIREM
FT                   MTAGALLVVLGAALAMEIGGLSMAMGAFVAGVMMSESAFRHQLEADIEPFRGLLLGLFF
FT                   MGVGMSLDLHLVFNHWILLLGIVFLYILGKASAVYIIARITRLDHREAIGRMSLMAHGG
FT                   EFAFVLFSAAATAEVISNEEKATFTAAVIISMLFSPIIAQIARKLIQRTEPKYLDQLDE
FT                   NDLDSIVDLEDNVLVIGFGRFSQIVCQTLLLRGISVSVIDRNIENIRAAAKFGFKVYYG
FT                   DGIRLDVLRAAGIEKAKCVVLGINDTQRIEHIVSQMKEAYPNLPILTRTYDRKTTVSLI
FT                   KQDVDFIVRETFESAITLSRATLMKLGIDKIEAEEIIKEVRTLDQERLNEEVLHGFSNE
FT                   IVKKYWTPRPFIKPHLDTKALNKETEEILSEKIEEEISNDHS"
FT   CDS_pept        complement(240864..241274)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04930"
FT                   /product="mutator protein MutT"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85956"
FT                   /protein_id="CBY85956.1"
FT                   /translation="MDKKIIQVAAGIIRNEFGQIYLTQRLEGQDFAQSLEFPGGKVDAG
FT                   ETPEQALKRELEEEIGIVALNAELYERFQFEYPTKIISFFFYLVNEWIGEPFGREGQEG
FT                   FWVEQRALDAGQFPPANAKLIHRLLNETHNFI"
FT   CDS_pept        complement(241339..244044)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04940"
FT                   /product="preprotein translocase SecA subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85957"
FT                   /protein_id="CBY85957.1"
FT                   /translation="MSILTRIFGSRNERVLRKLKKQVVKINKMEPAFEALSDDELKAKT
FT                   QEFRDRLSGGETLQQILPEAFATVREASKRVLGMRHFDVQLIGGMVLTNRCIAEMRTGE
FT                   GKTLTATLPCYLIALEGKGVHVVTVNDYLARRDAETNRPLFEFLGMSVGVNIPGLSPEE
FT                   KRAAYAADITYATNSELGFDYLRDNLAHSKEERFQRTLGYALVDEVDSILIDEARTPLI
FT                   ISGQAENSSELYIAVNKLIPSLIKQEKEDTEEYQGEGDFTLDLKSKQAHLTERGQEKVE
FT                   DWLIAQGLMPEGDSLYSPSRIVLLHHVMAALRAHTLFEKDVDYIVKDGEIVIVDEHTGR
FT                   TMAGRRWSDGLHQAIEAKEGVDVKSENQTVASISYQNYFRLYERLAGMTGTADTEAFEF
FT                   QQIYGLETVVIPTNRPMIRDDRTDVMFENEQYKFNAIIEDIKDCVERQQPVLVGTISVE
FT                   KSEELSKALDKAGIKHNVLNAKFHQQEAEIVAEAGFPSAVTIATNMAGRGTDIILGGNW
FT                   KAQAAKLENPTQEQIEALKAEWEKNHEIVMKAGGLHIIGTERHESRRIDNQLRGRSGRQ
FT                   GDPGSSRFYLSLEDGLMRIYLNEGKLNLMRKAFTVAGEAMESKMLAKVIASAQAKVEAF
FT                   HFDGRKNLLEYDDVANDQRHAIYEQRNHLLDNDDISETINAIRHDVFNGVIDQYIPPQS
FT                   LEEQWDIKGLEERLSQEFGMELPISNWLEEDNNLHEESLRERIVEIAEKEYKEKEALVG
FT                   EDAMRHFEKGVMLQTLDELWKEHLASMDYLRQGIHLRGYAQKDPKQEYKKESFRMFTEM
FT                   LDSLKHQVITTLTRVRVRTQEEMEEAERARQEMAARINQNNLPVDENSQTTQNSETEDY
FT                   SDRRIGRNEPCPCGSGKKYKHCHGSRVARQ"
FT   CDS_pept        complement(244169..244471)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85958"
FT                   /protein_id="CBY85958.1"
FT                   /translation="MISGTVKPNFWSRLLLSIIAIFALPNAQSFENQNNTENYSSSVSI
FT                   QQALETVKVAREVQRQAIPQPSISRQTKKQPKIQPHFLADVLNLSAPIRAGPLLI"
FT   CDS_pept        244551..244865
FT                   /transl_table=11
FT                   /locus_tag="HICON_04960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85959"
FT                   /protein_id="CBY85959.1"
FT                   /translation="MENKAERYQKAVNITDVLEQSPFAKIIKKGLAINELNQKFNRIFP
FT                   QEFHGKFRIGNITDHLIFIEVSNAIVRQGILFRQIELLTLIQEEFPKVTGFEITINPGF
FT                   "
FT   CDS_pept        complement(244893..245414)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04970"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85960"
FT                   /protein_id="CBY85960.1"
FT                   /translation="MDAAKVRSEFDEKMMRYALELADKAEALGEIPVGAVLVDDAGNII
FT                   GEGWNLSIVQSDPTAHAEIIALRNGAKNIQNYRLLNSTLYVTLEPCTMCAGAILHSRIR
FT                   RLVFGASDYKTGAIGSRFHFFDDYKMNHTLEITSGVLAEECSQKLSTFFQKRREEKKIE
FT                   KALLKSLSDK"
FT   CDS_pept        complement(245414..246265)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04980"
FT                   /product="thymidylate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85961"
FT                   /protein_id="CBY85961.1"
FT                   /translation="MKQYLDLCRRIVSEGEWVANERTGKHCLTVINADLEYDVANNQFP
FT                   LITTRKSYWKAAIAEFLGYIRGYDNAADFRALGTKTWDANANVNAAWLANPHRRGVDDM
FT                   GRVYGVQGRAWRKPNGETIDQLRKIVNNLTKGIDDRGEILTFFNPGEFDLGCLRPCMHT
FT                   HTFSLVGDTLHLTSYQRSCDVPLGLNFNQIQVFTFLALMAQITGKRAGKAYHKIVNAHI
FT                   YEDQLELMRDVQLKRKPFPLPKLEINPDIKSLEDLETWVTMDDFKVVGYQSHEPIKYPF
FT                   SV"
FT   CDS_pept        complement(246275..247081)
FT                   /transl_table=11
FT                   /locus_tag="HICON_04990"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_04990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85962"
FT                   /protein_id="CBY85962.1"
FT                   /translation="MNSNYLLLPHFDPSIFTLGDSNIGLRWYGLMYLLGFVFARWLAVR
FT                   RANRPNSGWTVDQVDTLLFNGFMGVFIGGRVGDVFFYNLDHFLQEPLYLFRVWEGGMSF
FT                   HGGLIGVIVAMIWTSYSQKRNFWQTADFVAPLIPFGLGLGRIGNFINLELWGRETNVPW
FT                   AMIFPNDPLLLPRHPSQLYEAFLEGLVLFAILNIFIKKPRPMASVAGLFLIGYGVFRFI
FT                   VEYVREPEVENFFGIITRGQALCLPMIIGGAFIMAWAYSRKSAVIK"
FT   CDS_pept        complement(247090..247884)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05000"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85963"
FT                   /protein_id="CBY85963.1"
FT                   /translation="MFTFILLCLLVGALAGFLAGLFGIGGGLVIVPTLVYLLPIVDVPE
FT                   SLLMSTALGTSFATIVITGIGSAQRHHKLGNIVWQAVRILAPVIMFSVFICGLFIGRLD
FT                   REISAKIFACLVVYLATKMVLSIKKDQVTTKPLTPLASVIGGILIGMASSAAGIGGGGF
FT                   IVPFLTARGINIKQAIGSSAFCGMLLGISGMFSFIVSGWGNPLMPEYSLGYIYLPAVLG
FT                   ITATSFFTSKLGASATAKLPVSTLKKGFALFLIVVAINMFLK"
FT   CDS_pept        complement(247884..248327)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05010"
FT                   /product="nucleotide hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85964"
FT                   /protein_id="CBY85964.1"
FT                   /translation="MYRELHEEVGLQPKDVRLLYVSKHWLRYKLPKRLLRYDSKPMCIG
FT                   QKQRWFLLQLVSDEKNINMQTTKSPEFDGWRWVSFWYPVRQVVSFKRDVYRKVMKEFAS
FT                   ILFTDNPLIFSASREANSQHYSANKKYSQAKYTKRHFYKSRGQ"
FT   CDS_pept        complement(248555..249661)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05020"
FT                   /product="gamma-glutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85965"
FT                   /protein_id="CBY85965.1"
FT                   /translation="MNKKTIVVKFGTSTLTQGSPKLNSPHMMEIVRQIAQLHNDGFRIV
FT                   IVTSGAIAAGRHYLNHPQLPPTIASKQLLAAVGQSQLIQVWEKLFAIYDIHIGQLLLTR
FT                   ADIEDRERFLNARDTLHALLDNHIIPVINENDAVATAEIKVGDNDNLSALVAILVQAEQ
FT                   LYLLTDQQGLFDSDPRKNSEAKLIPVVEQITDHIRSIAGGSGTNLGTGGMMTKIIAADV
FT                   ATRSGIETIIAPGNRPNVIADLAYEQNIGTKFIAHQSDRLESRKQWLFAAPSAGIITID
FT                   NGAQNAILEQNKSLLPAGIINVEGRFSRGEVVKIRTQSGKDIALGMPRYNSDALQLIKG
FT                   RKSADIENVLGYEYGAVAMHRDDMIILS"
FT   CDS_pept        249763..250245
FT                   /transl_table=11
FT                   /locus_tag="HICON_05030"
FT                   /product="dihydrofolate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85966"
FT                   /protein_id="CBY85966.1"
FT                   /translation="MTFSLIVATTLNSVIGKDNQMPWHLPADLAWFRQNTTGKPVIMGR
FT                   KTFESIGRPLPKRTNIVLSRQPFEHEGVVWKDSFESAVDFVRNFDEIMLIGGGELFKQY
FT                   LPQADKLYLTQIQAELDGDIFFPQLNWDEWTIEFDEYRKADEQNRYDCRSLILTRK"
FT   CDS_pept        250428..251600
FT                   /transl_table=11
FT                   /locus_tag="HICON_05040"
FT                   /product="multidrug efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85967"
FT                   /protein_id="CBY85967.1"
FT                   /translation="MTQIATENPSNKSVSNKTNRKKGLSIFILVLLIISIACALYWFFF
FT                   LKDFEETEDAYVEGNQVMVSSQVAGNVAKINADNMDKVHAGDILVELDDTNAKLSFEQA
FT                   KSNLANAVRQIEQLGFTVQQLQSAVHANEISLAQAQGNLARRVQLEKMGAIDKESFQHA
FT                   KEAVELAKANLNASKNQLAANQALLSNVPLREQPQIQNAMSSLKQAWLNLQRTKIRSPI
FT                   DGYVARRNVQVGQAVSVGGALMAVVSNEQMWLEANFKETQLTNMRIGQPVKIHFDLYGK
FT                   NKEFDGVINGIEMGTGNAFSLLPSQNATGNWIKVVQRVPVRIKLDPQQFTETPLRIGLS
FT                   ATAKVRISDSSGAMLREKAEPKTLFSTDTLKYDESAVENLIESIIQQNSH"
FT   CDS_pept        251610..253142
FT                   /transl_table=11
FT                   /locus_tag="HICON_05050"
FT                   /product="multidrug efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85968"
FT                   /protein_id="CBY85968.1"
FT                   /translation="MDNSAKKFPPIQGGALILLTLALSLATFMQVLDSTIANVAIPTIA
FT                   GDLGASFSQGTWVITSFGVANAISIPITGWLAKRFGEVRLFLVSTFLFVVSSWLCGIAD
FT                   SLEALIIYRVIQGAVAGPVIPLSQSLLLNNYPPEKRGMALAFWSMTIVVAPIFGPILGG
FT                   WISDNIHWGWIFFINVPIGLLVVLISWKILGNRESEIVHQPIDKVGLVLLVLGVGCLQL
FT                   MLDQGREQDWFNSNEIIILAVVAVVCLIALVIWELTDDNPVVDISLFHSRNFSVGCLCT
FT                   SLAFLIYLGSVVLIPLLLQQVFHYTATWAGLAASPVGLFPILLSPIIGRFGYKIDMRIL
FT                   VTISFIVYAITFYWRAVTFEPSMTFVDVALPQLVQGLAVSCFFMPLTTITLSGLPAHKM
FT                   ASASSLFNFLRTLAGSVGTSLTTFMWYNREAVHHTQLTEHINPYNPISQSFYHQMNQFG
FT                   LSDTQTSAYLAQQITSQGFIIGANEIFWLSAMGFLGLLIVIWFAKPPFSTQH"
FT   CDS_pept        complement(253155..253625)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05060"
FT                   /product="Cell division protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85969"
FT                   /protein_id="CBY85969.1"
FT                   /translation="MRLTEEQRQVLIQIERDQKAADEARKLAEQQRIEDATRTQSKKTE
FT                   DMKNTESEIVKLESIKKQDSQKIESAKKVEQIKTVNNVRDSKKFGLQCGAFKNRAQAEN
FT                   LQGRLQMTGLNAQIQTNGEWNRVRVASFDTRELAVQAQSRAKTVTDCVVIGM"
FT   CDS_pept        complement(254182..257256)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05070"
FT                   /product="multidrug efflux system protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85970"
FT                   /protein_id="CBY85970.1"
FT                   /translation="MYEEIRMKFTDIFIRRPVLAVSISLLMIILGLQAISKLAVREYPK
FT                   MTTTVITVSTAYPGADANLIQAFVTSKLEESIAQADNIDYMSSTSAPSSSTITIKMKLN
FT                   TDPAGTLADVLAKVNAVKSALPNGIEDPSVSSSSGGSGIMYISFRSKKLDSSQVTDYIN
FT                   RVVKPQFFTIEGVAEVQVFGAAEYALRIWLDPQKMAAQNLSVPTVMSALSANNVQTAAG
FT                   NDNGYYVSYRNKVETTTKSVEQLSNLIISSNGDDLVRLRDIATVELNKENDNSRATANG
FT                   AESVVLAINPTSTANPLTVAEKIRPLYESIKTQLPDSMESDILYDRTIAINSSIHEVIK
FT                   TIGEATLIVLVVILMFIGSFRAILIPILAIPISLIGVLMLLQSFNFSINLMTLLALILA
FT                   IGLVVDDAIVVLENIDRHIKAGETPFRAAIIGTREIAVPVISMTIALIAVYSPMALMGG
FT                   ITGTLFKEFALTLAGAVFISGVVALTLSPMMSSKLLKSNAKPTWMEERVEHTLGKVNRV
FT                   YEYMLDLVMLNRKSMLAFAVVIFSTLPFLFNSLSSELTPNEDKGAFIAIGNAPSSVNVD
FT                   YIQNAMQPYMKNVMETPEVSFGMSIAGAPTSNSSLNIITLKDWKERSRKQSAIMNEINE
FT                   KAKSIPEVSVSAFNIPEIDTGEQGAPVSIVLKTAQDYKSLANTAEKFLSAMKASGKFIY
FT                   TNLDLTYDTAQMTISVDKEKAGTYGITMQQISNTLGSFLSGATVTRVDVDGRAYKVISQ
FT                   VKRDDRLSPESFQNYYLTASNGQSVPLSSVISMKLETQPTSLPRFSQLNSAEISAVPMP
FT                   GISSGDAIAWLQQQANDNLPQGYTYDFKSEARQLVQEGNALTTTFILAVVIIFLVLAIQ
FT                   FESIRDPMVIMISVPLAVSGALVSLNILSFFSIAGTTLNIYSQVGLITLVGLITKHGIL
FT                   MCEVAKEEQLNYGKTRIEAITHAAKVRLRPILMTTAAMVAGLIPLLYATGAGAVSRFSI
FT                   GIVIVAGLSIGTIFTLFVLPVVYSYIATEHKPLGF"
FT   CDS_pept        complement(257256..258452)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05080"
FT                   /product="predicted membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85971"
FT                   /protein_id="CBY85971.1"
FT                   /translation="MSQTQHQRPKRSHIFFMKIILVVFVLIFVGVIGFNMIKGVMISRA
FT                   IAEMPEPSSPVTALEVQPREWTPVINTTGLVRPNQGAMLSTQNAGTISQVLVQNGQQVK
FT                   KGDLLIELDSSVEHASLQAAQAQLPALRQTYQRYANLLKSNAVSRQEMDNAKAAYDAQL
FT                   ANIESLKAVIERRKIVAPFDGKAGIVKINVGQYVNVGTEIVRVEDTSSMKVDFALSQND
FT                   LDKLHIGQRVTATTDARLGETFSARITAIEPAINSSTGLVDVQATFNPEDGHKLLSGMF
FT                   SRLRIALPTETNQVVVPQVAISYNMYGEIAYLLEPLSEEEKGKMSGNEKLDRLYRAKQI
FT                   TVFTKDRQGVYAQLQGNEVKAGDKIITGGQQGIGNGSLVEWIKKDIVGAVEPAHKTPL"
FT   CDS_pept        complement(258484..259047)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05090"
FT                   /product="transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85972"
FT                   /protein_id="CBY85972.1"
FT                   /translation="MRQAKTDLAEQIFSATDRLMAKEGLNQLSMHKLAKEANVAAGTIY
FT                   LYFKNKDELLEQFAHRVFSMFMATLEKDFDETKPFFEQYRQMWKNIWYFLQENLTILSN
FT                   LKQYESLPNFKDICKNIKNCRWDLFCHQAQKAGLLAELSEDILFLLSLKTAINLASDAK
FT                   FIDFDLKPEILESVIERSWRAIQK"
FT   CDS_pept        complement(259290..260537)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05100"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85973"
FT                   /protein_id="CBY85973.1"
FT                   /translation="MQQDYLSQQRFSALPLHPIVRDALAKKGFDFCTPIQALSLPISLN
FT                   GRDVAGQAQTGTGKTMAFLTATFHHLLTHQDPNLKYPHPRALILVPTRELAVQISNDAE
FT                   FLAKASGLKTALAYGGDGYDKQLQAIECGVDILIGTTGRVIDYVKQGVIGLDEIQVVVL
FT                   DEADRMFDLGFIRDIRYLLRKCPAPQARLTMLFSATLSYKVRELAFEDMNDPEYIEIEP
FT                   EQKTGHRIKEELFYPSNQDKMALLLTLMEDEWPERCIVFANTKHRCEEIWGYLAADGHR
FT                   VGLLTGDVAQKKRLSLLKQFTDGDLDILVATDVAARGLHISDVTHVFNYDLPDDREDYV
FT                   HRIGRTGRAGESGVSISFACEEYAMNLPAIEEYIGHSIPVSQYETEALLELPKPYRLKR
FT                   AVPPQGHTRHRSYHTK"
FT   CDS_pept        complement(260655..260861)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85974"
FT                   /protein_id="CBY85974.1"
FT                   /translation="MSDEMIEVPCPICQKSVPWINESTFRPFCSKRCQLIDLGEWVAEE
FT                   KAIPSDTADFAMDPNVSDGWSIK"
FT   CDS_pept        complement(260854..261474)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05120"
FT                   /product="dephospho-CoA kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85975"
FT                   /protein_id="CBY85975.1"
FT                   /translation="MTYIVGLTGGIGSGKTMIANLFADLGVPLVDADVVAREVVAKDSP
FT                   LLSKIVEHFGAQILTEQGELNRAALRERVFNHDEDKLWLNNLLHPAIRERMKQQLAEQT
FT                   APYTLFVVPLLIENKLTALCDRILVVDVSPQTQLARSAQRDNNNFEQIQRIMNSQVSQQ
FT                   ERLKWADDVINNDAELAQNLPHLQQKVLELHQFYLQQAENKNV"
FT   CDS_pept        complement(261545..262810)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05130"
FT                   /product="serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85976"
FT                   /protein_id="CBY85976.1"
FT                   /translation="MFTRNMTIADYDPVLWQAIQDENRRQEEHIELIASENYASPRVME
FT                   AQGSQFTNKYAEGYPGKRYYGGCEYADIVEQLAIDRAKELFGADYVNVQPHSGSQANAA
FT                   VYGALINAGDTILGMDLAHGGHLTHGAKVSFSGKIYNSVLYGITADGLIDYEDVRQKAL
FT                   ECKPKLIVAGFSAYSQVVDWAKMREIADEVGAYLFVDMAHVAGLIAAGLYPNPLPHAHV
FT                   VTTTTHKTLGGPRGGLILSSCGDEEIYKKLQSSVFPANQGGPLVHIIAAKAVCFKEALE
FT                   PQYKEYQANVIKNAKAMVEVFKQRGYDVVSNGTENHLFLVSFIKQGLTGKAADAALGKA
FT                   NITVNKNAVPNDPQKPFVTSGIRVGTPSVTRRGFNENDVRELAGWMCDVLDALGKENEE
FT                   QVIAETKEKVLAICKRLPVYPK"
FT   CDS_pept        complement(262934..264223)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05140"
FT                   /product="phosphoribosylglycinamide synthetase
FT                   phosphoribosylamine-glycine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85977"
FT                   /protein_id="CBY85977.1"
FT                   /translation="MDILIIGNGGREHALAWKAAQSPLADKVFVAPGNVGTALEHKVEN
FT                   VNISATDIPALVKFAQDKQIGLTIVGPEVPLVTGVVDAFREAGLKIFGPTQAAAQLEGS
FT                   KAFTKDFLARHKIPTAEYQNFTEVEPALAYLREKGAPIVVKADGLAAGKGVIVAMTLQE
FT                   AEDAVRDMLSGNAFGEAGSRVVIEEFLDGEEASFIVMVDGKNVEPMATSQDHKRVGEND
FT                   TGLNTGGMGAYSPAPVVTPEIHSRIMKEVIYPTVNGMAAEGNVYTGFLYAGLMIMPNGQ
FT                   PKVIEFNCRFGDPETQPIMLRLKSDLVELCLKACDGKLDEVISQWDPRASLGIVLAAEG
FT                   YPKDYRKGDEISGLPKSAVKNEKVFLAGVAEQEGKLVTNGGRVLCVTALGESVFEAQQK
FT                   VLKLAEQIQWSGRFYRRDIGYRAVERELQK"
FT   CDS_pept        complement(264318..265916)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05150"
FT                   /product="bifunctional purine biosynthesis protein PurH"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85978"
FT                   /protein_id="CBY85978.1"
FT                   /translation="MADRPIRQALLSVSDKTGIVEFAQGLVKRGVKLLSTGGTAKLLAQ
FT                   NGLPVMEVSDYTGFPEMMDGRVKTLHPKVHGGILGRRGTDDAIMQQHAIEGIDMVVVNL
FT                   YPFAATVAKPDCTLADAVENIDIGGPTMVRSAAKNHKDVAIVVNNNDFNAILAEMDQHQ
FT                   NSLTFETRFDLAIKAFEHTAQYDSMIANYFGQLVKPYHIAEEEEANAKCGQFPRTLNLN
FT                   FVRKQTMRYGENAHQNAAFYVDLNVKEASVATANQLQGKALSYNNIADTDAALECVKEF
FT                   DEPACVIVKHANPCGVALGKDILDAYNRAYQTDPTSAFGGIIAFNRELDEKTANEIVER
FT                   QFVEVIIAPKVSAEAQEVVKRKKNVRLLECGEWTSRSERLDFKRVNGGLLVQDADLGMV
FT                   GVDDLKVVSKRQPTEQELKDLLFCWKVAKFVKSNAIVYAKDNQTIGIGAGQMSRVYSAK
FT                   IAGIKAQDEGLTVAGCVMASDAFFPFRDGIDAAAKVGIQCVIHPGGSMRDQEVIDAADE
FT                   HNMVMVLTGMRHFRH"
FT   CDS_pept        complement(266104..>266469)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05160"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85979"
FT                   /protein_id="CBY85979.1"
FT                   /translation="KISPVFLGIFTYRCRLYVYFTRHSKIFGISNFCDPMLLVAGVIEI
FT                   VGSILLILGLCTRQAAFILSGEMAYAYFFLHVAGKGNLFFPIANGGELALLYSLLFLYF
FT                   VFSGAGACALDNKFFKK"
FT   CDS_pept        complement(266600..268339)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05170"
FT                   /product="Thiol:disulfide interchange protein DsbD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85980"
FT                   /protein_id="CBY85980.1"
FT                   /translation="MKKLFLFFTLIFTAFAANSGLFDKKQTFLKVDDAFAFSATLSTDK
FT                   SQLQAHWDIADGYYLYQDKINAELVGKSNSLSLHTQQAAELHQDPYFGEVQVFTHSIDG
FT                   IFSGAFNNADDKVEITYQGCTEGFCYPPETKVLRIGDLALSQEQIVEKTVEKNTALLSE
FT                   QDRLADGLFHSKWAIFGFFLLGLGLAFTPCVLPMLPLLSAIVIGQQQRPNMMRAFSLAF
FT                   LYVQGMALTYTLLGLAVAAIGLPFQIALQHPYVMIGLSILFVVLALSMFGLFTLQLPNS
FT                   LQNKLNTWSQKQTSGAFGGSFAMGMIAGLVASPCTSAPLSGALLYVAQSGDLFTGAATL
FT                   YLLALGMGVPLMLITLFGNKILPKSGEWMNTVKQTFGFVMLALPVFLLSRILPEVWEPR
FT                   LWAGLATAFFIWFALQMAKRGFGYAIKIISFALAMVSVQPLQNWIWQAQSTTQSAVENK
FT                   PVSQIKFKQIQNVDELDHTLAENPHSVAMLDLYADWCVACKEFEKLTFSNPKVQQQFQN
FT                   ILLLQVNMTKNSPENKALMERFNVMGLPTILFFDQQNNEIQGSRVTGFMDADAFSNWLK
FT                   ALH"
FT   CDS_pept        268531..269241
FT                   /transl_table=11
FT                   /locus_tag="HICON_05180"
FT                   /product="DNA-binding response regulator in two-component
FT                   regulatory system with ArcB or CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85981"
FT                   /protein_id="CBY85981.1"
FT                   /translation="MATPKILVVEDEIVTRNTLKGIFEAEGYDVFEAENGVEMHHILTN
FT                   HNINLVVMDINLPGKNGLLLARELREELSLPLIFLTGRDNEVDKILGLEIGADDYLTKP
FT                   FNPRELTIRARNLLHRTMPHQEKENTFGREFYRFNGWKLDLNSHSLITPEGQEFKLPRS
FT                   EFRAMLHFCENPGKLQTREELLKKMTGRELKPQDRTVDVTIRRIRKHFEDHPNTPNIIM
FT                   TIHGEGYRFCGDIE"
FT   CDS_pept        269641..271011
FT                   /transl_table=11
FT                   /locus_tag="HICON_05190"
FT                   /product="Sodium:alanine symporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85982"
FT                   /protein_id="CBY85982.1"
FT                   /translation="MTIESILSAIDSFIWGAPLLILLSGTGLYLTLRLGFIQIRYLPRA
FT                   LGYLFKKDKGGKGDVSSFAALCTALAATIGTGNIVGVATAVQAGGPGAIFWMWLVALLG
FT                   MATKYAECLLAVKYRVRDKNGFMAGGPMYYIERGLGIKWLAKLFALFGVMVAFFGIGTF
FT                   PQVNAITHAMQDTFNIPILVTAIIVTLLVGLIILGGVKRIAIASSVIVPFMAILYVTTS
FT                   LVIILLNIEKVPDAILLIIDSAFDPQAALGGAVGLTVMKAIQSGVARGIFSNESGLGSA
FT                   PIAAAAAQTREPVRQGLISMTGTFLDTIIVCTMTGIVLVLTGAWNNPELAGATVTNYAF
FT                   AQGLGTSIGATIVTVGLLFFAFTTILGWCYYGERCFVYLVGIRGVKLYRLAYIMLVGLG
FT                   AFLHLNLIWIIADIVNGLMAFPNLIALIGLRKVVVEETKDYFQRLKINHYDQDEVIK"
FT   CDS_pept        complement(271071..271808)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05200"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85983"
FT                   /protein_id="CBY85983.1"
FT                   /translation="MNTELQPKLEISAVNFQAKPRKQKIRKDPNAPFIREKLELPDGHN
FT                   KLLLHSCCAPCSGEVMEAILASGIEFTIYFYNPNIHPLKEYLIRKEENIRFAKKFGIPF
FT                   IDADYDRQNWFDRAKGMEWEPERGIRCTMCFDMRFEKTAEYAHKHGFPVFTSCLGISRW
FT                   KDMNQINGCGHRAAEKYDDVVYWDYNWRKEGGSQRMIEISKRERFYQQEYCGCVYSLRD
FT                   SNKWREDTGRQKIEIGKLYYSAD"
FT   CDS_pept        complement(271859..272848)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05210"
FT                   /product="octaprenyl diphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85984"
FT                   /protein_id="CBY85984.1"
FT                   /translation="MKKQDLMSIDEIQKLADPDMQKVNQNILAQLNSDVPLIGQLGFYI
FT                   VQGGGKRIRPLIAVLAARSLGFEGSNSITCATFVEFIHTASLLHDDVVDESDMRRGRAT
FT                   ANAEFGNAASVLVGDFIYTRAFQLVAQLESLKILSIMADATNVLAEGEVQQLMNVNDPE
FT                   TSEANYMRVIYSKTARLFEVAGQAAAIVAGGTEAQEKALQDYGRYLGTAFQLVDDVLDY
FT                   SANAQALGKNVGDDLAEGKPTLPLLHAMRHGNAQQAALIREAIEQGGKREAIDEVLAIM
FT                   TEHKSLDYAMNRAKEEAQKAVDSIAILPESDYKKALISLAYLSVDRNY"
FT   CDS_pept        273061..273372
FT                   /transl_table=11
FT                   /locus_tag="HICON_05220"
FT                   /product="50S ribosomal subunit protein L21"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85985"
FT                   /protein_id="CBY85985.1"
FT                   /translation="MYAVFQSGGKQHRVSEGQVVRLEKLELATGATVEFDSVLMIVNGE
FT                   DVKIGAPVVAGAKVVAEVVAQGRGEKVKIVKFRRRKHSRKQQGHRQWFTEVKITGIQA"
FT   CDS_pept        273393..273650
FT                   /transl_table=11
FT                   /locus_tag="HICON_05230"
FT                   /product="50S ribosomal subunit protein L27"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85986"
FT                   /protein_id="CBY85986.1"
FT                   /translation="MATKKAGGSTRNGRDSEAKRLGVKRFGGESVLAGSIIVRQRGTKF
FT                   HAGNNVGMGRDHTLFATADGKVKFEVKGEKSRKYVSIVTE"
FT   CDS_pept        273730..274650
FT                   /transl_table=11
FT                   /locus_tag="HICON_05240"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85987"
FT                   /protein_id="CBY85987.1"
FT                   /translation="MKQQPLLGFTFALITAMAWGSLPIALKQVLSVMNAQTIVWYRFII
FT                   AAVSLLALLAYKKQLPELMKVRQYAWIMLIGVIGLTSNFLLFSSSLNYIEPSVAQIFIH
FT                   LSSFGMLICGVLIFKEKLGLHQKIGLFLLLIGLGLFFNDRFDAFAGLNQYSTGVILGVG
FT                   GALIWVAYGMAQKLMLRKFNSQQILLMMYLGCAIVFMPMVEFSQVQELTPLALICFIYC
FT                   CLNTLIGYGSYAEALNRWDISKVSVVITLVPLFTILFSHIAHYFSPTDFAAPELNNISY
FT                   IGAFVVVCGAILSAIGHKLLPHKTH"
FT   CDS_pept        274678..275850
FT                   /transl_table=11
FT                   /locus_tag="HICON_05250"
FT                   /product="GTPase involved in cell partioning and DNA
FT                   repair"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85988"
FT                   /protein_id="CBY85988.1"
FT                   /translation="MKFIDESLIRIEAGDGGNGCVSFRREKFIPKGGPDGGDGGDGGDV
FT                   YLQADENLNTLIDYRFNKRFAAERGENGRSSDCTGRRGKDIILPVPVGTRAIDNDTKET
FT                   LGDLTQHGQKMLVAKGGYHGLGNTRFKSSVNRAPRQKTMGTPGEKRDLLLELMLLADVG
FT                   MLGFPNAGKSTFIRAVSAAKPKVADYPFTTLVPSLGVVKVDDSHSFVVADIPGLIEGAA
FT                   DGAGLGIRFLKHLERCRVLIHLVDIAPIDGSNPADNVAIIESELFQYSEKLSEKPRWLV
FT                   FNKIDTMSDEEAEERVREITEQLGWEEDYYLISAATGKNVPPLCRDIMDFIIANPREAE
FT                   TQQVAPEEVKFKWEDYHQEQLAEHQFDDDEDWDDDWTEEDDEGIEFIYKP"
FT   CDS_pept        complement(275920..276342)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05260"
FT                   /product="nucleoside diphosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85989"
FT                   /protein_id="CBY85989.1"
FT                   /translation="MTERTFSIIKPDAVKRNLIGAILTRFEQNGFKIIASKMVRLTREQ
FT                   AEGFYAEHQGKEFFAPLVDYMMSSPIVVSVLEKENAVKDYRTLIGTTNPETAEEGTIRK
FT                   DFALSQRENSVHGSDSIENANREIAYFFTDCEIFER"
FT   CDS_pept        complement(276352..277656)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05270"
FT                   /product="aminopeptidase B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85990"
FT                   /protein_id="CBY85990.1"
FT                   /translation="MQITLSNNLANDAWGKNAILSFDSNKATIHLKNNEKTDRTLVQQA
FT                   ARKLRGQGIKDVELLGEEWDLEFCWAFYQGFYTAKQDYGIEFPHLDHDLQDELLARIEC
FT                   GDFVRGIINEPAQSLTPVKLAERAAEFILNQADIYNEKSAVSFKIISGEELEQQGYHGI
FT                   WTVGKGSANLPAMLQLDFNPTQDPNAPVLACLVGKGITFDSGGYSIKPSDGMSTMRTDM
FT                   GGAALLTGALGFAIARGLNQRVKLYLCCAENLVSNNAFKLGDIITYKNGVTAEVLNTDA
FT                   EGRLVLADGLIEADSQNPDFIIDCATLTGAAKMAVGNDYHSVLSMDDDLVKNIFQSAKE
FT                   ENEPFWRLPFEDFHRSQINSSFADIANIGSVPVGAGASTATAFLSYFVKNYQQNWLHID
FT                   CSATYRKSSSDLWAVGATGIGVQTLANLMLSKSLK"
FT   CDS_pept        277806..279032
FT                   /transl_table=11
FT                   /locus_tag="HICON_05280"
FT                   /product="putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85991"
FT                   /protein_id="CBY85991.1"
FT                   /translation="MIQEKHLTFTINLLVSLFFLTVLIVPKGYNYAPIILSAIGLIYFI
FT                   PLKKKLSFSSEDKKLIFSFLFYFSTFLLSIIINKDGIREIDNPSRLLLFIPLLLLFKNF
FT                   PIKRKTILYAIPSSALITGCVALFQKFVLGYEKPFPETMHIQMGNIAISLATFTLVITL
FT                   HFFIKKQYKSTLFGFVASILAIMTSALSGARGGWIGLPVVIGIILFLYKEDINKKLIIT
FT                   LVTVITIGLTALIANPKFGIEKRYNAAKSDIVSYLEKNNRNTSLGARFDMWENALIAIK
FT                   EAPIFGHGSNGYEEFRHKQVKSKQMAKTTLNFGSLHNQYLESWVKRGLVGFIALILIIL
FT                   APIFFFIKNLNTHNLETKCICILGIIHIVSHIFYFTSQSFLAHNSGNIFYFFNYLIFYC
FT                   LIKREKITR"
FT   CDS_pept        complement(279068..280072)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05290"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85992"
FT                   /protein_id="CBY85992.1"
FT                   /translation="MNILITGGSGFIGSALIRYIIYQTQDSVINIDKLTYAANQSALKE
FT                   VENNPRYAFEQIDICDLKAIESVFEKYQPDAVMHLAAESHVDRSISGAADFIQTNIVGT
FT                   YTLLEVAKNYWHTLDEAKKTTFRFHHISTDEVYGDLSLSEPAFTEYSPYHPSSPYSASK
FT                   AASDHLVYAWHRTYGLPVIITNSSNNYGAYQHPEKLIPLVISNALMGKPLPIYGDGQQI
FT                   RDWLFVEEHVQALYLVLTKGRVGENYNIGGNCEKTNLEVVKTICQLLEELAPNKPNNIK
FT                   YYDDLIIFVKDRPGHDVRYSLDCSKIHAELGWQPKITFERGLSQTVQWYLFNS"
FT   CDS_pept        complement(280144..281556)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05300"
FT                   /product="Undecaprenyl-phosphate
FT                   galactosephosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85993"
FT                   /protein_id="CBY85993.1"
FT                   /translation="MNKLFLSKFILALLDFITFNASFSLSLLIISYYHHGYDQYLPIYE
FT                   IDDRYYIHTLLGFLCVGWFAIRLRHYTYRKPFWFELKEIFRTLLIFAVFELAIVAFSKL
FT                   YFSRYLWVLIWGITFLLFPLARVLVKKFLIKSGWFLRDTIVIGSGDNAFDVYNALRDEP
FT                   YLGFHVTYFISVSNISNNVKELNIPMLNNMSSWTSVTKKTDQFIIALEDDEEVDRNNWL
FT                   RYFSTNGYRSVFVIPTLRGLPLYSTDMSFMFSHEMMLLRMNNNLAKLSSRILKRTMDIV
FT                   GSLAIIIFSPVLLYLYFAVKKDGGNAIYGHPRIGRNGKTFNCLKFRSLIVNSKEVLDEL
FT                   LRTDPQARAEWEKDFKLKNDPRITKIGAFIRKTSLDELPQLFNVLKGEMSLVGSRPIVI
FT                   DELERYEENVDYYLMAKPGMTGLWQVSGRNNVDYNTRIYFDSWYVKNWSLWNDIAILFK
FT                   TVNVVLKRDGAY"
FT   CDS_pept        complement(join(281549..282184,282184..282462))
FT                   /transl_table=11
FT                   /locus_tag="HICON_05310"
FT                   /product="N-acetylneuraminic acid synthase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85994"
FT                   /protein_id="CBY85994.1"
FT                   /translation="MNKRVIIISSMRMLFLFLLIDKRRLGDVFIFSNKVESKIKSAFEF
FT                   HSAYSIFDLLFKKIISEIKLIYFCYKNKIEFKKTVVYGADHILGSSFFLSKCLFYLIED
FT                   GTENYQTKNYKRSLKNRLFSLPKFGMHKNVKKIYLTRNDNIPDCIKEKVEVINIHQLWK
FT                   NKTKEEQDEILFLLSVDKNKLENLKHKSIVLFTQPLSEDNVLTEEEKIALYKTIIGNYD
FT                   QEKLVIKTHPRETTNYRNYFPNIEVFSENYPSEILDVLGIRFEKVVTIFSTAVYVYPKE
FT                   NIIFYGTKIHHKLLSRFGRIEYE"
FT   CDS_pept        complement(282568..283107)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05320"
FT                   /product="Putative polysaccharide polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85995"
FT                   /protein_id="CBY85995.1"
FT                   /translation="MLPINKISISYFKDNVHDIEYGYLFFESVIKYFTDEHLVFLVFYV
FT                   FAMFLFLYKAINNTGLYRNIQLLIFYSFIFLEYIFSVHRQGVAMCIIYYAIILMIHEDK
FT                   LFILFLFYKRIPYTYSNLLLLYVSLFFIFSNVGVLANRVSGILLVSYAIFFSVLICNLK
FT                   FKRDRLLIILYMFFLT"
FT   CDS_pept        complement(283285..284208)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05330"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85996"
FT                   /protein_id="CBY85996.1"
FT                   /translation="MPIMDLLNTRNKNMISLLIISFGRYQEVLETFACVNKYHGKKIEL
FT                   LFLDNNPARELETALSSIVENNSSILFSYFHTGENLGVAEGRNFLIEKAQGDILITLDD
FT                   DIEIEDIILLIQKVTDYMANNAKVGALAFNIKNYFTRKALSHEIPHGNKKLDFSQNLLT
FT                   YYFIGAGHATRKEVYQKAGFYPKDLGLYGGEERDLSFRILEAGYQILYASDIVIYHKVS
FT                   PNGRMMRKKENFFRYRNQLIVLNRYMPMRYRLTSNFVWSIFYLVKMNGEILDIVKVLSE
FT                   IFSLKRKVVSDKTIRYIKFVDGRLYY"
FT   CDS_pept        complement(284174..284926)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05340"
FT                   /product="putative glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85997"
FT                   /protein_id="CBY85997.1"
FT                   /translation="MNMPLISIIMPVYNAECYLNQGILSCLNQSYQNIELILIDDGSTD
FT                   KSIEIINNIIDKDKRVKLFFTPTNQGPAAARNIGLEKAQGDYITFLDSDDFIANDKLEK
FT                   QLNFMLQNHLVMTHGNYAFCDLEGNQIKLVTTSKKIDYLTLLQGNQFKIMTVLVKRASI
FT                   KLLRFPNIKHEDYAFFLDCLKEVKQSILYSHQASSFVRIGKVSVSSNKFKSAIWTFNIY
FT                   FKREKLGVVKSIYYFILYAYNGFIKYKK"
FT   CDS_pept        complement(284907..285485)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05350"
FT                   /product="Lipopolysaccharide biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY85998"
FT                   /protein_id="CBY85998.1"
FT                   /translation="MMLSENVCLQWIIHIFHRFSEAELGLYAMGAQIAFILSVFILAIN
FT                   KALVPYLFEKLKQGSVKLKDLHRRSLLSLLIVPIPSLVTLIVPEQWLLFFLGKHFIGVK
FT                   YYIIVFLLSTSLTIPYLFLVNYLFYHGKTKEISFCSVLSTMIYLGALGGLIFTDVVYIP
FT                   YASVLGALGILPVLYKITKRVEENEYATH"
FT   CDS_pept        complement(285573..286196)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_05360"
FT                   /product="Chain length determinant protein"
FT   CDS_pept        complement(286673..288091)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05370"
FT                   /product="glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86000"
FT                   /protein_id="CBY86000.1"
FT                   /translation="MPNANAIANVFKLIEENNVKFVLLRFTDIKGKEHGVSIPVSLVDE
FT                   DMFEDGKMFDGSSVEGWKTINKADMLLMPMAETAVVDPFAQIPTLSIRCSVYEPTTMQS
FT                   YDRDPRSIAIRAENYMRSTGIADQAFFGPEPEFFLFDDVRFNVSMNKASFSIDDIEAAW
FT                   NTNKKYEEGNNAYRPLKKGGYCAVAPIDSAHDIRSEMCLILEEMGLVIEAHHHEVATAG
FT                   QNEIATKFNTLTLKADETQIYKHVVQNVALEHGKTACFMPKPITGDNGSGMHCNMSLSK
FT                   EGKNIFQGDKYAGLSETALYYIGGIIKHAKALNAFTNPSTNSYKRLVPGYEAPVLLAYS
FT                   ASNRSASIRIPAVTNPKAIRIEARFPDPLANPYLAFAALLMAGLDGVVNKIHPGDAMDK
FT                   NLYDLPPEELKDIPAVASSLEEALNSLEKDYEFLTQGGVFANDFIDAFISIKRKEVERL
FT                   NMAPHPVEFEMYYA"
FT   CDS_pept        288323..290173
FT                   /transl_table=11
FT                   /locus_tag="HICON_05380"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86001"
FT                   /protein_id="CBY86001.1"
FT                   /translation="MKNEIDIKKLRNIAIIAHVDHGKTTLVDKLLQQSGTFESARGDID
FT                   ERVMDSNDLEKERGITILAKNTAINWNDYRINIVDTPGHADFGGEVERVLSMVDSVLLV
FT                   VDAFDGPMPQTRFVTQKAFAHGLKPIVVINKVDRPGARPDWVVDQVFDLFVNLGASDEQ
FT                   LDFPIIYASALNGVAGLEHEDLAEDMTPLFEAIVKYVESPKVELDAPFQMQISQLDYNN
FT                   YVGVIGIGRIKRGSIKPNQPVTIINSEGKTRQGRIGQVLGHLGLQRYEEDVAYAGDIVA
FT                   ITGLGELNISDTICDINAVEALPSLTVDEPTVTMFFCVNTSPFAGQEGKYVTSRQILER
FT                   LNKELVHNVALRVEETPNPDEFRVSGRGELHLSVLIENMRREGYELAVSRPKVIYRDID
FT                   GKKQEPYEQVTIDVEEQHQGSVMEALGIRKGEVRDMLPDGKGRVRLEYIIPSRGLIGFR
FT                   GEFMTMTSGTGLLYSSFSHYDEIKGGEIGQRKNGVLISNATGKALGYALFGLQERGKLM
FT                   IDANVEVYEGQIIGIHSRSNDLTVNCLQGKKLTNMRASGKDDAIVLTTPVKFSLEQAIE
FT                   FIDDDELVEVTPESIRIRKKLLTENDRKRANRTTTSTSTH"
FT   CDS_pept        complement(290261..290950)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05390"
FT                   /product="pyridoxine 5'-phosphate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86002"
FT                   /protein_id="CBY86002.1"
FT                   /translation="MILQPLFYLHFSSNLKGEKMELHNIRDEYTKRVLSQHDCHENPIS
FT                   QFEQWQKEAIHAQVNEPTAMNIATVDEQGRPNSRMVLLKEVNEQGFVFFTNYLSRKGGC
FT                   IERNPYVALTFFWSELERQVRIEGKAVKIPAEQSDKYFATRPYTSRIGAWASEQSAVIS
FT                   NYKSLLVKAALVAAKHPLNVPRPDYWGGYLVVPETVEFWQGRPSRLHDRIRYRKESDNW
FT                   IRERLSP"
FT   CDS_pept        291086..291793
FT                   /transl_table=11
FT                   /locus_tag="HICON_05400"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86003"
FT                   /protein_id="CBY86003.1"
FT                   /translation="MKLTSPIFNDQQKRGAIIWLSFFHIFIIAASNYFVQIPFEITLKL
FT                   TALGAANDFSFHSTWGTLTFPFIFLATDLTVRIFGAEDARKIIFVVMFPALIVSYVISV
FT                   LFSESKFQGFESLTHFDLFVFRIAIASFAAYVVGQLLDVIVFNRLRQLKTWWVAPTSSM
FT                   TFGSMADTFVFFSIAFYQSADPFMAEHWAQLGFVDYLFKLFIGIILFVPAYGVVLNVIL
FT                   RKLQMLVTERVPA"
FT   CDS_pept        complement(join(291875..293272,293269..293379))
FT                   /transl_table=11
FT                   /gene="caaA6"
FT                   /locus_tag="HICON_05410"
FT                   /product="Putative trimeric autotransporter adhesin"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86004"
FT                   /protein_id="CBY86004.1"
FT                   /translation="MKIIKQASKQASKQASKQASKQASKQASKQASKQASKQSSLTRLS
FT                   LISLLISTSFYSVQSFAAAVPSVNDKTYSFQGGQVVIGNGKVKSQNNIAIGKNSTAQGV
FT                   NSIALGDGSAVVSEEGQGIAIGYKAESKDKDTYDNIVIGFETKASSKANRSIAMGYKAS
FT                   VADGASTAAFGESATVSKLTGNKTTPINGTSKQVVTDGSGNVTNVITTSQNEETVIKKY
FT                   GATYGSQAFGYKASSHGLLANSFGAFSTTGATGASAYGAQSKALGKYSTVIGFNSKATK
FT                   ENASAFGHFAEANEKDSLALGANSTAEKEKSVALGNYSIADRANTVSVGSKEANYRRQI
FT                   VNVADGTEDYDAVNVRQLNAVEAKIGQVNNQFTQVDTRLNRTDLRINRVGASAAALASL
FT                   KPAQLGEDDKFALSLGVGSYKNAQAMAMGAVFKPVENVLLNVAGSFSGSEKTFGAGVSW
FT                   KFGKKSKPAVSTQSAVDSAEVLQLRQEMSAMQKELAELKKALRK"
FT   repeat_region   complement(293270..293365)
FT                   /note="GCAA x24"
FT   CDS_pept        complement(293567..293848)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05420"
FT                   /product="Virulence-associated protein D (VapD) conserved
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86005"
FT                   /protein_id="CBY86005.1"
FT                   /translation="MYAIAFDLDTATLKALYATGSWQNAYGDVKRTLESLGFDLQQGSV
FT                   YFGNSEMTAVKCVLAAQKLSQTYSWFKPSVSNIRMLRIEELNDLSPAL"
FT   CDS_pept        294044..296392
FT                   /transl_table=11
FT                   /locus_tag="HICON_05430"
FT                   /product="exoribonuclease R, RNase R"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86006"
FT                   /protein_id="CBY86006.1"
FT                   /translation="MTKKRKNLINQDPHYKQELEKYGNPIPSREFILSIIRDNNAPMNR
FT                   DEILTALSIRNEDQIEAMRRRLRAMENDGQLVFTKRKRYALPEKLDLFKGTVIGHREGF
FT                   GFLQVDGKKDDLFIPNHQMQRVMHGDFVLAQPAGLDRRGRREVRIVRVLESRKKQIVGR
FT                   FFLENGFSYVVPDDSRIGRDILVPNEHRNGARMGQVVVVELQERSASFNQPIGVITEIL
FT                   GDNMAKGMEVEIALRNHDIPHKFPSAVEKYVKKFTEEVPEEAKKGRVDLRNLPLVTIDG
FT                   EDARDFDDAVYCEKHGKGWKLWVAIADVSYYVRLRSALDVEAHNRGNSVYFPNRVVPML
FT                   PEILSNGLCSLNPQVDRLCMVCEMQISAKGKLIDYRFYEAVMNSHARLTYTKVAKMLEG
FT                   DEELRARYSTLVPHLEDLYKLYQALLGARHQRGAIDFETIETKFIFNAMGRIERIEPVV
FT                   RNDAHKIIEECMILANIAAANFMEKHKEPALYRIHATPSEEKLTSFRTFLSEFGLTLEG
FT                   GLKPTTKDYAALLEKVKERPDHELIQTMLLRSLSQAVYHADNIGHFGLALEEYAHFTSP
FT                   IRRYPDLTLHRGIKYLLAKEQGAKRKTTDTGGYHYSFDEMDLLGNHCSMTERRADDATR
FT                   EVPDWLKCEYMQDHVGSEFSGVISSVTGFGLFVRLDDLFIDGLVHISTLENDYYQFDAA
FT                   KQRLIGENSGMQYRLGDKVRIKVEAVHLENKMVDFSLMGSERKPRRAGKTAKEKAKKVF
FT                   KELPSKASKKRKSAVKKKEVSKKTSRKRK"
FT   CDS_pept        296448..297188
FT                   /transl_table=11
FT                   /locus_tag="HICON_05440"
FT                   /product="23S rRNA (Gm2251)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86007"
FT                   /protein_id="CBY86007.1"
FT                   /translation="MSEQIYGIHAVNSILTHSPERLIEVFVLKGREDKRLQPLLNELYS
FT                   LGIGVQFVNRQTLDKKADGEVHQGVIARVQAAKELNENDLDEILANKQNPLLLVLDGVT
FT                   DPHNLGACLRTADAAGSVAVIVPKDKSAQLTSIARKVACGAAETVPLIRVTNLSRTLRD
FT                   LQQNHNIWVVGTAGEVAETIYQSKLTGPLALVMGAEGEGMRRLTREHCDQLISIPMAGS
FT                   VSSLNVSVATGVCLFEIVRQRLGS"
FT   CDS_pept        complement(297226..299796)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05450"
FT                   /product="protein disaggregation chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86008"
FT                   /protein_id="CBY86008.1"
FT                   /translation="MNIEKFTTKFQEALSEAQSLAIGKDNQFIEPVHLLTALLNQQGGS
FT                   IAPILTASGVNVALLRNELKTELNKLPQVIGNGGDVQLSRQLINLLNLCDKFAQQNQDK
FT                   FISSELFLLAALEERGTISDILKKCGAKKEQISQAIQHIRGGQNVNDQNAEESRQALEK
FT                   YTIDLTARAESGKLDPVIGRDEEIRRAIQVLQRRTKNNPVLIGEPGVGKTAIVEGLAQR
FT                   IVNGEVPEGLKNKRVLSLDMGALIAGAKYRGEFEERLKAVLNELSKEEGRVILFIDEIH
FT                   TMVGAGKTDGAMDAGNLLKPSLARGELHCVGATTLDEYRQYIEKDAALERRFQKVFVDE
FT                   PSVEDTIAILRGLKERYEIHHHVDITDPAIVAAATLSHRYISDRQLPDKAIDLIDEAAS
FT                   SIRMEIDSKPEPLDRLERRIIQLKLEQQALQKEEDEASRKRLEMLEKELAEKEREYAEL
FT                   EEVWKSEKATLSGSQHIKQELDTAKTELEQARRAGDLAKMSELQYGRIPALEKQLEQAE
FT                   TSEGKEMTLLRYRVTDEEIAEVLSKATGIPVSKMMEGEKEKLLRMEEELHKRVIGQNEA
FT                   VDAVANAIRRSRAGLSDPNRPIGSFLFLGPTGVGKTELCKTLAKFLFDSEDAMVRIDMS
FT                   EFMEKHSVSRLVGAPPGYVGYEEGGYLTEAVRRRPYSVILLDEVEKAHADVFNILLQVL
FT                   DDGRLTDGQGRTVDFRNTVVIMTSNLGSDLIQGNKDESYSEMKALVMSVVSQHFRPEFI
FT                   NRIDETVVFHPLGKENIRAIASIQLERLAKRMETRGYELVFTDDLLDFIGEVGYDPIYG
FT                   ARPLKRAIQQEIENSLAQQILSGALLPGKFVTIDYANAEVQARQ"
FT   CDS_pept        complement(299924..300487)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05460"
FT                   /product="predicted 5-formyltetrahydrofolate cyclo-ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86009"
FT                   /protein_id="CBY86009.1"
FT                   /translation="MNTQKRQQIRTEIRKIRANLTALQQKKAEQSVTQQALNLIEQRQA
FT                   KNIALYFSFDGEISTKALIQSLWMQNKNVYLPVLHPFTKHYLLFLRYLPDTPMKQNQFG
FT                   IWEPKLNVQNVLPLNELDILFTPLVAFDKQGNRLGMGGGFYDRTLQNWQNKSFIPVGLA
FT                   HQCQQVENLPTEHWDMPLFDILVD"
FT   CDS_pept        complement(300786..301088)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86010"
FT                   /protein_id="CBY86010.1"
FT                   /translation="MSLKLVEILVLGQVLRLNVPIEQEELLRQAARNLDILVSEMKEKT
FT                   GLIQLDRVLSIVALNLSFELSQEKNKTAKIEEVLRTGIQQLDHSLENIRVTKEPH"
FT   CDS_pept        302197..304029
FT                   /transl_table=11
FT                   /locus_tag="HICON_05480"
FT                   /product="DNA polymerase I"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86011"
FT                   /protein_id="CBY86011.1"
FT                   /translation="MENTPKIQIDRTKYETLLTQADLTRWIEKLNSAKLIAVDTETDSL
FT                   DYMSANLVGISFALENGEAAYLPLQLDYLDAPKTLEKSTALAAIKPILENPNSHKIGQN
FT                   IKFDESIFARHGIELQGVEFDTMLLSYTLNSTGRHNMDDLAKRYLGHETIAFESLAGKG
FT                   KSQLTFNQIPLEQATEYAAEDADVTMKLQQALWLKLQEEPTLVELYKTMELPLLHVLSR
FT                   MERTGVLIDSDALFMQSNEIASRLTALEKQAYALAGQPFNLASTKQLQEILFDKLGLPV
FT                   LQKTPKGAPSTNEEVLEELSYSHELPKILVEHRGLSKLKSTYTDKLPQMVNSQTGRVHT
FT                   SYHQAVTATGRLSSSDPNLQNIPIRNEEGRRIRQAFIAREGYSIVAADYSQIELRIMAH
FT                   LSGDQGLINAFSQGKDIHRSTAAEIFGVSLDEVTSEQRRNAKAINFGLIYGMSAFGLSR
FT                   QLGISRADAQKYMNLYFQRYPSVQQFMTDIRAKAKAQGYVETLFGRRLYLPDINSSNAM
FT                   RRKGAERVAINAPMQGTAADIIKRAMIKIDEVIRHDPDIEMIMQVHDELVFEVRSEKVA
FT                   FFREQIKQHMEAAAELVVPLIVEVGVGKNWDEAH"
FT   CDS_pept        304044..304391
FT                   /transl_table=11
FT                   /locus_tag="HICON_05490"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86012"
FT                   /protein_id="CBY86012.1"
FT                   /translation="MNLERLNEIEKPLLHIVKHDVVPALGCTEPISLALASATAAKYLG
FT                   KTPEHIEAKVSPNLMKNGLGVAVPGTGMVGLPIAAAIKVLSNMILIELLIISALLYQKV
FT                   CNISTDKLSKL"
FT   CDS_pept        complement(304526..305287)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05500"
FT                   /product="putative heme iron utilization protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86013"
FT                   /protein_id="CBY86013.1"
FT                   /translation="MDFNRIITHMNDHHQDDMAALCKKFGGEKEITDVTLVNVDFAGLD
FT                   FKYNGGKTLRVEFPQQADAGSIKQAIINLCVENKPVANYDRIKAKIDEFRQEFKSCVLS
FT                   TLDKDGLPMASYAPIIFFDGKYYIYISAIAEHYENLKRNPNQVEVMFLEDENKAKSIIV
FT                   RTRLRYKASARFIPREDPIVEKVLDKLAETMNDVGGIKTIREFTDFDLVELTFGTGRFV
FT                   RGFGQAYLIDANGEISHIGVKGNPHEKESDK"
FT   CDS_pept        complement(305463..307106)
FT                   /transl_table=11
FT                   /gene="hbpA"
FT                   /locus_tag="HICON_05510"
FT                   /product="heme-binding lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86014"
FT                   /protein_id="CBY86014.1"
FT                   /translation="MKLKATLTLTAATLVLAACDQSSSANKSTAQTEAKSSSNNTFVYC
FT                   TVKAPLGFSPALIIEGTSYNASSQQVYNRLVEFKKGSTDIEPALAESWEISDDGLSYTF
FT                   HLRKGVKFHTTKEFTPTRDFNADDVVFSFQRQLDPNHTYHNVSKGTYPYFKAMKFPKLL
FT                   KSVEKVDDNTIRITLNKKDATFLASLGMDFISIYSAEYADSMLKAGKPETLDSRPVGTG
FT                   PFVFVDYKTDQAIQYVANENYWKGRTPLDRLVISIVPDATTRYAKLQAGTCDLILFPNV
FT                   ADLAKMKTDPKVQLLEQKGLNVAYIAFNTEKAPFDNVKVRQALNYAVDKKAIIEAVYQG
FT                   AGTSAKNPLPPTIWSYNDEIQDYPYDPEKAKQLLAEAGYPNGFETDFWIQPVIRASNPN
FT                   PKRMAELIMADWAKIGVKTNPVTYEWADYRKRAKEGELTAGIFGWSGDNGDPDNFLSPL
FT                   LGSSNIGNSNMARFNNSEFDALLNEAIGLTNKEERAKLYKQAQVIVHNQAPWIPVAHSV
FT                   GFAPLSPRVKGYVQSPFGYDAFYGVSVDGK"
FT   CDS_pept        complement(307253..308644)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05520"
FT                   /product="putative transporter protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86015"
FT                   /protein_id="CBY86015.1"
FT                   /translation="MTTESNAYRGLAWVAAMALFMQSLDATILNTALPAISSDLHKPAF
FT                   EMQMAIIAYSLAVALFIPLTAWAAAKFGTLTVFRSAVFTFILGSVACAAASNLESLILA
FT                   RVIQGIGGAFMMPVARLAIIQAVPKQQLVNAWNLMATAGLIGPILGPILGGWLVIHASW
FT                   HWIFLINIPIGALGILASGSVMNNIKGEAKKLDWTGFLLFALGLVGITLGLDLLGESQH
FT                   NSSVTYSILVVGILLLVTYCGYAKNNENAILPLSLFRTRTFRLGIIANIFIRLSASGVP
FT                   FLLPLMFQLSFGYSAEMSGWLLAPIALISVMLKILIGRILNRWGYKTTLISSALLMAGS
FT                   VISMAWLDKQSSLTWIICNLMWYGACMSIIFTSINTLAVGDLSKQQSGTGSTVLSIVQQ
FT                   VGIGFGIAVSSIILNLYRHFFSANDGLQQAFSYTFLTSSLFVIALVWSLMKLHKNDGDH
FT                   LRKMP"
FT   CDS_pept        complement(308641..309156)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05530"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86016"
FT                   /protein_id="CBY86016.1"
FT                   /translation="MNNQIPLLGITGYSGSGKTTLLEKLIPELIARHIRVSVIKHSHHN
FT                   MQVDKEGKDSWRMKEAGSSQVILANDERWAIMTETPKPVSLDYFAQQFDRTLTDLVLVE
FT                   GFKQEPIPKILLHRQEMTKPLSEIDEYVVAVATNYPLEIDRTLLDINRIPQIADFIENW
FT                   LHHFHGAR"
FT   CDS_pept        complement(309579..310013)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05540"
FT                   /product="predicted positive regulator of sigma E"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86017"
FT                   /protein_id="CBY86017.1"
FT                   /translation="MLRESAVVISYENGIAKVKCQSQSACGQCAAKNSCGTSSLSELNG
FT                   KRGEHIFNVETLMPLREGQIVEIGLEEKSMLLSALLMYVVPLLTLLIVTMLSDYISDNE
FT                   ILRAILIFGLTALSFIFVKSYSRKLGQQTEFQPVLLRILS"
FT   CDS_pept        complement(310007..310780)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05550"
FT                   /product="predicted SAM-dependent methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86018"
FT                   /protein_id="CBY86018.1"
FT                   /translation="MAHSQVGIQLISESTEKTLAELTALCAEHNIIHNENSPLALVQTD
FT                   DRLELRKLDEPKLGAVYVDFVGGTMAHRRKFGGGRGEAVAKAVGIKDSALPTVIDATAG
FT                   LGRDAFVLASIGCQVRLVERHPVVFLLLQDGLNRAYQDEEIGEMLQQNLRLLNVHHINE
FT                   LDPNSDYADVVYLDPMYPHKQKSALVKKEMRVFQHLVGADLDADELLLPALQLAKKRVV
FT                   VKRPDYAEFLSEKQPHFSRETKNHRFDIYMGASRC"
FT   CDS_pept        complement(310762..311853)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05560"
FT                   /product="tRNA (uracil-5-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86019"
FT                   /protein_id="CBY86019.1"
FT                   /translation="MQLPIFQYNELLQKKLEKLTALLRPFNAPDIQVFDSPTNHYRMRA
FT                   EFRIWHEQDDFYHIMFDQATLQRYRVDEFPIASMLINRMMQTLLPLLKQQEVLHKKLFQ
FT                   IDYLSTLSNKIIVSLLYHKTLTEEWESAAKNLKDLLEKQDFDVQIIGRASKQKICFEQD
FT                   YVDEVLPVNGRNYVYRQVENSFTQPNATVNCKMLEWAIDCTQNSEGDLLELYCGNGNFS
FT                   IALAQNFRKVLATEIAKPSVAAAQFNIAENKVDNLQIIRMSAEEFTQAMNGVRAFNRLK
FT                   GIDLKSYECNTIFVDPPRAGLDPDTVKLVQNYDRILYISCNPHTQCDNLVELSKTHCIE
FT                   KAALFDQFPYTDHMESGVWLIRK"
FT   CDS_pept        complement(311997..312332)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86020"
FT                   /protein_id="CBY86020.1"
FT                   /translation="MAASFSVTRRFFDDKNYPRGFSRHGDYTIKESQVLEQYGQAFKAL
FT                   DLGEREPATKEEKDFIAFCRGKRAAETFFEKTWNKYRTRINTKKRVYTLSSDVSEAASG
FT                   GEDYSGE"
FT   CDS_pept        complement(312394..313011)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05580"
FT                   /product="thiol:disulfide interchange protein DsbA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86021"
FT                   /protein_id="CBY86021.1"
FT                   /translation="MKKVLLALGLGISTLMSVNSFAADLQEGKQYVQVSQQASQQKEVI
FT                   EFFSFYCPHCYAFEMEYKIPQQVADALPKDVKFKQYHVNFLGRQSENLTRAWALAMALG
FT                   AESKVKAPLFEAAQKDALKSMDDIRAIFLSNGITAEQFDGGINSFAVNGLVNKQVNAEE
FT                   QFKVRGVPDFYVNGKFRVNPEGLNYDDFVKDYVQTVKGLLQK"
FT   CDS_pept        complement(313024..313290)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86022"
FT                   /protein_id="CBY86022.1"
FT                   /translation="MKCKRLNEVLELLQPYWSKDSNLSLMEILQKIANESGFQKPLNEL
FT                   TDEVIIYQLKMDGTDKHEPIPGLKKDYEEDFKTALLRARGIIK"
FT   CDS_pept        313355..313933
FT                   /transl_table=11
FT                   /locus_tag="HICON_05600"
FT                   /product="molybdopterin-guanine dinucleotide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86023"
FT                   /protein_id="CBY86023.1"
FT                   /translation="MTITISAVILAGGKARRMGGQDKGLQILGKQSLIEHVIHRLQPQI
FT                   HQISINANRNQTEYAKFGFPVFSDELPDFQGPLSGMLTALEKTKSDFILFTPCDTPFFP
FT                   MNLLDKLKSAVKNDRTLIAYACDEEREHPVFCLMSVQLKEKLRHYLASGERRLLQFMKE
FT                   NGGISVKFAQEEGNFENFNTLDDLKKTVI"
FT   CDS_pept        complement(314072..315064)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86024"
FT                   /protein_id="CBY86024.1"
FT                   /translation="MKSHVRSFKTYIRDEIIKKGGWVNAHAHADRAFTMTPEKIGIYHS
FT                   SNLQQKWDLVDEVKRTSSVDDYYARFCQSIELMISQGVTAFGTFVDIDPICEDRAIIAA
FT                   HKAREVYKHDIILKFANQTLKGVIEPTARKWFDIGAEMVDMIGGLPYRDELDYGRGLEA
FT                   MDILLDKAKSLGIMCHVHVDQFNNPSEKETEQLCDKTIEHGMEGRVVGIHGISIGSHSK
FT                   EYRYKLYEKMRKAKMMMIACPMAWIDSNRKEDLMPFHNALTPADEMIPEGITVALGTDN
FT                   ICDYMVPLCEGDLWQELSLLAAGCRFPHLDEMVNIASINGRKVLGLELI"
FT   CDS_pept        complement(315262..317019)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05620"
FT                   /product="predicted hydrolase, inner membrane"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86025"
FT                   /protein_id="CBY86025.1"
FT                   /translation="MKWIKKGTFSGKQYRDDVSRKISWGHWFAFFNIIVAIFIGARYAF
FT                   IIDWPDTLAGKLYFFVSLLGHFSFNVFALYLLVVFPLSFIVKNHRTFRGLTVIFSTICT
FT                   TLLLFDTAVFNRFNLHLSSVVWNLLVNPENGEMSRDWQIFFAPMPIILLAQMLFSRWSW
FT                   EKLRSLERQKWLKGTGIFLTTTFIATHLIYAWADAYLYRPITMQRSNFPLSYPMTARSF
FT                   LEKHGFLDGEEYTQKLAQEGRLDALKIDYPKKELTYAPITHKPNILLVTVSGLRHDAIS
FT                   NEKMPKLAKFATSSTEFTNHYSTGNSNNAGLIGLFYGLNANYTDSILSNHTQSVLIEKL
FT                   RAENYQLGLFSATNFKDSVFRQALFREIKLSSNKTNKANNKSAVKNLNDFIKAQKTDSS
FT                   WFAYLDLALEAKTPSDYDRTLQDIDSLLENTLESTPLENALVIITSEHGLTFNEMNEKE
FT                   RENYFGRDEIQVPLLVYWKDLPVGKQNGLSNHADIFSALMQTVFRVKNPLMDYSQGRNL
FT                   FELKGDDWVLASNFHWNVVIQPDGTQYHIDRKGNYKKFDKDYIEQSSDRPPLGIFLETF
FT                   QLQNFFFEK"
FT   CDS_pept        complement(317021..317239)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86026"
FT                   /protein_id="CBY86026.1"
FT                   /translation="MAQHSKYSDAQLSAIVNDMIAVLEKHKAPVDLSLIALGNMASNLL
FT                   TTSVPQIQREALAQAFSNSLINAVKTR"
FT   CDS_pept        317365..318381
FT                   /transl_table=11
FT                   /locus_tag="HICON_05640"
FT                   /product="nucleotide associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86027"
FT                   /protein_id="CBY86027.1"
FT                   /translation="MSITVNQIVLHQLVKNVDGDSIKMESVLRDELLSITPEVEQMMLQ
FT                   LHQGYQNKAKAFGVFQEKSIFAQHLNRLLEQEIEFLGFSQYSTKLLADELGKYNFAESG
FT                   TLILCQYNFLATDYLFIALLDSRHSMLVDEHLDIRRTEYLDITQFDIAARINLTDLQVN
FT                   ANSNRYLTFIKGRVGRKISDFFMDFLGAEEGLNPQVQNQCLLQAVSDYCDQGELNKEQT
FT                   QAVKKQVFEYCKGQLSNGNNIELRELSDSLPTLNEQPFVVFTEEQNYGLEESIPPIRST
FT                   LKSLTKFSGSGKGVTLSFDAELLNTRIQWDPMTDTLTIKGLPPNLKDQLQKALKSEN"
FT   CDS_pept        318447..318860
FT                   /transl_table=11
FT                   /locus_tag="HICON_05650"
FT                   /product="small protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86028"
FT                   /protein_id="CBY86028.1"
FT                   /translation="MQVKTLLGATFLALSLASCSTVEKVVYRIDVPQGNYLEATTVAQV
FT                   KEGMTAQQVQYLLGTPILIDPYNNYTWYYVFLQQRAYETPVQHTFTVKFDQRGIVTETH
FT                   LDKPLPQVSQQGENNTVIETGEKPKSSWWKFWK"
FT   CDS_pept        318914..319597
FT                   /transl_table=11
FT                   /locus_tag="HICON_05660"
FT                   /product="transcriptional regulatory protein CpxR"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86029"
FT                   /protein_id="CBY86029.1"
FT                   /translation="MSKLLLVDDDIELTELLSTLLELEGFDVETANNGLDALQKLNESY
FT                   KLVLLDVMLPKLNGIETLKEIRKVSNEPVMMLTARGEDIDRVLGLELGADDYLPKPFND
FT                   RELIARIKAILRRSVSPSNNTANVEILSFDGITLHFSHGIATYNEENLNLTNYEFKILC
FT                   LLLKSKGNVVSREELSLEVMEKPLTPFDRSLDMHISNLRRKLPKRKNKPSWFKTLRGKG
FT                   YALVT"
FT   CDS_pept        319682..319825
FT                   /transl_table=11
FT                   /locus_tag="HICON_05670"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86030"
FT                   /protein_id="CBY86030.1"
FT                   /translation="MMSLVITVPNFDLRIYSPLKEANIVNYQKEILGGLSMNIKLPLWI
FT                   TH"
FT   CDS_pept        complement(319862..320833)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05680"
FT                   /product="putative lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86031"
FT                   /protein_id="CBY86031.1"
FT                   /translation="MTALNHWQPSADIKNLLKRAKIIAEIRQFFTERGLLEVETPVLSE
FT                   FGVTDLHLSTFSTEFLAPFGEQSKTLWLSTSPEYHMKRLLAAGSGPIFQISKVFRNEEA
FT                   GNCHNPEFTMLEWYRPHFHMHRLINEVDDLLQQILDCPPAESLSYQFVFQEYVGLDPLS
FT                   AERSELIEVARKHNFMAEDNEDRDTLLQFLFSEVVEPQIGKERPIAVYHFPSTQAALAQ
FT                   VSPEDQRVAERFEFYYKGLELANGFHELADAQEQRHRFELDNQQRQKCELPTREIDERF
FT                   LAALEAGMPDASGVALGIDRLMMIALDCEKINDVISFAVDNA"
FT   CDS_pept        321167..322843
FT                   /transl_table=11
FT                   /locus_tag="HICON_05690"
FT                   /product="fumarate reductase flavoprotein subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86032"
FT                   /protein_id="CBY86032.1"
FT                   /translation="MRSHTVAAEGGAAAVIKEEDSYDKHFQDTVAGGDWLCEQDVVEYF
FT                   VQHSPVEMTQLERWGCPWSRKADGDVNVRRFGGMKIERTWFAADKTGFHLLHTLFQTSI
FT                   QYPQIQRFDEHFVLDILVDDGHARGMVAMNMMEGSLVQINANAVVIATGGGCRAFKFNT
FT                   NGGIVTGDGLSMAYRHGVPLRDMEFVQYHPTGLPNTGILMTEGCRGEGGILVNKDGYRY
FT                   LQDYGLGPETPIGKPQNKYMELGPRDKVSQAFWQEWKKGNTLKTAKGVDVVHLDLRHLG
FT                   EKYLHERLPFICELASAYEGVNPVNEPIPVRPVVHYTMGGIEVDFNSETRIKGLFAVGE
FT                   CASSGLHGANRLGSNSLAELVVLGRVAGEYAAQRAVEAQSVNQSAVDAQAKDVVARLEA
FT                   LHKQEGNESWSEIRDEMGTVMEEGCGIYRDQASMQKAVDKIAELKERYKRICVSDNSSV
FT                   FNTDVLYTVELGYILDVAQSIANSAIERKESRGAHQRLDYTERDDVNYLKHTLAFYNEN
FT                   GAPRIEYSPVKITKSQPAKRVYGAEAEAQEAAAKAKEQANG"
FT   CDS_pept        322836..323606
FT                   /transl_table=11
FT                   /locus_tag="HICON_05700"
FT                   /product="fumarate reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86033"
FT                   /protein_id="CBY86033.1"
FT                   /translation="MANSPVMNVEVLRYNPEIDQEPHLNTYQVPYDNQTSLLDALGYIK
FT                   DKLEPSLSYRWSCRMAICGSCGMMVNNKPKLACKTFLRDYSGHMRIEPLANFPIERDLV
FT                   VDLSHFIESLEAIKPYIIGNEAPALDGKPHPSKELQVSRTKQTPAQLEKYRQFSMCINC
FT                   GLCYAACPQFGLNPEFLGPAAITMAHRYNLDNRDHGKAKRMSLLNGKNGVWSCTFVGYC
FT                   SEVCPKHVDPASAINQGKVESAKDYVISMLKPKG"
FT   CDS_pept        323617..324027
FT                   /transl_table=11
FT                   /locus_tag="HICON_05710"
FT                   /product="fumarate reductase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86034"
FT                   /protein_id="CBY86034.1"
FT                   /translation="MSVTVSKRKKYVRPMTATWWQKLDFYKAYMLREATSIFAVWFCIV
FT                   LLYGVLCLASNPILGLDILSFIEFLRNPIVVFLNIITLIATLYHTVTYFLMTPKVMNII
FT                   VKNERLPHHVVRNALWAVTALVSVIALVLVYI"
FT   CDS_pept        324040..324384
FT                   /transl_table=11
FT                   /locus_tag="HICON_05720"
FT                   /product="fumarate reductase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86035"
FT                   /protein_id="CBY86035.1"
FT                   /translation="MVDQNPKRSGEPPVWLMFGAGGTVSAIFLPVVILIIGLLLPFGLV
FT                   DAHNLITFAYSWIGKLVILVLTIFPMWCGLHRIHHGMHDLKIHVPAGGFIFYGLATIYT
FT                   VWVLFAVINL"
FT   CDS_pept        complement(324491..325075)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05730"
FT                   /product="biosynthetic peptidoglycan transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86036"
FT                   /protein_id="CBY86036.1"
FT                   /translation="MVQQKVANLLQGDFRYQIQYDWVSLENISPNIQLAVIASEDQRFP
FT                   EHLGFDFEAIQRVIRYNEKSKKGIRGASTISQQTAKNLMLWHGQNWLRKGLEVPATMLL
FT                   ELTWSKKRILEVYLNIAEFGNGIFGVEAASRYYFKKSAKNLSQNEAALLAAVLPNPIIY
FT                   KVNKPSLLVRKKQAWILRQMGNLGTEYLSHL"
FT   CDS_pept        complement(325218..325523)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05740"
FT                   /product="Trp operon repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86037"
FT                   /protein_id="CBY86037.1"
FT                   /translation="MYISRNLEQWNAFLQMLKIAFEENKAQEFLTLLLTADERDAVGLR
FT                   LQIVSQLLDKNLPQREIQQNLNTSAATITRGSNMIKTMDPDFMQWMKQHLDLIEKN"
FT   CDS_pept        complement(325561..327342)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05750"
FT                   /product="putative soluble lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86038"
FT                   /protein_id="CBY86038.1"
FT                   /translation="MKKVALISLCIFTALSAFADSPNTATASINLEQEKQNWASIQHQD
FT                   YLKRLKQREVFLQVEGLLKSAVKNQQFSEATQNITKTLIDSLQGYPLQYDLLARFWETK
FT                   IAFLQNDDIQGKQQAINELNALVQQNYPFVTPVFQALLQKLSTLNEQQTSATSDNAKEN
FT                   NRVQKEQNQLENPKKLAEIVRKSDPNTLDKTVLIDAFPRYLKTLPEQMNNLSFESYQKW
FT                   ANTWQLSEDEIKQWKIAFLNRFFDNENTDFQKWRDEQIRQLQTDNLTERRLRMAIWQKT
FT                   ELTSWLNLLSAESKSKQEWRYWEAKQDILKNTKKLTALSKERGFYPMLAATQLKQAYQL
FT                   NVPIARSFTQAEQLPFKQVFAMITELRELGRNGLAKQRWRILLGDVDFTTQLKLAQYAD
FT                   NQQWFELAVDASIVAKAWDYLSLRLPNAYSEYFNATLQNLNISKTFAMAIARQESAWNP
FT                   MAQSSANARGLMQLLPSTAKLTAENNQLPYQGEQDLFKPLNNISLGTAHLNELNEKYPN
FT                   NRILIAAAYNAGASRVEKWLSRANGELALDEFVASIPFYETRGYVQNVVAYDFYYQILQ
FT                   NKENPQIFSQEELNRLY"
FT   CDS_pept        complement(327358..327642)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86039"
FT                   /protein_id="CBY86039.1"
FT                   /translation="MFAQDIPNTLEKRLTVREQHLARLKQLQAENRLLTAGPNPAIDDE
FT                   NPSEAGFTGSTVIAQFENLQAAKDWAAQDPYVEAGVYADVIVKPFKKVF"
FT   CDS_pept        complement(327671..328135)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05770"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86040"
FT                   /protein_id="CBY86040.1"
FT                   /translation="MFANFIDKNGRQSKGVLLLRTLAMPSDTNANGDIFGGWIMSQMDM
FT                   GGAILAKEIAHGRVVTVAVESMNFIKPISVGDVVCCYGECLKVGRSSIKIKVEVWVKKV
FT                   ASEPIGERYCVTDAVFTFVAVDNNGRSRTIPRENNQELEKALALISEQPL"
FT   CDS_pept        complement(328135..328692)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05780"
FT                   /product="probable intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86041"
FT                   /protein_id="CBY86041.1"
FT                   /translation="MKQLLDFIPLILFFVTYKLGGVREAAIVLVVATILQIVILKWKYG
FT                   TVEKQQKIMASAVVFFGLLTAYFNEIRYLQWKVTIINALFAIVLLVAQFQFKTPLIKKL
FT                   LGKELKLPEKAWNTLNFGWAIFFIICMLVNIYISHNMSEEAWVDFKSFGIIGMTLIATI
FT                   ISGAYIYRYLPKDDSNSKDGEK"
FT   CDS_pept        complement(328698..329432)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86042"
FT                   /protein_id="CBY86042.1"
FT                   /translation="MLINFTQVLQDSWNFFRNQKKIMLQFVAILFIVQRASALLSFSVN
FT                   DENKNDVLNLANTDITSFIFSVAITQILTSFIAAWGLISIHKISLQNYRTLGETFSLTL
FT                   RRFAGVIVLDLLMVAPMLLGLGEAFAALLTKKSPSIMSLIAMLVGVWFFVRLNLTVVHY
FT                   LSTQEALSQTIRKIWMQGNTRKGVLFIYTLLVYFLVPILIFQLSALSNNAVFDMAIGIF
FT                   SALLNIFMLVVTYRFYSLFMKD"
FT   CDS_pept        complement(329578..330588)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05800"
FT                   /product="Beta-methylgalactoside transporter inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86043"
FT                   /protein_id="CBY86043.1"
FT                   /translation="MSALEKNKSFDLLKQNAIYFVLLILLGIIIAQDPTFLNLVNFSNI
FT                   LTQSSVRLIIALGVAGLLITQGTDLSAGRQVGLAAVISATMLQSMENINRVFPEMGQIP
FT                   IPVVILAVCAIGAVIGLVNGLVIAYLNVTPFIATMGTMIIIYGFNSLYYDAVGGSPIAG
FT                   FSENFSTFAQGFFRIGSFKLSYITIYAAIAALLVWIMWNKTRFGKNVFAIGGNPEAAKV
FT                   SGVNVARNLVAIYMIAGMFYAFGGMLEAGRIGSATNNLGFMYELDAIAACVVGGVSFAG
FT                   GVGTVIGVITGVIIFTVINYGLTYIGVNPYWQYIIKGSIIILAVAIDSLKYAKKK"
FT   CDS_pept        complement(330605..332125)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05810"
FT                   /product="Galactoside transport ATP-binding protein MglA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86044"
FT                   /protein_id="CBY86044.1"
FT                   /translation="MTAQTQCQDSQVLLTMTNVCKSFPGVKALDNANLTVRSHSVHALM
FT                   GENGAGKSTLLKCLFGIYAKDEGEILFLGEPVNFKTSKEALENGISMVHQELNLVRQTS
FT                   VMDNLWLGRYPLKGPFVDHAKMYRDTKAIFDELDIDVDPKEKVAKLSVSQMQMIEIAKA
FT                   FSYNAKIVIMDEPTSSLSEKEVEHLFKIIDKLKQRGCGIIYISHKMDEIFKICDEITIL
FT                   RDGKWINTVNVKESTMEQIVGMMVGRELTQRFPEKTNVPKEVILQVENLTAKNQPSIQD
FT                   VSFELRKGEILGIAGLVGAKRTDIVEAIFGVRELIEGTIKLHGKTVKNHTALEAINNGF
FT                   ALVTEERRSTGIYSNLSIEFNSLISNMKSYLTPWKLLSTKKMKSDTQWVIDSMNVKTPS
FT                   HRTTIGSLSGGNQQKVIIGRWLLTQPEILMLDEPTRGIDIGAKFEIYQLIQELAKKDKG
FT                   IIMISSEMPELLGVTDRILVMSNGKLAGIVESAKTSQEEILQLAAKYL"
FT   CDS_pept        complement(332191..333186)
FT                   /transl_table=11
FT                   /locus_tag="HICON_05820"
FT                   /product="D-galactose-binding periplasmic protein
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86045"
FT                   /protein_id="CBY86045.1"
FT                   /translation="MKKTVVLSAIALAIGLGSISSSFAADNKIGVTIYKYDDNFMSLMR
FT                   KEIDKEAKAVGGIKLLMNDSQNAQSIQNDQVDILLSKGVKALAINLVDPAAAPTIIGKA
FT                   KSDNIPVLFFNKDPGAKAIGSYEQAYYVGTDPKESGLIQGDLIAKQWKANPALDLNKDG
FT                   KIQFVLLKGEPGHPDAEVRTKYVVEELNAKGIQTEQLFIDTGMWDAAMAKDKVDAWLSS
FT                   SKANDIEVIISNNDGMALGALEATKAHGKKLPIFGVDALPEALQLINKGELAGTVLNDS
FT                   VNQGKAVVQLSNNLAQGKSATEGTKWELKDRVVRIPYVGVDKDNLGDFLK"
FT   CDS_pept        complement(333370..334362)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_05830"
FT                   /product="HTH-type transcriptional regulator GalR"
FT   CDS_pept        334570..335619
FT                   /transl_table=11
FT                   /locus_tag="HICON_05840"
FT                   /product="galactose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86047"
FT                   /protein_id="CBY86047.1"
FT                   /translation="MTALFEPTEHPHRRYNPLIDQWVLVSPHRAKRPWQGQQEKVNEEQ
FT                   KPSYDPTCYLCPSNKRITGELNPDYRKPYVFKNDFSALLEDTPAPEKSSDPLFQSSQAR
FT                   GESRVICFSPDHSKTLPLLTALEIEEVIKVWQEQLRELGAKYQWVQIFENKGAAMGCSN
FT                   PHPHGQIWANSFLPNEVAREDRTQRDYLLKHGSVMLVDYVKRELALKERIVVETEHWVA
FT                   LVPYWAIWPFETLLLPKTHVKRLTELSDEQSKDLAVILKKLTTKYDNLFETSFPYSMGF
FT                   HAAPFNGEDNEHWQLHAHFYPPLLRSATVRKFMVGYEMLGENQRDLTAEQAADRLRALS
FT                   EVHYKERTK"
FT   CDS_pept        335696..336850
FT                   /transl_table=11
FT                   /locus_tag="HICON_05850"
FT                   /product="galactokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86048"
FT                   /protein_id="CBY86048.1"
FT                   /translation="MTPIQNAQQIFNRQHKNLPEITVYAPGRVNIIGEHTDYNDGFVMP
FT                   CAINFGTAVSGTKRDDHIWNVYAADLDETDEFSLNVEIPKSEHKWANYVRGVVKFIQER
FT                   YPDFQQGANLVISGNVPLSSGLSSSAALEVAVGKFCQQLGDLPLSHTDIALNGQKAENQ
FT                   FVGANCGNMDQLISALGQENHLLMIDCRSLETTPTPVPQDVAVIIVNSNVPHDLVTGEY
FT                   NTRRQQCEEAAKFFGVKALRDVSVEQFQKREAELTALSPLAAKRARHIVTENQRVLDAV
FT                   EALKNNDLTCLGKLMEASHDSMRDDFEITVPQIDYLVELVQLVIGKSGGARMTGGGFGG
FT                   CIVALAPHDKVDAIRKIIADNYEKTTGLKETFYVCTASQGVRVI"
FT   CDS_pept        336860..337882
FT                   /transl_table=11
FT                   /locus_tag="HICON_05860"
FT                   /product="aldose 1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86049"
FT                   /protein_id="CBY86049.1"
FT                   /translation="MLEQTTFNAPDGAPYQLITLQNENGMRVQFMDWGATWLSCKVPVN
FT                   DTLREVLLGCKVENYPTHQSYLGASVGRYANRIANAQFELNGELIKLSSNQGKHQLHGG
FT                   EGFDKRRWKIQECGENFVCFSLQSEHGDQGFPGNVDVSVTYTLTDDNSVKIEYAGICDK
FT                   DTALNLTNHAYFNLENAEQGSDVREHTLRLNADFYLPVDNEGIPNSPLKHVVNTSFDFR
FT                   IAKPIKQDFLQGDQQATKGYDHSFIVNKAWQKPCVLLTSPTGDLSLEVRTSQAALQVYT
FT                   GNYLAGTPTRNGELYADFSGIALETQCLPDTPNHPEWQNYGGIQKASEQYYQWTEFKFK
FT                   "
FT   CDS_pept        338053..338601
FT                   /transl_table=11
FT                   /locus_tag="HICON_05870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86050"
FT                   /protein_id="CBY86050.1"
FT                   /translation="MLISYSDLNQQLKSAGIGFNATELHGFLSGLLCGGLKDQSWLPLL
FT                   YQFSNDNHAYPTGLVQPVTELYEQINQTLSDVEGFTFELGLTEDENVLAQADSLSDWAN
FT                   QFLLGLGLAQPELAKEKGEIGEAVDDLQDICQLGYNEDDNEEELAEALEEIIEYVRTIA
FT                   MLFYSHFNEEEIESKPVLH"
FT   CDS_pept        338613..339905
FT                   /transl_table=11
FT                   /locus_tag="HICON_05880"
FT                   /product="Xaa-Pro aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86051"
FT                   /protein_id="CBY86051.1"
FT                   /translation="MELTYMAKLPKEEFEERRTRVFAQMQPNSALLLFSEIEKRRNNDC
FT                   TYPFRQDSYFWYLTGFNEPNAALLLLKTEQTEKAIIFLRPRDPLLETWNGRRLGVERAP
FT                   QQLNVNEAYSIEEFATVLPKILKNLTALYHVPEIHTWGDTLVSESAVNFSEILDWRPML
FT                   SEMRLIKSPNEIRLIQQAGQITALGHIKAMQTTRPNRFEYEIESEILHEFNRHCARFPS
FT                   YNSIIAGGSNACILHYTENDRPLNDGDLVLIDAGCEFAMYAGDITRTFPVNGKFSQPQR
FT                   EIYELVLKAQKRAIELLVPGNSIKQANDEVIRIKTQGLVDLGILKGDVDTLVEQQAYRQ
FT                   FYMHGLGHWLGLDVHDVGSYGQDKQRILEIGMVITVEPGIYISEDADVPEQYKGIGVRI
FT                   EDNLLMTEYGNKILTAAVPKEIADIENLMNF"
FT   CDS_pept        340007..340432
FT                   /transl_table=11
FT                   /locus_tag="HICON_05890"
FT                   /product="universal stress global response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86052"
FT                   /protein_id="CBY86052.1"
FT                   /translation="MYKHILVAVDLSEESPILLKKAVGIAKRHDAKLSIIHVDVNFSDL
FT                   YTGLIDVNMSSMQDRISTETQKALLDLAESADYPISEKLSGSGDLGQVLSDAIEQYDVD
FT                   LLVTGHHQDFWSKLMSSTRQVMNTIKIDMLVVPLRDE"
FT   CDS_pept        340620..343244
FT                   /transl_table=11
FT                   /locus_tag="HICON_05900"
FT                   /product="alanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86053"
FT                   /protein_id="CBY86053.1"
FT                   /translation="MKTTAEIRQSFLDFFHSKGHQVVESSSLVPENDPTLLFTNAGMNQ
FT                   FKDVFLGMDKRPYSRATTAQRCVRAGGKHNDLENVGYTARHHTFFEMLGNFSFGDYFKQ
FT                   DAINFAWEYLTSPQWLGLPKEKLWVTVYETDDEAYNIWNKDVGVPAERIIRIGDNKGAP
FT                   YASDNFWAMGDTGPCGPCTEIFYDHGNHIWGGPPGSPEEDGDRYIEIWNVVFMQFNRLA
FT                   DGTMEKLPRPSVDTGMGLERISAVLQHVNSNYEIDIFKTLIAKTAEIVGATDLTNKSLR
FT                   VIADHIRSCAYLIADGVIPSNEGRGYVLRRIIRRAVRHGHLLGAKESFFYKLVPTLIDV
FT                   MAEAGKDVKAKQTNVEKLLRLEEEQFARTLERGLSLLDEALSQVKDGILSGEVAFKLYD
FT                   TYGFPLDLTADVCRERNITIDEQAFDRKMEAQRTRAQSASQFGVDYNSVIRVDGETKFE
FT                   GYTEVESQAKITALFYDGKSVESIEAGQSAVVILENTPFYAESGGQIGDSGYLSTQSVT
FT                   FNVKDTQKYGQVFGHIGELTQGSLKVGQSVNAIVDAKRRHNTSLNHSATHLLHAALRQI
FT                   LGLHVVQKGSLVSDKALRFDFAQPEAITKEQLSEIETLVNQKIRANFPVQTDIMDIDSA
FT                   KAKGAMALFGEKYGDKVRVLTMGDFSIELCGGIHAKRTGDIGLFKIITENAVAAGIRRI
FT                   EAVTGQNAIDWLHNQQRILTQSADLLKSDVNTLAEKIQQLQDKAKKVEKELQGLKEKAA
FT                   MQAGSDFVKSAVKINGVSVIAQQLDGIETKSLRVMVDDLKNQLGSGVIAFASILDEKVN
FT                   LVVGVTNDLTAKIKAGELVNLMAQQVGGKGGGRPDMAMAGGSQPENVAQAIKVAQDWLN
FT                   KNL"
FT   CDS_pept        343353..343517
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_05910"
FT                   /product="Carbon storage regulator"
FT   CDS_pept        343535..344422
FT                   /transl_table=11
FT                   /gene="galU"
FT                   /locus_tag="HICON_05920"
FT                   /product="UTP--glucose-1-phosphate uridylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86055"
FT                   /protein_id="CBY86055.1"
FT                   /translation="MKAIIPVAGLGTRMLPATKAIPKEMLTLVDKPLIQYVVNECVAAG
FT                   IKEIVLVTHSSKNAIENHFDTSFELETMLEKRVKRQLLEEVRSICPKNVTIMHVRQGNA
FT                   RGLGHAVLCGRPLVGNESFAVMLPDVLLAEFSADQKKENLAAMIQRFNETGASQIMVTP
FT                   VPQENVSSYGVADCGGIELNGGESAKINSIVEKPSIEDAPSNLAVVGRYVFSAAIWDLL
FT                   EKTPIGVGDEIQLTDAIDMLIEKETVEAFHMTGETFDCGDKIGYMEAFVEYGIRHEKLG
FT                   KEFKSFIKNLAKTL"
FT   CDS_pept        344557..345930
FT                   /transl_table=11
FT                   /locus_tag="HICON_05930"
FT                   /product="argininosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86056"
FT                   /protein_id="CBY86056.1"
FT                   /translation="MALWGGRFTQAADKRFKDFNDSLRFDYRLAEQDIQGSIGWSKALV
FT                   KVNVLTVEEQHQLEQALNELLVEVRSNPQAILQDDAEDIHSWVESKLIDKVGNLGKKLH
FT                   TGRSRNDQVAVDIKLWCKQRVIELQESVRNLQRHLVQTAENTQQAVMPGYTHLQRAQPI
FT                   TFAHWCMAYVEMFDRDYSRLTDAYNRMNTCPLGSGALAGTAYAVDRDSLAHDLGFTFAT
FT                   RNSLDSVSDRDHIVELLSIASLSMAHLSRFAEDMIIFNSGEANFVELSDRVTSGSSLMP
FT                   QKKNPDACELIRGKTGRVIGSLTSMLITLKGLPLAYNKDMQEDKEGIFDALDTWQNCVD
FT                   MATFVLDELKVNVERTREAALKGYSNATELADYLVSKGVPFRDSHHIVGETVVYAIEKS
FT                   KGLEDLTIPEFRQFSEVVGDDVYEILSLQSCLDKRCAKGGVSPLRVAEAIAEAKTRFA"
FT   CDS_pept        346075..346956
FT                   /transl_table=11
FT                   /locus_tag="HICON_05940"
FT                   /product="heat shock protein Hsp33"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86057"
FT                   /protein_id="CBY86057.1"
FT                   /translation="MTNQQDYTQDNDKLYRYLFQHRAVRGEWVRLNKTFTDTLNTHQYP
FT                   KAVQDLLGEMMVATNLLTATLKFDGNITVQIQGDGPLRLALVNGNDQQQIRALARVDGN
FT                   ITENMSLHNMIGKGVLVITIAPKEGERYQGVISLDKPTITECLEDYFVRSEQLQTQLII
FT                   RTGEYEGKPVAAGMLLQIMPDGSGTPEDFEHLTTLAATVKDEELFGLPAEELLYRLYHE
FT                   ETVNLYPAQDVQFFCGCSAERSSSALLLISDEEIDEILAEHKGSIDMQCECCGTHYFFN
FT                   KEAIEKLKSTRV"
FT   CDS_pept        347129..348745
FT                   /transl_table=11
FT                   /locus_tag="HICON_05950"
FT                   /product="phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86058"
FT                   /protein_id="CBY86058.1"
FT                   /translation="MTDLNKVVKELEALGIYDVKEVVYNPSYEQLFEEETKPGLEGFEK
FT                   GTLTTTGAVAVDTGIFTGRSPKDKYIVLDEKTKDTVWWTSETAKNDNKPMNQATWQSLK
FT                   DLVTNQLSRKRLFVVDGFCGASEHDRIAVRIVTEVAWQAHFVKNMFIRPTEEQLKNFEP
FT                   DFVVMNGSKVTNPNWKEQGLNSENFVAFNLTERIQLIGGTWYGGEMKKGMFSMMNYFLP
FT                   LKGVGAMHCSANVGEDGDVAIFFGLSGTGKTTLSTDPKRELIGDDEHGWDDVGIFNFEG
FT                   GCYAKTIHLSEENEPDIYRAIRRDALLENVVVRSDGSVDFDDGSKTENTRVSYPIYHID
FT                   NIVKPVSRAGHATKVIFLTADAFGVLPPVSKLTPEQTKYYFLSGFTAKLAGTERGITEP
FT                   TPTFSACFGAAFLTLHPTQYAEVLVKRMQAAGAEAYLVNTGWNGTGKRISIKDTRGIID
FT                   AILDGSIEKAEMGELPIFNLAIPKALPGVDSAILDPRDTYADKAQWQSKAEDLAGRFVK
FT                   NFVKYATNEEGKALIAAGPKA"
FT   CDS_pept        348897..349454
FT                   /transl_table=11
FT                   /locus_tag="HICON_05960"
FT                   /product="ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86059"
FT                   /protein_id="CBY86059.1"
FT                   /translation="MLNQIKKDAQDRMEKSLEALKGHISKIRTGRAQPSLLDAIQVEYY
FT                   GAATPLRQLANVVAEDARTLAVTVFDRSLISAVEKAILTSDLGLNPSSAGTTIRVPLPP
FT                   LTEERRRDLIKIVKGEGEQGKVAIRNVRRDANDKIKALLKDKEISENEQHKAEEEIQKI
FT                   TDIYIKKVDEVLADKEKELMDF"
FT   CDS_pept        349565..350758
FT                   /transl_table=11
FT                   /locus_tag="HICON_05970"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86060"
FT                   /protein_id="CBY86060.1"
FT                   /translation="MQKQNIVILGSTGSIGKSTLSVIENNPEKYHAFALVGGKNVETMF
FT                   EQCIKFRPHFAALDDVNAAKILREKLIAHHIPTEVLAGQQAICELAAHPDADQIMASIV
FT                   GAAGLLPTLSAVKAGKRVLLANKESLVTCGQLFIDAVKNYGAKLLPVDSEHNAIFQSLP
FT                   PEAQEKIGFCPLSELGVSKIILTGSGGPFRYTPLEQFTNITPEQAVAHPNWSMGKKISV
FT                   DSATMMNKGLEYIEARWLFNASAQEMEVIIHPQSIIHSMVRYVDGSVIAQMGNPDMRTP
FT                   IAETMAYPYRTFAGVEPLDFFKVKELTFIEPDFNRYPNLKLAIDTFSAGQYATTAMNAT
FT                   NEIAVQAFLDRQISFMDIAKINLKTIEKISPYTIQNIDDVLGIDAQAREIAKTLIRE"
FT   CDS_pept        complement(350790..351599)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_05980"
FT                   /product="conserved hypothetical protein"
FT   CDS_pept        352044..352433
FT                   /transl_table=11
FT                   /locus_tag="HICON_05990"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_05990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86062"
FT                   /protein_id="CBY86062.1"
FT                   /translation="MAYLGLQPDLCIFRETCGDQLVIEQNGDIYSCDHYVYPEYKLGNL
FT                   IEPPLIQLLNNNTKQKNFGATKSFLSEQCKICKFRFACHGGCPKHRTIQGFGKAHNQFY
FT                   EAYYSALSHMDPYLKSFAKSFGKIK"
FT   CDS_pept        352552..353148
FT                   /transl_table=11
FT                   /locus_tag="HICON_06000"
FT                   /product="predicted cAMP-binding protein-catabolite gene
FT                   activator and regulatory subunit of cAMP-dependent protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86063"
FT                   /protein_id="CBY86063.1"
FT                   /translation="MFTLSYYLPQNLNKCIISESKTLEKNSLIYAQGEKPKEFYFLKQG
FT                   LVGLYHSLENGKETLTRVYHANEYFSFRTIFSETSYHCSAKVLMEADIVRIFPSNHANF
FT                   IANNPDFSCYLMKQLSNELYDAEHRISNTAYKRSYERIIDAIENLTESYPDYPWTYREI
FT                   AEFCGCETETAIRISRELKKQRILDKNTRHLRICS"
FT   CDS_pept        complement(353275..353661)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06010"
FT                   /product="50S ribosomal subunit protein L17"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86064"
FT                   /protein_id="CBY86064.1"
FT                   /translation="MRHRKSGRQLNRNSSHRQAMFRNLASALVSHEIIKTTLPKAKELR
FT                   RVVEPLITLAKVDSVANRRLAFARTRNVETVAKLFNELGPRFAQRAGGYTRILKCGFRA
FT                   GDNAPMAYIELVDRPEVAEATTEE"
FT   CDS_pept        complement(353702..354688)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06020"
FT                   /product="RNA polymerase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86065"
FT                   /protein_id="CBY86065.1"
FT                   /translation="MQGSVTEFLKPRLVDIEQISSTHAKVILEPLERGFGHTLGNALRR
FT                   ILLSSMPGCAVTEVEIDGVLHEYSSKEGVQEDILEVLLNLKGLAVKVQNKDDVILTLNK
FT                   SGIGPVVAADITHDGNVEIVNPDHVICHLTDENASISMRIRVQRGRGYVPASSRTHTQE
FT                   ERPIGRLLVDACYSPVERIAYNVEAARVEQRTDLDKLVIELETNGALEPEEAIRRAATI
FT                   LAGQLDAFVDLRDVRQPEIKEEKPEFDPILLRPVDDLELTVRSANCLKAETIHYIGDLV
FT                   QRTEVELLKTPNLGKKSLTEIKDVLASRGLSLGMRLENWPPASIAED"
FT   CDS_pept        complement(354720..355340)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06030"
FT                   /product="30S ribosomal subunit protein S4"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86066"
FT                   /protein_id="CBY86066.1"
FT                   /translation="MARYLGPKLKLSRREGTDLFLKSGVRAIDSKCKIDTAPGQHGARK
FT                   PRLSDYGSQLREKQKVRRIYGILERQFRNYYKEANRLKGNTGENLLVLLEGRLDNVVYR
FT                   MGFAATRAEARQLVSHKAIVVNGRVVNIPSFQVSVNDVVAIREKSKKQARIKASLELAE
FT                   QREKPTWLEVDSAKMEGVFKRVPERSDLSADINEHLIVELYSK"
FT   CDS_pept        complement(355368..355757)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06040"
FT                   /product="30S ribosomal subunit protein S11"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86067"
FT                   /protein_id="CBY86067.1"
FT                   /translation="MAKTPVRARKRVKKQVVDGVAHIHASFNNTIVTITDRQGNALAWA
FT                   TAGGSGFRGSRKSTPFAAQVAAERCAEIVKEFGLKNLEVMVKGPGPGRESTIRALNAAG
FT                   FRITNITDVTPIPHNGCRPPKKRRV"
FT   CDS_pept        complement(355773..356129)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06050"
FT                   /product="30S ribosomal subunit protein S13"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86068"
FT                   /protein_id="CBY86068.1"
FT                   /translation="MARIAGINIPDHKHAVIALTAIYGIGKTRSQAICAAAGIAEDVKI
FT                   RELSEEQIDKLRDEVGKFTVEGDLRREVTLNIKRLLDLGCYRGLRHRRSLPVRGQRTKT
FT                   NARTRKGPRKPIKK"
FT   CDS_pept        complement(356269..356382)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06060"
FT                   /product="50S ribosomal subunit protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86069"
FT                   /protein_id="CBY86069.1"
FT                   /translation="MKVRASVKKMCRNCKIVKREGVVRVLCSDPKHKQRQG"
FT   CDS_pept        complement(356411..357736)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06070"
FT                   /product="preprotein translocase SecY subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86070"
FT                   /protein_id="CBY86070.1"
FT                   /translation="MAKQPGYQARSTNSGKGELKSRLLFVLGALIVYRIGSFIPVPGID
FT                   AAVLAQLVEQQKGTIIDMFNMFSGGALSRASILALGIMPYISASIVIQLLATVSPALAE
FT                   LKKEGAAGQRKISKYTRYATVVFATIQAVAISTGLPNMLSGLVPNVGFSFYFTSVVSLV
FT                   TGTMFLMWLGEQITERGIGNGISILVFGGIVAGLPSAILQTIEQARQGQMHPLVLLLIA
FT                   AIVFAVTYFVVFVERGQRRIRVEYAKRQQGRQILGGHSTHLPLKVNMANVMPAIFASSI
FT                   ILFPATLTQWFGQNDKFEWLNNLSMLLNPGQPLYLLVYAVAIIFFSFFYTAMQYNPRDT
FT                   ADNLKKSGAFIPGIRPGEQTSRYIDKVMTRLTLIGGLYVTFVCLVPYIMTSAWDVKFYF
FT                   GGTSLLIVVVVIMDFIVQVQSHLMSSQYESALKKANLKGFGQ"
FT   CDS_pept        complement(357744..358178)
FT                   /transl_table=11
FT                   /gene="rplO"
FT                   /locus_tag="HICON_06080"
FT                   /product="50S ribosomal subunit protein L15"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86071"
FT                   /protein_id="CBY86071.1"
FT                   /translation="MRLNTLSPAEGAKHSAKRLGRGIGSGLGKTGGRGHKGQKSRTGGG
FT                   VRRGFEGGQMPLYRRLPKFGFTSMKSAVTAEVRLNELTKVEGNVVTLETLKAANILTKD
FT                   IQFAKVILAGEVKSAVTVRGLRVTKGAKAAIEAAGGSIEE"
FT   CDS_pept        complement(358182..358361)
FT                   /transl_table=11
FT                   /gene="rpmD"
FT                   /locus_tag="HICON_06090"
FT                   /product="50S ribosomal subunit protein L30"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86072"
FT                   /protein_id="CBY86072.1"
FT                   /translation="MAKTIKVTQVRSSIARLPKHKATLRGLGLRHMHHTVELIDTPAVR
FT                   GMINQVSYMVKVEE"
FT   CDS_pept        complement(358368..358868)
FT                   /transl_table=11
FT                   /gene="rpsE"
FT                   /locus_tag="HICON_06100"
FT                   /product="30S ribosomal subunit protein S5"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86073"
FT                   /protein_id="CBY86073.1"
FT                   /translation="MSNIEKQVGELQEKLIAVNRVSKTVKGGRIMSFTALTVVGDGNGR
FT                   VGFGYGKAREVPAAIQKAMEKARRNMINVALNEGTLQHPVKGVHTGSRVFMQPASEGTG
FT                   IIAGGAMRAVLEVAGVRNVLSKAYGSTNPINVVRATIDALANMKSPEMVAAKRGKTVDE
FT                   ILG"
FT   CDS_pept        complement(358883..359236)
FT                   /transl_table=11
FT                   /gene="rplR"
FT                   /locus_tag="HICON_06110"
FT                   /product="50S ribosomal subunit protein L18"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86074"
FT                   /protein_id="CBY86074.1"
FT                   /translation="MDKKSARIRRAARARHMMREQGVTRLVIHRTPRHIYAQVIAPNGS
FT                   EVLAAASTVEKAIREQVKYTGNKDAAAAVGKAVAERALAKGVQAVAFDRSGFKYHGRVQ
FT                   TLADAAREAGLQF"
FT   CDS_pept        complement(359250..359783)
FT                   /transl_table=11
FT                   /gene="rplF"
FT                   /locus_tag="HICON_06120"
FT                   /product="50S ribosomal subunit protein L6"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86075"
FT                   /protein_id="CBY86075.1"
FT                   /translation="MSRVAKAPVNIPAGVEVKLDGQLLTVKGKNGELSRKIHESVEVKQ
FT                   DNGQFTFTPREGFVEANAQSGTARALVNAMVIGVTEGFTKKLVLVGVGYRAQLKGNAIA
FT                   LSLGYSHPVEHTLPVGITAECPSQTEIVLKGADKQLIGQVAADIRAYRRPEPYKGKGVR
FT                   YADEVVRIKEAKKK"
FT   CDS_pept        complement(359799..360191)
FT                   /transl_table=11
FT                   /gene="rpsH"
FT                   /locus_tag="HICON_06130"
FT                   /product="30S ribosomal subunit protein S8"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86076"
FT                   /protein_id="CBY86076.1"
FT                   /translation="MSMQDPIADMLTRIRNGQAANKVAINMPSSKLKVAIANVLAAEGY
FT                   IESVKVLEGAKPELEITLKYFQGKPVVESIQRVSRPGLRIYKRKDELPKVMGGLGVAVI
FT                   STSKGVMTDRAARQAGLGGEIICYVA"
FT   CDS_pept        complement(360228..360533)
FT                   /transl_table=11
FT                   /gene="rpsN"
FT                   /locus_tag="HICON_06140"
FT                   /product="30S ribosomal subunit protein S14"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86077"
FT                   /protein_id="CBY86077.1"
FT                   /translation="MAKQSMKARDVKRVKLAEKFYAKRVELKKIISDVNASDEDRWDAV
FT                   LKLQTLPRDSSPSRQRNRCRQTGRPHGVLRKFGLSRIKVREAAMRGEIPGLKKASW"
FT   CDS_pept        complement(360545..361084)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06150"
FT                   /product="50S ribosomal subunit protein L5"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86078"
FT                   /protein_id="CBY86078.1"
FT                   /translation="MAKLHDYYRDQVVSELKNKFGYKSVMQVPRIEKITLNMGVGEALT
FT                   DKKLLDNAVADLAAISGQKPLVTKARKSVAGFKIRQGYPIGCKVTLRGERMWEFFERLI
FT                   TIAVPRIRDFRGLSAKSFDGRGNYSMGVREQIIFPEIDYDKVDRVRGLDITITTTAKND
FT                   EEGQALLAAFNFPFRK"
FT   CDS_pept        complement(361102..361413)
FT                   /transl_table=11
FT                   /gene="rplN"
FT                   /locus_tag="HICON_06160"
FT                   /product="50S ribosomal subunit protein L24"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86079"
FT                   /protein_id="CBY86079.1"
FT                   /translation="MAAKIRQNDEVIVLTGKDKGKRGKVTKVLPNGKVFVEGINIITKH
FT                   EKPVPALGKAGGLVKKEAAIDASNVAIFNPKTNKADRVGFRFEDGKKVRFFKSNNEII"
FT   CDS_pept        complement(361424..361795)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06170"
FT                   /product="50S ribosomal subunit protein L14"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86080"
FT                   /protein_id="CBY86080.1"
FT                   /translation="MIQEQTMLDVADNSGARSVMCIKVLGGSHRRYAAIGDIIKITVKE
FT                   AIPRGKVKKGDVLKAVVVRTKKGVRRPDGSVIRFDGNACVILNNNTEQPIGTRIFGPVT
FT                   RELRSEKFMKIISLAPEVL"
FT   CDS_pept        complement(362077..362700)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86081"
FT                   /protein_id="CBY86081.1"
FT                   /translation="MKYILIHDLPYQEEEIGITEFYDENDLDTEADMYDRETFGILLGE
FT                   YVAGLYLLDDTFIEPVLDNINIPNNVYSTNIFAIHYVAKHILGIKDLDKRLKSGDIELV
FT                   RELGEVTIGGKEKYFYSFATKYCSHHNPIAFPIYDSYVEQVLLYFNKVDKFSAFKRKDL
FT                   KNYRKFKEVLIDFQRFYKLDRFNLKELDRYLWLLGKEIFPKSKN"
FT   CDS_pept        complement(363090..363347)
FT                   /transl_table=11
FT                   /gene="rpsQ"
FT                   /locus_tag="HICON_06190"
FT                   /product="30S ribosomal subunit protein S17"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86082"
FT                   /protein_id="CBY86082.1"
FT                   /translation="MTDKIRSVQGKVVSDKMEKSFVVAIERKVKHPLYGKFIRRTTKLH
FT                   VHDENNEAKVGDTVEIRECRPLSKTKSWTLVRVVEKAVIA"
FT   CDS_pept        complement(363347..363538)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06200"
FT                   /product="50S ribosomal protein L29"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86083"
FT                   /protein_id="CBY86083.1"
FT                   /translation="MKAQDLRTKSVEELNAELVNLLGEQFKLRMQTATGQLQQTHQAKQ
FT                   VRRDIARVKTVLTEKAGE"
FT   CDS_pept        complement(363538..363948)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06210"
FT                   /product="50S ribosomal subunit protein L16"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86084"
FT                   /protein_id="CBY86084.1"
FT                   /translation="MLQPKRTKFRKVHKGRNRGIASGTEVSFGTYGLKAVGRCRLTARQ
FT                   IEAARRAMSRAVKRQGKIWIRVFPDKPITEKPLEVRMGKGKGNVEYWVALIQPGKVLYE
FT                   MDGVSEEVARNAFALAAAKLPVKTTFVTKTVM"
FT   CDS_pept        complement(363962..364669)
FT                   /transl_table=11
FT                   /gene="rpsC"
FT                   /locus_tag="HICON_06220"
FT                   /product="30S ribosomal subunit protein S3"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86085"
FT                   /protein_id="CBY86085.1"
FT                   /translation="MGQKVHPHGIRLGIVKPWSSTWFANTQDFADNLEGDFKVRKFLNK
FT                   ELANASVSRITIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRNAVSKIASVPAQINIA
FT                   EVKKPELDAKLVADSIASQLERRVMFRRAMKRAVQSAMRLGAKGIKVEVSGRLGGAEIA
FT                   RSEWYREGRVPLHTLRADIDYNTAEAHTTYGVIGVKVWIFKGEILGGMAAVAQSEQQPA
FT                   DKPKKAPRGKGRK"
FT   CDS_pept        complement(364687..365019)
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HICON_06230"
FT                   /product="50S ribosomal subunit protein L22"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86086"
FT                   /protein_id="CBY86086.1"
FT                   /translation="METIAKHRYARTSAQKARLVADLIRGKKVAQALEILTFTNKKAAA
FT                   LVKKVLESAIANAEHNDGADIDDLKVAKIFVDEGPSMKRVMPRAKGRADRILKRTSHIT
FT                   VVVSDR"
FT   CDS_pept        complement(365031..365306)
FT                   /transl_table=11
FT                   /gene="rpsS"
FT                   /locus_tag="HICON_06240"
FT                   /product="30S ribosomal subunit protein S19"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86087"
FT                   /protein_id="CBY86087.1"
FT                   /translation="MPRSLKKGPFLDLHLLKKVEKAVESGDKKPIKTWSRRSMIIPSMI
FT                   GLTIAVHNGRQHVPVYVSDEMIGHKLGEFAPTRTYRGHAADKKAKK"
FT   CDS_pept        complement(365332..366153)
FT                   /transl_table=11
FT                   /gene="rplB"
FT                   /locus_tag="HICON_06250"
FT                   /product="50S ribosomal subunit protein L2"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86088"
FT                   /protein_id="CBY86088.1"
FT                   /translation="MAIVKCKPTSAGRRHVVKIVNPELHKGKPYAPLLDTKSKTGGRNN
FT                   YGRITTRHIGGGHKQHYRLIDFKRNKLDIPAVVERLEYDPNRSANIALVLYKDGERRYI
FT                   LAPKGLSVGDQIQAGINSPIKVGNSLPMRNIPVGSTVHNVELKPGKGGQIARSAGAYVQ
FT                   IIAREGNYVTLRLRSGEMRKVLAECVATIGEVGNSEHMLRVLGKAGANRWRGIRPTVRG
FT                   TAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRHNKRTDKYIVRRRGK"
FT   CDS_pept        complement(366171..366470)
FT                   /transl_table=11
FT                   /gene="rplW"
FT                   /locus_tag="HICON_06260"
FT                   /product="50S ribosomal subunit protein L23"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86089"
FT                   /protein_id="CBY86089.1"
FT                   /translation="MSQERLLSVLRAPHISEKATNNAEKSNTVVLKVALDANKAEIAAA
FT                   VAQLFEVKVDSVRTVVVKGKTKRRGNKMGRRSDWKKAYVTLAEGQNLDFVDSAE"
FT   CDS_pept        complement(366467..367069)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06270"
FT                   /product="50S ribosomal subunit protein L4"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86090"
FT                   /protein_id="CBY86090.1"
FT                   /translation="MELQVVGANALTVSETTFGREFNEALIHQVVVAYAAGARQGTRAQ
FT                   KTRAEVSGSGKKPWRQKGTGRARAGDIKSPIWRSGGTTFAAKPQDHSQKVNKKMYRGAI
FT                   KSILSELVRQDRLVVVEKFELDAPKTKVLVQKLKDLAVEDALIITASLDENLFLAARNL
FT                   YKVDVRDVQGIDPVSLIAFDKVIVTVDAVKQIEEILA"
FT   CDS_pept        complement(367085..367711)
FT                   /transl_table=11
FT                   /gene="rplC"
FT                   /locus_tag="HICON_06280"
FT                   /product="50S ribosomal subunit protein L3"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86091"
FT                   /protein_id="CBY86091.1"
FT                   /translation="MIGLVGRKVGMTRIFNEDGVSVPVTVIEIEANRVTQVKTLENDGY
FT                   TAVQVTTGSKKANRVTKPEAGHFVKAGVEAGRGLWEFRTEGEEFTLGQEINVDIFADVK
FT                   KVDVTGTSKGKGFQGGVKRWNFRTQDATHGNSLSHRVLGSIGQNQTPGRVFKGKKMAGH
FT                   LGAERVTVQSLEVVRVDAERKLLLVKGSVPGAINGDVIVKPAVKA"
FT   CDS_pept        complement(367728..368039)
FT                   /transl_table=11
FT                   /gene="rpsJ"
FT                   /locus_tag="HICON_06290"
FT                   /product="30S ribosomal subunit protein S10"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86092"
FT                   /protein_id="CBY86092.1"
FT                   /translation="MQNQRIRIRLKAFDHRLIDQSTAEIVETAKRTGAQVRGPIPLPTR
FT                   KERFTVLISPHVNKDARDQYEIRTHKRLVDIVEPTEKTVDALMRLDLAAGVDVQISLG"
FT   CDS_pept        complement(368359..369291)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06300"
FT                   /product="cell division protein FtsX"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86093"
FT                   /protein_id="CBY86093.1"
FT                   /translation="MSRSTDASVFVQTAYTLRAVWADLWQRKFGTLLTILVIAVSLTIP
FT                   TVSYLMWKNLHLATTQFYPESELTIYLHKNLSEENANLVVEKIRQQKGVESLNYVSRQE
FT                   SLKEFKSWSGFGEELEILDDNPLPAVVIVKPTSEFNVSEKRDELRTNLNKIKGVQEVRL
FT                   DNDWMEKLTALSWLIAHVAIFCTVLMMIAVFLVIGNSIRSDVYSSRSSIDVMKLLGATD
FT                   QFILRPYLYTGMIYALLGGLVAAIFSSFIISYFTSAVKYVTDIFAVQFSLNGLGVGEFV
FT                   FLLVCGLIMGYVGAWISAKRHLSVLDNRY"
FT   CDS_pept        complement(369301..369957)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06310"
FT                   /product="cell division ATP-binding protein FtsE"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86094"
FT                   /protein_id="CBY86094.1"
FT                   /translation="MIKFSNVSKAYHGATQPALQGLNFHLPVGSMTYLVGHSGAGKSTL
FT                   LKLIMGMEKANAGQIWFNGHDITRLSKYEIPFLRRQIGMVHQDYRLLTDRTVVENVALP
FT                   LIIAGMHPKDANTRAMASLDRVGLRNKAHYLPPQISGGEQQRVDIARAIVHKPQLLLAD
FT                   EPTGNLDDELSVGIFNLFEEFNRLGMTVLIATHDINLIQQKPKPCLVLEQGYLRY"
FT   CDS_pept        complement(369976..371220)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06320"
FT                   /product="cell division protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86095"
FT                   /protein_id="CBY86095.1"
FT                   /translation="MNDIFIGLQLREHFMAEENKKGGFWASLFGRNKKQDEPKIEPIIE
FT                   EEKIKDIEPSIEKLETHDLVEEEKIQEISTALEPIEEIIEAKKLEDELQPVAEIETREK
FT                   PSEGGFFSRLVKGLLKTKQNIGAGFRGFFLGKKIDDELFEELEEQLLIADIGVPTTSKI
FT                   IKNLTEHASRKELQDAELLYQQLKVEMANILEPVAKPLVIDNTKKPYVILMVGVNGVGK
FT                   TTTIGKLARKFQAEGKSVMLAAGDTFRAAAVEQLQVWGERNHIPVVAQSTGSDSASVIF
FT                   DAMQSAAARNIDILIADTAGRLQNKNNLMDELKKIVRVMKKYDETAPHEIMLTLDAGTG
FT                   QNAISQAKLFNEAVGLTGISLTKLDGTAKGGVIFAIADQFKLPIRYIGVGEKIEDLREF
FT                   NAKEFIEALFVHEEE"
FT   CDS_pept        371275..371856
FT                   /transl_table=11
FT                   /locus_tag="HICON_06330"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86096"
FT                   /protein_id="CBY86096.1"
FT                   /translation="MKKIQTPNAKGEVRIIAGLWRGRKLPVLNSEGLRPTGDRVKETLF
FT                   NWLMPYIYQSECLDGFAGSGSLGFEALSRQAKKVTFLELDKTIANQLKKNLQTLKCSSE
FT                   QAEVINQSSLDFLKQPQNQPHFDVVFLDPPFHFNLAEQAINLLCENNWLKPNALIYVET
FT                   EKDKPLITPENWTLLKEKTTGMVSYRLYQN"
FT   CDS_pept        371867..372349
FT                   /transl_table=11
FT                   /locus_tag="HICON_06340"
FT                   /product="tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86097"
FT                   /protein_id="CBY86097.1"
FT                   /translation="MLDIVLYEPEIPQNTGNIIRLCANTGFRLHLIEPLGFTWDDKRLR
FT                   RSGLDYHEFAEIKRHKTFEAFLESEKPKRLFALTTKGSPAHSQVKFELGDYLMFGPETR
FT                   GIPMSILNEMPMEQKIRIPMTANSRSMNLSNSVAVTVYEAWRQLSYEGAVNLPEVK"
FT   CDS_pept        complement(join(372398..373219,373218..373238))
FT                   /pseudo
FT                   /transl_table=11
FT                   /gene="lpsC"
FT                   /locus_tag="HICON_06350"
FT                   /product="lipooligosaccharide biosynthesis protein"
FT   CDS_pept        complement(373258..373905)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06360"
FT                   /product="3,4-dihydroxy-2-butanone-4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86099"
FT                   /protein_id="CBY86099.1"
FT                   /translation="MNQSILSPFGNTAEERVLNAINAFKNGNGVLVLDDEDRENEGDLI
FT                   FPAETITPEQMAKLIRYGSGIVCLCITDERCQQLDLPPMVEHNNSVNKTAFTVTIEAAK
FT                   GVSTGVSAADRVTTIQTAIADNALPTDLHRPGHVFPLRAANGGVLTRRGHTEASVDLAR
FT                   LAGFKEAGVICEITNDDGTMARTPDIVEFAKKFGYSVLTIEDLVEYRLANNI"
FT   CDS_pept        374166..375389
FT                   /transl_table=11
FT                   /locus_tag="HICON_06370"
FT                   /product="bifunctional protein NadR"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86100"
FT                   /protein_id="CBY86100.1"
FT                   /translation="MHTKYNAKYLVTKSEREKYFHLSYNKHTQFLRYQEQIMSKTKEKK
FT                   VGVIFGKFYPVHTGHINMIYEAFSKVDELHVIVCSDTVRDLKLFYDSKMKRMPTVQDRL
FT                   RWMQQIFKYQKNQIFIHHLIEDGIPSYPNGWQSWSEAVKTLFHEKHFEPSIVFSSEPQD
FT                   KAPYEKYLGLEVSLVDPDRTFFNVSATKIRTTPFQYWKFIPKEARPFFAKTVAILGGES
FT                   SGKSVLVNKLAAVFNTTSAWEYGREFVFEKLGGDEQAMQYSDYPQMALGHQRYIDYAVR
FT                   HSHKIAFIDTDFITTQAFCIQYEGKAHPFLDSMIKEYPFDVTILLKNNTEWVDDGLRSL
FT                   GSQKQRQQFQQLLKKLLDKYKVPYIEIESPSYLDRYNQVKAVIEKVLNEEEISELQNTT
FT                   FPIKGTSQ"
FT   CDS_pept        375386..376066
FT                   /transl_table=11
FT                   /locus_tag="HICON_06380"
FT                   /product="predicted diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86101"
FT                   /protein_id="CBY86101.1"
FT                   /translation="MILFAGDPHGSYDHIYPFIKEQENVALIILGDLQLTTADELDKLA
FT                   QHCDIWFIHGNHDSKTISAFDSIWGSEWQSRNLHNRVVDIQGTRIAGLGGVFRGQIWMP
FT                   PNRPMFFDPIHYCQYSPQEKIWRGGVPLRHRTSIFPSDIEILENQQADVLICHEAPKPH
FT                   PMGFQVINDLAMKMGVKLVFHGHHHENFTYRTKYPYKITNVGFRSLADAEGNYLLQTID
FT                   DREK"
FT   tRNA            complement(376288..376360)
FT                   /product="transfer RNA-Asn"
FT                   /anticodon="(pos:376325..376327,aa:Asn)"
FT   tRNA            complement(376366..376438)
FT                   /product="transfer RNA-Phe"
FT                   /anticodon="(pos:376403..376405,aa:Phe)"
FT   CDS_pept        complement(376676..377749)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06390"
FT                   /product="membrane-bound lytic murein transglycosylase C"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86102"
FT                   /protein_id="CBY86102.1"
FT                   /translation="MKKYLLLALLPFLYACSNSSNQGINYDEAFAKDTQGLDILTGQFS
FT                   HNIDRIWGVNELLVASRKDYVKYTDSFYTRSHVSFDEGNIVIETQQDLNRLHNAIVHTL
FT                   LMGADAKGIDLFASGDVPISSRPFLLGQVVDHQGQQIANQVIASNFATYLIQNKLQTRR
FT                   LQNGHTVQFVSVPMIANHVEVRARKYLPLIRKAAQRYGIDESLILGIMQTESSFNPYAI
FT                   SYANAIGLMQVVPHTAGRDVFAMKGKGGQPSTRYLYDPANNIDAGVSYLWILQNQYLDG
FT                   ITNPTSKRFAMISAYNSGAGAVLRVFDNDKDTAIYKINQMYPEQVYRILTTVHPSSQAR
FT                   NYLLKVDKAQKKFRVRR"
FT   CDS_pept        complement(377764..378036)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06400"
FT                   /product="Probable Fe(2+)-trafficking protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86103"
FT                   /protein_id="CBY86103.1"
FT                   /translation="MARTVFCEYLKKEAEGLDFQLYPGELGKRIFDSVSKQAWGEWIKK
FT                   QTMLVNEKKLNMMNAEHRKLLEQEMVNFLFEGKDVHIEGYVPLSN"
FT   CDS_pept        complement(378014..379150)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06410"
FT                   /product="adenine DNA glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86104"
FT                   /protein_id="CBY86104.1"
FT                   /translation="MLAKSSINAPFAKSVLAWYDKFGRKHLPWQQNKTLYGVWLSEVML
FT                   QQTQVATVIPYFERFIKTFPNITALANASQDEVLHLWTGLGYYARARNLHKAAQKVRDE
FT                   FNGNFPTNFEQVWALSGVGRSTAGAILSSVLNQPYPILDGNVKRVLARYFAIEGWSGEK
FT                   KVENRLWTLTEQVTPTTRVADFNQAMMDIGAMVCTRTKPKCDLCPLNIDCLAYKNTNWE
FT                   KFPAKKPKKAMPEKTTYFLILSKNGKVCLEQRENSGLWGGLFCFPQFEDKSSLLHFLAQ
FT                   EKVTHYQEWPSFRHTFSHFHLDIHPIYAEMESTLCVELANLDWRKVMESTKEYQSNLSS
FT                   AVKYWYDPQNPEPIGLAQPVKNLLIQFVRNHYGKNSIL"
FT   CDS_pept        379327..379539
FT                   /transl_table=11
FT                   /locus_tag="HICON_06420"
FT                   /product="50S ribosomal subunit protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86105"
FT                   /protein_id="CBY86105.1"
FT                   /translation="MKQGIHPEYKEITATCSCGNVIKTRSTLGKDINLDVCGNCHPFYT
FT                   GKQRVVDTGGRVERFNSRFKIPSTK"
FT   CDS_pept        complement(379617..380300)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06430"
FT                   /product="phosphoglyceromutase 1"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86106"
FT                   /protein_id="CBY86106.1"
FT                   /translation="MELVFIRHGFSEWNAKNLFTGWRDVNLTERGVEEAKAAGKKLLDK
FT                   GYEFDIAFTSVLTRAIKTCNIVLEESHQLWIPQVKNWRLNERHYGALQGLDKKATAEQY
FT                   GDEQVHIWRRSYDISPPDLDPQDPNSAHNDRRYANIPSDVVPNAENLKLTLERALPFWE
FT                   DQIAPAMLSGKRVLVVAHGNSLRALAKHIIGISDAEIMDFEIPTGQPLVLKLDDKLNYV
FT                   EHYYL"
FT   CDS_pept        380476..381705
FT                   /transl_table=11
FT                   /locus_tag="HICON_06440"
FT                   /product="membrane-bound metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86107"
FT                   /protein_id="CBY86107.1"
FT                   /translation="MLRFGVNQKTLLLTALLSCGLLIFSPVSQSSDLNQIQKQIKQQES
FT                   KIEKQKREQTKLQANLKKHESKINSVASELLETKISLKEIRKQIADADKQLKQLEKQER
FT                   EQKARLAKQIDIIYRSGINPSLIERMFAQDPTKAERMKVYYQHLNQVRIEMINNLKVTQ
FT                   AQIAVQKKAILSQQKNHRNQLSTHKKQQQALQKAQQEHQSTLNELNKNLALDQDKLNTL
FT                   KANEQALRQEIQRAEQAAREQEKREREALAQRQKAEEKRTSKPYQPTVQERQLLNSTSG
FT                   LGAAKKQYSLPVSGSILHTFGSIQAGEVRWKGMVIGASAGTPVKAIAAGRVILAGYLNG
FT                   YGYMVIVKHGETDLSLYGFNQAVSVKVGQLVSAGQVIAQVGNTGEISRSALYFGISRKG
FT                   TPVNPAGWVR"
FT   CDS_pept        381705..382547
FT                   /transl_table=11
FT                   /locus_tag="HICON_06450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86108"
FT                   /protein_id="CBY86108.1"
FT                   /translation="MNILIKSAVKNFIVFSTALYTSFSFAQSKLAIVIDDVGYHSKEDA
FT                   AIFAMPREISVAIIPAAPYARARNQEAKSQGRDILIHMPMQPISAIKIEDGGLHLGMSA
FT                   AQVNDRVNTAKSIVRDAIGMNNHMGSAATADPQLMTYLMTALQEKHLFFLDSRTIGKSV
FT                   AGKIAKEQGVRSLDRHIFLDDSNEFSDVQRQFKAAIHYARKHGSAIAIGHPRQNTIAVL
FT                   QAGLRNLPEDIQLVGMGNLWRNEKVIPPKPFILLFSEMPAPTSIEPFEPVGLLRGIPK"
FT   CDS_pept        complement(382608..383351)
FT                   /transl_table=11
FT                   /gene="lex2B"
FT                   /locus_tag="HICON_06460"
FT                   /product="UDP-glucose--lipooligosaccharide
FT                   glucosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86109"
FT                   /protein_id="CBY86109.1"
FT                   /translation="MFITPIFIINLEKSTDRKAYMQAQFEQLFSNNLIQEIHFFDAIYG
FT                   KSNPNHPLFQRYNENKRLNAKGYPLTLGQLGCYASHYSMWEKCVELDYPIIVLEDDAKF
FT                   KNNFLEVLDFINSDKNTFEFFWLQPDRLKNKRKLISNFGNLSIYQFSKGFAGATGYYLT
FT                   PQAARKFLTQSKEWYLTVDVTMDRFFENKVPPYAIVPFCLEDDGEIESTIYEKQKKRRS
FT                   LKIVIMRELFNLKTNIKRRIYNLFH"
FT   repeat_region   complement(383532..383655)
FT                   /note="GCAA x31"
FT   CDS_pept        complement(383918..387811)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06470"
FT                   /product="phosphoribosylformyl-glycineamide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86110"
FT                   /protein_id="CBY86110.1"
FT                   /translation="MTVKTFRGSPALSEFRLTQLQQKCQQYQLPIKSVYAEYLHFVEQK
FT                   TSLVEDEIVKLQALLHYGSMFSELKPAGYCLIVTPRVGTISSWSSKATDIAHNCGLSKV
FT                   NRIERGIAYYFNIERDLTEAELATLKDLLHDRMLETVLNHETEATLLFTQQEPKALTTI
FT                   DILNGGRQALERANIALGLALADDEMDYLVESFTALKRNPQDVELYMFAQANSEHCRHK
FT                   IFNADWIIDGKKQDKSLFKMIKNTFGQTPDFVLSAYKDNAAVMEGSKVGRWFPDPDGQY
FT                   RVHQEDVHILMKVETHNHPTAISPFPGAATGSGGEIRDEGATGRGAKPKAGLTGFSVSN
FT                   LVIPNFEQPWENPLSKPNRIASALDIMIDAPLGSAAFNNEFGRPALLGYFRTYEEKVNS
FT                   FAGKEVRGYHKPIMLAGGIGNIRGEQVQKGEIPIGAKLIVLGGAAMNIGLGGGAASSMD
FT                   SGKSKEDLDFASVQRENPEMERRCQEVIDRCWQLGEENPILFIHDVGAGGLSNAMPELV
FT                   HDGKRGGKFDLRSILCDEKGMSPLEIWCNESQERYVLAVAPENLELFTALCERERAPFA
FT                   VIGEATQAEHLILHDSHFDNNPIDLPMNVLLGKTPKMTREVLSKTVENQPLKTESIQLK
FT                   EAFHRVLRLPVVAEKTFLITIGDRSVTGMVARDQMVGPWQIPVSDVAVTTASLDSYHGE
FT                   AMAMGERSPVALLDFSASARLAVAEAITNIAGTLIGEMKRIKLSANWMSAAGHTGEDAG
FT                   LYEAVKAVGEELCPALGLTIPVGKDSMSMKTTWIDNGEKKSVTAPLSLVISAFARVEDV
FT                   RKTLTPQLRTDNGFSSLLLIDLGEGHNRLGATALAQVYKQLGDKPADVVKVQRLKDFYN
FT                   AMQILVAEDKLLAYHDRSDGGLITTLAEMAFAGHCGVEVDISALGDNDLAVLFNEELGA
FT                   VIQVADSQLESVREVLKAHNLLGITHQLGTVTADDRFEISRGSHKLFSEKRSELRSIWA
FT                   ELTYQMQRLRDNPECAEQEFEAKKNPDDKGLSAFLTYDVNEDITAPFINKGVKPTIAIL
FT                   REQGVNSHYEMAAAFDRAGFNAIDVHMSDLMIGRRNLAEFNAMVACGGFSYGDVLGAGG
FT                   GWAKSILFNPKLHEQFSQFFINPNTLTLGVCNGCQMISNLAEIIPGTENWPHFVRNKSE
FT                   RFEARVSLVKINEVDSVWFAGMAGSHMPIAVSHGEGQVKFKSVEQFAGLKAQGIIAAQY
FT                   IDNNGSPTELYPANPNGSAEGITAITNLDGRVAIMMPHPERVFRAVSNSWHPENWTEDG
FT                   AWMRLFRNARMVF"
FT   CDS_pept        388444..388941
FT                   /transl_table=11
FT                   /locus_tag="HICON_06480"
FT                   /product="lipid hydroperoxide peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86111"
FT                   /protein_id="CBY86111.1"
FT                   /translation="MTVTLAGNPIEVGGHFPQVGEIVENFILVGNDLADVALNDFAGKR
FT                   KVLNIFPSIDTGVCATSVRKFNQQAAKLSNTIVLCISADLPFAQARFCGAEGIENAKTV
FT                   STFRNHALHSQLGVDIQTGPLAGLTSRAVIVLDEQNNVLHSQLVEEIKEEPNYEAALAV
FT                   LA"
FT   CDS_pept        complement(389162..389986)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06490"
FT                   /product="diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86112"
FT                   /protein_id="CBY86112.1"
FT                   /translation="MQFSKMHGLGNDFVVVDGVTQNVFFTPETIRRLANRHCGIGFDQL
FT                   LIVEAPYDPELDFHYRIFNADGSEVSQCGNGARCFARFVTLKGLTNKKDISVSTQKGNM
FT                   VLTVKDDNQIRVNMGEPIWEPAKIPFTANKFEKNYILRTDIQTVLCGAVSMGNPHCVVQ
FT                   VDDIQTANVEQLGPLLESHERFPERVNAGFMQIINKEHIKLRVYERGAGETQACGSGAC
FT                   AAVAVGIMQGLLNNNVQVDLPGGSLMIEWNGVGHPLYMTGEATHIYDGFITL"
FT   CDS_pept        complement(390129..390752)
FT                   /transl_table=11
FT                   /gene="lexA"
FT                   /locus_tag="HICON_06500"
FT                   /product="LexA repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86113"
FT                   /protein_id="CBY86113.1"
FT                   /translation="MRPLTARQQEVLDLLKRHLETTGMPPTRAEISRELGFKSANAAEE
FT                   HLKALSRKGAIEIIPGASRGIRILDNSSNDEFDGLPLVGRVAAGEPILAEQHIEATYRV
FT                   DADMFKPQADFLLKVYGLSMKNVGILDGDLLAVHSTKDVRNGQIVVARIEDEVTVKRLE
FT                   KKGSIIYLHAENEEFDPIVVNLEEQKNFEIEGIAVGIIRNNAWM"
FT   CDS_pept        391007..393439
FT                   /transl_table=11
FT                   /locus_tag="HICON_06510"
FT                   /product="glycerol-3-phosphate O-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86114"
FT                   /protein_id="CBY86114.1"
FT                   /translation="MANFINMYRQLLSLPLSALVKNNPIPANPIEELSLNIHQPIVYVL
FT                   PYTSQTDFVIFRRNCLALGLSDPAEKNEINGVKLPRYVYLDEGRRIFKSKGAKDETTTI
FT                   FNKYLELHRASESLDVQLIPVSVLWGRSPGQEDKSDLPNLRLLNGIQKTFAAIWFGRDT
FT                   FVRFSQAVSLRYMVVEHGSDEKIAQKLARVAKMHFAKQRISATGPRLPNRQAMFNKLLQ
FT                   SEAIRRAIEDEAKSKNISIEKAQKEAYKILDEIAADVSHSSLRAVDRFLRWLWNKLYSG
FT                   IDVQNSNRVRKLALEGHEIVYVPCHRSHIDYLLLSYVLYHQGLVPPHIAAGINLNFWPI
FT                   GRMFRSWGAFFIRRTFKGNRLYSAIFREYLSELFHRGYSVEYFIEGGRSRTGRLLAPKT
FT                   GMMSMTLQALQHSQTRPISIVPVYVGYEHVLEVDTYAKELRGAAKEKENAGLVLRVIKK
FT                   LRNLGQGFVNFGEPITLSNYLSQHFPDWKEQNHEEKPQWFTPAVNNISKQVMININKAA
FT                   AVNSMNLVGTALLSSRQRALSREQLLEQLSSYQQLLQNVPYSTDVVLPNVTPQAMLEHV
FT                   LALDRIGVLIEKDNFGEIVRLERSSAVLMTYYRNNIQHLFVLPSLVASIILHYEAIQKD
FT                   LLLDAIRKIYPFLQGELFLHFNEDELNVQIHQIINEFARQSVINSNDNFLSINKSKVRI
FT                   LQLWSAGMREILQRYYITVTILQKQPAISRAELEKESQLVAQRLSVLHGINAPEFFDKA
FT                   VFSSFIANLKEQRYFDESGYTVLDKIEELASTLSHLISTEICLTVKGTIEKSEDLSS"
FT   CDS_pept        complement(393518..394852)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06520"
FT                   /product="NADH dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86115"
FT                   /protein_id="CBY86115.1"
FT                   /translation="MKNVVIVGGGAGGIELATFLGNKLGRQKQAKVTLVDRNATHLWKP
FT                   LLHEIATGVMDDGVDSLSYRAHGKNHFFSFEQGSIIRINREQKYVELAPVYGQEGDMLV
FT                   IARRIPYDYLVIAIGSKSNDFNTKGVADNCIFLDSSKQALRFQHKLLELFLKFSENRAL
FT                   DDIGEEEFKQKLVDENKVNIAIVGGGATGVELTAELYHAAEDLSSYGYGKIDSSCLQVT
FT                   LVEAGTRLLPALPENLSAAVLDELKEMGTNVQLNTMITEAQPNTLITKDGGEIKADLIV
FT                   WAAGVRASTVTQQFDGLEINRINQLVVKDTLQTTVDDSIFAIGDCAALIQSNGKLVPPR
FT                   AQAAHQMAKACAKNIFALFENKPLKSFKYNDKGTLVSLSNFTALGSLTNKFGKNPLTVQ
FT                   GKFAQFAYVSLYRMHQHALHGCIKIGLIILVDKLNRYLKPRLKLH"
FT   CDS_pept        complement(395056..396378)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06530"
FT                   /product="anaerobic C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86116"
FT                   /protein_id="CBY86116.1"
FT                   /translation="MSAMFLLQFAIVLLCIFVGARVGGIGLGVFGGLGIAILSFGFGLK
FT                   PAGLPIDVMFMIMAVVAAAAAMQAAGGLDYMIKIATKILRRNPKHITFIAPAVTWLFTL
FT                   LAGTGHVAYSVLPVIAEVSRQNGIRPERPMSMAVIASQFAIVASPIAAAVVAVVAYLEP
FT                   QGIHLGDVLMVTIPSTILGLFLACLFVNKMGKELKDDPEYQRRLNDPKYADIFASTTSV
FT                   KEVEVSKTAKISVSLFLFGALLVVLMGAAPSIRPVFDGKPMGMAHTIEIIMLSIGALII
FT                   LTCKPDGTAITKGSVFHAGMRAVIAIFGIAWLGDTLMQAHITEVKEMVKGLVETAPWAF
FT                   AFALFVLSVLVNSQGATVATLFPLGIALGIPAPVLIGVFVAVNGYFFIPNYGPIIASLD
FT                   FDTTGTTKIGKYILNHSFMLPGLLSMFFCLLIGLGLSHVIL"
FT   CDS_pept        396625..397071
FT                   /transl_table=11
FT                   /locus_tag="HICON_06540"
FT                   /product="predicted rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86117"
FT                   /protein_id="CBY86117.1"
FT                   /translation="MQEFISMATEFAQKHTLLAVSWFAIFVMVIYTFYKGATSKFKVIT
FT                   HNEVIRLINSDEAIVVDLRSLEEFQRGHIINSINVLPSEIKNQNIGKLESHKEKALILV
FT                   DTNGTSASASAVFLTKQGFNSVFVLKEGLSAWVAANLPLVKKHK"
FT   CDS_pept        397085..397594
FT                   /transl_table=11
FT                   /locus_tag="HICON_06550"
FT                   /product="protein-export protein SecB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86118"
FT                   /protein_id="CBY86118.1"
FT                   /translation="MSEQKQDVAATEEQQPVLQIQRIYVKDVSFEAPNLPHIFQQEWKP
FT                   KLGFDLSTETTQVGDDLYEVVLNISVETTLEDSGDVAFICEVKQAGVFTISGLEDVQMA
FT                   HCLTSQCPNMLFPYARELVSNLVNRGTFPALNLSPVNFDALFVEYMNRQQAENAEEKSE
FT                   EEQTKH"
FT   CDS_pept        complement(397661..398014)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06560"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86119"
FT                   /protein_id="CBY86119.1"
FT                   /translation="MPLSQILLMCHLLVAEQCCRICELRNGWYTENYTESVPTTLANNA
FT                   FYGSAENGKISSALRAELAEAAADYAVALVQAGLDEGFAGLIAQWDVDTSNGALTCCLQ
FT                   REWYLVIKNLHLS"
FT   CDS_pept        complement(398139..399791)
FT                   /transl_table=11
FT                   /gene="pgmB"
FT                   /locus_tag="HICON_06570"
FT                   /product="phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86120"
FT                   /protein_id="CBY86120.1"
FT                   /translation="MTTLFEVAQHWLNQDPDTETRAELTALLDAAKGGDKAAEAELHAR
FT                   FDGRLQFGTAGLRGRLQAGSMGMNRVLVSQAAGGLAEYLKGYDKEPSIVIGYDGRKNSD
FT                   VFARDTAEIMAGAGVKAYLLPRKLPTPVLAYAIQYFDTTAGVMVTASHNPPEDNGYKVY
FT                   LGKANGGGQIVSPADKDIAALIDKVAAGNIQDLPRSDNYVVLNDEVVDAYITKTASLAK
FT                   EPACDINYVYTAMHGVGYEVLSKTLAKAGLPQPHVVADQVWPDGTFPTVNFPNPEEKGA
FT                   LDLAIKVAKEKNAEFIIANDPDADRLAVAVPDAQGNWKSLHGNVVGCFLGWYLAKQYQG
FT                   EQGTLACSLVSSPALAEIAKKYGFQSEETLTGFKYIGKVSGLLFGFEEALGYLVDPDKV
FT                   RDKDGISAAIVFLDLVRNLKKQGKTLADYADEFTKEFGAYVSGQISIRVSDLSEIGKLM
FT                   TALRNNPPAEISGVKVAQFIDHIKTDRQSDILVFNLENGGRLIARPSGTEPKIKFYLDA
FT                   RGKDPKDADRVLAEFDEGVRHILRQDTYGKQDC"
FT   CDS_pept        400030..403509
FT                   /transl_table=11
FT                   /locus_tag="HICON_06580"
FT                   /product="DNA polymerase III alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86121"
FT                   /protein_id="CBY86121.1"
FT                   /translation="MSSQPRFVHLRTHTDFSMIDSIVKVKPLVKACAANEMVAMGLTDF
FT                   TNFCGVVRFYDEMLSSGMKPIIGADVKVKSPLCGDEYFDLTLLAKNNEGYRNITLLLSK
FT                   AYQRGYNDLPYIDQDWLIEHRDGVIILSGGTQGDVGKKLLKENVAEIESAVAFYQEFFA
FT                   DHFYLALSRTGRPNQERYIQAALKLAERCDLPLVATNDVMFLNAEDFEAHEIRVAIHDG
FT                   YTLDDPKRPKCYTSQQYFRSEEDMCKLFADIPSALENTLLIAQRCSVTLRLGQYFLPQF
FT                   PTGDLSTEDFLVQKSKEGLEERLAFLFPDEKVRLEKRPKYDERLQVELDVINQMGFPGY
FT                   FLIVMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEFDLLFERFLNPERVSM
FT                   PDFDVDFCMDGRDRVIEHVAETYGRGAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDR
FT                   ISKLIPPDPGMTLAKAFEAEPQLQTAYDSDEEVRALINMARKLEGVTRNAGKHAGGVVI
FT                   SPTLITDFAPLYCDNEGLHPVTHFDKNDVEYAGLVKFDFLGLRTLTIIKWALDMINVRM
FT                   VREGKPRVDIAAIPLDDPESFELLKRSETTAVFQLESRGMKDLIKRLQPDCFEDIIALV
FT                   ALFRPGPLQSGMVDNFIDRKHGREEVSYPDAEYQHASLKPILEPTYGIILYQEQVMQIA
FT                   QVLAGYTLGGADLLRRAMGKKKPEEMAKQRLVFKEGAEKNGIDGELSMKIFDLVEKFAG
FT                   YGFNKSHSAAYALVSYQTLWLKTHFPAEFMAAVMTSEMDNTDKIVGLYDECLRMGLKVT
FT                   PPDINIGKHHFSVNEQGEIVYGIGAIKGVGEGPIEALVTARNEGGIFKDLFDLCARVDL
FT                   KKINRRTFESLIMSGAFDKLGPHRAALSKNLEDALRASDQHAKDEAMGQTDMFGVLTET
FT                   HEDVENAYANTPPYTEKQILDGERETLGLYLSSHPVSRYLKELSHYTSTRLKDLAPNRR
FT                   GQISTVAGLVVASRIAMTKKGNRLGIATLDDRSGRLDLTLFGESLEQFGEKLQKDTVIV
FT                   ASGQVSFDDFSGGLKMTVRELMTLDEARSRYVKSLAISLSEHQITPSFIKQFKALLEPV
FT                   SGGTLPINVYYQSPKGRALLRLGVQWSIIPTDEILTELVNLLGESAVELEFE"
FT   CDS_pept        complement(403548..405089)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06590"
FT                   /product="threonine dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86122"
FT                   /protein_id="CBY86122.1"
FT                   /translation="MKNLLTNPQPSQSDYINAIVKLGSRVYEAAQVTPLQKMGKLSERL
FT                   HNNIWIKREDRQPVNSFKLRGAYAMISSLSAEQKAAGVIAASAGNHAQGVALSAKQLGL
FT                   KALIVMPQNTPSIKVDAVRGFGGEVLLHGANFDEAKAKAIELSKEKNMTFIPPFDHPLV
FT                   IAGQGTLAMEMLQQVVDLDYVFVQVGGGGLAAGVAILLKQFMPEIKIIGVESKDSACLK
FT                   AALDKGEPTDLTHVGLFADGVAVKRIGDETFRLCQQYLDDMVLVDSDEVCAAMKDLFEN
FT                   VRAVAEPSGALGLAGLKKYVKQNHIEGKNMAAILSGANLNFHTLRYVSERCEIGENREA
FT                   LLAVTMPEQPGSFLKFAYVLGNRAVTEFSYRYADDKRACVFVGVRTTNEQEKADIIADL
FT                   TKNGFDVEDMSDDDIAKTHVRYLMGGRAANDNERLYTFEFPEQKGALLKFLETLQNRWN
FT                   ISLFHYRAHGADYGNILAGFQIEEREQAEFEQALAQLNYVFEDVTESKSYRYFLR"
FT   CDS_pept        complement(405168..407006)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06600"
FT                   /product="dihydroxyacid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86123"
FT                   /protein_id="CBY86123.1"
FT                   /translation="MPKLRSATSTQGRNMAGARALWRATGMKENDFGKPIIAVVNSFTQ
FT                   FVPGHVHLKDMGQLVATEIEKAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRDLIADSV
FT                   EYMVNAHCADAMVCISNCDKITPGMLMAAMRLNIPTIFVSGGPMEAGKTKLSDQLIRLD
FT                   LVDAMIEAADPNISDERIDAIERSACPTCGSCSGMFTANSMNCLTEALGLSLPGNGSML
FT                   ATHADRKELFLKAGRQIVELCKRYYEQDDASVLPRSIGTFDAFENAMSLDIAMGGSSNT
FT                   VLHLLAAAQEAGVDFKMEDIDRLSRKVPCLSKIAPNTNKYHMEDVHRAGGIMGLLGELD
FT                   RAGLIHKNTHTVLGMSMGEQLDQYDIIRNQDEELHKFFRAGPAGIRTTQAFSQDCRWDT
FT                   VDNDRINGCIRNKKNAISQEGGLAVLFGNLAEDGCIVKTAGVDESIWKFTGTAIVFESQ
FT                   EDAVAGILDGKVKEGHVVVIRYEGPKGGPGMQEMLYPTSYLKSMGLGKKCALLTDGRFS
FT                   GGTSGLSIGHASPEAASGGAIGLVRDGDIINIDIPNRAINLEISNEELATRRAEQDQKG
FT                   WQPAHREREVSFALKVFGHFATSADKGAVRDKTLLK"
FT   CDS_pept        complement(407048..407716)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06610"
FT                   /product="acetolactate synthase isozyme II large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86124"
FT                   /protein_id="CBY86124.1"
FT                   /translation="MTGAQLIMACLKAHHVTTLFGYPGGAIMPTYDDLYDAGLDHLLCR
FT                   NEQGAAMAAIGYARSTGKMGVCIATSGPGATNLVTGLGDAMMDSIPVVAITGQVASPLI
FT                   GTDAIEPWREQIRDLKAKLDFTYIENQGNRPIDPWALLNSLSNRKPNNAVICTDVGQHK
FT                   MWSAQHMLRVARHCGFTVTTMEMTLIETQVRLKITVKSDRTLDLLVNQLVKLPDVLMVN
FT                   "
FT   CDS_pept        407962..409488
FT                   /transl_table=11
FT                   /locus_tag="HICON_06620"
FT                   /product="conserved hypothetical sodium-dependent
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86125"
FT                   /protein_id="CBY86125.1"
FT                   /translation="MANSAQKAQKRETFSGRRAFILAAIGSAVGLGNIWRFPYTTYENG
FT                   GGAFIIPYLIALLTAGIPLLFLDYAIGHRHRGGAPLSYRRVSPHFEVFGWWQMMVNVII
FT                   GLYYAVVLGWAASYTYFSFTGAWGDKPIDFFIGEFLKMGDIKNGISFEFVGMVTAPLIA
FT                   MWIVALGVLSMGVQKGIAKVSSVLMPVLVVMFMVIVIYSLFLPGAAKGLDALFTPDWSK
FT                   LSNPSVWIAAYGQIFFSLSIGFGIMVTYASYLKKESDLTGSGLVVGFANSSFEVLAGIG
FT                   VFAALGFIATAQGQEVSEVAKGGIGLAFFAFPTIINKAPFGEVLGMLFFGSLTFAALTS
FT                   FISVIEVIISAIQDKIRISRGKVTFIVGVPMMLVSVILFGTTTGLPMLDVFDKFVNYFG
FT                   IVAVAFASLIAIVANEKLGLLGNHLNETSSFKVGFFWRLCIVLTSGVLAFMLFSEGAKV
FT                   FSEGYEGYPNWFVNTFGWGMSISLLVVAFFLSRLKWKSETKLTIDETKGE"
FT   CDS_pept        complement(409718..410431)
FT                   /transl_table=11
FT                   /gene="lpxH"
FT                   /locus_tag="HICON_06630"
FT                   /product="UDP-2,3-diacylglucosamine pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86126"
FT                   /protein_id="CBY86126.1"
FT                   /translation="MKHSYFISDLHLSETQPELTALFVDFMQNLAPQAERLYILGDLFD
FT                   FWIGDDEQSTLIQQVKDLIKSVSEQGVQCYFQHGNRDFLIGERFSKETGAQLLPDYQLI
FT                   TLYDKKILLCHGDTLCIDDVAYQQFRRRVHQKWLQRLFLCLPLKVRVIIAEKIRAKSNQ
FT                   DKQAKSQEIMDVNQAFTAEKVQEFGVNLLIHGHTHREAIHQQEEFTRIVLGDWRKNYAS
FT                   ILKMDESGEFGFIKD"
FT   CDS_pept        410517..411239
FT                   /transl_table=11
FT                   /locus_tag="HICON_06640"
FT                   /product="1-acyl-sn-glycerol-3-phosphate acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86127"
FT                   /protein_id="CBY86127.1"
FT                   /translation="MLKLLRIFLVLICCILICILGTIYSFIRFKNPSNVGIVARWFGRL
FT                   YPLFGLKVEHRIPQDQKQISRAIYIGNHQNNYDMVTISYMVQPRTVSVGKKSLIWIPFF
FT                   GILYWVTGNIFLDRENRTKAHNTMSQLARRINEDNLSIWMFPEGTRNRGRGLLPFKTGA
FT                   FHAAISAGVPIIPVVCSTTHNKINLNRWDNGKVICEIMDPIDVSGYTKDNVRDLAAYCH
FT                   DLMEKRIAELDEEIAKGN"
FT   CDS_pept        411241..412650
FT                   /transl_table=11
FT                   /locus_tag="HICON_06650"
FT                   /product="SufI"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86128"
FT                   /protein_id="CBY86128.1"
FT                   /translation="MPRLSRRQLLKTAAISTALSIVPAPLLAASREKLVVPPLIEVRRG
FT                   RPIVLTMQETNYPLDGSHNVTVWGFNGNYLGPTIKIKSGSFAKLNYHNNLPQSVALSIQ
FT                   GLQASGELFGGAARVLKKGESWAPIVPIEQPAASCWYRSATLANSAYQTYRGLAGMWLI
FT                   EDEQSLKANLPNKYGVDDIPLILQDMEFNNDGLQLFKQNQPHFVGNRLLVNGIEAPYLD
FT                   VARGWIRLRLLNASLARAYDLRLDNDQEMLLIAQDLSFLPKAKSVKSLVLSPGERAEIL
FT                   VNMNEIDNVSLISGSKRSLYEKIKNMLFSGDELANNTVLELRAKGEMSAFNKQPNLTFE
FT                   TDAPAILQQAVAQTREFNIDVTNGLINQRRFDPRKVDVMARKGTIERWILNASLPVGFT
FT                   IQGAKFVVESQGEHQLQAEELAWKDTVWVKNKTQILVKFDQASSGNYPFLFGVSNLMLE
FT                   DMGCLGVLMVQ"
FT   CDS_pept        412770..415118
FT                   /transl_table=11
FT                   /locus_tag="HICON_06660"
FT                   /product="LPS-assembly protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86129"
FT                   /protein_id="CBY86129.1"
FT                   /translation="MNKKHTLISLAILTALYSQPSLADLHEQCLMGVPKFSGEVVTGDV
FT                   NSLPVYIEADNAEINQPNDATYQGNVDLKQGNRHLLAQSVQVKQSGNQSTPLRMAYVRN
FT                   GFDYKDNQINMLGKDAEFNLDSHDGNLTNSEYEFVGRQGRGKADNIKLHNNYRVMKNAT
FT                   FTSCLHGDNAWAVDASEIRQYVKEEYAEMWHARFKIHGVPVFYTPYLQLPIGDRRRSGL
FT                   LIPSAGTSNRDGLWYAQPIYWNIAPNYDLTFTPKYMSRRGWQANGEFRYLTSIGEGKVA
FT                   GEYLGKDRYSEYASDNRKRHLFYWNHNSSFLQNWRLNINYTRVSDKRYFNDFDSIYGRS
FT                   TDGYANQYARIAYYQPNYNFSLSAHQFQIFDDIVNIGPYRAVPQLDFNYHKYDLANGWL
FT                   NFKLHSQAVRFDNDSKLMPTAWRFHAEPSLNSLMSNKYGSLNIETKLYATRYEQKKGSG
FT                   KNAEDVQKTVNRVIPQFKVDLQSVLARDITFLKEYTQTFEPHVQYLYRPYRNQSNIGST
FT                   LNNDYLGFGYDSALVQQDYYSLFRDRRYSGLDRISSANQVTLGGTTRFYDIAGEERFNL
FT                   SAGQIYYLNNSRIDENPANKTPTSSSAWALESNWKISNKWYWRGSYQFDTHTNSTSLAN
FT                   TSLEYNPEKNNLIQLNYRYVNQEYIDQNLGKSANAYQQDIQQVGLVVGWEIANNWAVVG
FT                   RYYQDLALQKPVEQYLGVQYNSCCWAASVGVKRNVTNHQNQTRNEIVYDNSIGITLELR
FT                   GLGSNDHQSGIQEMLEKGKLPYIRAFSLD"
FT   CDS_pept        complement(415206..416924)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06670"
FT                   /product="prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86130"
FT                   /protein_id="CBY86130.1"
FT                   /translation="MRTSQYLFSTLKETPNDAQVVSHQLMLRAGMIRPMASGLYNWLPT
FT                   GIRVLKKVEKVVREEMNKGGAIEVLMPVVQPAELWEESGRWDQYGPELLRFEDRGNRNF
FT                   VLGPTHEEVITDLVRREVSSYKQLPLNLYQIQTKFRDEVRPRFGVMRSREFIMKDAYSF
FT                   HTTQESLQATYDVMYQVYSNIFNRLGLDFRAVQADTGSIGGSASHEFQVLASSGEDDVV
FT                   FSTESDFAANIELAEAIAIGERQAPTAEMCLVDTPNVKTIAELVEQFNLPIEKTVKTLI
FT                   VKGADENQPLVALIIRGDHELNEIKAQKHPLVADPLEFADETEIKAKIGAGVGSLGAVN
FT                   LNIPAIIDRTVALMSDFSCGANINGKHYFNVNWERDVAMPEVFDLRNVVEGDPSPDGKG
FT                   TLQIKRGIEVGHIFQLGKKYSEAMKATVQGEDGKPLVMTMGCYGIGVTRVVASAIEQHH
FT                   DDRGIIWPSDEIAPFTVAIVPMNMHKSEAVQKYAEELYRTLQSQGVDVIFDDRKERPGV
FT                   MFADMELVGVPHMVVIGEKNLDNGEIEYKNRRTGEKEMISKDKLLSVLNEKLGNL"
FT   CDS_pept        complement(417009..418868)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06680"
FT                   /product="ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86131"
FT                   /protein_id="CBY86131.1"
FT                   /translation="MLDSPLPSKIIEKPTALSVLKSVFGYQSFRKGQEEVINAALNGQD
FT                   ALVVMATGNGKSLCYQIPALCFDGLTLVISPLISLMKDQVDQLQANGIEADFLNSSQTL
FT                   EQQQQVQNKLISGQLKLLYVSPEKVMTNSFFQLISYSKVCFIAIDEAHCISQWGHDFRP
FT                   EYTQLGGLKASFPDAPIMALTATADYATQQDILRHLNLKNLHKYIGSFDRPNIRYTLEE
FT                   KYKPMEQLTRFVLAQKGKSGIIYCNSRNKVERIAESLRNKGVSAAAYHAGMETAIRERV
FT                   QQDFQRDNVQVVVATIAFGMGINKSNVRFVAHFDLPRSIESYYQETGRAGRDDLPAEAV
FT                   LFYEPADYAWLQKILFEKPETPQRQIEQHKLEAIGEFAESQTCRRLVLLNYFGEHRQTP
FT                   CNNCDICLDPPKKYDGLVDAQKVMSTIYRVGQCFGAHYVIAMLRGMHNQKIIERQHHKL
FT                   SVYGIGKDKSKEHWQSVIRQLIHLGFVQQVISELNPTLQLTESAKVILKGEEPLELAMP
FT                   RISAISKIAHNPQRQGVANYDKDLFARLRFLRKQIADKENIPPYIVFNDATLQEMAQYM
FT                   PTSNIEMLQINGVGSIKLERFGQPFMALIQEHKAILANAQNND"
FT   CDS_pept        complement(418870..419175)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06690"
FT                   /product="frataxin, iron-binding and oxidizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86132"
FT                   /protein_id="CBY86132.1"
FT                   /translation="MNIAEFHQNIEQVWQKIEEELENQGADVDCETQGSVFTITFDNRT
FT                   QIVINKQEPLLELWIASKLGGFHFAFKNGDWVSNDGQRFWDCFVEACAAHGENVQF"
FT   CDS_pept        419436..420683
FT                   /transl_table=11
FT                   /locus_tag="HICON_06700"
FT                   /product="diaminopimelate decarboxylase, PLP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86133"
FT                   /protein_id="CBY86133.1"
FT                   /translation="MNFFQYKHNKLYAEDIPIQQLAEQFGTPLYVYSRATLERHWHAFD
FT                   SAFGKRPHLICFAVKSCSNIGVLNIMAKLGSGFDIVSQGELERVLAAGGDASKVVFSGV
FT                   AKSREEIMRALEVGIRCFNVESVSELKHINQIAGEMGKIAPISLRVNPDVDAHTHPYIS
FT                   TGLKENKFGVSVNEAREVYKLASTLPNIKITGMDCHIGSQLTELQPFLDATDRLIVLME
FT                   QLKEDGITLKHLDLGGGLGVTYTDETPPHPSDYANALLEKLKNYPELEIILEPGRAISA
FT                   NAGILVAKVQYLKSNESRNFAITDTGMNDMIRPALYEAYMNIVEIDRTLEREKAIYDVV
FT                   GPVCETSDFLGKQRELSIAEGDYIAQCSAGAYGASMSSNYNSRARTAEVLVDGDQSYLI
FT                   RRRETLQELWALESTI"
FT   CDS_pept        420889..421515
FT                   /transl_table=11
FT                   /locus_tag="HICON_06710"
FT                   /product="nitrate/nitrite response regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86134"
FT                   /protein_id="CBY86134.1"
FT                   /translation="MQDKLKVLLIDDHPLMRRGIKQLVELDDNFEVVADVSSGTEGISV
FT                   ALQTSPDVIILDLNMKGLSGLDTLKGLRAEGVDARILILTVSDAKNDIYTLIDAGADGY
FT                   LLKDTEPDTLLEQIKRIAQGEVILSDSIKNLLLERTHEDNPLDSLTDREMGVLRQIATG
FT                   LSNKQIAAQLFISEETVKVHIRNLLRKLNVHSRVAATVLFFEQNR"
FT   CDS_pept        complement(421606..422016)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86135"
FT                   /protein_id="CBY86135.1"
FT                   /translation="MIWIFFVIALFLVTGLTLYAIRLLKQLKVQKELIAKAKNNRVIRL
FT                   KESIDIIARAMQSGECNLSEGVIRFTMLLRPFGKNLSSYPAMANLYEVVRDMPTHDDRK
FT                   LLEKRERMRLDLARESAEAQFEKILNKNCIFY"
FT   CDS_pept        complement(422020..422580)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86136"
FT                   /protein_id="CBY86136.1"
FT                   /translation="MARKKKTRRITDIMPIRKADKKIDIIKARSGKKLTRYELDAKARE
FT                   DKKKRKHKGLASGSRHSAVEEKANKLQNEIKDPKIGSKKKIPLVVEFVNKPEKGQVIPV
FT                   IKQVKKQDPMKELENLENNEILNELLDALDAGKTISKSDQQFVDECLDRISELMEELGI
FT                   EDEDESEDDLYRTFERMDINQFR"
FT   CDS_pept        complement(422694..422972)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86137"
FT                   /protein_id="CBY86137.1"
FT                   /translation="MEGDKFIAVTYNNGDIKFVSSYAPSDRFSLRKLNKLNSDSRLGKY
FT                   ILNDDGGMRIEVTIRSNNKGLTIAQIIQGVKDIKLLDRYAINEFSDK"
FT   tRNA            complement(427101..427173)
FT                   /product="transfer RNA-Glu"
FT                   /anticodon="(pos:427137..427139,aa:Glu)"
FT   CDS_pept        complement(429184..429738)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06750"
FT                   /product="D,D-heptose 1,7-bisphosphate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86138"
FT                   /protein_id="CBY86138.1"
FT                   /translation="MNKAIFLDRDGTLNIDYGYVHEIDNFKFIDGAIDALRELKKMGYM
FT                   LVLVTNQSGIARGYFSEDQFLQLTEWMDWSLAEQDVDLDGIYYCPHHPEGKGEYKEDCD
FT                   CRKPKSGMLLQAIKELKIDPTQSIMVGDKVEDLKAGTGAKVKMNVLVRTGKPVTGEGEG
FT                   IADYVLDSIVDLPRILKRLKK"
FT   CDS_pept        429914..430951
FT                   /transl_table=11
FT                   /locus_tag="HICON_06760"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86139"
FT                   /protein_id="CBY86139.1"
FT                   /translation="MIKLNNITKIFELPNKKLTALDNVSLNIEKGQICGVIGASGAGKS
FT                   TLIRCVNLLEKPTSGSVIVDGVELTKLSDRELVLARRQIGMIFQHFNLLSSRTVFENVT
FT                   LPLELESESKAKIQEKITALLDLVGLSEKRDAYPSNLSGGQKQRVAIARALASDPKVLL
FT                   CDEATSALDPATTQSILQLLKEINRTLGITILLITHEMEVVKQICDQVAVIDQGRLVEQ
FT                   GTVGEIFANPKTELAQEFIRSTFHISLPDEYLENLTDTPKHSKAYPIIKFEFTGRSVDA
FT                   PLLSQASKKFGVELSILTSQIDYAGGVKFGYTIAEVEGDEDAITQTKVYLMENNVRVEV
FT                   LGYVQ"
FT   CDS_pept        430941..431630
FT                   /transl_table=11
FT                   /locus_tag="HICON_06770"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86140"
FT                   /protein_id="CBY86140.1"
FT                   /translation="MFNDFLATFSQQLTPQMWGVVATATYETVYISFASTLLSVLVGVP
FT                   VGVWTFLTGKNEILQNNRTHFVLNTIINIGRSIPFIILLLILLPVTRFIVGTVLGTTAA
FT                   IIPLSICAMPFVARLTANALMEIPNGLTEAAQAMGATKWQIVRKFYLSEALPTLINGVT
FT                   LTLVTLVGYSAMAGTQGGGGLGSLAINYGVYRNMPYVTWVATIIIVLFVMISQKLGDTL
FT                   ARKVDHR"
FT   CDS_pept        431669..432490
FT                   /transl_table=11
FT                   /locus_tag="HICON_06780"
FT                   /product="DL-methionine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86141"
FT                   /protein_id="CBY86141.1"
FT                   /translation="MKLKQLFAITAIASALVLTGCKEDKKPEAAAAPLKIKVGVMSGPE
FT                   HQVAEIAAKVAKEKYGLDVQFVEFNDYALPNEAVSKGDLDANAMQHKPYLDEDAKAKNL
FT                   NNLVIVGNTFVYPLAGYSKKIKNVNELQDGAKVVVPNDPTNRGRALILLEKQGLIKLKD
FT                   ANNLLSTVLDIVENPKKLNITEVDTSVAARALDDVDLAVVNNTYAGQVGLNAQDDGVFV
FT                   EDKDSPYVNIIVSRTDNKDSKAVQDFVKSYQTEEVYQEAQKHFKDGVVKGW"
FT   CDS_pept        complement(432792..433559)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06790"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86142"
FT                   /protein_id="CBY86142.1"
FT                   /translation="MKQSLRHQKIIKLVGQSGYLSTEELVAALDVSPQTIRRDLNILAE
FT                   LDLIRRHHGGAASPSSAENSDYVDRKKFFSLQKNNIAQEVAKLIPNGASLFIDIGTTPE
FT                   AVANALLGHEKLRIVTNNLNAAHLLRQNESFDIVMAGGSLRMDGGIIGEATVNFISQFR
FT                   LDFGILGISAIDADGSLLDYDYHEVQVKRAIIESSRQTLLVTDHSKFSRQAIVRLGELS
FT                   DVEYLFTDDVPEGIVNYLKAQKTKLVLCNGKVR"
FT   CDS_pept        complement(433589..434167)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06800"
FT                   /product="GlpG peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86143"
FT                   /protein_id="CBY86143.1"
FT                   /translation="MKNFLAQQGKITLILTALCVLIYLAQQLGFEDDIMYLMHYPAYEE
FT                   QDSEVWRYISHTLVHLSNFHILFNLSWFFIFGGMIERTFGSVKLLILYVVASGITGYVQ
FT                   NYVSDPAFFGLSGVVYAVLGYVFIRDKLNHHLFDLPEGFFTMLLVGIALGFISPLFGVE
FT                   MGNAAHISGLIVGLIWGFIDSKLRKNSLE"
FT   CDS_pept        complement(434194..434853)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06810"
FT                   /product="ribosomal large subunit pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86144"
FT                   /protein_id="CBY86144.1"
FT                   /translation="MALIEYNPPLEPYLDIIYQDNHLCVVNKPSGLLSVPGNQPQYYDS
FT                   VMSRVKEKFGFCEPAHRLDMATSGIIVFALSKAADRELKRQFREREPEKHYQAIVWGHL
FT                   ENDYGEVNLPMICDWENRPRQRLDFVLGKRAVTKFEVLARLPNNSTRVKLTPVTGRSHQ
FT                   LRLHMLALGHPILGDKFYSHPQAKAMSPRLCLHAEELTITHPITGETMTFNAKSDF"
FT   CDS_pept        complement(434856..437627)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06820"
FT                   /product="RNA polymerase-associated helicase protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86145"
FT                   /protein_id="CBY86145.1"
FT                   /translation="MPFAIGQRWLSESENALGLGVITALDQRTVTIYFPAADETRIYAM
FT                   AQAPLSRIVFSKGETLSHQAGWQGEILEVQNMNGLLFYLVKNPQDEDVIVQERDISPII
FT                   SFSQAKDRLFSAQIDRSTHFALRYRTLCHQQAQFKSPLRGLRGTRAGLIPHQLHIAAEV
FT                   GNRVNPRVLLADEVGLGKTIEAGMILQNQLFAEKVQRVLIIVPETLQHQWLVEMLRRFN
FT                   LHFSLFDEERCNDFDLDAVNPFTTESLIICSLNWLETHPNRVEQALDAQFDCLIVDEAH
FT                   HLVWSETSPSTAYLLVEQLARIIPSVLLLTATPEQLGQESHFARLRLLDPERFFDYQTF
FT                   VKEQERYQPVVNAVESLLANKALSAVEKNHISDLLLEQDVEPLFKAIASNNDEEQQRAR
FT                   QELIQALIDRHGTGRMLFRNTRQGVKGFPHRVYHQITLSEENDKIDWLIDFLKLHRDEK
FT                   IFVICQTAATAIQLEQILREREAIRAAVFHEKMSIIERDRAAAYFADLENGAQVLLSSS
FT                   IGSEGRNFQFAANLVLFDLPTNPDLLEQCIGRLDRIGQKRDVQIYMPCAKDSPQSRLAR
FT                   WYNEGLNAFEQTCPMGMALFSQFADELEKVRSNSTALSENEFSELLKQTKTAREKLKIE
FT                   LEKGRDRLLELNSHGGEQAQALADQIADEDNSPELVNFALKLFDIIGVEQEDLGANSIV
FT                   ISPTGTMLVPDFPGLKEEGVTVTFDRELALAREEMEFLTWDHPMIRQGIDLVASGDIGK
FT                   AAMALLVNKQLPAGTLLIELIYVVESQSPKGLQLNRFLPPTPIRLLLDNKGNDIGEQVA
FT                   FETLHSKLKPLGKNIANQMVKMARANIEALITRGDQLVKSLAEPIIFEAKNQAEQQLSA
FT                   EINRLQALRAVNKNIRQSEIDILEQQRTQSLDELSKANWRLDCLRVIVTNKE"
FT   CDS_pept        437822..438571
FT                   /transl_table=11
FT                   /locus_tag="HICON_06830"
FT                   /product="DNA-binding transcriptional activator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86146"
FT                   /protein_id="CBY86146.1"
FT                   /translation="MNYRDELILQWVNQQGKASVIELAQHCDISVETIRRDLNKLANKG
FT                   LLHRTHGGAVSNKTKDLGSFFQTRKHINATAKRHIAQKALDLLYENAVIGLDASSTSWY
FT                   FAYLMPDIPCTVVTNSMFNINALVNKSNVKTIVTGGVYSAKYEAFYGPLSEYLLQRLHI
FT                   NFSVFSCSGIDKNGNIWESNELNASLKRKMMEASERAYLLIDSSKFEKTSLIQLADLSK
FT                   INTIFSDRSLPDNLQKYCEQHDIMTVL"
FT   CDS_pept        438801..440570
FT                   /transl_table=11
FT                   /locus_tag="HICON_06840"
FT                   /product="L-fucose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86147"
FT                   /protein_id="CBY86147.1"
FT                   /translation="MALATQSNRIKIGIRPTIDGRRMGVRESLETQTIRMAQSVAQLLQ
FT                   THIRHTDGTFVECVVADSTIGGVAEAAACADKFKRENVGLTITVTPCWCYGSETIDMDP
FT                   HMPKAIWGFNGTERPGAVYLAAALAGHSQLGLPAFSIYGTEVQEADDTNIPEDVKEKLL
FT                   RFARAGLAVASIRGKSYLSIGSVSMGIAGSIVNQAFFQEYLGMRNEYVDMMEIKRRLDR
FT                   KIYDQEEVDLALSWVKQYCKEGVDVNSLENQLNAEERAELWENVVKMTIITRDLMVGNP
FT                   KLATLNYAEEALGHNAIAAGFQGQRHWTDHLPNGDFMEAMLNSTYDWNGVRPPYILATE
FT                   NDSLNAIGMLFGHQLTGKAQIFADVRTYWSQDSVERVTGWRPESGFIHLINSGSAALDG
FT                   TGEHQDAQGNPTLKPAWDVTEEEAKRCLENTRWCPAVHEYFRGGGLSSQFLTKGGIPFT
FT                   MHRINLIKGLGPVLQIAEGWSIDLPQDVHNKLNQRTNETWPTTWFVPRLTGKGAFTDVY
FT                   SVMANWGANHCVATHGHVGADLITLASMLRIPVCMHNVSEKNIFRPSAWNGFGQDKEGQ
FT                   DYRACQNFGPLYK"
FT   CDS_pept        440643..442055
FT                   /transl_table=11
FT                   /locus_tag="HICON_06850"
FT                   /product="L-fuculokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86148"
FT                   /protein_id="CBY86148.1"
FT                   /translation="MAIALIFDCGATNLRTIAINEKGQILASHHLANNTKQGMESSDYH
FT                   IWDIEEIWQKLTSCATQTFNQLMQQGIDLKDIVGISVTTFGVDGAPFDENDQQLYPIIS
FT                   WKCPRTIPVMENLSNQSDIKSLYQRNGIGQYSFNTLFKLHWLKTHRPDVFQKMAKFVFI
FT                   SSMLTQRLTSQFTTDHTMAGTSMMTNLTSGNWDPSILASLGLSNNHFPPMRYAGEKVGK
FT                   LRTPLAQKWGLNPVPVISCGHDTQFAVFGSGAGLNQPVLSSGTWEILMARTQHAEPRFE
FT                   FVSQGLTTEFDAQSNCFNPAVQWVGSGVIEWLGKLLFSDVYGSDHYYTTMIKEGEKAFN
FT                   AGKRAVNFEGIFSQLGQGNISGLSMFATRGEIYVSALQHMANQLKNGLSVLHQVSQFQA
FT                   KSLICVGGGSKNVLWNQIRANTLNLPIDVVDISESTVLGAAMFTFAGVGIYENVNAAQQ
FT                   AMQPTRKRIYPN"
FT   CDS_pept        442069..442503
FT                   /transl_table=11
FT                   /locus_tag="HICON_06860"
FT                   /product="L-fucose mutarotase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86149"
FT                   /protein_id="CBY86149.1"
FT                   /translation="MLKGIHPALSPELLKTLAEMGHGDEIVLADAHFPAHSLHKNVIRA
FT                   DGISIDILLEAITPLFEFDAYVDAPLLMMKAVEGDSLDPNVETRYLNAIESAVGFTPNL
FT                   TCLERFDFYTRAKQAYAVVVSGEIAKYGNIIIKKGVTPIL"
FT   CDS_pept        442523..443173
FT                   /transl_table=11
FT                   /locus_tag="HICON_06870"
FT                   /product="L-fuculose-1-phosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86150"
FT                   /protein_id="CBY86150.1"
FT                   /translation="MNRAELSQKIIDTCLEMTKLGLNQGTAGNVSVRYKDGMLITPTGM
FT                   PYHLMKTENIVYVDGNGKHEENKLPSSEWQFHLSVYHTRPEANAVVHNHSIHCAGLSIL
FT                   EKPIPAIHYMVAVSGTDHIPCIPYATFGSHELASYVATGIKESKAILLAHHGLITCGEN
FT                   LDKALWLAQEVEVLASWYLKLLSTGLEIPLLSKEQMQVVLGKFHTYGLRIEES"
FT   CDS_pept        443212..444498
FT                   /transl_table=11
FT                   /locus_tag="HICON_06880"
FT                   /product="L-fucose transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86151"
FT                   /protein_id="CBY86151.1"
FT                   /translation="MNAKVLEKKFIVPFVLITSLFALWGFANDITNPMVAVFQTVMEIP
FT                   ASEAALVQLAFYGGYGTMAIPAALFASRYSYKAGILLGLALYAIGAFLFWPAAQYEIFN
FT                   FFLVSLYILTFGLAFLETTANPYILAMGDPQTATRRLNFAQSFNPLGSITGMFVASQLV
FT                   LTNLESDKRDAAGNLIFHTLSEAEKMSIRTHDLAEIRDPYIALGFVVVAVFIIIGLKKM
FT                   PAVKIEESGQISFKTAVSRLAQKAKYREGVIAQAFYVGVQIMCWTFIVQYAERLGFTKA
FT                   EGQNFNIIAMAIFISSRFISTALMKYLKAEFMLMLFAIGGFLSILGVIFIDGVWGLYCL
FT                   ILTSGFMSLMFPTIYGIALYGLKEESTLGAAGLVMAIVGGALMPPLQGMIIDQGEVMGL
FT                   PAVNFSFILPLICFVVIAIYGFRAWKILK"
FT   tRNA            complement(444647..444720)
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:444684..444686,aa:Arg)"
FT   tRNA            complement(444771..444844)
FT                   /product="transfer RNA-Pro"
FT                   /anticodon="(pos:444808..444810,aa:Pro)"
FT   CDS_pept        445026..445874
FT                   /transl_table=11
FT                   /locus_tag="HICON_06890"
FT                   /product="bifunctional 5,10-methylene-tetrahydrofolate
FT                   dehydrogenase/5,10-methylene-tetrahydrofolate
FT                   cyclohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86152"
FT                   /protein_id="CBY86152.1"
FT                   /translation="MAAKIISGTELSKQIKANLADKITHYIEQGKRAPGLAVILVGADP
FT                   ASQIYVGNKRKSCEEVGILSKSYDLPETTTQNELLAIIDQLNADKNIDGILVQLPLPKQ
FT                   INAEAIIERIDPKKDVDGFHPYNVGRLCQRIPTLRACTPYGVMKLLETTGIDLHGKHAV
FT                   IVGASNIVGRPMSLELLLAGATVTVTHRFTKNLENHVRQADILVVAVGKPNLISGDWIK
FT                   ESAVVIDVGINRVDGKLVGDVEFDKAAEKAAYITPVPGGVGPMTVAMLMSNTLYAYEHN
FT                   K"
FT   CDS_pept        complement(446012..447397)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06900"
FT                   /product="Sodium/sulfate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86153"
FT                   /protein_id="CBY86153.1"
FT                   /translation="MGEMASLKSHKNGIIFILDIVLFFVLLNVLPFEPKANSGLALLAF
FT                   IAVLWLSEALHVTITALLVPLLAVALGLVSTKQALVGFADPTIFLFFGGFSLATALHIQ
FT                   KLDKLIANKIMALARGNLFIAVIYLFLITAFLSMWMSNTATAAMMLPLAMGILSQLDRK
FT                   KDHNTYVFVLLGIAYSASIGGMGTLVGSPPNAIVASNLNLTFSDWLWYGLPIMIILLPL
FT                   MIGILYIIFKPKLHLNFEQTFENIEMNPMRILTFIIFSVIALTWIFSGKINPFISGLLG
FT                   LQKNIASFDSIVALLAAILICSTGVASWKQIQSNADWGVLMLFGGGLTLSAVLKDSGAS
FT                   KILADSIVFMIDGQHFYLIGLLVAAFIIFLTEFTSNTASAALLVPIFISIAQSLGMPEI
FT                   GLALIIGIGASCAFMLPVATPPNAIVFGSGQVKQSEMVKVGFLLNLVCVVVIATMGYMF
FT                   WLK"
FT   CDS_pept        complement(447536..448351)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06910"
FT                   /product="conserved hypothetical shikimate
FT                   5-dehydrogenase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86154"
FT                   /protein_id="CBY86154.1"
FT                   /translation="MINKDTQLCMSLSGRPSNFGTTFHNYLYDKLGLNFIYKAFTTQDI
FT                   EHAIKGVRALGIRGCAVSMPFKETCMPFLDEIHPSAQAIESVNTIVNDDGFLRAYNTDY
FT                   IAIVKLIEKYHLNKNAKVIVHGSGGMAKAVVAAFKNSGFEKLKIYARNVKTGQYLAALY
FT                   GYAYINSLENQQADILVNVTPIGMKGGKEEMDLAFPKAFIDNASVAFDVVAMPVETPFI
FT                   RYAQARGKQTISGAEVIVLQAVEQFELYTHQRPSDEFIAEAAAFARTKF"
FT   CDS_pept        complement(448361..449164)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06920"
FT                   /product="serine acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86155"
FT                   /protein_id="CBY86155.1"
FT                   /translation="MTLDVWQHIRQEAKELAENEPMLASFFHSTILKHQNLGGALSYLL
FT                   ANKLANPIMPAISLREIIEEAYQSNPSIIDCAACDIQAVRHRDPAVELWSTPLLYLKGF
FT                   HAIQSYRITHYLWNQNRKSLALYLQNQISVAFDVDIHPAAKIGHGIMFDHATGIVVGET
FT                   SVIENDVSILQGVTLGGTGKESGDRHPKVREGVMIGAGAKILGNIEVGKYAKIGANSVV
FT                   LNPVPEYATAAGVPARIVSQDKAAKPAFDMNQYFIGIDDGMNLNI"
FT   CDS_pept        complement(449181..450188)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06930"
FT                   /product="glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86156"
FT                   /protein_id="CBY86156.1"
FT                   /translation="MITSQTPITVLGAGSYGTALAITFSRNGSPTHLWGHNPVHIAQMQ
FT                   TERQNYRFLPDVIFPEDLHLESNLAQAMEYSQDILIVVPSHAFGEILIKIKPHLKAHHR
FT                   LIWATKGLERNTGRLLQTVVEEQLGTQYPLAVLSGPTFAKELAQGLPSAITLAANNEQF
FT                   AREFQSRIHCSKGFRVYINSDMTGVQLGGAIKNVIAIGAGISDGMGFGANARTALITRG
FT                   IAEITRLGISLGANTNTFMGMSGLGDLVLTCTDNQSRNRRFGLMLGKGLDAQMAMENIG
FT                   QVVEGFYNTKEAYLLAQRQGVEMPITEQIYQMLFCGKSAQDVAISLLGRACKGE"
FT   CDS_pept        complement(450262..452472)
FT                   /transl_table=11
FT                   /gene="cyaA"
FT                   /locus_tag="HICON_06940"
FT                   /product="adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86157"
FT                   /protein_id="CBY86157.1"
FT                   /translation="MGSFGSISQTSSSDLDTWICVRDGLSPDEYTLLTQKAKRISEWAM
FT                   QFNVEINFYLMDQQRFRNEHYADPLTIENSGSAQYMLLLDEFYRSAVRLAGKPLLWLHL
FT                   WVENEKDYEKEVARLITEGEIDPNDWVDFGGLGQFSANEYFGASLWHLYKGIDSPYKSV
FT                   LKILLLEAYSKEYPNTCLIARTFKQDLLSGNTNPDHHFDPYIAILAKVTQYLTALSEFK
FT                   RLDFVHRCFYVKATEDFARYQANNWRIRYMEILAQEWGWSAETVKHLNKRPFWKIKAVK
FT                   ENHDNIMKFLMLSYRNLVEFARKHHIHSSVVPQDINILSRKLYTAFEELPGKVSLLNTQ
FT                   ISHNLSEAHLTFVEVRGNKHFKDGWYLINQPIHHIMFSKERVIEYGESLNKLVSWAYFN
FT                   HLLTEKTKLSIFSKNVTLSTLQRFVTNLRQSFPSTIAKQPKNSDLLNQCEIRSLFIAIN
FT                   LTTDPTSKIEEVLTGISSRDLFSFGSLEQSLVGSIDFTYRNVWNEIRTLHFEGQNAILL
FT                   ALKVLSNKIYRGVNRPDSIQVYCYSERYRQDLRQLVMGLVNRCVSIQVGDIKQPCQTSR
FT                   LRVAGKNWQLFFEDRGISLQEIGNESVCNEAESAVDFDEVLQTPIEDGETNQESRRYPP
FT                   EMDAFASEGFLQFFFEDNSDHSFNVYILDESNHLEIYRHCDGEKDEKVREINQLYQNAK
FT                   QEGDKNPYNIVQHNFNYPQFYQLQNGKNGISIVPFKFRQMNK"
FT   CDS_pept        453098..454309
FT                   /transl_table=11
FT                   /locus_tag="HICON_06950"
FT                   /product="HemX, predicted uroporphyrinogen III methylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86158"
FT                   /protein_id="CBY86158.1"
FT                   /translation="MAKEQPNDLTEQLTDTPKTAVEQTETMQSVPQTIVKKTGTALSLL
FT                   AILIALGIGGAGYYFGQQQMAKIQQKLTALENQTGANLSSNNTNNNKRLTQLEQSLKTA
FT                   QENIAQLEQLIVSKTGEITSLQTQMKQVSQLAIAQQPSDWLFSEADFLLNNALRKLVLD
FT                   NDVDTAVSLLKLADETLVKVNNSQANEIRSAINQDLKQLLSLSSVDQNAIMQKLSQLAN
FT                   TVDELQALNVNFDETSKNNDKLSNNITDWQQNIEKSATSFLNHFIRISPKQNSNKKELL
FT                   APNQDIYLRENIRLRLQLAIMAVPRQQNELYKQSLEAVSSWVRSYFDTNAEVTQNFLKL
FT                   VDGLTDTSIYVDVPEQLKSLTLLDKYLNRTALDVQKVEIEADKAIDTMPKVEVVKPTQS
FT                   ESQQ"
FT   CDS_pept        454320..455606
FT                   /transl_table=11
FT                   /locus_tag="HICON_06960"
FT                   /product="HemY porphyrin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86159"
FT                   /protein_id="CBY86159.1"
FT                   /translation="MFRVLFLMLTLLVGLVAGPYISGQQGYVRIETANRIIEMSITTLV
FT                   IFFIISLAIIYAFEWGITRFFRLSRSSYQWFSNRKRVKAQKQTLEGLVKMDEGDYAKAE
FT                   KLIGKNAKHSAEPVLNLIKAAEAAQQRGDEFSANRYLIEATELAGSDNLLVEIARTRIL
FT                   LQQNKLPAARSSVDSLLEMARRNKEVLKLAVEIYLRSKAYQALDKILDNVANSGLFNDE
FT                   EFKDLRSKTENGLLDEKMNEEGIDGLLTWWNQQPRHRRNNIELKISLIQRLIDCNDHES
FT                   ATELTFEILKKLGDNTAISLPLCTQITRLQPEDNSKLLKLIEKRAKRVDEKQKCCINRA
FT                   LGYLYVRNNEFIKAADVFKNVIACPEQLEQNDLMMASYVFEQAGDKALAEQVRQESLKS
FT                   VMAIQDVIPESAEEKTEENSTALLESKSE"
FT   CDS_pept        complement(456881..457891)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06970"
FT                   /product="Predicted portal vertex protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86160"
FT                   /protein_id="CBY86160.1"
FT                   /translation="MSKNTKKSTALSTGNQAQAFSFGEPIPVLDRAEVLNYFESVLMYE
FT                   KYYNPPINLSYLAKALNASAHHNSAITVKKNILLSTCKTTALLPRTQLEKLVQDYLVFG
FT                   NAYVEKTVNSFGKVVSLKSPLAKYMRVGVEAGVFYQIVNGFDEYEFKKGSVFNLINPDV
FT                   NQEIYGVPEYLAALQSAFLNESATLFRRKYYLNGAHAGSIIYMTDPTQNQDDIEAIKTQ
FT                   IRQTKGTGNFKNLFVYIPNGKKDGMQVIPLSDAIAKDDFLNIKNASRDDVLAAHRVPPQ
FT                   LMGIVPNNTGGFGDVEKATRVFFINEIIPLQERLKEINSWVGEEVITFSDYKLLN"
FT   CDS_pept        complement(457901..459712)
FT                   /transl_table=11
FT                   /locus_tag="HICON_06980"
FT                   /product="Terminase, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86161"
FT                   /protein_id="CBY86161.1"
FT                   /translation="MIYKHTQYKIFIVEELNNISPESTADTKRQAQVMYFSGYKIAEIS
FT                   RQLNIPASTIASWKDREKWDDIAPVGRVELALETRLNLLIAKEEKSGSDYKEIDLLGRQ
FT                   MERMARVKKYSFGDGNEVDLNPKLANRNKGDRKKAEPNAISQEQEELLINGFLDGMFNY
FT                   QRIWHKAKEHRIRNILKSRQIGATYYFAHEAFIDALTTGHNQIFLSASKKQALQFRSYI
FT                   VNYAKQTADVDLKGETIKLPNGAELTFLGTNSATAQSYHGNLYFDEVFWVPKFDVMRKV
FT                   ASGMAAQKMYRQTYFSTPTTIAHPAYAFFSGKAFNRNRAKSEKIEIDISHENLKSGKLC
FT                   ADRQWKQIVSIYDAMEGGCNLFNIDDLIAENSKEEFEQLFLCQFADDNSSAFKFSDLQL
FT                   CQVDSLEEWHDYKPFYQRPFGNREVWLGYDPAFTGDRAALVIVAPPKVERGDYRVLHKQ
FT                   TFHGMDYETQASRIKQFCDDYNVTRIVIDKTGMGSGVYQEVRKFYPMVQGLEYNADLKN
FT                   EMVLKTQNLIQKRRLKFDSGDNDIVSSFMTVKKRITGTGKITYVSDRSEDASHGDLSWA
FT                   IMNCILNVPYGLGGDVSSNKSTIFTFE"
FT   CDS_pept        460104..460748
FT                   /transl_table=11
FT                   /locus_tag="HICON_06990"
FT                   /product="Possible prophage antirepressor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_06990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86162"
FT                   /protein_id="CBY86162.1"
FT                   /translation="MTTQIQFSTFNFKNFPVRTITDPNSEIWFCGTDVCDILGYSNAPD
FT                   ALRKHCKPKGIAKRYTPTVGGEQEMIFISEPNLYRLTVKSRKPEAEPFEEWIFEEVLPQ
FT                   IRKTGKYEISQPALPMPEPTYAQSFSQQDINNLVWLLFSHERMRFLLENLYKPLALFNS
FT                   PFAPQVYGNVTEYKRVHKIAKPLIKKLLDKLQSDNPEKWRHLTRYLNNEIC"
FT   CDS_pept        460926..461741
FT                   /transl_table=11
FT                   /locus_tag="HICON_07000"
FT                   /product="Predicted capsid scaffolding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86163"
FT                   /protein_id="CBY86163.1"
FT                   /translation="MAKKSKWVVVATEGATTDGRTIQRNWISEMAESYDPKNTYGARIN
FT                   LDHIKFSLYMPEMANSHCFGDVLAVKTEEREDGKLQLLAQLQPTDALIALNKEGQKVYT
FT                   SVEIDTNFADTGKAYLVGLAVTDNPASLGTEMLNFSHNGLNARKLKADNIFTAAVETEL
FT                   EFVEEAEKSPSVLEKIKALFAKKEKSDDERFSDQSSAIELLAEQTKETLEKLAALSDDL
FT                   AKQKDEIEEMKAGNAEIQATFAELQKPVEPENPRPLVYGEQPETDGRFF"
FT   CDS_pept        461763..462812
FT                   /transl_table=11
FT                   /locus_tag="HICON_07010"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86164"
FT                   /protein_id="CBY86164.1"
FT                   /translation="MNKFTKQKFNAYLAGVAQDNGEDVAFVANGGQFTVEPTIQQKLEN
FT                   AVLESSDFLKRINVVMVQEMKGSALRLGVLSPVASRTDTNTKARETTDIHSLQENTYSC
FT                   EQTNFDTHLNYPTLDSWAKFPDFSARVGKLKAERIALDRIMIGWNGTSAAATTNRTEHP
FT                   LLQDVNKGWLVQIEDKAKARVLKEIEKSSGKIEIGAGKTYKNLDALVFALKEDFIPAQY
FT                   RDDTKLVAIMGSDLLADKYFPLINQEKPSEILAGDTVISQKRVGGLQAVSVPFFPKGTV
FT                   LVTSLDNLSIYVQEGKVRRHLKDVPERNRVEDYLSSNEAYVVENYEAVAMAKNITILEA
FT                   PAPIPPVAA"
FT   CDS_pept        462824..463474
FT                   /transl_table=11
FT                   /locus_tag="HICON_07020"
FT                   /product="Predicted terminase, endonuclease subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86165"
FT                   /protein_id="CBY86165.1"
FT                   /translation="MRPTKRHFLEVSAAIANAAETEDLSDFTEYEKMCRILARHRKDLK
FT                   NIQSTERKGAFKKQILPDYLPWIEGALSVGSGKQDNVLMTWCVWAIDCGEYHLALQIAD
FT                   YAVFHDLRLPEPFTRTLGTLLAEEFADQAKAAQAANKPFEVAYLEQVQRITADCDMPDE
FT                   SRARLLRELGLLLVDKHPEQALAYLERALGLDQKIGVKGDIKKLKKQLSATEC"
FT   CDS_pept        463767..464273
FT                   /transl_table=11
FT                   /locus_tag="HICON_07030"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86166"
FT                   /protein_id="CBY86166.1"
FT                   /translation="MSDGAISVKLAPDYEMGEVQQQLNDYDTSDDIISNDGFFPDMSLS
FT                   QFRNQYRADGTITTQRLQDALIEGMASVNAELSTFKTQSKRGSLEQITAPSINGESVLI
FT                   YRYKRAVSCLALANLYERYASYDSTNDGEKKMAQLKDSIDELRRDARFAISDILGRKRV
FT                   DAELI"
FT   CDS_pept        464698..465216
FT                   /transl_table=11
FT                   /locus_tag="HICON_07040"
FT                   /product="Lysozyme"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86167"
FT                   /protein_id="CBY86167.1"
FT                   /translation="MIKRSAKYLCAISAVVGLVIATHGNEIRTSEKGLLLIGNAEGCMK
FT                   KPYQCPADVLTVGIGITDAVEKIDRNKIYTLQEIAELYVKGIKQSEKCVNQYANGQTMP
FT                   QGAFDALVSITFNVGCGKLKNSSLFKMARQGYSKAMCGQFERWIYAAGKPLKGLIERRQ
FT                   KEKNLCLIS"
FT   CDS_pept        465938..466408
FT                   /transl_table=11
FT                   /locus_tag="HICON_07050"
FT                   /product="Putative uncharacterised protein, probable phage"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86168"
FT                   /protein_id="CBY86168.1"
FT                   /translation="MKKPNQLRKILEQSHPDFVKNPDHLQLYVDGGQIVATGAASFSFE
FT                   YRYTLNVVVTDYAGDIATLIVPMMAYLRTNQPEILENPQIRENAFKFQVDYNNNNTADI
FT                   SFEIQLTERVVSKKDGNNVQIHYAKEPVWDEPNRVKVYLENRDSPIFEGDIV"
FT   CDS_pept        466408..466866
FT                   /transl_table=11
FT                   /locus_tag="HICON_07060"
FT                   /product="Putative uncharacterised protein, probable phage"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86169"
FT                   /protein_id="CBY86169.1"
FT                   /translation="MATVEEVQAKLTALIANLSPQARRQLGRKIGQALRKSQSNRIARQ
FT                   QNPDGSAFEPRKPRKEFGKKKGRIKRKAMFAKLRTARHLKVRSNGNEVSVGFNGSSAAI
FT                   AAVHQYGLSASPSKNKDFKVQYAQRELLGFSESDVDLIENLIIEQLSL"
FT   CDS_pept        467186..469921
FT                   /transl_table=11
FT                   /locus_tag="HICON_07070"
FT                   /product="Predicted phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86170"
FT                   /protein_id="CBY86170.1"
FT                   /translation="MKSLELKFVLDAVDRLTTPLKSVQKQLDSLQKKVKNTTTELNKLQ
FT                   QQEKTANSFKRLENALQQNNQKLVEAREKAKKLAEQLKNTAAPTAALKRQVESAHKSAH
FT                   RLAQAQEHQRKKLNELRQSLRQGGFDTSKFKESQEKLKQKIKQSTAAIEKQNAAMAKLH
FT                   QRQAKYKSYRESVDNLKNRSDQLRTFGQCSMIAGTVTNALSGVMLKPALDFEQDFSRVQ
FT                   ALTGLSKANPEQAAVLERLRNQGIHLGATTSFTSGEVAQGQGYLAMAGFNADQIEKSMP
FT                   AILSMTKAAGIEMGQVSDISSDISSGFKISADEMSRVADVLTATFSGSNTTLEGLGDTM
FT                   KYLGPIATATGQDFETMSAMVGLLGNVGIKGTQAGTSLRSAMLRLAAPPKQAAKALKSL
FT                   GVSAKDSRGNMRALTNILMDVERKTAKMGTGDRMAYYKAIFGTEAATAMVELVKQAGVN
FT                   GIQEFTDKLKNSAGRAEQVAQTMADNLLGDIKNLESAREAVGIAIYDTISDDMRASVQS
FT                   ITEMVRKVNEWIKANPELTAKIVKWSAAIAGAVTALGALSLLTSFVFYPIARLVLGLSK
FT                   LDVILPKFMGKVIDVSGAISRWLLSPLKLLPYILSLGGAAFIGAALLIYKYWQPIKAFF
FT                   GGFWEGLKSGLAPVLEKFQPLGTAFGVVVGWIEKAVKWFTYLLSPVQSTKEDLDAAVSA
FT                   GERFGNGMAKAIEFILTPLTRLMDGIKWISENMPSWEGIKNSVSSAWERTKNTSNNAWQ
FT                   STKETAGSAWESFKDFTGFGSNSKKLPSQNWSGGYTGNGGKYQPMGIVHGGEYVMTKEA
FT                   TSRLGINTLNALNYGKRALIAGGLGISVATAAPVQVDTRAPISARPVVTQTSQPMSVNI
FT                   TINAAQGMDERAIAQQVAKEIQRIENQRQARARSSMWDRA"
FT   CDS_pept        470687..471286
FT                   /transl_table=11
FT                   /locus_tag="HICON_07080"
FT                   /product="Predicted phage P2-like baseplate assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86171"
FT                   /protein_id="CBY86171.1"
FT                   /translation="MPMSAELQRKLDNIIRFGVIAEVNHATARARVKSGDILTDFLPFV
FT                   TFRAGTTKTWSPPTVGEQCVMLSVSGEFTTACILVGLYTQNSPSQSPDEHVIEFADGAK
FT                   ITYNQSSGALVVTGIKTASITAANQIDIDCPTINIKGNVNIDGSLSTTGTSTTKGNIST
FT                   QGSVTASGDIKGGSISLQNHVHLEQGDGQRTSNAKA"
FT   CDS_pept        471623..472537
FT                   /transl_table=11
FT                   /locus_tag="HICON_07090"
FT                   /product="Predicted phage-related baseplate assembly
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86172"
FT                   /protein_id="CBY86172.1"
FT                   /translation="MSELVDLSKLDAPKVLENLDFESLLADRKAEFIALFPQDERAFWQ
FT                   ARLSLESEPITKLLQEVVYLQLMERNRINNAAKATMLAYASGSDLDVIAANYNVKRQVI
FT                   QEANNNVTPKIPQILEDDTSLRLRTQLAFEGLSVAGPRSAYIFHALSAHPDVADVSVVS
FT                   PQPANVTVTILSHNGQGEANENLLNVVRAKLNDDDIRPIGDRVIVQSAVIQSYEIRAKL
FT                   HLYRGPEYEPIKAAALKKLTAYTEEKHRLGRDISLSGIYAALHLEGVQRVELISPTADL
FT                   VLPSSKSAYCTAINLEIVTSDDY"
FT   CDS_pept        473072..473713
FT                   /transl_table=11
FT                   /locus_tag="HICON_07100"
FT                   /product="Probable tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86173"
FT                   /protein_id="CBY86173.1"
FT                   /translation="MASQYFAILTDYGTRAIAQALSQGQPLQLTQFAVGDGNGKAVTPT
FT                   ANATALVHQTHIAPVSAVSLDPRNNKQVIVELTIPENVGGFYIREMGVFDAQNKLIAYA
FT                   NCPESFKPTESSGSGKVQVLRMILKVESSSAVTLSIDNSVIFVTRQQMTPKTITDTTQN
FT                   GFDESGHSHEIAKASITQQGIVQLTNDTGLDLHSPQKQVKNSLNKLHNCS"
FT   CDS_pept        473704..475308
FT                   /transl_table=11
FT                   /locus_tag="HICON_07110"
FT                   /product="Probable tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86174"
FT                   /protein_id="CBY86174.1"
FT                   /translation="MQLNVSQNYIPNSKKSSAVNSNSADTVATSAAVKTAYDLANSKQS
FT                   PATTLAGYGIGNFKIETFVGNLNTLKTDGIYAITQASRSQNLPVSTSCHIQVIAGGDGT
FT                   WCRQLAYVAYSTDVYERHQTSYQTDSWSAWKKLNTDGIPTGAVVSFPRAVTNPVGFLKA
FT                   NGSTFNQQTFPDLYRTLGNSNKLPDLTRSDVGMTAYFAVDNIPTGWIAFDSIRTTVTQQ
FT                   NYPELYRYLVGKYGSISNVPLAEDRFIRNASNNLSVGETQSDEIKKHVHKVRTHWVNSS
FT                   DSNIFYDKTKTVIDSRLRTATTTDDNLSDNGFMHPLLDSPMATGGAETRPRAIALKLCI
FT                   KAKNTFDDVQFWVKAFGVVENAGALDAGTLAQNMQALSESVEQKIEENKQSTLREITNA
FT                   KADINQQFLQAKENLSQIGTLKTVWQGNVGSGRIDISEKCFGKTLILYLQSSESHSLDD
FT                   NNNIEIVSFEVGAEIEGKKGGRVRWLDVREVNAHSNGGRATYYVEVKRFDVTVDRNGTT
FT                   IQIQDLAGRFVKRIDIR"
FT   CDS_pept        475320..475922
FT                   /transl_table=11
FT                   /locus_tag="HICON_07120"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86175"
FT                   /protein_id="CBY86175.1"
FT                   /translation="MKVYFLKENLNSYQIFPIPQNLNDFVEMEVENESELETKQLIDFK
FT                   SQYILVDRQPTELHKWNGNSWVVDKKKKTEIKRELIKNLVDSIDDTAANISARWTRFAE
FT                   EYKEREAAAIAFKEANFAGEVSVYISSFATVAGLDNQSASLLILQQAESLRTLQQQLAV
FT                   QRMRKYELKHEALSDEELQRIHDDIIGKMQALAEAQQ"
FT   CDS_pept        475919..476419
FT                   /transl_table=11
FT                   /locus_tag="HICON_07130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86176"
FT                   /protein_id="CBY86176.1"
FT                   /translation="MIGTKIYLALYKGKKSGKKPKDLLARFSDWLTRKFTKGIYSHCEL
FT                   IVRKEEFLTGHHYEVEVIYDCYSSSIRDGGVRCKQIDVYDREKWDLIELEGVTEAQIKA
FT                   YFDRTLGCKYDWWSALGIVLGIKQKRSKYFCSEWCFNAICGGESGWRFSPNQLAAIFNK
FT                   EKS"
FT   CDS_pept        476771..477616
FT                   /transl_table=11
FT                   /locus_tag="HICON_07140"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86177"
FT                   /protein_id="CBY86177.1"
FT                   /translation="MANQNTFKQAPLPFIGQKRMFLKHFETVLNENIKGDGEGWTIIDT
FT                   FGGSGLLSHAAKVIKPKAHVIYNDFDSYAERLAYINDTNALRTQIFAKIGNATPKNKRL
FT                   PKSLKAEIIKIIDQFKGYKDLNCLTSWLLFSGQQVSSLDELYKKDFWHCVRLSDYPSAE
FT                   GYLDGVEVIRESFHTLLPKFSDNPKALFVLDPPYLCTKQESYKQATYFDLIDFLRLVNI
FT                   TLPPYIFFSSTKSEFVRFIEYMVDDKVHNWQTFDNAERIVVNASASYSGKYEDNMVYKF
FT                   "
FT   CDS_pept        478061..479245
FT                   /transl_table=11
FT                   /locus_tag="HICON_07150"
FT                   /product="Phage tail sheath-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86178"
FT                   /protein_id="CBY86178.1"
FT                   /translation="MTDEYLHGVKVTEISEALRTLTTSSTAVIGLVATAPDADASVFPL
FT                   NKPTLLTGITAEMQAKAGKQGTLSRALDGIADIVNCKVVVIRVEENEDESTMKANVIGS
FT                   VDNEGNYTGLKAFLVSAAVCGVKPRIFCIPKYDNQDVTTELLSVAKKLNGFVYASCGTA
FT                   KTKEEAVTYGSNFSQRELMLIFGDFLSFNPNTKETEVDYAVVRAAAMRAYQDKEYGWHT
FT                   SISNKGLTGVTGVTKPLSFDINDSATDVNYLNEKGITCCVNHNGFKFWGLRTRSADKLF
FT                   IYENYTRTAQVLKDTIAQSFDWAMDKDISVNLVKEIVEAINAKWREYVAQGYLIGGKAF
FT                   INANLNTAATLKDAKLLVSYDYCPVPPLEQLGFNQYISDEYLVEFAANIAKVGA"
FT   CDS_pept        479249..479755
FT                   /transl_table=11
FT                   /locus_tag="HICON_07160"
FT                   /product="Phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86179"
FT                   /protein_id="CBY86179.1"
FT                   /translation="MALPRKLKLMNFLADGNSYRGQVTEITQPKLAIKLEEYRAGGMFG
FT                   PVKVNLGVEGLEAQFKMGGYMTELIKEFGGKIDGTALRFAGAYQQDDTEEVVSIELVMR
FT                   GRFGEIDNGTSKSGDDTEQSYTVPLTYYKIIENGKDLVEIDLINSVFIVGGVDRLAEHR
FT                   TAIGI"
FT   CDS_pept        479824..480123
FT                   /transl_table=11
FT                   /locus_tag="HICON_07170"
FT                   /product="Probable phage-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86180"
FT                   /protein_id="CBY86180.1"
FT                   /translation="MKTENTKIISLTNPITRGENQITEITVNKPTVPALKGLKMFDVLQ
FT                   MDVDALQVLLARVTTPVLHKSDFVTMEVADFTELAAAAVGFLGKNSEVETEATE"
FT   CDS_pept        480598..481035
FT                   /transl_table=11
FT                   /locus_tag="HICON_07180"
FT                   /product="Probable phage-related tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86181"
FT                   /protein_id="CBY86181.1"
FT                   /translation="MFQNLALATLGMFVFTRQTIPFQSLDRTSNWRHPTNSVVGRMPKA
FT                   QFTGKESETITISGRLIPEITGGRLSIKALELMADSGGAFPLIDGATFEIIGFFVIESV
FT                   QETRTEFFGDGAPRAIDFSMSLKRTDDPMLIAIAESLMSSL"
FT   CDS_pept        481035..482228
FT                   /transl_table=11
FT                   /locus_tag="HICON_07190"
FT                   /product="Putative regulator of late gene expression"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86182"
FT                   /protein_id="CBY86182.1"
FT                   /translation="MFDLNLNDNHRTPAFKVQITTKDKKQQDITQAISSRLISLSLTDN
FT                   RGLEADTLDLELSDHDGKLALPPRNATIQVALGWKGKPLIDKGQYSVDEVQFSGGAGSA
FT                   DRLTIRARAADLKGSFSEQKERSFDKKTLGEIIDTIAKENQLKSHCEKKLANTFIAHID
FT                   QTNESDINLLSRLAEEHGAMCTVKNGTLLFMPLGQGKTATGKPIPLRKITRKSGDNYNF
FT                   SIAESENYKAVRAYWHDTDTGKRGEIIVDKNTKIVKKQRMTKGRTLADGTVKGRRLTKR
FT                   KYNTIEQKAPVESDNDKIKNLRVTYPSEARAIISAKSAFDKLKRGVATFSLNLAFGEPD
FT                   LIPETPIELSGFKAEIDATNWLITKVTHNLSDGGFTSQIECELKVEEDEVEVKKEKK"
FT   CDS_pept        complement(482504..483673)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07200"
FT                   /product="Unknown protein, no known homologues"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86183"
FT                   /protein_id="CBY86183.1"
FT                   /translation="MKKLFALTLCAMAVMGCDDKSTESSQSNQLKQTEVSVPNSEQKTS
FT                   EIKAVIPEKYIDVPFSKTEKGRVIYKNPLDAFENGSDYNSEDKTLVINAKSPLKVTLKE
FT                   DTGATLSVDDVKQLLEHRFILAVYQFFAYTNENEIEITLEPVKEGNKPYGKGYKAIKGK
FT                   ITREQALKTLQTFSGMKDFDDYVSFDKDSEWVILGFTPSRKAQKFTSSDYQSQILNSLL
FT                   TGKIDTPYEIVKLPIDVDFTNIQVKLKKAFDLSLFQNDSRTLTNGDKEYSTVISDFVKV
FT                   YAIEKDKNHLVQVAVQFAFVNNADIVMQSTGAIAAAMLATPDPNKSFKIVTSMMEAASK
FT                   KMKKSKNKDKAEEVRLVDGLTLKLTVHPNLGGIAFLTIEKLEKRPVIFE"
FT   CDS_pept        complement(483683..484372)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07210"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86184"
FT                   /protein_id="CBY86184.1"
FT                   /translation="MSDLSTRLKTLLEEKGLSMNAFSKMVGVSQPAISDIVSGKTRSPK
FT                   NIVEIATALGVDVNWLKNGEGDSEIGRITAYCHSEKDNEHTLRVDLLDVNLAAYSSGII
FT                   NAEYPNIVSSLYFTEEGANRILGRTTTNGVYMFRVPTDSMVPTIKQTDIVFIDTNIKHY
FT                   IGEGIYAFSLNGEEYIKRLQRLPTGVIRALSDNKHYEPFDITEELFDSAVIIGKFIKAV
FT                   EWNVKNL"
FT   CDS_pept        484492..484740
FT                   /transl_table=11
FT                   /locus_tag="HICON_07220"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86185"
FT                   /protein_id="CBY86185.1"
FT                   /translation="MSSMSEYVNKAIEIRGSQSALARACGVSQPTVNLWLNGSKMDVKY
FT                   IPPIIQATKFEVNPTELRPDVDWPTIYESLKQVFEGN"
FT   CDS_pept        485105..485470
FT                   /transl_table=11
FT                   /locus_tag="HICON_07230"
FT                   /product="Putative uncharachterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86186"
FT                   /protein_id="CBY86186.1"
FT                   /translation="MCETAIQASGKFFLRKTKDGKYRLSFTLFDNSSTSVEKIQARQIL
FT                   LQSFLLDLHQEKNCLDVGHVCIRNSDEVLASVHSLCDDERKQIFKRINAEVLFCIICNK
FT                   FINLIFNHSLGSFVNRE"
FT   CDS_pept        486119..486499
FT                   /transl_table=11
FT                   /locus_tag="HICON_07240"
FT                   /product="Putative uncharachterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86187"
FT                   /protein_id="CBY86187.1"
FT                   /translation="MALMPYCFDDETESAAEKWCRVNQVKVPEIRSFDDVLHSLSKSQF
FT                   RVEREFDGLQQGFREMLLELADLDFSDLRAGHLTGTKLHHYTEQGQRKIARALRKVRLL
FT                   SGMFSQGVTEREFTQIDKTMGE"
FT   CDS_pept        487189..489330
FT                   /transl_table=11
FT                   /locus_tag="HICON_07250"
FT                   /product="Putative phage gene"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86188"
FT                   /protein_id="CBY86188.1"
FT                   /translation="MMNWELECNANLAKREQAMADARAVMMQSAVNFDRTFDTAQATSA
FT                   QMELFSVAPHQFDYVEKLLSALPRKRQREHFRHVWLRAFNGVKDDGSIGFKFGNKQAAY
FT                   ANIYLREILTNRLKAVFQHYQVSLDWLIDRDTHSQVVALSKGKKAANFPFYLLSEHQLK
FT                   EMADKLAMLFTKLQSDFVNEQAERKERGEISLDDFTALSRDLYRLVGEVCADIGFPLKH
FT                   WFAYQDNRFLDVNDIEVDLNKSVCQKHWKRQLTTAQKRLKEHVEIGCGAVSAKVSPYVS
FT                   QSAFNDYRAQRADNLEYLQQMVLENLDDSTEQMPLIEMWKKSVANPAIRFQETMNRLRG
FT                   IDEWATENSFVSLFLTLTAPSSFHATHETGKNNKKWQGASPRDTQRYLNKVWAQLRAQF
FT                   AKRGIGFFGFRGVEPHHDGTPHWHLLMYVKPEHKDDVIHLFRKKALELDGDEFGAKKYR
FT                   FKVEEIDPTKGSAIGYVAKYIAKNIYAGKQGKEMSDEVENLTLLENVQRVSAWANLWGI
FT                   RQFQFYGTPSISTWRELRKIDDAMAAVADDEVLDIGRTVADVSCFGSYLKVQGGAMTKR
FT                   CDQPICIEYEECEPNKYGEIRKKIVGVKNRFTEKKIITKLKNWVIKSAKSALGSTALNS
FT                   ESTETNKVHRAAWTCVNNCNRSKIEQQANLLMLSIGSPLKPSQINLLIRHGRLRLNDYR
FT                   WICCENDEVFIKEEKIPLA"
FT   CDS_pept        489819..490340
FT                   /transl_table=11
FT                   /locus_tag="HICON_07260"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86189"
FT                   /protein_id="CBY86189.1"
FT                   /translation="MAKLQHLIKNIEQWAEDRNFIEGSTPQKQFIKLMEEFGELCSGIA
FT                   KNKPDVIKDSIGDCFVVMVILAKQNHIDSVLETISNLDSFQPVFKLDVEEIIAETVVSL
FT                   GMLASELMGQNLEMPTKVDAIFGCPCLSLKLISRKYNLMLTDCVQAAWDEIKDRKGRMI
FT                   DGVFVKEGDL"
FT   CDS_pept        490580..491635
FT                   /transl_table=11
FT                   /locus_tag="HICON_07270"
FT                   /product="Prophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86190"
FT                   /protein_id="CBY86190.1"
FT                   /translation="MSIYKRGSTYWLDITTPSGERIRRSTGTEVKKKAQELHDKIKAEL
FT                   WDMAHLNKKPPKLFEEALLLFVEDAKLKKDFDTNRRHAIYWRSVFGGWKLSDITGEDIM
FT                   TNLPTYSTTHKKPLSPSTKNRYRTSILRVLSLAYKNGWIDRIPYVKKFVEPKVRVRWIT
FT                   KEQATTLISNLNLAWMKNVCSFALFTGARMTEILSMTWDKVDFERSIAIVSNDVAKSGK
FT                   ARALPLNNTALDLLQKLYQTRRSEFVFHRGTDKQIGRIDWHDFHQALEKSNIHNFRFHD
FT                   LRHTWASWHVQAGTPLYTLKEMGGWETLEMVKKYAHLNADHMIEFANNVTFTPHEDDDF
FT                   SQENFYNVVNY"
FT   tRNA            complement(491656..491728)
FT                   /product="transfer RNA-Trp"
FT                   /anticodon="(pos:491693..491695,aa:Trp)"
FT   tRNA            complement(491760..491833)
FT                   /product="transfer RNA-Asp"
FT                   /anticodon="(pos:491797..491799,aa:Asp)"
FT   tRNA            complement(495891..495963)
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:495928..495930,aa:Ala)"
FT   tRNA            complement(496045..496118)
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:496082..496084,aa:Ile)"
FT   CDS_pept        complement(498039..498575)
FT                   /transl_table=11
FT                   /gene="sxy"
FT                   /locus_tag="HICON_07280"
FT                   /product="DNA transformation protein TfoX"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86191"
FT                   /protein_id="CBY86191.1"
FT                   /translation="MFAIWQNKKLYLRGEGVLAIQLTKLGCEPFTTNELNKRFVLSQYY
FT                   ALSDQVLRSNRLCRKLIILSIKQILEQKLECTLRKLNRLKDLPNLTIKHERALIKVGIT
FT                   NVAMLREIGAENALVELKKSGSGATLDFYWKLVCALQNKNSQMLSQAEKERLLKKLNEV
FT                   LRKNGLKGYRKLDDE"
FT   CDS_pept        499065..500129
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="HICON_07290"
FT                   /product="RecA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86192"
FT                   /protein_id="CBY86192.1"
FT                   /translation="MATQEEKQKALAAALGQIEKQFGKGSIMKLGDTKTLDVESISTGS
FT                   LGLDVALGIGGLPMGRIVEIFGPESSGKTTLTLSVIAQAQKAGKTCAFIDAEHALDPIY
FT                   AAKLGVDVKELFVSQPDNGEQALEICDALVRSGAIDVIIVDSVAALTPKAEIEGDMGDS
FT                   HMGLQARLMSQALRKLTGQIKNANCLVVFINQIRMKIGVMFGNPETTTGGNALKFYSSV
FT                   RLDIRRTGSVKDGENIIGNETRVKVVKNKLAAPFRQVDFQILYGEGISKAGELLELGVK
FT                   HKLVEKSGAWYSYNGEKIGQGKANSMKWLNENIEKSDELEARLRAELVANPEQALMADI
FT                   EQSENNTESESDFE"
FT   CDS_pept        500287..500667
FT                   /transl_table=11
FT                   /gene="recX"
FT                   /locus_tag="HICON_07300"
FT                   /product="regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86193"
FT                   /protein_id="CBY86193.1"
FT                   /translation="MQEKNFSEEEIDEALSRCQAKNWQSDRRFSENYLNSRVQKGYGLG
FT                   RIRQELRQLKGVSSDIIDEVLMESEIDWYEMAENLLRKKFPNYNEQQTPKMKQKIWQYM
FT                   LSHGFRSDEFADLIGQNQSEWD"
FT   CDS_pept        complement(500664..501050)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07310"
FT                   /product="predicted inner membrane protein associated with
FT                   chromosome condensation, CrcB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86194"
FT                   /protein_id="CBY86194.1"
FT                   /translation="MQALLFISCGAILGASLRWAIGLLFNPLFSSFAFGTLIANLLGCL
FT                   IIGVLLGLFWQFPQISSEWRLFLITGFLGSLTTFSSFSSEVVELFFNDKWLNGFCVLMM
FT                   HLFGCLAMTVLGIWIYKICSQLLS"
FT   CDS_pept        complement(501050..501868)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07320"
FT                   /product="predicted hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86195"
FT                   /protein_id="CBY86195.1"
FT                   /translation="MNLPFRAMVSDLDGTLLTPEHLVGDLTIDTLRALEQKGVDIILAT
FT                   GRNHTDVSSILGKIGAERAVMITSNGARVRDLQGNLLYSNSLPEELVFELYKTPFDTSK
FT                   VCMNSYQDEGWFTNKDIPAMRQFHKESGFDYNVVDFSKHHGRGTEKVFFIGKTPEDLVE
FT                   VETYLRDKFGDVTTIVYSALACLEVMNKNVSKADALKHLLESREYELKDCIAFGDGMND
FT                   VEMLSWAGKGCIMKDADIRLKMACPELEVIGSNKEESVARYLRTQFGLDY"
FT   CDS_pept        502271..502774
FT                   /transl_table=11
FT                   /locus_tag="HICON_07330"
FT                   /product="ornithine carbamoyltransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86196"
FT                   /protein_id="CBY86196.1"
FT                   /translation="MAFNMKNRHLLSLVHHTEREIKYLLDLSRDLKRAKYAGTEQQKLK
FT                   GKNIALIFEKTSTRTRCAFEVAAYDQGAQVTYIDPNSSQIGHKESMKDTARVLGRMYDG
FT                   IEYRGFKQSIVQELADYAGVPVFNGLTDEFHPTQMLADVLTMIEHCDKPLSEISLCIYW
FT                   GCSQ"
FT   CDS_pept        503286..504218
FT                   /transl_table=11
FT                   /locus_tag="HICON_07340"
FT                   /product="predicted carbamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86197"
FT                   /protein_id="CBY86197.1"
FT                   /translation="MRIVIALGGNALLRRGEPMTAENQRQNVRIACEQIAKIWPNNELV
FT                   IAHGNGPQVGLLALQGAAYTDVPTYPLDVLGAETAGMIGYIIQQELGNLVPFEVPFATL
FT                   LSQVEVDINDPAFKNPTKPIGPVYTKEEAERLAKEKNWSIAQDGDKYRRVVPSPLPKRI
FT                   FEIRPVKWLLEKGSIVICAGGGGIPTYYDEHHNLQGVEAVIDKDLCSALLAENLDADLF
FT                   IIATDVSATFVDWGKPNQKAISVASPEAISELGFASGSMGPKVQAAINFAKQTGKDAVI
FT                   GSLSDIVDIVKGKAGTRITKKAEGISYYA"
FT   CDS_pept        504323..505852
FT                   /transl_table=11
FT                   /locus_tag="HICON_07350"
FT                   /product="predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86198"
FT                   /protein_id="CBY86198.1"
FT                   /translation="MDASKKKKTLNFPSAFTILFAILILAVGLTWVIPSGSYSKLTYNS
FT                   TDNVFVVKAYGVDDKTYPATTDTLDNLNIKIKLSNFTEGVIKKPIAIPGTYQRVEQHHK
FT                   GIEDITKSMVEGTIEAVDVMVFIFVLGGMIGVINRTGSFNAGLMALVKKTKGNEFFIVF
FT                   CVSVLMVLGGTTCGIEEEAVAFYPILVPVFLALGYDAIVCVGAIFLAASMGSAFSTINP
FT                   FSVVIASNAAGIQFTEGIGFRALGLVLGATCVIAYLYWYCKKIKADPSFSYTYDDREEF
FT                   RQRYMKNFDPNTTIPFSARHKLILTLFCIAFPIMIWGVMVGGWWFPQMAASFLAITIII
FT                   MFISGLSEKDVVESFTEGASELVGVSLIIGLARGVNLVLEQGMISDTILDYMSNVVSGM
FT                   PGSVFILGQLVVFIFLGLIVPSSSGLAVLSMPIMAPLADSVGIPRDIVVSAYNWGQYAM
FT                   LFLAPTGLVLVTLQMLHIPFDRWVKFVMPMIGCLLLIGSILLVVQVSLYSV"
FT   CDS_pept        join(506263..506339,506344..509206)
FT                   /transl_table=11
FT                   /gene="hgpB2"
FT                   /locus_tag="HICON_07360"
FT                   /product="hemoglobin-haptoglobin binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86199"
FT                   /protein_id="CBY86199.1"
FT                   /translation="MTNFRLNVLAYSVMLGLTASVAYAEPTNQPTNQPTNQNSNASEQL
FT                   EQINVSGSTENTDTKAPPKIAETVKTAKTLEREQANNIKDIVKYETGVTVVEAGRFGQS
FT                   GFAIRGVDENRVAINIDGLRQAETLSSQGFKELFEGYGNFNNTRNGAEIETLKEVNITK
FT                   GADSIKNGSGSLGGSVIYKTKDARDYLLNKDYYVSYKKGYATENNQSFNTLTLAGRYKK
FT                   FDVLVVTTSRNGHELENYGYKNYNDKIQGKRREKADPYKIEQDSTLLKLSFNPTENHRF
FT                   TFAADLYEHRSRGQDLSYTLKYQRSGHEDPEVESRHTNDKTKRRNISFSYENFSQTPFW
FT                   DTLKLTYSDQRIKTRARTDDYCDAGVRHCEGTENPAGLTVTNGKITRRDGSELQFEKKD
FT                   KNTSGIYNFKRFIDIDNNIIEDKLKLVNANDTWYDCSIFDCENKTKIKVFEGNNYYGHD
FT                   GKWKESELEKTEINGKIFARIKDRNNRKIRSILPLSPGYLERLWQERDLDTNTQQLNLD
FT                   LTKDFKTWRVEHNLQYGSSYNTTMKRMVNRAGNDATDVQWWAERTLGLKTDLYTLKETP
FT                   ETCKNTYSWNAFLCPRVDPEFSYLLPIKTKEKSVYLFDNVIITDYLSFDLGYRYDNIHY
FT                   QPKYKHGITPKLPDDIVKGLFIPLKSNTDDDIKKNVQQNIDYIAKQNKKYKAHSYSFVS
FT                   TIDPTSFLRLQLKYSKGFRTPTSDEMYFTFKHPDFTILPNTDLKPEIAKTKEIAFTLHN
FT                   DDWGFISTSLFKTNYKNFIDLVYKGEKIFSVGNRGGTQSYRLHQNINRDNASLKGIEIN
FT                   SKVFLGKMAKFMDGFNLSYKYTYQKGRMNGNIPMNAIQPKTMVYGLGYDHPNHKFGFDF
FT                   YTTHVASKNPEDTYDIYAKDKKQTDTSIKWRSKSYTILDLIGYVQPIKNLTIRAGVYNL
FT                   TNRKYITWDSARSIRSFGTSNVIDQTTGLGINRFYAPGRNYKMSVQFEF"
FT   CDS_pept        509476..509835
FT                   /transl_table=11
FT                   /locus_tag="HICON_07361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07361"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86200"
FT                   /protein_id="CBY86200.1"
FT                   /translation="MYEILFYRDQNDIEPVKEYLLSLAQNESKDSRIKLNKIRDYVKLL
FT                   SELGTSVGKPYVKHLDGEIWELRPIRDRILFARLMDGRFVLLHQFMKKTQKTPKREIQT
FT                   AQQRLSELKERLKNE"
FT   CDS_pept        509828..510124
FT                   /transl_table=11
FT                   /locus_tag="HICON_07362"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07362"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86201"
FT                   /protein_id="CBY86201.1"
FT                   /translation="MNKISPLGSNWNEFEQQIFNEEEIRESNLRVALIKELITSRQQLG
FT                   ISQKQLETLSGVKQPMIARIEKGQTNPQLETLLKLLAPLGKTLSIVPLRVKNA"
FT   CDS_pept        510285..512201
FT                   /transl_table=11
FT                   /locus_tag="HICON_07370"
FT                   /product="ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86202"
FT                   /protein_id="CBY86202.1"
FT                   /translation="MIIFSNLSLKRGQTELLENASATINPKQKVGLVGKNGCGKSSLFA
FT                   LLKKELMPEGGEVNYPANWRVSWVNQETPALDISAIDYVIQGDREYCRLQQKLNEANER
FT                   NDGHAIAHIHGQLETLDAWTIQSRAASLLHGLGFSQEETIQPVKAFSGGWRMRLNLAQA
FT                   LLCPSDLLLLDEPTNHLDLDAVIWLERWLVQYQGTLVLISHDRDFLDPIVTKILHIENQ
FT                   KLNEYTGDYSSFEVQRATKLAQQTAMYRQQQQKISHLQKYIDRFKAKATKAKQAQSRMK
FT                   ALERMELIAPAYVDNPFTFEFRPPQSLPNPLVMIEQASAGYGSGESAVEILSKIKLNLV
FT                   PSSRIGLLGKNGAGKSTLIKLLAGELTALSGTVQLAKGVQLGYFAQHQLDTLRADESAL
FT                   WHMQKLAPEQTEQQVRDYLGSFAFHGDKVNQAVKSFSGGEKARLVLALIVWQRPNLLLL
FT                   DEPTNHLDLDMRQALTEALVDYEGSLVVVSHDRHLLRNTVEEFYLVHDKKVEEFKGDLE
FT                   DYQKWLSEQNSTSENKVSEKVGDNENSVQNRKEQKRREAELRQQTAPLRKKITQLEEKM
FT                   NKFSSELANIENQLADAELYNAENKEKLTALLAQQVDVKKALDDVETEWMIAQEELEEM
FT                   LQA"
FT   CDS_pept        512211..512747
FT                   /transl_table=11
FT                   /locus_tag="HICON_07380"
FT                   /product="predicted DNA topoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86203"
FT                   /protein_id="CBY86203.1"
FT                   /translation="MNQSLFHHSKQQEYCPQCGAPLQIKQGKKGLFLGCSAYPECDYLR
FT                   PLQRSEHKVLKTLDEICPKCSNLLQLKQGSFGMFIGCSHYPECDFVVREESESEEKIAC
FT                   PECKTGHLIPRRGRQGKIFYGCDNFPKCKFSLPAKPYAVPCPTCHFPLSLLKSEDGEKQ
FT                   IFQCANKTCRHIFEQ"
FT   CDS_pept        512763..513314
FT                   /transl_table=11
FT                   /locus_tag="HICON_07390"
FT                   /product="predicted ribosome maturation factor
FT                   SUA5/yciO/yrdC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86204"
FT                   /protein_id="CBY86204.1"
FT                   /translation="MNREQIAETLRQNQVVAYPTEAVFGLGCNPQSESAVKKLLDLKQR
FT                   PVEKGLILVAPSLDFFRPFVDFEQINDEQLSRLQGKYERPTTWIVPAKSTTPHFLTGKF
FT                   DSIAIRLCDHPSVKALCELTGFALTSTSANLTGEPPCRTADEVRLQFGSDFPVLDEMVG
FT                   RAHNPSEIRDLRTNQLFRQG"
FT   CDS_pept        513318..514124
FT                   /transl_table=11
FT                   /locus_tag="HICON_07400"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86205"
FT                   /protein_id="CBY86205.1"
FT                   /translation="MDLYAVWGNPIVQSKSPLIQNKLATQTHQAMEYIAKLGDLDAFEQ
FT                   QLLAFFDEGAKGCNITSPFKERAYQLADEYSQRAKLAEACNTLKKLDDGKLYADNTDGI
FT                   GLVTDLQRLNWLHPNQRILILGAGGATKGVLLPLLQAQQNIVLANRTFSKTKELAERFK
FT                   PYGNIQAVSMDSIPLQTYDLVINATSAGLSGGTASVDVEILKLGSAFYDMQYAKGTDTP
FT                   FIALCKRLGLTNVSDGFGMLVAQAAHSFHLWRGVMPDFVSVYEQLK"
FT   CDS_pept        514136..514888
FT                   /transl_table=11
FT                   /locus_tag="HICON_07410"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86206"
FT                   /protein_id="CBY86206.1"
FT                   /translation="MENKYSDFMVYVDESGDHSLQSIDKNYPVFVLAFCIFYKDHYRNN
FT                   IVPQIQKLKFDYFGHDMVILHEHEIRKEKGDFNIFTSREQREGFMERISSIIENTNFIL
FT                   AACVIDKRKMPQNETTHPYHFSLKHCLETLYEFVCEKHQEDKITFVAVESRGRNEDREL
FT                   ELEFLRICDGQNKFKKSLPFQVKIVPKQINSVGLQVADLVARPIGRHILDSNQPNRAFE
FT                   ILKKKFYCEGGRKIQGENFDQKGLKHFP"
FT   CDS_pept        515003..515566
FT                   /transl_table=11
FT                   /locus_tag="HICON_07420"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86207"
FT                   /protein_id="CBY86207.1"
FT                   /translation="MQQITRCPWVGEQPIYIDYHDKEWGKPEFDSQKLFEKICLEGQQA
FT                   GLSWITILKKRESYRVAFHQFDPQKIAKMTALDIDACMQNTGLIRHRAKLEAIVKNAKA
FT                   YLEIEKCGENFSDFIWSFVNHKPIVNDVPDLRTVPAKTEASKALSKALKKRGFVFVGET
FT                   TCYAFMQSMGLVDDHLNDCPCKTR"
FT   CDS_pept        complement(515563..516327)
FT                   /transl_table=11
FT                   /gene="lgtF"
FT                   /locus_tag="HICON_07430"
FT                   /product="Glycosyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86208"
FT                   /protein_id="CBY86208.1"
FT                   /translation="MPTISVAMIVKNEAQDLANCLDTVKDWVDEIIILDSGSTDNTKEI
FT                   ALSYGAKFYENSNWPGFGKQRQLAQQYVTSDYVLWLDADERVTPKLQQAILSAVKNDRE
FT                   NTVYEIPRVSEVFGREIRHSGWYPDYVVRLYRTNYAQYNDSLVHEKVEFPAGTKLEKLT
FT                   GDLEHFTYKSIHHYLVKSAGYAKAWADQRQAKGKKATLWQGITHALGCFVKMYLLKAGF
FT                   LDGKQGFLLAVLSAHSTFVKYADLWEREQHKH"
FT   CDS_pept        516390..517673
FT                   /transl_table=11
FT                   /gene="kdtA"
FT                   /locus_tag="HICON_07440"
FT                   /product="3-deoxy-D-manno-octulosonic acid transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86209"
FT                   /protein_id="CBY86209.1"
FT                   /translation="MWRFFYTSLLLICQPLILCFIGLLSVKSPRYRQRLTERYGFYGNA
FT                   SCPPPQGIFIHAASVGEVIAATPLVRQLQQDYPHLSITFTTFTPTGSERVKATFGNSVF
FT                   HYYLPFDLPFSIHRFINFVQPKLCIVMETELWPNLIHQLFLRNIPFVIANARLSARSAH
FT                   RYGKIKAHLQTMWSQISLIAAQDHISGKRYATLGYPKEKLNITGNIKYDLSITDELREK
FT                   IDDLRSLWVKNRPIWIAASTHNGEDEIILKSHRTLLAKYPNLLLLLVPRHPERFNVVAD
FT                   LLKKEKFQFIRRSTNELPNENTQVILGDSMGELMLMYGVSDIAFVGGSLVKHGGHNPLE
FT                   PLAFKMPVITGKHTFNFPEIFRMLVEVQGVLEVNSTADALERAVEALLNSKEARERLGN
FT                   AGYEVLMENRGALQRLLDLLKPYLERNV"
FT   CDS_pept        517670..518140
FT                   /transl_table=11
FT                   /locus_tag="HICON_07450"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86210"
FT                   /protein_id="CBY86210.1"
FT                   /translation="MTSVIYPGTFDPITNGHLDIIERSAVIFPRVLVAVANSPSKKTLF
FT                   SLEERVELVRQSVAHLSNVEAFGFSDLLANVIKQHNISAIIRGVRTTTDFEYELQLAAL
FT                   NRLLTKGADSLFFPPVEKWAFVSSTIVREIYLHGGDVAELVPVPVFNALKAR"
FT   CDS_pept        518137..518348
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_07460"
FT                   /product="predicted periplasmic lipoprotein"
FT   CDS_pept        518354..520366
FT                   /transl_table=11
FT                   /locus_tag="HICON_07470"
FT                   /product="DNA helicase and single-stranded DNA-dependent
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86212"
FT                   /protein_id="CBY86212.1"
FT                   /translation="MKLNPQQQQAIEYVTGSCLVLAGAGSGKTRVIINKIAHLIEKCGY
FT                   SPKQIAAVTFTNKAAREMKERVAHSIGKEQSKGLLVSTFHTLGFDIIKREYKALGFKSN
FT                   MTLFDEHDQFALLKELTADVLKEDKDLLRELISVISNWKNDLISPKQAFALARGAKYQT
FT                   FAKCYERYATQIRAYNALDFDDLIMLPTLLFKQNEEVRSRWQAKIRYLLVDEYQDTNTS
FT                   QYELIKLLVGDRICFTVVGDDDQSIYSWRGARPENMVRLRDDFPRLNVIKLEQNYRSTQ
FT                   RILHCANILIDNNEHVFDKKLFSTIGEGEKLLVIEAKNEEHEAEQIVAELIAHRFSRKT
FT                   KYKDYAILYRGNHQSRLLEKVLMQNRIPYKISGGTSFFSRAEIKDMMAYLRLVVNQDDD
FT                   AAFLRIVNTPKREIGTATLQKLGELAQEKHISLFDAIFEFELIQRITPKAYDSLQKFGR
FT                   WIVELNDEIQRSEPERAVRSMLSVIHYEEYLYEYATSPKAAEMQSKNVATLFDWVADML
FT                   KGDETNEPMNLNQVVTRLTLRDMLERSEDDDDSDQVQLMTLHASKGLEFPYVYLIGMEE
FT                   GILPHQTSIDEDNVEEERRLAYVGITRAQKELTFSLCRERRQYGELVRPEPSRFLAELP
FT                   NDDVLWERDKPKLTTEQKQEKTQNQLDRLRAILKS"
FT   CDS_pept        520805..521209
FT                   /transl_table=11
FT                   /locus_tag="HICON_07480"
FT                   /product="NADPH quinone reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86213"
FT                   /protein_id="CBY86213.1"
FT                   /translation="MDAVIWQMPSWWMHEPWTVKKYIDEVLTSGYGKLYHSDGRHSVNP
FT                   TEGYGTGGLLQGKKHMLSLTWNAPIEAFTRESDFFEGKGVDVLYMHFHKLNEFIGLTRL
FT                   PTFLCNDVVKSPQVEQYLADYQAHLEKVFG"
FT   CDS_pept        complement(521272..522609)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07490"
FT                   /product="2-methylthioadenine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86214"
FT                   /protein_id="CBY86214.1"
FT                   /translation="MQNSTPSIGFVSLGCPKNLVDSERILTELRTDGYNIVPSYENVDL
FT                   VIVNTCGFIDSAVQESLESIGEALEENGRVIVTGCLGAKEDQIREVHPKVLEVSGPHSY
FT                   EAVMAQVHKYVPKPTHNPYISLVPKQGVKLTPKHYAYLKISEGCDHRCTFCIIPSMRGD
FT                   LESRSITQVLDEAKRLAEAGVKELLVVSQDTSAYSMDLKRQEGGVKTAFWNGMPIKNDL
FT                   MTLCKQLGKLGIWVRLHYVYPYPHVDDLIPLMADGTLLPYLDIPLQHASPKILKAMKRP
FT                   GSIDRTLERIKQWREICPDLTLRSTFIVGFPGETEEDFQLLLDFLKEAQLDRVGCFKFS
FT                   PVEGAPATDMADQVPEDVKEERFHRFMQLQQEISANRLKQKIGKTLDVLVDEIDEDGII
FT                   GRSKADAPEVDGLVYVDNLSRINVKVGDVIKVTITNSDEYDLWGSC"
FT   CDS_pept        522761..523477
FT                   /transl_table=11
FT                   /locus_tag="HICON_07500"
FT                   /product="predicted Mg(2+) transport ATPase inner membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86215"
FT                   /protein_id="CBY86215.1"
FT                   /translation="MENSSLLLTALFNPDHLIIFSKMLLAMVLGSVIGLERELKRKPVG
FT                   VKTCAIIAVTTCVLTIVSIQAAEHYAQVSENIRTDPMRLAAQVISGIGFLGAGVILHKK
FT                   NDAISGLTTAAIIWASAGIGIAAGAGFVFDAVIATMMILVSIRLSPLVQRWVHRKSQRR
FT                   RTKFNILVNDAESIGKVTQLLVNNQYRIEHIQVKDQSSGEVRLQIRCFSIDSTMLKDAY
FT                   ALLKAEDGVISVEVDN"
FT   CDS_pept        523636..524751
FT                   /transl_table=11
FT                   /locus_tag="HICON_07510"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86216"
FT                   /protein_id="CBY86216.1"
FT                   /translation="MKNVGFIGWRGMVGSVLMDRMSQENDFANLNPVFFTTSQAGQKAP
FT                   VFGGKDAGDLKSAFDIEELKKLDIIVTCQGGDYTNEVYPKLKATGWDGYWIDAASALRM
FT                   KDDAIIVLDPVNQHVISEGLKKGIKTFVGGNCTVSLMLMAIGGLFEKDLVEWVSVATYQ
FT                   AASGAGAKNMRELLSQMGLLEQAVSSELKDPASSILDIERKVTAEMRADNFPTDNFGAA
FT                   LGGSLIPWIDKLLPETGQTKEEWKGYAETNKILGLSDNPIPVDGLCVRIGALRCHSQAF
FT                   TIKLKKDLPLEEIEQIIASHNEWVKVIPNDKEITLRELTPAKVTGTLSVPVGRLRKLAM
FT                   GPEYLAAFTVGDQLLWGAAEPVRRILKQLVA"
FT   CDS_pept        524806..>525693
FT                   /transl_table=11
FT                   /locus_tag="HICON_07520"
FT                   /product="lysophospholipase L(2)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86217"
FT                   /protein_id="CBY86217.1"
FT                   /translation="MIREPYFHQFALAELLPFFEQFPTQYLSGKRNIKLAYRHLIQPES
FT                   AVRKLMILVNGRAENMLKWSELAYDFYHQGYDVLLFDHRGQGYSQRIIPQKGHLDEFRF
FT                   YIDDMAKIIEKVTALFSYSTQHLLAHSMGALIATYYLANYDHHINKAVLSSPFYGILLK
FT                   HPIRDELIITLMNILGQGERYVFGKGPYQQAHLEYNELTFCKTRMKWMNRVNRKNPAIN
FT                   LGGPTFRWVHLCLNAIKRLPKVIPKIEIPILILQAEKEKIVDNKNLEKLTALFPNARCE
FT                   VVFNAKHEVLFEKDN"
FT   CDS_pept        525904..527004
FT                   /transl_table=11
FT                   /locus_tag="HICON_07530"
FT                   /product="Cytochrome C-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86218"
FT                   /protein_id="CBY86218.1"
FT                   /translation="MSKMKKIVTALCLVGVGATALLGSQWIMHKTSTPEFCASCHSMSY
FT                   PQQEWEGSSHFANAKGVRAQCSDCHIPKEGWHYVKAKFIALKDLWYEAQGKIENKEKYE
FT                   AHRAEMAQRVWKDMKANDSETCRSCHSFDAMELSKQTKLAKQTHTEAQTNGQTCIDCHK
FT                   GIVHFLPEVHGDQNAQKSSTVQGGTISDGSAIFATEMVKATNDKGNEVRLMPYAELMQW
FT                   KVNGDQIQGTLHGWQQVGAEAVVYQELGKRITLALMDEDARNHVQVLKTVHDAVTDSDW
FT                   KEINVAVNVAKEKMTSDLTALNQYGNQLNQTQCSGCHAAIGADHYTANQWIGVVNSMKD
FT                   RTSMKKDEVRALTIYLQRNAKDMAKQ"
FT   CDS_pept        527033..529510
FT                   /transl_table=11
FT                   /locus_tag="HICON_07540"
FT                   /product="Biotin sulfoxide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86219"
FT                   /protein_id="CBY86219.1"
FT                   /translation="MKKNNVNEQRRDFLKKTSLGVAGSALSGGMVGIVSKSAVAKEAEM
FT                   KTVVTAAHWGSIGVVVQDGKVVKSGPAIEPAVPNELQTVVADQLYSEARVKYPMVRKGF
FT                   LANPGKSDTTMRGRDEWVRVSWDEALDLVHNQLKRVRDEHGPTGIFAGSYGWFSCGSLH
FT                   ASRTLLQRYMNATGGFVGHKGDYSTGAAQVIMPHVLGTIEVYEQQTSWESILESSDIIV
FT                   LWSANPLTTMRIAWMSTDQKGIEYFKKFQASGKRIICIDPQKSETCQMLNAEWIPVNTA
FT                   TDVPLMLGIAHTLVEQGKHDKGFLKKYTSGYAKFEEYLLGKTDGQPKTAEWAAKICGVP
FT                   AETIKQLAADFSSKRTMLMGGWGMQRQRHGEQTHWMLVTLASMLGQIGLPGGGFGLSYH
FT                   YSNGGVPTATGGIIGSITASPSGNAGAKTWLDDTSKSAFPLARIADVLLHPGKKIQYNG
FT                   TEITYPDIKAVYWAGGNPFVHHQDTNTLVKAFQKPDVVIVNEVNWTPTARMADIVLPAT
FT                   TSYERNDLTMAGDYSMMSVYPMKQVVPPQFEAKNDYDIFVELAKRAGVEEQYTEGKTEM
FT                   EWLEEFYNAAFSAARANRVAMPRFDKFWAENKPLSFEAGEAAKKWVRYGEFREDPLLNP
FT                   LGTPSGKIEIFSDVVEKMNYNDCKGHPSWMEPEEFAGNVTEEYPLALVTPHPYYRLHSQ
FT                   LAHTSLRQKYAVNDREPVMVHPEDAATRGIKDGDIVRIHSKRGQVLAGAVVTENIIKGT
FT                   VALHEGAWYDPMDLGESEKPLCKNGCPNVLTRDEGTSKLAQGNSPNTCIVQIEKFIGVA
FT                   PEVTVFKQPKQVA"
FT   tRNA            529792..529883
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:529827..529829,aa:Ser)"
FT   tRNA            529907..529980
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:529941..529943,aa:Arg)"
FT   tRNA            530040..530113
FT                   /product="transfer RNA-Arg"
FT                   /anticodon="(pos:530074..530076,aa:Arg)"
FT   CDS_pept        530212..530523
FT                   /transl_table=11
FT                   /locus_tag="HICON_07550"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86220"
FT                   /protein_id="CBY86220.1"
FT                   /translation="MKKQSLPTKFSPFAWGLAAFCSPILLCPMALLISTVFSKNPYLSS
FT                   WQINLFSTLFWVYPFILAVTARMLYRLHQHKPKLANKLLTLSAVIFYVILITICKIGL"
FT   CDS_pept        complement(530563..531933)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07560"
FT                   /product="bifunctional N-acetylglucosamine-1-phosphate
FT                   uridyltransferase/glucosamine-1-phosphate
FT                   acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86221"
FT                   /protein_id="CBY86221.1"
FT                   /translation="MTKKALSAVILAAGKGTRMYSDLPKVLHTIAGKPMVKHVIDIAHQ
FT                   LGSENIHLIYGHGGDLMRTHLANEQVNWVLQTEQLGTAHAVQQAAPFFKDNENIVVLYG
FT                   DAPLITKETLEKLIDAKPENGIALLTVNLDNPTGYGRIIRENGNVVAIVEQKDANADQL
FT                   NIKEVNTGVMVSDGASFKKWLARVGNNNAQGEYYLTDLIALANQDNCQVVAVQATDVME
FT                   VEGANNRLQLAALERYLQNKQASKLLLEGVMIYDPARFDLRGTLEHGKDVEIDVNVIIE
FT                   GNVKLGDRVKIGAGCVLKNVVIGNDVELKPYSVLEDSIVGEKAAIGPFSRLRPGAELAA
FT                   ETHIGNFVEIKKSTVGKGSKVNHLTYVGDSEIGSNCNIGAGVITCNYDGANKFKTIIGN
FT                   DVFVGSDTQLVAPVKVADGATIGAGTTITRDVGENELVITRVAQRHIQGWQRPIKKK"
FT   CDS_pept        complement(532092..532463)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07570"
FT                   /product="50S ribosomal subunit protein L7/L12"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86222"
FT                   /protein_id="CBY86222.1"
FT                   /translation="MSLTNEQIIEAIASKTVTEIVELIAAMEEKFGVSAAAAVAAAPAA
FT                   GSAAAAEEKTEFDVVLKSAGANKVAVIKAVRGATGLGLKEAKDLVESAPANLKEGVSKE
FT                   EAEALKKELEEAGAEVEVK"
FT   CDS_pept        complement(532518..533009)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07580"
FT                   /product="50S ribosomal subunit protein L10"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86223"
FT                   /protein_id="CBY86223.1"
FT                   /translation="MALNLQDKQAIVAEVNEAAKGALSAVIADSRGVTVEKMTELRKSA
FT                   REAGVTMRVVRNTLLRRAVEGTDYECLKDTFVGPTLIAFSNEHPGAAARLFKEFAKAND
FT                   KFEIKGAAFEGKIQDVEFLATLPTYEEAIARLMGTMKEAAAGKLARTFAALRDKLQEAA
FT                   "
FT   CDS_pept        complement(533281..534651)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07590"
FT                   /product="adenylosuccinate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86224"
FT                   /protein_id="CBY86224.1"
FT                   /translation="MQLSTLTALSPLDGRYQDKVTPLRAIFSEFGLMKFRVAVEVRWLQ
FT                   KLASTADITEVPPFSTQANAFLDGIVANFNEADAARIKEIERTTNHDVKAVEYFLKEKI
FT                   QNEVELVNVSEFIHFACTSEDINNLSHALMLSTARDEVILPEWQKLIDEITCLAEEYKT
FT                   IPLLSRTHGQPASPSTVGKEMANVVYRLKRQFKQLQNAEILGKINGAVGNYNAHLSAYP
FT                   NIDWHKFSEEFVTSLGIQWNPYTTQIEPHDYIAEFFDAVVRFNTIIIDFDRDLWGYIAL
FT                   NHFKQRTIAGEIGSSTMPHKVNPIDFENSEGNLGLANAVMTHLGQKLPISRWQRDLTDS
FT                   TVLRNLGVGLGYCLIAYASTRKGMSKLEVNQPHLLEELNQNWEVLAEPIQTVMRRYGIE
FT                   KPYEKLKELTRGKRVTEQAMREFIDKLDIPQEEKLRLQKLTPATYIGAAVELVEKLS"
FT   CDS_pept        complement(534674..535291)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86225"
FT                   /protein_id="CBY86225.1"
FT                   /translation="MKNYHDIVLALAGVCQSAKLVHQLATESRADSDTFLTALNSLFIT
FT                   QPQRIEDVFGGEVRHLKLGLETLIHQLNAQGDQNLTRYWLSLLALEGKLSKNPDAKQTL
FT                   GNRISRLKEQEIHYARDSETMLSIMANIYSDIISPLGKKIHILGSPDYLRQELVQNKIR
FT                   AVLLAGIRSAVLWKQMGGTKWQILFFRRKLLATAKQIYSSIY"
FT   CDS_pept        535420..536424
FT                   /transl_table=11
FT                   /locus_tag="HICON_07610"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86226"
FT                   /protein_id="CBY86226.1"
FT                   /translation="MAKPIVFSGVQPSGELTIGNYLGALRNWVKMQEDYECIFCVVDLH
FT                   AITVRQDPVALRKATLDVLALYLACGIDPNKSTIFVQSHVPEHTQLSWVLNCYTYFGEM
FT                   SRMTQFKDKSARYAENINVGLFDYPVLMAADILLYQAKSVPVGDDQKQHLEITRDIANR
FT                   FNALYGNIFTIPEIFIGKAGARIMSLQDPEKKMSKSDDNRNNVVTLLEDPKSVAKKIKR
FT                   AVTDSDEPPVVRYDVQNKAGVSNLLDILSAVTDKPIADLEKEFEGKMYGHLKTAVADEV
FT                   STLLAGLQERFHQYRNDEALLDNILRQGTDKARAKAQETLAKVYEALGFVAAK"
FT   CDS_pept        536447..536737
FT                   /transl_table=11
FT                   /locus_tag="HICON_07620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86227"
FT                   /protein_id="CBY86227.1"
FT                   /translation="MAIQTEKPIECVGCNTFDMKSLFDNRDCSQVIEYVYDSEKQAQEA
FT                   LAFFTQKARDVESEPCEIQSEITKVDDGYLLKADLTFCCQAELVIFQMRIA"
FT   CDS_pept        complement(536786..537649)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07630"
FT                   /product="tRNA-dihydrouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86228"
FT                   /protein_id="CBY86228.1"
FT                   /translation="MVTAPAIIHAKYDHLDFDLQENPVALQLGGSDPEQLKHCAKLAEE
FT                   RGYHEINLNVGCPSDRVQNGMFGACLMAKADLVADCVEQMQSAVKIPVTVKTRIGIDEL
FT                   DSYEFLCDFIEKVQGKGCQEFIIHARKAWLSGLSPKENREIPPLDYARVYQLKRDFPHL
FT                   TIAINGGIKTIEEMKQHLQYVDGVMVGREAYQNPSLLGQIDQALFYPNAAIVTAHEAVQ
FT                   SMLPYIEQQLNQGIHLNHIVRHMLGAFQNCKGARQWRRYLSENAFKQGAGVEVVETALS
FT                   FVENES"
FT   CDS_pept        complement(join(537778..538035,538039..538476))
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_07640"
FT                   /product="EriC protein (fragment)"
FT   CDS_pept        complement(538712..539896)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07650"
FT                   /product="Translation elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86230"
FT                   /protein_id="CBY86230.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALQALNGVAEWEEKILELAGHLDTYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGDEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK"
FT   tRNA            complement(540004..540076)
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:540041..540043,aa:Thr)"
FT   tRNA            complement(540083..540154)
FT                   /product="transfer RNA-Gly"
FT                   /anticodon="(pos:540119..540121,aa:Gly)"
FT   tRNA            complement(540200..540281)
FT                   /product="transfer RNA-Tyr"
FT                   /anticodon="(pos:540245..540247,aa:Tyr)"
FT   tRNA            complement(540314..540386)
FT                   /product="transfer RNA-Thr"
FT                   /anticodon="(pos:540351..540353,aa:Thr)"
FT   CDS_pept        540603..541526
FT                   /transl_table=11
FT                   /locus_tag="HICON_07660"
FT                   /product="pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86231"
FT                   /protein_id="CBY86231.1"
FT                   /translation="MNLTPFLSFNRKQWAELRKSVPLKLTEQDLKPLLGFNEELSLDEV
FT                   SMIYLPLARLINYYIDENLRRQAVLHRFLGRNKTKVPYIISIAGSVAVGKSTSARILQS
FT                   LLSHWPAERKVDLITTDGFLYPLEKLKKDHLLHKKGFPISYDTPKLIHFLADVKSGKTE
FT                   VEAPIYSHLTYDIIPDKFNVINKPDILILEGLNVLQTGNNKTNQTFVSDFVDFSIYVDA
FT                   EEKLLKEWYIKRFLKFRESAFNDPNSYFKHYANLSKEESITTASKIWDEINGLNLNQNI
FT                   LPTRERANLILKKGHNHQVELIKLRK"
FT   CDS_pept        complement(541617..542564)
FT                   /transl_table=11
FT                   /gene="rseB"
FT                   /locus_tag="HICON_07670"
FT                   /product="sigma-E factor regulatory protein RseB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86232"
FT                   /protein_id="CBY86232.1"
FT                   /translation="MKKILLKFTALSLSLLFSSIASAEELSAKQSLDKMTQALDNLNYE
FT                   IAFVQTTPANMDSFRYRHIKQDNKTYAQLVILDGRQQEIIQRDNLVSYFQPNAQAFTLN
FT                   SGNIVDAMPAVVRANFDKLSSDYDFVKLGKDRVAGRFADTIRIVPKDDFRYQYLVFIDE
FT                   ENGLLLRSDMLDREGKLLDQFRVVTLYIDDRLRGLTDYINKVSLPPLLKESKNEQSSDI
FT                   TWSAGWLPQGFSLVRYTQEILENEIIDSALYSDGLFTFTLFVSNVGSNDLPENTWKQGA
FT                   YTIYSEVIGGKEITFIGQLPISTAKRIVQDVKFR"
FT   CDS_pept        complement(542644..543231)
FT                   /transl_table=11
FT                   /gene="rseA"
FT                   /locus_tag="HICON_07680"
FT                   /product="sigma-E factor regulatory protein RseA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86233"
FT                   /protein_id="CBY86233.1"
FT                   /translation="MQKEQLSAYMDGEQVKTDLTDALLRDEELQASWHSFHTVRSVMRK
FT                   ESAVFLGADFTAKMADLIELEDVKKVDVIAVSQPEPEDAHNSAFMQKLKAFFAPMTQVA
FT                   VAAGVCLVAVLGVQSFNSKNEASNLPEVSVLQTLPFNNAVQEVSYNAPSKDTLTSDQLE
FT                   KKSRRIGAMLQNYELQRRMHSDSSDVSRSQVR"
FT   CDS_pept        complement(543256..543825)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07690"
FT                   /product="RNA polymerase sigma-E factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86234"
FT                   /protein_id="CBY86234.1"
FT                   /translation="MAEQLTDQALVERVQQGDKKAFNLLVSRYQNKVAGLLTRYVSRND
FT                   IPDVVQESFIKAYRSIESFRGESAFYTWFYRIAVNTAKNYLTAQGRRPPNEDILAEDAE
FT                   NYDVGTHLRDVDTPENEILSSELERIVFDTIHNLPEDLKTAITLRELEGLSYEEIAEIM
FT                   DCPIGTVRSRIFRAREMIENKIQSLM"
FT   CDS_pept        complement(543934..544191)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07700"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86235"
FT                   /protein_id="CBY86235.1"
FT                   /translation="MEKYNKLGIEWDCRRGMLELDKIIMPFYLKHFDELTDDKKDIFIR
FT                   LLASTDLQLFSWFFNRGKSSDSEIQSMVEYIQNVQKITTN"
FT   CDS_pept        complement(544281..544667)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07710"
FT                   /product="large-conductance mechanosensitive channel"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86236"
FT                   /protein_id="CBY86236.1"
FT                   /translation="MNFIKEFREFAMRGNVVDMAVGVIIGGAFGKIVSSLVSDIFMPVL
FT                   GILTGGIDFKDMKFVLAQAQGDVPAVTLNYGVFIQNVIDFIIIAFAIFMMIKGLNKVRK
FT                   PEEKKAGPTSEDLLTEIRDLLKNK"
FT   CDS_pept        complement(544741..546117)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07720"
FT                   /product="NAD-binding component of TrK potassium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86237"
FT                   /protein_id="CBY86237.1"
FT                   /translation="MKIIILGAGQVGTTLAENLVSEDNDITLVDNESPQLQTLQEKHDL
FT                   RVVQGSPSSPKVLRDAGAADADLMVAVTASDEINMVACQMGYTLFNTPTRIARIRNSEY
FT                   LREKDKLFNNENIPIDHLISPENLVTDEITRLIAYPGALQVAHFANNRISIVVVKAYYG
FT                   GALVGYALSAFREHMPHIDCRIMSILRNGKPIRPQGSTIVEAGDEITFICATEHIKAVM
FT                   GELQRLEKPYKRVMIVGGGNVASGVAKRLENSCIVKLIERDSNRAQALAEKLPKTLVFN
FT                   GDASDQNLLFEEHIESVDVFLSLSSDDEANIMSALLAKRLGAKKAMVLIQRIAYINLIQ
FT                   GGAIDIAVSPQQVTISALLGHVRKGDVKNVATLRHGIAEAIEIVAHGNVNTSNIVGRKI
FT                   GELRLPMGTIIGALLRGDDVIIARRQVIIEEGDHIVIYLSDKKNVPEIEKLFQPSAFFI
FT                   "
FT   CDS_pept        complement(546130..547485)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07730"
FT                   /product="16S rRNA m5C967 methyltransferase,
FT                   S-adenosyl-L-methionine-dependent"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86238"
FT                   /protein_id="CBY86238.1"
FT                   /translation="MKKFSSKTIKVKNSVKMTALSTRAIAANLILQVLDEGKSLSALIP
FT                   EVQLSVKAQDLPLLQEICFGVCRVLPRLEQIIKRVVEKPLKGKTRIVHCLLLVGLYQLL
FT                   YMRVPAHAAVDEVVNATKSLKSDSFRGLVNAVLRRFLREQDEILAIIDKNWQTLHPEWF
FT                   VNKLKKAYPNWREIIEANNQKPPMWIRVNSQKNALETYRSLLEEQGVSSKTSHHPNALC
FT                   LDIPIAVQKLPHFEEGAVTVQDLSAQWAATLLEPKNEEWILDACAAPGGKTTHILELAP
FT                   QANVIALDVESHRLKRVEENLERLNQQAIVVCGDASKPDEWLAEIGKSAAKFDRILLDA
FT                   PCSATGVIRRHPDIKWLRKETDIAQLVELQKKILSALWEKLKPNGVLLYATCSVLPEEN
FT                   YEQIQEFLNAHADAELLSLPFSDDTSAVGFQFIPQPNSGDGFYYAKLLKRAS"
FT   CDS_pept        complement(547485..548441)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07740"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86239"
FT                   /protein_id="CBY86239.1"
FT                   /translation="MKSLNIIFAGTPDFAAQHLQAILNSQHNVIAVYTQSDKPAGRGKK
FT                   LQASPVKQLAEQNNIRVYQPKSLFKEEAQSELKALNADVMVVVAYGLILPKAVLDAPRL
FT                   GCLNVHGSILPRWRGAAPIQRSIWAGDVQTGVTIMQMDEGLDTGDMLHKIYCDILPTET
FT                   STSLYNKLAELAPSALIDVLDNLENSKFIAEKQDGSQSNYAEKLSKEEAQLDWSLPAMQ
FT                   LERNIRAFNPWPIAYFLTEDKDGNAQILKVYQAEVLPHQDKPAGTILSADKNGIQIATV
FT                   DGVLKLLQLQPAGKKPMSAQDLLNGRAEWFTIGKVLA"
FT   CDS_pept        complement(548517..549026)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07750"
FT                   /product="peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86240"
FT                   /protein_id="CBY86240.1"
FT                   /translation="MTALNVLIYPDDHLKVVCEPVTEVNDAIRKIVDDMFDTMYQEKGI
FT                   GLAAPQVDILQRIITIDVEGDKQNQFVLINPEILASEGETGIEEGCLSIPGFRALVPRK
FT                   EKVTVRALDRDGKEFTLDADGLLAICIQHEIDHLNGILFVDYLSPLKRQRIKEKLLKYK
FT                   KQIAKQ"
FT   tRNA            complement(553133..553205)
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:553170..553172,aa:Ala)"
FT   tRNA            complement(553287..553360)
FT                   /product="transfer RNA-Ile"
FT                   /anticodon="(pos:553324..553326,aa:Ile)"
FT   CDS_pept        complement(555338..556759)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07760"
FT                   /product="potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86241"
FT                   /protein_id="CBY86241.1"
FT                   /translation="MCFSGTMLVPAFVALIYGDGGGKAFMQAFMLSLTAGTLLWWPCHH
FT                   HKQELRSRDGFLIVVAFWLVLGSLATLPLLLFDSPHLTIASAVFEAFSGLTTTGATVMT
FT                   GLDNLPKSILFYRQFLQWLGGMGIIVLAVAIIPLLGIGGTQLYRAESSGPLKDQKSLPK
FT                   ISEVAKALWIIYASLTALCAIAYWLSGMNLFDAIGHSFSTISNGGFSTHDASIGYFNQA
FT                   SIYWVTTIFMLIGGVNFSLHISAFLALGKRNIWRNYWKDPEFRFFLTMQIIFIGIVSLS
FT                   LYGYGLVSDINEAVTKGALQLTSMSMTAGYTIFDIDNLPPFIGLLLVISAVIGGCGGST
FT                   TGGLKAIRTLILWKQIDRELHSLIHPNLVQPIRIGKNRLAPRMIESIWAFFIIFILVYW
FT                   GCVFAVILCGMNTFDAMGAVFATLTNAGPGLGFIHESFIGVPESAKLVFSFAMICGRLE
FT                   MFSLIVLFIPSYWKK"
FT   CDS_pept        complement(556804..557424)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86242"
FT                   /protein_id="CBY86242.1"
FT                   /translation="MAEYLVPKSAVVFEEEIKKSRFITYLQHTEGLEDARAFWAKIKQE
FT                   HPNARHHCWAAVAGKPTDSLQLGFSDDGEPAGTAGKPMLSALQGSQLGEISAVVVRYYG
FT                   GILLGTGGLVRAYGNGVQQALKLIESEIKVERTPFKLDCDYGQLRLVQQLCEKYQVEIL
FT                   SQGFQANIHLILGISEKTIEAFSSELTEKSSGRLVIQLLEIGE"
FT   CDS_pept        557540..557779
FT                   /transl_table=11
FT                   /locus_tag="HICON_07780"
FT                   /product="Response regulator SirA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86243"
FT                   /protein_id="CBY86243.1"
FT                   /translation="MSEISVTQTLNTLGLRCPEPVMLVRKNIRHLNDGEILLIIADDPA
FT                   TTRDIPSFCQFMDHTLLQCEVEKPPFKYWVKRGK"
FT   CDS_pept        complement(557821..558672)
FT                   /transl_table=11
FT                   /gene="HtpX"
FT                   /locus_tag="HICON_07790"
FT                   /product="Heat shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86244"
FT                   /protein_id="CBY86244.1"
FT                   /translation="MMRILLFLATNMAVMLVLGIILSVTGIAGNSTGGILIMALLFGFA
FT                   GSLISLFLSKTMALRSVDGEVITQPRNQTERWLIDTVSRQAQKAGIPMPDVAIYHSPDV
FT                   NAFATGATKSNSLVAVSTGLLNNMTEAEAEAVLAHEISHISNGDMVTMALLQGVLNTFV
FT                   IFLSRVIATAVASSRNNNGEETRSSGIYFLVSMVLEMLFGVLASIIAMWFSRYREFRAA
FT                   AGSASLVGKEKMIMALQRLQQLHEPQNLEGSLNAFMINGKRSELFMSHPPLEKRIEALR
FT                   NL"
FT   CDS_pept        complement(558840..559232)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07791"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07791"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86245"
FT                   /protein_id="CBY86245.1"
FT                   /translation="MMTQIIHTEKAPAAIGPYVQAVDLGNLVLTSGQIPVNPATGEVPA
FT                   DIVAQARQSLENVKAIIEKAGLTAADIVKTTVFVKDLNDFAAVNAEYERFFKENNHPNF
FT                   PARSCVEVARLPKDVGLEIEAIAVRK"
FT   CDS_pept        complement(559286..560038)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07800"
FT                   /product="VacJ lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86246"
FT                   /protein_id="CBY86246.1"
FT                   /translation="MKTKVILTALLSAIALTGCANNNDTKQASERNDSLEGFNRTMWKF
FT                   NYNVIDRYVLEPAAKGWNNYVPKPISSGLAGIANNLDEPVSFINRLIEGEPKKAFVHFN
FT                   RFWINTVFGLGGFIDFASASKELRIDNQRGFGETLGSYGVDAGTYIVLPIYNATTPRQL
FT                   TGAVVDAAYMYPFWQWVGGPWALVKYGVQAVDARAKNLNNAELLRQAQDPYITFREAYY
FT                   QNLQFKVNDGKLVESKESLPDDILKEID"
FT   CDS_pept        complement(560189..560746)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07810"
FT                   /product="transcription antitermination protein NusG"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86247"
FT                   /protein_id="CBY86247.1"
FT                   /translation="MTEETTVSKKRWYVLQAFSGFESRVALTLREYIKQQQMEDQFGEV
FT                   LVPTEEVVENVAGKRRKSERKFFPGYVLVEMEMNDETWHLVKSVPRVMGFIGGTPDKPA
FT                   PISKREADTILNRLEQNTDKPRHRNEYHPGEEVRVTEGPFADFNGTVEEVDYEKGRLKV
FT                   SVSIFGRATPVELEFGQVEKIH"
FT   CDS_pept        complement(560748..561164)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07820"
FT                   /product="preprotein translocase SecE"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86248"
FT                   /protein_id="CBY86248.1"
FT                   /translation="MATEIVDKKKNTQEVIVEGKSKGLNTFLWVLVVIFFAAAAIGNIY
FT                   FQQIYSLPIRVIGMAIALVIAFILAAITNQGTKARAFFNDSRTEARKVVWPTRAEARQT
FT                   TLIVIGVTMIASLFFWAVDSIIVTVINFLTDLRF"
FT   CDS_pept        complement(561308..562543)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07830"
FT                   /product="ATP-dependent Clp protease ATP-binding subunit
FT                   ClpX"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86249"
FT                   /protein_id="CBY86249.1"
FT                   /translation="MTDKDKDLHCSFCGKEKGEVDRLIAGTDGYICNECIELCHSMLEE
FT                   SHDKNLEESAVENEEKLPTPHEIRAHLDDYVIGQDYAKKVLSVAVYNHYKRLRTNYESN
FT                   DVELGKSNILLIGPTGSGKTLLAQTLARRLNVPFAMADATTLTEAGYVGEDVENVLQKL
FT                   LQNCEYDTEKAEKGIIYIDEIDKISRKSEGASITRDVSGEGVQQALLKLIEGTIASIPP
FT                   QGGRKHPQQEMVKLDTSKILFICGGAFAGLDKIIDKRTQTSTSIGFNAKVEKDEKQQSL
FT                   SELFRQVEPDDLMKFGLIPEFIGRLPMIAPLSELDEDALIQILTKPKNALIKQYQALFG
FT                   LEKVELDFTPEALKAMAKKALERKTGARGLRSIVESVLLDTMYDLPSLENLQKVIVDES
FT                   TIVDNLAPKLEY"
FT   CDS_pept        complement(562553..563134)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07840"
FT                   /product="ATP-dependent Clp protease proteolytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86250"
FT                   /protein_id="CBY86250.1"
FT                   /translation="MSVIPMVVEQTSRGERSYDIYSRLLKERVIFLSGEVEDRMANLIV
FT                   AQLLFLESEDPTKDINIYINSPGGSVTAGMAIYDTMQFIKPDIRTLCIGQACSMGAFLL
FT                   AGGTAGKRAALPNARVMIHQPLGGFRGQASDIQIHAQEILKIKHTLNDRLAFHTGQSIE
FT                   RIEKDTDRDNFMSAEEAQAYGLVDEVLVKR"
FT   CDS_pept        complement(563257..564555)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07850"
FT                   /product="bacterial trigger factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86251"
FT                   /protein_id="CBY86251.1"
FT                   /translation="MSLNIETTQGLERRVAITVPTEIVSKAVREEFKRAAKNVRVDGFR
FT                   KGHVPAHIIEQRFGASIRQDVLNDLLPRHFFDAVIAEKINIAGRPTFAIETFEEGKDLV
FT                   FTATFEVYPEVKLQGLENIKVEKPTVEITEADIDKMIDVLRKQQATWAESQDVVKADDR
FT                   VTIDFVGSVDGEEFEGGKATDFVLFMGQGRMIPGFEEGIVGHKVGEQFDIDVTFPAEYH
FT                   AENLKGKAAKFAITLKKIENMVLPELTDEFVAKFGPNTKSVADLCAEIRKNMERELKNA
FT                   LVSRVKQQVINGLIEQNPIDVPASAVEEEINVLRNQAAQRFGGNAQQTAQLPRELFEAE
FT                   ATRRVQVGLLFSEVIKSNELKADEERAKAMIADIASAYEQPAEVVEYYSKNEELMNNIR
FT                   NVVLEEQAVDAVLAKAQVTEKVSSFDEIMNPQA"
FT   CDS_pept        join(564860..564949,564934..568083)
FT                   /transl_table=11
FT                   /gene="hgpC"
FT                   /locus_tag="HICON_07860"
FT                   /product="hemoglobin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86252"
FT                   /protein_id="CBY86252.1"
FT                   /translation="MTNFKFSLLACSIAFALNASTAYAAQPTNQPTNQPTNQPTNQPTN
FT                   QPTNQPTNQPTNQPTNQNSNVSEQLEQINVSGSSENINIKEKKVGETQISAKKLAKQQA
FT                   SDSRDLVRYETGITVVETGRTGASGYAVRGVDENRVGIMVDGLRQAETLSSQGFKELFE
FT                   GYGNFNNTRNSIEIENVKTATITKGADSLKSGSGALGGSVIFETKDARDYLIDKDYYLS
FT                   YKRGYQTMNNQNLKTLTLAGRSKKFDILVVDTTRDGHEIENYDYRIYPNKQADLSAVGP
FT                   TREKADPYQITRQSTLIKLGFQPNENHRLSVALDDSTLETKGMDLSYVFRPCKDTACSE
FT                   KYGERVINDQSKRKNIQFSYENFSQTPFWDHIKLSYSSQKITNKARSDEYCHQSTCNGV
FT                   LNPQGLKLVEKNGVYSIVDKNGGEFTYEQDGYYRKFKNNKKEDVDNDIDSSKGSLDSVL
FT                   IDCEKLNCEKKFRVFVEKNEKYEDKYDYEDRQIEVETLPNGKKYGKIQLKKGEALWENG
FT                   PLKEEIARFLFPKSYGYSTDFVNDRDLNTNTQQIKLDLDKEFSLWHTQHSLKYGGFYEK
FT                   TLKSMVNHQYNTAANVQWWADYFFCARADGGNLGVEKKPQPNISVAGCANGTPIHSDKG
FT                   KETYLIPVTTKNNVLYFGDNVQLTSWLGLDLNYRYDHVKYLPGYDEKIPVPGGLIAGIF
FT                   VPFDEKDFVYGTSTPPTGYNDCRYNTDCYKNNVKKNLALLLRKTDYKHHSYNLALNLDP
FT                   TDWLRVQLKYANGFRAPTSDEIYMTFKHPQFSIQPNTDLKAETSKTKEVAFTFYKNSSY
FT                   ITLNAFQNDYRNFIDLVEVGERPIEEGSTIAYPFHQNQNRDRARVRGIEIASRLEMGDL
FT                   FEKLQGFHLGYKFTYQKGRIKDNGLNPKYKEFLDLNKAQHPEYEAIARKPQPMNALQPT
FT                   TSIYNIGYDAPSKKWGVDMYITNVAAKKAKDSFNSQWTSMVKRKEKIYGNEKDAEASTA
FT                   NGKEVKDSRGLWRNNRYTVIDTIAYWKPIKNLTFTAGVYNLTNKKYLTWDSARSVRHLG
FT                   TINRVETATGKGLNRFYAPGRNYRMSVQFEF"
FT   repeat_region   564934..565029
FT                   /note="CCAA x24"
FT   CDS_pept        568318..569406
FT                   /transl_table=11
FT                   /locus_tag="HICON_07870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86253"
FT                   /protein_id="CBY86253.1"
FT                   /translation="MTQVDPLYFPRSELAERLLSSLKDGILHAITLFAPRRMGKTQFLL
FT                   NDVKPKAEKLGFNVFYFSFMDRTSNELGHVFTRELIHFLDVVDGKTNNLFDKLKAIDLM
FT                   GVGVELQDKNQTKLDELSLVQIINAITESSDKPILMLLDEVQELARVSHTIGLIRSLRT
FT                   GLDINQQKIKVIFTGSSTNGLRAMFNDNKAPFFHFAHPLDFPNLGKNFTDFLADIYHSR
FT                   TGQEIDKNQFYELFERFNFTPLYMRSIAQDMIINPNLSLKQASEYRIAQMSELGDSVKI
FT                   WRELSSIEREILKSVVNGENALYSKEKRAYFAKALGIEDISSSTIQGKVRKLERKELIT
FT                   RNANGTIKINSPYFQTWIKENS"
FT   CDS_pept        complement(569798..572383)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07880"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86254"
FT                   /protein_id="CBY86254.1"
FT                   /translation="MISEENFQQHTPMMQQYLKLKAENPDILLFYRMGDFYELFYDDAK
FT                   KAAALLDISLTKRGQSAGQPIPMAGMPYHAVEGYLAKLVQLGESVAICEQIGDPTTSKG
FT                   PVERQIVRIVTPGTVSDEALLPERQDNLIAAVYQEKEKFGLATLDMTSGRFQLCEPADK
FT                   ETLRAELQRIAPVELLYCEEFNEMAAIEHCKGLRRRPIWEFELSTAITLLNHQFGTKDL
FT                   RAFGVEKSPLGLSAAGCLLQYAKETQRTALPHIQSISLIQNQDCIQLDVATRRNLELTQ
FT                   NLAGGTENTLASVLDKCVTPMGSRLLKRWIHQPVRDVEKLKQRQQAIAEILNFDLVDEL
FT                   QPYLQLVGDMERILARVALRSARPRDLTRLRTALEQIPALRAIVQQKTPPFLTALFSQI
FT                   ADFSEQCDLLQRALIETPPLLIRDGGVIAEGYHTELDEWRMLSDGATQYLENLEKRERE
FT                   STGIDTLKIGFNAVHGYYIQISQGQAHKAPIHYVRRQTLKNAERYIIPELKEYEDKVLK
FT                   SKGAALALEKQLYDELFDLLLPHLGALQLASLALSELDVLVNLAERADTLNYVMPTFCD
FT                   EVSVKIENGRHPVVEQVLKDPFIANPVELNHNRHLLVITGPNMGGKSTYMRQTALITLL
FT                   AYIGSFVPADSARIGPIDRIFTRIGASDDLASGRSTFMVEMTEMANILHQATAQSLVLI
FT                   DEIGRGTSTYDGLSLAWACAEWLAKKIRSLTLFATHYFELTALPEQLEGIANIHLDALE
FT                   HNNTIAFMHAVQDGAASKSYGLAVAALAGVPQSVIKLAKQKLTQLEKNSSYSVEEQIQA
FT                   LREANHNQGELLFEQETDALREAIEKLDPDDLSPKQALAYLYQLKKMVG"
FT   CDS_pept        complement(572518..573735)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07890"
FT                   /product="Lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86255"
FT                   /protein_id="CBY86255.1"
FT                   /translation="MKKSFLLLPLSLVVLSACTSNFPAPISDADGNFSPSVMQSVNGSN
FT                   VGGAWQPEIQKNSLPTIGNMVTPQPNFQPINQQPTMPTAPAQPAFQPSPKTVVSAPTVQ
FT                   TKTVTKTVADCVDGQHINIPRNPNTNVPDYSKISKGSYKGNTYKVNKGDTMFLIAYLAG
FT                   IDVKELAALNNLSEPYNLSLGQVLKISNCSTKTVTTTVSVKQPAVTASTAMPVKPAVTY
FT                   TPGANGTQIGSDGTIIGPIKSEAGTSSSVPVATSSTQVTSSVNNVNSTPINSNVVAPIA
FT                   SNVAWQWPTSGNIIQGFSSTDGGNKGIDISGSRGQAVKAAAAGRVVYAGNALRGYGNLI
FT                   IIKHNDDFLSAYAHNDKILVVDQQEVKAGQDIAKMGSSGTNAVKLHFEVRYKGKSVDPV
FT                   RYLPRR"
FT   CDS_pept        complement(573759..573944)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86256"
FT                   /protein_id="CBY86256.1"
FT                   /translation="MNKLSLVLVAGFLLVGCASEPVKDPDALPNGIMQPVEGTGAVAGG
FT                   SFMPEIQKNTIPTQMK"
FT   CDS_pept        complement(573953..574531)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86257"
FT                   /protein_id="CBY86257.1"
FT                   /translation="MKIFGTMYDKTMEWSKHRFAVSWLSFVSFIEAIFFPIPPDVMLIP
FT                   MSMSKPKGAVKFAFYTAIASVIGGIIGYAIGFYATDWVENIVQQWGYAAHWAKAVSWFE
FT                   QWGVLVVFVAGFSPIPYKVFTLCSGVMQMAFFPFVITAFVSRLARFLLVAKLAAWGGEK
FT                   FAAKLRKSIEIIGWSVVVLAIIAYFILKN"
FT   CDS_pept        complement(574540..575289)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07920"
FT                   /product="Acid phosphatase SurE"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86258"
FT                   /protein_id="CBY86258.1"
FT                   /translation="MRILVSNDDGFHAEGIQVLATELRKIAEVIIVAPDRNRSAASSSL
FT                   TLVEPLRPRHLDNGDYCVNGTPADCVHLALNGFLSGQVDLVVSGINAGCNMGDDTIYSG
FT                   TLAAALEGRHLGLPAIAVSLDGRQHYETAARVVCDLIPKLHHQLLNPREIININVPDLP
FT                   FEELKGYKVCRLGYRASSAEVIKQKDPRDETIYWIGPSALPEDESEGTDFYAVKNGYVS
FT                   ITPIQADLTAYHSLLSLQNWLDQEFTK"
FT   CDS_pept        complement(575299..576318)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07930"
FT                   /product="tRNA pseudouridine synthase D"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86259"
FT                   /protein_id="CBY86259.1"
FT                   /translation="MLEQLPYLALKTPPKTTALLKAECADFIVKEHLGYEMSGEGEFVA
FT                   LYVRKTDCNTLFVGEKLAKFAGVSERNMGYAGLKDRRAVTEQWFCLQMPGMETPDFSQF
FT                   ELDGVEILTVTRHNRKIRTGSLEGNYFDILLRGAEESDELKVRLDFVANFGFPNYFTEQ
FT                   RFGREGHNLTQALRWAQGEIKVKDRKKRSFYLSAARSEIFNLVVAARIAKSATNQVLPN
FT                   DIVQLAGSHSWFKADEKEDLTALQVRLENQDILLTAPLIGEDILVASEIENEIVNQHSV
FT                   FDPLMKQERMKAARRPLLMKAKGFSWAFEPEGLRLKFYLPAGSYATALVRELVNYTEE"
FT   CDS_pept        576427..576849
FT                   /transl_table=11
FT                   /locus_tag="HICON_07940"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86260"
FT                   /protein_id="CBY86260.1"
FT                   /translation="MSKLAELQAETREIIEDLLNDGSDPNALYIIEHHIAHHDFDLLEK
FT                   IAVDAFKAGYEVSEAEEFKDDDGKPIFCFDIISEVELKAEIIDAQQKEILPLLEKHNGI
FT                   YDGWGTYFEDPNADDDEYGDDGEFFDDEDEEEPRVH"
FT   CDS_pept        576929..>577461
FT                   /transl_table=11
FT                   /locus_tag="HICON_07950"
FT                   /product="FKBP-type peptidyl prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86261"
FT                   /protein_id="CBY86261.1"
FT                   /translation="MKVEKNVVVSISYQVRTQDGVLVDEAPANQPLEYLQGHNNLVIGL
FT                   EKALEGKEVGDKFEVRVQPEEGYGAYSENMVQRVPKDVFQGVDEFEVGMRFLADTDIGP
FT                   VPVVITEIDGDEVVVDGNHMLAGQELHFTVEVVATREATLEEIAHGHVHGAHSHHHDDD
FT                   EEGHSCGCGGHHHH"
FT   CDS_pept        577689..579425
FT                   /transl_table=11
FT                   /locus_tag="HICON_07960"
FT                   /product="predicted outer membrane protein and surface
FT                   antigen"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86262"
FT                   /protein_id="CBY86262.1"
FT                   /translation="MNKTLSKLTALFLALSCFPAFAEQTVDIEVQGIRGFRAVRNTDLN
FT                   VHLINKEEMDGSERYQHLVTQAVDRGLRVFGYYESSVRFERKQRQGKRDLLIAHVTPGE
FT                   PTKIAGTDVQIKGEATQDENFDGLRKNLPKEGVLVEHQTYDDYKTAISRLASNRGYFDG
FT                   EFKISRLEISPETHQAWWRMLFDSGVRYHYGNITFSHSQIRDDYLNNILNIKSGEPYLM
FT                   NSLSDLTSDFSSSNWFSSVLVQPNVNHKNKTVDVEIILYPRKKNAMELGVGFATDGGVH
FT                   GQIGWTKPWINSRGHSLRSNLYLSAPKQTLEATYRMPLLKNPLNYYYDFAVGWEGEKEN
FT                   DTNTRVLTLSALRYWNNAHGWQYFGGLRTRYDSFTQADITDKTLLLYPTVGFTRTRLRG
FT                   GSFATWGDVQKITFDLSKRIWLSESSFIKVQASSAWVRTYAENHRIVARAEIGYLHTKD
FT                   IEKIPPTLRFFAGGDRSVRGYGYKKIAPKNKNGKLVGGSRLLTTSLEYQYQVYPNWWAA
FT                   TFADSGLAANDYTEKELRYGAGVGVRWASPVGAIKFDIATPIRDKDNSKNIQFYIGLGT
FT                   EI"
FT   CDS_pept        579435..583331
FT                   /transl_table=11
FT                   /locus_tag="HICON_07970"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86263"
FT                   /protein_id="CBY86263.1"
FT                   /translation="MTEQIQASETSPKSPEKPNKKHWVRKAVCIGSAVIFIPVLGVAGT
FT                   LSFDAGQRGLIQLVDKMLDSFSVEQIEGGLQNGLVLKNVRYQTAGIETHIAQARLQLDF
FT                   GCLLSREVCLRDFTLNKPTIAINTALLPPSAPDNSKSGSMKRISLPISINAENLVVQDL
FT                   SVNIDQTSITLGNFKSAVSLNNEKGLTIAPTEINDISVIAKKLSEVKSDLKAEQPNKPV
FT                   DWATIEQSLTPAFLGNVSEIILPFDLHIPEISGKNWQYQAVNEKGETLQSVEMSSLIAQ
FT                   ADTVDNQLQLQKLAVESSLGNLSSQGKLQLDGDMPLDLTLKSHLEPLKSDGKEILPASD
FT                   VDLALSGSLKKSTALSLKTKGVLDAELNGDVQLAQDKMPLNLTLNVAKGQYTFVNTMTP
FT                   LKINDVTLKLTGDLLNYHAELKGNVVGMNYIPASQVELNADGKLYEVTVNKLGIDSLDG
FT                   KSEFVGTANWKEGANWDIQADLEKMNIGFFVPVMPATLSGKLHSRGFAGSQGWQVEVPV
FT                   ADLNGMLSAKPISLKGSATLNQNVLLTVPDLQIRYGENYLKASGVLDDHSDFALDINAP
FT                   NLRGLWSDLKGRVKGRVAISGQITTPNLDLDLTSSNLHLQGFQLAKASIKGHINNASLS
FT                   SGKLNIKAEQLHYGENIKLHLLDLDLSGDEQNHKLSLKSQGEPVAANLQINGHFDRTLE
FT                   QWKGTISQAKFETPIGDVKSNQAIAVSYDNKQTQANIASHCWQNTDVELCFPQAFNAGK
FT                   QGNIPFQFKRVNLDLVNKLIEQNSLKGNLQVQGNVAWFTDKPFQFTANVDGNHLAFSQK
FT                   LDYRTFKLDIPKLTLNADIQNNNLVLKTDINVHNQGRIVGDIHLNDLAKNRQLGGSLAI
FT                   ERLSLSIANQLLTQGESVNGEVVSKLRFGGNLEKPLLNGDFNIRNIRTKLKSMPVNITD
FT                   GDIALRFNGNRSTLQGKIKTVDSHLNLTGRANWANIEHWTTELNAQANNFNVDIPSMAK
FT                   LRFSPNITIKANPKELNLSGTVDIPWARIKIDSLPDTAEPVSEDEVILNGPHKSKEELI
FT                   KREFAAKTKSGMEIRSDLRINIGKDVSLDAYGLKTNLDGLLSVKQDKGNLGLFGQINLT
FT                   KGRYASFGQDLLIRKGLISFSGQATQPTLNIEAIRNPETMEDSKITAGVRVIGIADSPE
FT                   VTIFSEPSKPQDQALSYLLTGRSLESSGEVGSTGSVGAALIGLGISKSGKLVGSIGEVF
FT                   GIQDLNLGTSGVGDKSKVTVSGNITNRLQIKYGVGLFDGLAEVTLRYRLMPQLYFQSVS
FT                   STNQVFDLLYKFEF"
FT   CDS_pept        583339..584316
FT                   /transl_table=11
FT                   /locus_tag="HICON_07980"
FT                   /product="Exopolyphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86264"
FT                   /protein_id="CBY86264.1"
FT                   /translation="MNDAILEPKHRGNVREIAAIDLGSNSFHMIVARIVNGSIQVLSRL
FT                   KQKVKLAEGLDENAVLNQEAITRGVNCLALFAERLQGFPVENVNVVGTYTLRRAVNNDE
FT                   FLRQAAKVFPYPINIISGQTEAKTIYAGVCHTQPEKGRKLVIDIGGGSTEMIIGDDFTP
FT                   LIAESRHMGCVSFATQFFTDGIISPENFQRARQSAVNKIEDLGLAYRKLGWQSVLGSSG
FT                   TIKTVAQVIATNLDPNGTITAERLNALIEQTLQAKHFTELNINGLNQDRVDVFVPGLAI
FT                   LSAVFDVFHIQQMRYSDGALREGVIYSLEKTSKLQIFERAPLEG"
FT   CDS_pept        complement(584436..585119)
FT                   /transl_table=11
FT                   /locus_tag="HICON_07990"
FT                   /product="Pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_07990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86265"
FT                   /protein_id="CBY86265.1"
FT                   /translation="MKKNFLVGKLPSKGKSAVNFYRTFKPKSKPQTLSLDETKVVLFNK
FT                   PFDVLTQFTDEQGRATLKDFISIPNVYAAGRLDRDSEGLLILTNNGELQHRLADPKFKT
FT                   EKTYWVQVEGIPEETDLAQLRKGVELKDGVTKPAKVRLISEPNLWERNPPIRERKNIPT
FT                   SWLEIKISEGRNRQVRRMTAHIGFPTLRLVRVSMGSLSINGLENGSFRLLSLDEIKALF
FT                   QTVKL"
FT   CDS_pept        complement(585297..586121)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08000"
FT                   /product="Lipoprotein E"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86266"
FT                   /protein_id="CBY86266.1"
FT                   /translation="MKTTLKMTALAALSTFVLAGCGSHQMKSEEHANMQLQQQAVLGLN
FT                   WMQDSGEYKALAYQAYNAAKVAFDHAKVAKGKKKAVVADLDETMLDNSPYAGWQVQNNK
FT                   LFDGKDWTRWVDARQSRAVPGAVEFNNYVNSHKGKVFYVTNRKDSTEKAGTIDDMKRLG
FT                   FNGVEESAFYLKKDKSAKAARFAEIEKQGYEIVLYVGDNLDDFGDTVYGKLNADRRAFV
FT                   DQNQGKFGKTFIMLPNANYGGWEGGLADGYFKKDTQGQIKARLDAVQAWDGK"
FT   CDS_pept        complement(586247..587341)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08010"
FT                   /product="glycerophosphoryl diester phosphodiesterase
FT                   precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86267"
FT                   /protein_id="CBY86267.1"
FT                   /translation="MKLKTLALSLLAAGVLAGCSSHSSNMANTQMKSDKIIIAHRGASG
FT                   YLPEHTLESKALAFAQQADYLEQDLAMTKDGRLVVIHDHFLDGLTDVAKKFPHRHRKDG
FT                   RYYVIDFTLKEIQSLEMTENFETKDGKQAQVYPNRFPLWKSHFRIHTFEDEIEFIQGLE
FT                   KSTGKKVGIYPEIKAPWFHHQNGKDIAAETLKVLKKYGYDKKTDMVYLQTFDFNELKRI
FT                   KTELLPQMGMDLKLVQLIAYTDWKETQEKDPKGYWVNYNYDWMFKPGAMAEVVKYADGV
FT                   GPGWYMLVNKEESKPDNIVYTPLVKELAQYNVEVHPYTVRKDALPAFFTDVNQMYDALL
FT                   NKSGATGVFTDFPDTCVEFLKGIK"
FT   CDS_pept        complement(587445..588887)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08020"
FT                   /product="sn-glycerol-3-phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86268"
FT                   /protein_id="CBY86268.1"
FT                   /translation="MFGPFKPAPHIAELPAEKIDSTYKRLRWQVFAGIFFGYAAYYFVR
FT                   ANFDLAQPGLIQAGLYSKAELGVIGSAAGLAYGLSKFVMAGMSDRSNPRVFLPFGLLLS
FT                   GLCMTLMGLFPWATSGIAIMWVMIFLNGWFQGMGWPPCGRTMVHWWSKSERGTIVSIWN
FT                   TAHNIGGMVPGAMVLLASAIFFSTHGIEAQAKDVWQQSLYFPGIAAMIFAIPVYFVMRD
FT                   TPQSCGLPSIEKWRNDYPDDYNEKTYENDLTAKEIFVTYVLKNKLLWYIAIANVFVYLI
FT                   RYGVLKWSPVYLSEVKHFNIKGTAWAYTIYELAAVPGTLLCGWVSDKVFKGKRGLTGFI
FT                   FMILTTAAVVAYWMNPATPEAELANYSAWYENPYQLTDFVLMTLIGFLIYGPVMLIGLH
FT                   ALELAPKKAAGTAAGFTGLFGYLGGTVSASAVIGWAAQHYGWDGGFYVMIGGGVLAVLL
FT                   LLIVMVEEGKHKAKLGDTYGTK"
FT   CDS_pept        589181..590872
FT                   /transl_table=11
FT                   /locus_tag="HICON_08030"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase
FT                   (anaerobic), large subunit, FAD/NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86269"
FT                   /protein_id="CBY86269.1"
FT                   /translation="MGLSPSIYKDVGDLSSLSTDVIIIGGGATGAGIARDCALRGIDCI
FT                   LLERRDIATGATGRNHGLLHSGARYAVNDQESAEECIKENRILRKIARHCVDETEGLFI
FT                   TLPEDSLDYQKTFLESCAKSGIDAQAIDPELAKIMEPSVNPDLVGAVVVPDGSIDPFRL
FT                   TASNMMDATENGAKMFTYCEVKNLIREGGKVIGVNVYDHKNRRERQFFAPLVVNAGGIW
FT                   GQGIAEYADLKIKMFPAKGALLVMGHRINKLVINRCRKPADADILVPGDTICVIGTTSS
FT                   RVPYDQIDNMQVTPEEVDILFREGEKLAPSLRHTRVLRAYAGVRPLVASDDDPSGRNVS
FT                   RGIVLLDHAERDGLDGFITITGGKLMTYRLMAEWATDLVCKKLNKTARCVTAEQALPGS
FT                   TESRQETNQKVISLPSTIRYSAVYRHGSRATRLLEKERLDRSMVCECEAVTAGEVRYAV
FT                   DELDVNNLVDLRRRSRVGMGTCQAELCACRAAGLINRFEVATPRQSTTQLSAFMEERWR
FT                   GIEPIAWGEAIREAEFTSWMYASVLGLNDVKPLDEQAQQGTDSNEF"
FT   CDS_pept        590862..592160
FT                   /transl_table=11
FT                   /locus_tag="HICON_08040"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase
FT                   (anaerobic), membrane anchor subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86270"
FT                   /protein_id="CBY86270.1"
FT                   /translation="MNFDVAIIGGGLAGLTCGIALQQRGKRCVIINNGQAAIDFASGSL
FT                   DLLSRMPSTTYGENRAVENLKENITALRNELPAHPYSLLGAEKVLAKAQDFERLANELN
FT                   LDLIGSTEKNHWRVTGLGSLRGAWLSPNSVPTVQGNEPFPHKRIAVLGIEGYHDFQPQL
FT                   LAANLVLNPQFEHCEVTSGFLNIPQLDELRKNAREFRSVNISQLLEHKLAFKDLVKEII
FT                   ESAQGAEAVFLPACFGLENQEFMTALRDATKLALFELPTLPPSLLGMRQRIQLRHKFES
FT                   LGGLMINGDSALNATFEGNKVRCINTRLLENEEITADNFVLASGSFFSKGLISEFDKIY
FT                   EPVFESDIIGVEGFNQKDRFTWTAHRFAHPQPYQSAGVAINAQCQVKKCGQFLTNLYAV
FT                   GNVIGGFNALELGCGSGVAVVTALAVADEILAK"
FT   CDS_pept        592172..593452
FT                   /transl_table=11
FT                   /locus_tag="HICON_08050"
FT                   /product="sn-glycerol-3-phosphate dehydrogenase
FT                   (anaerobic), small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86271"
FT                   /protein_id="CBY86271.1"
FT                   /translation="MDNNIQRLIDSAKQSLNSPESYKYIDESFESCIKCTACTAVCPVS
FT                   RNNPLYPGPKQSGPDGERLRLKSAELYDEALKYCTNCKRCEVACPSDVKIGDLIVRARN
FT                   NHLAQSKKPLMNKLRDAILSNTDVMGKINTPLAPIVNTITSLKATKFMLEKTLKISKER
FT                   TLPKYAFGTFRSWYMKNALQDQQKFERKVAYFHGCYVNYNNPQLGKEFLKVFNAMNIGV
FT                   MLLEKEKCCGLPLMVNGFPNRARNIAQFNTDYIGKMVDENGIDVISEASSCSLNLRDEY
FT                   HHILGIDNAKVRPHIHMVTPFLYQLFKEGKTLPLKPLKLRVAYHTACHVDKAGWAPYTL
FT                   EVLKKIPGLEIIMLPSQCCGIAGTYGFKSENYEISQSIGKNLFDNINEGGFDYVISECQ
FT                   TCKWQIDMSSNVTCIHPLTLLCMSMDA"
FT   CDS_pept        complement(593563..595041)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08060"
FT                   /product="ketol-acid reductoisomerase, NAD(P)-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86272"
FT                   /protein_id="CBY86272.1"
FT                   /translation="MANYFNTLNLRQKLDQLGRCRFMDREEFADEANFLKGKKIVIVGC
FT                   GAQGLNQGLNMRDSGLDISYALRPEAIAEKRASFQRATENGFKVGTYEELIPTADLVVN
FT                   LTPDKQHSKVVADVMPLMKKDSAFGYSHGFNIVEVGEEIRKDITVVMVAPKCPGTEVRE
FT                   EYKRGFGVPTLIAVHPENDPKGEGMAIAKAWAAATGGHKAGVLESSFVAEVKSDLMGEQ
FT                   TILCGMLQAGSIVCYDKLVADGKDPAYAGKLIQYGWETITEALKQGGITLMMDRLSNSA
FT                   KLRAFELAEQIKESLGFLYYKHMDDIISGHFSATMMADWANGDKDLFAWREATGKTAFE
FT                   NAPKYDGKISEQEYFDNGVLMIAMVKAGVELAFDAMVASGIYEESAYYESLHELPLIAN
FT                   TIARKRLYEMNVVISDTAEYGNYLFSNVATPILAKEIIPNLQKGDLGEPTPAVEVDNIT
FT                   LRDVNDAIRNHPVELIGQELRGYMTDMKRIAVAG"
FT   CDS_pept        595694..596572
FT                   /transl_table=11
FT                   /locus_tag="HICON_08070"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86273"
FT                   /protein_id="CBY86273.1"
FT                   /translation="MEFTDLQIFIHLSDTKNFTKTATQNHMSPSTLSRQIQRLEDELGK
FT                   TLFIRDNRQVKLTEYGEKFLQFAKTEWQNWQQFKQQLKDESDELCGEIKLFCSVTASYS
FT                   HLPHVLKEFRQRYPKVEIQLTTGDPALALELIQAQQVDLALAGKPNNLPSSVVFHKIDD
FT                   ISLSLIAPRVACLATQLLQEKPIDWQQMPFIFPVEGHARQRIEQWLREKQIKHPKIYAT
FT                   VAGHEGIVPMVGLGFGLAMLPDAVIDSSPMNNQISRLNLDKPIEPFELGICTQKRNLEQ
FT                   PLVRAFWAMLE"
FT   CDS_pept        596604..597482
FT                   /transl_table=11
FT                   /locus_tag="HICON_08080"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86274"
FT                   /protein_id="CBY86274.1"
FT                   /translation="MFKGILVSLLASFLFGYMYYFSTLLKPLSGTDIFGYRMIFTFPFV
FT                   LLSVTLFKQKAALIERLKRIQKRPHLALSYLLCGLLMGFQMWLFLWAPNNGSSLSVSFG
FT                   YLLLPIVMVAAGRVFFKERISTFKFIAVIIATLGVISNIVLKGGLSWEAIVICLGYTAY
FT                   FSIRKALKNTDLASFCLEMLSLMPVSIYFALQTDFATVQQTNPFIWGLLVLLGLISGTA
FT                   LIAYVIASNMLPMNLLGLLGYVETIMMLCVSFLIGEQIDSESYPLFICLVIAMILVMVD
FT                   GVYKQHAKGSL"
FT   CDS_pept        597483..597800
FT                   /transl_table=11
FT                   /locus_tag="HICON_08090"
FT                   /product="thiosulfate:cyanide sulfurtransferase
FT                   (rhodanese)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86275"
FT                   /protein_id="CBY86275.1"
FT                   /translation="MSFKEITPQQAWEMMQQGAILVDIRDNMRFAYSHPKGAFHLTNQS
FT                   FLQFEELADFDSPIIVSCYHGVSSRNVATFLVEQGYENVFSMIGGFDGWCRAELPIDTA
FT                   Y"
FT   CDS_pept        complement(597883..598674)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08100"
FT                   /product="triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86276"
FT                   /protein_id="CBY86276.1"
FT                   /translation="MARRPLVMGNWKLNGSKAFTKELIEGLKAELHDVTGCDVAIAPPV
FT                   MYLGTAEAALSGCGCSCGGKSVIQLGAQNVDINVKGAFTGDISSEMLKDFGAKYIIIGH
FT                   SERRTYHKESDEFVAKKFGALKEAGLVPVLCIGESEAENEAGKTEEVCARQIDAVINAL
FT                   GVEAFNGAVIAYEPIWAIGTGKSATPAQAQAVHAFIRGHIAAKSQAVAEQVIIQYGGSV
FT                   NDANAAELFTQPDIDGALVGGASLKAPAFAVIVKAAAAAKN"
FT   CDS_pept        598840..599280
FT                   /transl_table=11
FT                   /locus_tag="HICON_08110"
FT                   /product="Triosephosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86277"
FT                   /protein_id="CBY86277.1"
FT                   /translation="MKLFKAEQWNIEVLLPLFEAYRQAYGQAENPERTLAFLTNRMRFN
FT                   ESLFFIAVDENEKAIGFVQLFPRLSSLQLQRYWQITDIFVLEHAQQTEIYAALISKAKD
FT                   FVHFTQSNRLVAELAQNQYSMLESEGFKLNPKERLFELSLSC"
FT   CDS_pept        599274..600161
FT                   /transl_table=11
FT                   /locus_tag="HICON_08120"
FT                   /product="site-specific tyrosine recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86278"
FT                   /protein_id="CBY86278.1"
FT                   /translation="MLTALNRYWDYLRIERQMSPHTITNYQHQLDATIKILAQQDIHSW
FT                   TQVTPSVVRFILAESKKQGLKEKSLALRLSALRRFLSFLVQQGELKVNPATGISAPKQG
FT                   WHLPKNMDGEQIQQLLANDSKEPIDIRDRAILELMYSSGLRLSELQGLDLNSINTRVRE
FT                   VRVIGKGNKERVVPFGRYASHAIQEWLKVRALFNPKDEALFVSQLGNRISHRAIQKRLE
FT                   TWGIRQGLNSHLNPHKLRHSFATHMLEASSDLRAVQELLGHSNLSTTQIYTHLNFQHLA
FT                   EVYDQAHPRAKRKK"
FT   CDS_pept        complement(600214..601668)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08130"
FT                   /product="aminoacyl-histidine dipeptidase (peptidase D)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86279"
FT                   /protein_id="CBY86279.1"
FT                   /translation="MSEITTLQPSLLWKWFDQICAIPHPSHYEDTLANFIVNWAKEKHF
FT                   FVERDEVGNVLIRKPATKGMENHTPVVLQAHLDMVPQANEGNPHDFTKDPIQPYIDGEW
FT                   VKARGTTLGSDNGIGLASTLAVLESNDLAHPPLEVLLTMTEETGMDGAKGLRHNWLQSE
FT                   ILINTDTEEIGEIYIGCAGGINANFEIPVQYETNTFEHSAQITLKGLRGGHSGGDIHTG
FT                   RANAIKVLARVLAKLSQNGPHFALSEIRGGSIRNAIPREIVAVLAFNGDVKAIESAVEN
FT                   LAVILKEELAIAEPNFTLFVESAEKAPTVFTAQSTQTVINALNVLPNGVIRNSDVVKNV
FT                   VESSLSVGVLKTEGNVVKSTILVRSLIESGKYYVTEMLSSLAILANAKVEFSAPYPGWQ
FT                   PVNDSTILDVTRKHYAEVLGEQPVVKVIHAGLECGLLKEHYPNIEMISVGPTIRNAHSP
FT                   DEKVEIATVQTYWDLLTRVLADIPAK"
FT   CDS_pept        601779..602246
FT                   /transl_table=11
FT                   /locus_tag="HICON_08150"
FT                   /product="guanine-hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86280"
FT                   /protein_id="CBY86280.1"
FT                   /translation="MSEKYVVTWDMFQMHARRLSERLLPASQWKGIIAVSRGGLFPAAV
FT                   LARELGLRHIETVCIASYHDHNNQGELQVLHAAQVPNGGEGFIVVDDLVDTGNTARAIR
FT                   QMYPNAKFVTVFAKPAGAELVDDYVIDIPQNTWIEQPWDLGLTFVPPLSRK"
FT   CDS_pept        602369..602647
FT                   /transl_table=11
FT                   /locus_tag="HICON_08160"
FT                   /product="Cell division protein ftsB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86281"
FT                   /protein_id="CBY86281.1"
FT                   /translation="MRLLILILLSVLVLFQYNFWFGSNGFLDYRQNAEKIKENQAENEK
FT                   LSQRNQRINAEIQGLTKGFEAIEERARMQHGLVKENEVFYHIVKESK"
FT   CDS_pept        602647..603324
FT                   /transl_table=11
FT                   /locus_tag="HICON_08170"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86282"
FT                   /protein_id="CBY86282.1"
FT                   /translation="MARSIIAVLPAAGVGSRMQADKPKQYLTLLGKTLLEHTLDVMLSY
FT                   PAVSKIILAVSKDDPYISTLSLDPKIQLVEGGTTRAESVLNGLNAIAEKNAWVLVHDAA
FT                   RPCLQHADIDKLLAIEDKQGAILAIPVTDTIKRADNQQCIVKTEDRSQLWQAMTPQFFP
FT                   VDILRDALSTGIQQGANITDEASAIELAGFRPHLVAGRSDNLKVTRPEDLALAEFYLTR
FT                   NKL"
FT   CDS_pept        603321..603797
FT                   /transl_table=11
FT                   /locus_tag="HICON_08180"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86283"
FT                   /protein_id="CBY86283.1"
FT                   /translation="MIRIGHGFDVHAFGEDRPLIIGGVEVPYHTGFIAHSDGDVALHAL
FT                   TDAILGAAALGDIGKLFPDTDMQYKNADSRGLLREAFRQVQEKGYKIGNVDITIIAQAP
FT                   KMRPHIDAMRAKIAEDLQCDIEQVNVKATTTEKLGFTGRQEGIACEAVALLIRQ"
FT   CDS_pept        complement(604102..604536)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08190"
FT                   /product="D-tyr-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86284"
FT                   /protein_id="CBY86284.1"
FT                   /translation="MIALIQRVSQAKVDVNGETIGKIGKGLLVLLGVEKEDNREKADKL
FT                   AEKVLNYRIFSDENDKMNLNVQQAQGELLIVSQFTLAADTQKGLRPSFSKGASPALANE
FT                   LYEYFIQKCAEKLPVSTGQFAADMQVSLTNDGPVTFWLNV"
FT   CDS_pept        complement(604533..604973)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08200"
FT                   /product="FMN-binding protein MioC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86285"
FT                   /protein_id="CBY86285.1"
FT                   /translation="MHICILSGSTLGGAEYVAEHLNDVLETQGFSTALFHGPNLSDIEN
FT                   EKIWLIITSTHGAGELPDNLKPLFDELANSQKDFSDVRFAVIGLGSSDYDTFCYAADKV
FT                   EQTLQAKSAVKICETLKIDVLNVDDQESYAEEWLPSFIEGLK"
FT   CDS_pept        complement(605070..605288)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08210"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86286"
FT                   /protein_id="CBY86286.1"
FT                   /translation="MSLEILDQLEEKIKQAVETIQLLQLEVEELKEKNAESQRNIENLQ
FT                   TENEQLKNEHRNWQEHIRSLLGKFDNV"
FT   CDS_pept        605450..606451
FT                   /transl_table=11
FT                   /locus_tag="HICON_08220"
FT                   /product="fructose 1,6-bisphosphatase II"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86287"
FT                   /protein_id="CBY86287.1"
FT                   /translation="MNRALAIEFSRVTEAAALAAYTWLGRGDKNAADDAAVKAMRYMLN
FT                   LIHMDAEIVIGEGEIDEAPMLYVGEKVGSGLGELVSIAVDPIDGTRMTAMGQSNAISVL
FT                   AAGGKNTFLKAPDMYMEKLVVGSNVKGIIDLNLPLEQNLRRIASKLGKSLSDLTVMVLA
FT                   KPRHDAVIKQIHNLGAKVLAIPDGDVAGSVLCCLPDAEVDLLYGIGGAPEGVAAAAAIR
FT                   ALGGDMQARLIPRNEVKSDTEENKKIAANEIQRCAALGVKVNEVLKLEDLVRDDNLVFT
FT                   ATGITNGDLLKGISRKGNLASTETILIRGKSRTVRKIQSIHYLDDLYKILNI"
FT   CDS_pept        606651..606959
FT                   /transl_table=11
FT                   /locus_tag="HICON_08230"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86288"
FT                   /protein_id="CBY86288.1"
FT                   /translation="MNNLSAQLENQIDELKKLQKSVITYEQAQRQQLYAGKITDLKAFG
FT                   KMLNDKRKSLGIELSMLELQTGVSISTLNRLFQDPSQVRFTTVFLVAQTLGVSLCAI"
FT   CDS_pept        606947..607267
FT                   /transl_table=11
FT                   /locus_tag="HICON_08240"
FT                   /product="Flavodoxin"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86289"
FT                   /protein_id="CBY86289.1"
FT                   /translation="MRNLVRSGKVFLYGEFIGLLREDHRGFHFSYNPDYQGIPISLSFP
FT                   IEQSPFHSDTLFPYFASLVPEGWLKHKYALHQRIDESDMFRFLLNNGENMLGAVQIQEE
FT                   KQ"
FT   CDS_pept        607264..608295
FT                   /transl_table=11
FT                   /locus_tag="HICON_08250"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86290"
FT                   /protein_id="CBY86290.1"
FT                   /translation="MNFCRILLKPLKKNEVHSGYSTKGLHYLTGNKNFNPELPFSRQEF
FT                   ITVKPQKQQGMSISGFQPKLQLIIEDEHFDSVNQQGNYILKPSPEEYPFLAENEHATMR
FT                   IMKELGFDVPENGLVSFAGEQNHKEFAFVIKRFDRDEQQKTMHQEQLDGAMNIRDKYGK
FT                   IGADNEQYVSYERVAKFILQHTENHLAQQREIFRRIIYAYLLGNNDLHLRNFSFIYPKN
FT                   SHPKLAPIYDFVSVSPYPEIFNSTLLALPLLAREEGNATLAKGFNTQYGEYIGGDFVEF
FT                   GENIGLNKNVIIQKLIPEITQEKEKVEQIYSQSFMPQPHIDCVLKTYRKRLALLNLLNE
FT                   PEL"
FT   CDS_pept        complement(608378..610036)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08260"
FT                   /product="probable ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86291"
FT                   /protein_id="CBY86291.1"
FT                   /translation="MRKNGFVVMGHLLKLVTPLAHIMAFTITMGTLGFLAAIFIMVLGA
FT                   MGLVNLLNFDTHLSFSGILTALIVLAVARGVLRYLEQMSGHYIAFKLLALLRDKVFSSL
FT                   RRLAFVKLQDKQAGQLVSLVTNDIELLEVFYAHTIAPIMIAFFTSAILLLVFAQLSGWF
FT                   VLVALAAYLTVGVILPIITTKLAREDGRRYRELVGEMNDFFLDSVRGMKEIQLFGYAKQ
FT                   RLAEIQQRSQKIDTAFERIKDQEAKVRVYTEVAVSVFNIIMLFTGLILFSLDKIDFAAF
FT                   LIGVILLMSSYGPVIALSNLSSNLLQTLASGERVLSLLAEEPELKDVESAVDLKDVSCI
FT                   DVENVNFAYGEEQILSDVSLSVKKGEILGIHGRSGSGKSTLLKLLMRFYDPKSGSIKIN
FT                   GETLPNINTRSLRDNMAYITQQTYIFNETIEENIRLARRDATLEEIMEAAKKASIHDFI
FT                   LSLPQGYQTKMTELGGNLSDGEKQRIGIARAFLHNAPIILLDEPTSNLDSLNEAMILKS
FT                   LLNVKAEKLIILVSHRQSTMAICDQVIGIENGRMS"
FT   CDS_pept        complement(610029..611774)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08270"
FT                   /product="probable ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86292"
FT                   /protein_id="CBY86292.1"
FT                   /translation="MMIDKRLINTVADSKKWIGITVLWNWVALVGGIISAVVFSYILQA
FT                   AYFHELSLLSAVILGILLIAALALRAFAGKKSVQASYFASTKVKHELRSLIYRKLASMP
FT                   LNQVNQQSTSSIIQVASEGVEQLEIYFGRYLPQLFYSLLAPLTLFVFLIFFSFKTAVIL
FT                   LICVPLIPMSIIAVNKIAKKLLAKYWSIYVGLGSSFLDNLQGLITLKIYQDDAYKAKEM
FT                   DKEAEHFRKITMKVLTMQLNSVSLMDLLAYGGAAIGILTALLQFQDAQLSVLGVILFIL
FT                   LSSEFFIPLRLLGSFFHVAMNGKAASDKIFTLLDTPVETQQSAVNFEAKNNLQVEIKDL
FT                   HFSYSEEKPAITGLDLSILPNQLSVFVGKSGCGKSTLVSLLMGFNKAQQGEILFNGQNA
FT                   LNIDRTSFYQKVSLVSHSSYVFKGSLRENMTMAKIDATDEQIYACLEQVNLAQFVRENG
FT                   GLDMQLLSRGANLSGGQIQRLALARALLHNAELYIFDEATSNIDVESEEIILQFIQQFK
FT                   QQKTIVMISHRLANAVNADCINVLDQGKLIEQGTHETLMSKQGAYAEMFQQQKDLEQIR
FT                   EVANA"
FT   CDS_pept        join(612074..612151,612156..615011)
FT                   /transl_table=11
FT                   /gene="hgpB"
FT                   /locus_tag="HICON_08280"
FT                   /product="Hemoglobin and hemoglobin-haptoglobin-binding
FT                   protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86293"
FT                   /protein_id="CBY86293.1"
FT                   /translation="MTNFRLNVLAYSVMLGLTASVAYAEPTNQPTNQPTNQPTNQNSNA
FT                   SEQLEQINVSGSTENTDTKAPPKIAETVKTAKTLEREQANNIKDIVKYETGVTVVEAGR
FT                   FGQSGFAIRGVDENRVAINIDGLRQAETLSSQGFKELFEGYGNFNNTRNGAEIETLKEV
FT                   NITKGADSIKNGSGSLGGSVIYKTKDARDYLLNKDYYVSYKKGYATENNQSFNTLTLAG
FT                   RYKKFDVLVVTTRRNGHELENYDYKNADSLTQGKKREKADPYKIEQDSTLLKLSFNPTE
FT                   NHRFTFAADLYEHRSRGQDLSYTLKYQKTNPNLPEDDSRHTNDKTKRRNISFSYENFSQ
FT                   TPFWDTLKITYSDQRIKTRARTDEYCDAGVRHCEGTDNPAGLTVTNGKITRRDGTELEF
FT                   KKKDGSNDTYDFKKFIDTDDQVIEDKLTLGNPSDTWYDCSIFNCKNDTKIKVFEGNYRY
FT                   GYDGKWKEVDLEIKELNGKKFAKIKADNYSKIKSILPSSPGYLDNLWQERDLDTNTQQL
FT                   NLDLTKDFKTWHIEHNLQYGGSYNTTMKRMVNRAGNDASDVQWWATPTLGNHWSGKPHT
FT                   CATTSEWNANLCPVVDPEFSYLLPIKTKGKSVYLFDNFVITDYLSFDLGYRYDNIHYQP
FT                   KYKHGITPKLPDDIVKGLFIPLKSNTDDDIKKNVQQNIDYIAKQNKKYKAHSYSFVSTI
FT                   DPTSFLRLQLKYSKGFRTPTSDEMYFTFKQPDFTILPNTDLKPEISKTKEIAFTLHNDD
FT                   WGFISTSLFKTNYKNFIDLVYKGEKIFSVGNRGGTQSYRLHQNINRDNASLKGIEINSK
FT                   VFLGKMAKFMDGFNLSYKYTYQKGRMNGNIPMNAIQPKTMVYGLGYDHPDHKFGFDFYT
FT                   THVASKNPEDTYNMFYKEEGKTDSTIKWRSKSYTILDFIGYVQPIKNLTIRAGVYNLTN
FT                   RKYITWDSARSIRSFGTSNVIEQSTGLGINRFYAPGRNYKMSVQFEF"
FT   CDS_pept        615472..616176
FT                   /transl_table=11
FT                   /locus_tag="HICON_08290"
FT                   /product="(alpha)-aspartyl dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86294"
FT                   /protein_id="CBY86294.1"
FT                   /translation="MKNMLLLSSSKYKNTGYLEHTLPWLQNFLADYRGKTIAFVPYAGV
FT                   SRTFDEYEKTVQNALSDLGMNIVSVHRGKQHRDIIEQADVIAIGGGNTFCLLKQLYEHN
FT                   LIDIIREKVNNGTPYFGWSAGANVAGASIMTTNDMPITYPPSFQALQLFPHQINPHFIS
FT                   GKMQGHNGESREERLAEFLLVNPTAFVYALPEGSALHIQNEMATVLGENPILCFSENME
FT                   CGTFDINTTFSY"
FT   CDS_pept        616194..617489
FT                   /transl_table=11
FT                   /locus_tag="HICON_08300"
FT                   /product="Predicted C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86295"
FT                   /protein_id="CBY86295.1"
FT                   /translation="MELFKSIVAVIGIIATIYFLIKKAETRTVLIGVGLIMSILTLNPM
FT                   GALDAFAKSMTSGGLIMAICSSMGFAYVMKYTQCDTHLVHLLTKPLSGLKFFLIPIATV
FT                   ITFFINIAIPSAAGCAAAVGATLIPVLKSAGVRPATAGAAILAGTFGSMMSPGSSHSAM
FT                   ISEMSGLTITQVNLSHAPYNMIAGAIGAVVLTILALVFKDYGKQHRKAYLAEQKESEIK
FT                   VVEGVNVLYALAPLIPLVILVIGGTSLQQVPGLEWTKMGVPQAMLIGAIYGIIVTRISP
FT                   VKITEEFFNGMGNSYANVLGIIIAASVFVAGLKSTGAVDAAISFLKESNEFVRWGATIG
FT                   PFLMGLITGSGDAAAIAFNTAVTPHAVELGYTHVNLGMAAAIAGAIGRTASPIAGVTIV
FT                   CAGLAMVSPVEMVKRTAPGMILAVLFLALFML"
FT   CDS_pept        complement(617612..618868)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08310"
FT                   /product="Histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86296"
FT                   /protein_id="CBY86296.1"
FT                   /translation="MSVKYQSIKGMKDVLPSESPKWIFFERIIIEWMKKYGYEQIRTPI
FT                   IENTNLFIRSIGEATDIVEKEMYSFVDSLNKDKLTLRPEGTVACLRACLENNLLYNSTQ
FT                   RLWYMGPMFRHEKPQKGRYRQFTQVGIEALGLEGPDIDAEMITMTKDLWNQLGFKNIEL
FT                   QVNTLGTVAERVKYRNILIKYLEDNIDVLDEDGRRRLYSNPLRVLDSKNKSMQDICNNA
FT                   PKLIEYLGKDSLCHYYTWLNFLEKLGISYVENTRLVRGLDYYNNSVFEWVSYANESPLT
FT                   FCAGGRYNGLMEELGGESKAGIGFAMGVERVLDMLDTKVIPENNNLIYIVHFGNNTDEY
FT                   GLLIAQKLRNIGFNVKQDFEHSSIKSQLKRADKYNARFSIIIGENEVYLNKVKVKEMKS
FT                   RNEVLIDLNNLIDFFIKNN"
FT   CDS_pept        complement(join(619045..619335,619334..619447,
FT                   619449..619682,619681..619836))
FT                   /transl_table=11
FT                   /locus_tag="HICON_08320"
FT                   /product="GABA permease"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86297"
FT                   /protein_id="CBY86297.1"
FT                   /translation="MSDKEVNKSLTLRHIQFLALGSAIGTGLFYGSYESIKLAGSSVIF
FT                   GYLIVGFLLFYTQLNKDSLEQIASINNLIKYGGFFPNGLEGFIYSLSIIAFSFGGIEII
FT                   GISAGETLDPKKSIPIAIRSVPFRIIFFYIFTIFIILTIVPWNNLDSSKSPFVIIFEYI
FT                   GIPYFSDILNIVIISASISAINSDVFSASRIIYSMSKRNQAPIILSRISKQGIPWLVVL
FT                   LVSFLLCFGIFLNYLFPDKVFIFIASSASVITIFVWIIIQFY"
FT   CDS_pept        complement(619902..621053)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08330"
FT                   /product="Histidine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86298"
FT                   /protein_id="CBY86298.1"
FT                   /translation="MKLSMKDQVKLDEFYGYCLKNRFFNLGYPESADIDYSVLEKFWNI
FT                   NFNNCGDWAEYCNFKLNTFEFEKDVMEYFYDLFKISKEDAWGYVTNGGTEGNMFGIWLA
FT                   RETFPNSTLFYSKEAHYSAAKIVTLLRMKSCVVERQKDGVVDYEDLINKILQSGEKHPI
FT                   ILANLGSTVHGAIDDISKIQKLMSQAGFKREDYYIHGDAALSGMILPFVDDPQPHTFSD
FT                   GLDSIGVSGHKMLASPIPCGIAIGRKKLVDNITVEVDYIAAHDKTITGSRNGHTPLVLW
FT                   TAIKGHTFDAFKARIDRCLSMADYVVNRIRSAGYNAWKHKNSITVVVPRPEESVWEKWS
FT                   LAPSGNEVHVVTTAHNEWETERVEQLCDELIENYRKINCQDKI"
FT   CDS_pept        complement(621077..622438)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08340"
FT                   /product="putative amino acid permease"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86299"
FT                   /protein_id="CBY86299.1"
FT                   /translation="MSSEISVKKAKKMGVLALTLVTASNMMGSGVFLLPTNLGSIGAIS
FT                   IFGWIITILGVMALALVFAKTSLIHEKIGGIVAYSRDAFGPFVGFQSTVAYWVSAWIGN
FT                   VALLVAGVGYLAYFFPILKDPTVGTTYSCIVAIAILWIYVFLSSFGAKVAGSAQSFTAL
FT                   CGLAVILGVGIFGWFYFKPETYLEVINDTGNSNFSAIIAAASLAFWGFLGVESAVVSTG
FT                   QVENPEKTVPKATVYGLLIAAVCYVASSTVIAGIIPHEVLKNSSAPFADVVKYMFDSEL
FT                   AGSIASALSILACFGSISGWFILQSEAPRAAAESGLFPKWFAELNKNDVPMKSLIFTAV
FT                   LMCCVLLLTASPNLAEQFQIVILMSVYCSLLPYLYTITALPILWTAKKLKKDGNYKWHT
FT                   LLVLISILYCMFALVGSGADSIFLGTLLVTFMIPVFTFPALKLINNKELDVKID"
FT   CDS_pept        622948..624918
FT                   /transl_table=11
FT                   /locus_tag="HICON_08350"
FT                   /product="2':3'-cyclic-nucleotide 2'-phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86300"
FT                   /protein_id="CBY86300.1"
FT                   /translation="MNRRHFIQIGATSILALSANRFAMAKGKSDVELRIVATTDVHSFL
FT                   TDFDYYKDAPTDKFGFTRAASLIRQARAEVKNSVLVDNGDLIQGNPIADYQAAQGYKEG
FT                   KSNPAVDCLNAMNYEVGTLGNHEFNYGLNYLADAIKQAKFPIVNANVVKAGTEEPYFTP
FT                   YVIQEKSVVDNNGKTHKLKIGYIGFVPPQIMVWDKANLQGKVETRDIVKTAQKYVPEMK
FT                   KKGADIVVALAHTGPSDEPYQEGAENSAFYLADVPHIDAVIFGHSHRLFPNKEFAKSPN
FT                   ADIVNGTVKGVPESMAGYWANNISVVDLGLTEHNGKWIVTSGKAVLRPIYDVETKKALA
FT                   KNDPEITALLKPVHEATRKYVSQPIGKATDNMYSYLALVQDDPTIQIVNQAQKAYVEKV
FT                   APSVAAMAGLPILSAGAPFKAGGRKNDPTGYTEVNKGKLTFRNAADLYLYPNTLVVVKA
FT                   TGEQLKEWLECSAGMFKQIDPTSDKPQSLIDWEGFRTYNFDVIDGVNYEYDLTKPARYD
FT                   GECKLINPESHRVVNLTYQGKPVDPKAEFLIATNNYRAYGNKFPGTGDQHIVYASPDES
FT                   RQILADYIKATSEKEGSVNPNADKNWRFVPITGNDKLDVRFETSPSEQAAKFIAEKAQY
FT                   PMKQVGTDEVGFAVYQIDLSK"
FT   CDS_pept        625603..627492
FT                   /transl_table=11
FT                   /locus_tag="HICON_08360"
FT                   /product="glucose-inhibited cell-division protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86301"
FT                   /protein_id="CBY86301.1"
FT                   /translation="MFYTETYDVIVIGGGHAGTEAALAPARMGFKTLLLTHNVDTLGQM
FT                   SCNPAIGGIGKGHLVKEVDAMGGLMAHAADKAGIQFRTLNSSKGPAVRATRAQADRVLY
FT                   RQAVRTALENQPNLDIFQQEATDILIEQDRVTGVSTKMGLTFRAKSVILTAGTFLAGKI
FT                   HIGLENYEGGRAGDPASVNLSHRLRDLGLRVDRLKTGTPPRIDARTINFDILTKQHGDE
FT                   VLPMFSFMGSVDDHPQQIPCYITHTNEQTHEVIRNNLDRSPMYTGMIEGIGPRYCPSIE
FT                   DKVMRFSDRNSHQIYLEPEGLTSNEVYPNGISTSLPFDVQMGIVNSMKGLENARIVKPG
FT                   YAIEYDYFDPRDLKPTLETKSISGLFFAGQINGTTGYEEAAAQGLLAGINAGLYVQEKD
FT                   AWYPRRDQSYTGVLVDDLCTLGTKEPYRVFTSRAEYRLLLREDNADIRLTPIAHELGLI
FT                   DEARWARFNQKMENIEQERQRLRSIWLHPRSEYLEEANKVLGSPLVREASGEDLLRRPE
FT                   MTYDILTSLTPYKPAMEDKEAVEQVEIAIKYQGYIEHQQEEIEKQKRHENTAIPANFDY
FT                   SKVSGLSNEVRAKLEQHRPVSIGQASRISGITPAAISIILVNLKKQGMLKRGE"
FT   CDS_pept        627675..628049
FT                   /transl_table=11
FT                   /locus_tag="HICON_08370"
FT                   /product="30S ribosomal subunit protein S12"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86302"
FT                   /protein_id="CBY86302.1"
FT                   /translation="MATINQLVRKPRVKKVVKSNVPALEACPQKRGVCTRVYTTTPKKP
FT                   NSALRKVCRIRLTNGFEVTSYIGGEGHNLQEHSVVLIRGGRVKDLPGVRYHTVRGALDC
FT                   AGVKDRKQGRSKYGVKRPKA"
FT   CDS_pept        628207..628677
FT                   /transl_table=11
FT                   /locus_tag="HICON_08380"
FT                   /product="30S ribosomal subunit protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86303"
FT                   /protein_id="CBY86303.1"
FT                   /translation="MPRRRSVEARKILPDPKFGSELLAKFINVIMVDGKKSVAESIVYG
FT                   ALETLAQRTGKEPLEAFEVALENVRPTVEVKSRRVGGSTYQVPVEVRPVRRNALGMRWI
FT                   VEAARKRGDKSMALRLANELSDASDNKGAAVKKREDVHRMAEANKAFAHYRW"
FT   CDS_pept        628761..630863
FT                   /transl_table=11
FT                   /locus_tag="HICON_08390"
FT                   /product="protein chain elongation factor EF-G,
FT                   GTP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86304"
FT                   /protein_id="CBY86304.1"
FT                   /translation="MARTTPIERYRNIGISAHIDAGKTTTTERILFYTGVSHKIGEVHD
FT                   GAATMDWMEQEQERGITITSAATTAFWSGMSQQFPQHRINVIDTPGHVDFTVEVERSMR
FT                   VLDGAVMVYCAVGGVQPQSETVWRQANKYEVPRIAFVNKMDRTGANFLRVVEQLKTRLG
FT                   ANAIPLQLPVGAEENFTGVVDLIKMKAINWNEADQGMTFTYEEVPANMQADCEEWRQNL
FT                   VEAAAEASEELMEKYLGGEDLTEEEIKSALRQRVLANEIILVTCGSAFKNKGVQAMLDA
FT                   VVEYLPAPTDIPAIKGINPDETEGERHASDEEPFSSLAFKIATDPFVGNLTFFRVYSGV
FT                   INSGDTVLNSVRQKRERFGRIVQMHANKREEIKEVRAGDIAAAIGLKDVTTGDTLCAID
FT                   APIILERMEFPEPVISVAVEPKTKADQEKMGLALGRLAQEDPSFRVHTDEESGETIISG
FT                   MGELHLDIIVDRMKREFKVEANIGKPQVSYRETIRTRVNDVEGKHAKQSGGRGQYGHVV
FT                   IDLYPLDPEGPGYEFVNEIKGGVIPGEYIPAVDKGIQEQLKSGPLAGYPVVDLGVRLHF
FT                   GSYHDVDSSELAFKLAASLAFKAAFSKANPVLLEPIMKVEVETPPEYVGDVIGDLSRRR
FT                   AMVNGQEANEFVVKIDAEVPLSEMFGYATDLRSQTQGRASYSMEPLKYAEAPTSVAAAV
FT                   IEARKK"
FT   CDS_pept        630928..632112
FT                   /transl_table=11
FT                   /locus_tag="HICON_08400"
FT                   /product="Elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86305"
FT                   /protein_id="CBY86305.1"
FT                   /translation="MSKEKFERTKPHVNVGTIGHVDHGKTTLTAAITTVLAKHYGGAAR
FT                   AFDQIDNAPEEKARGITINTSHVEYDTPTRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVAATDGPMPQTREHILLGRQVGVPYIIVFLNKCDMVDDEELLELVEMEVRELLSQYDF
FT                   PGDDTPIVRGSALQALNGVAEWEEKILELAGHLDTYIPEPERAIDQPFLLPIEDVFSIS
FT                   GRGTVVTGRVERGIIRTGDEVEIVGIKDTAKTTVTGVEMFRKLLDEGRAGENIGALLRG
FT                   TKREEIERGQVLAKPGSITPHTDFESEVYVLSKDEGGRHTPFFKGYRPQFYFRTTDVTG
FT                   TIELPEGVEMVMPGDNIKMTVSLIHPIAMDQGLRFAIREGGRTVGAGVVAKIIK"
FT   CDS_pept        complement(632242..632529)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08410"
FT                   /product="Conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86306"
FT                   /protein_id="CBY86306.1"
FT                   /translation="MLYTFSQSDYPKTELDDYFSYITEKDAVVLWQNGVLLAIKYPDYF
FT                   AKCKGNCMILKQDILARNLTALLPQSSKIKLISIEELVGITENYLPQLSL"
FT   CDS_pept        complement(632538..632897)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08420"
FT                   /product="predicted intraceullular sulfur oxidation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86307"
FT                   /protein_id="CBY86307.1"
FT                   /translation="MKIAFLFRTSPHGTSISREGLDAILAATAFCEPNDIGIFFIDDGV
FT                   LNLIDNQQPEIIQQKDFIRTFKLLDLYDVEQRFICTASLQKFKLDNRELILSCEKIDRS
FT                   LLLEKLNQAEKLFTF"
FT   CDS_pept        complement(632894..633274)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08430"
FT                   /product="predicted intraceullular sulfur oxidation
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86308"
FT                   /protein_id="CBY86308.1"
FT                   /translation="MRYVIAVKSPIYGKQGAFLAYQFADALIKKGHEISQIFFFQDGVS
FT                   NGNALVYPANDEVNLQKHWQMFSITYNIPLHLCVAASQRRGVVDNLTTPTTAHYNLAEG
FT                   FTIAGLGEFIAASLNADRVITL"
FT   CDS_pept        complement(633274..633939)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08440"
FT                   /product="predicted DNA-binding transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86309"
FT                   /protein_id="CBY86309.1"
FT                   /translation="MTLNDKYPFTDEDQAIINSYKPVVDGVSALIGEHCEIVLHSLENI
FT                   EHSAVCIANGHNTNRQVGSPITDLALRSLRNMQSESVSKPYFTRAKGSVLMKSVTIAIR
FT                   NKTQRIIGLLCININLDVPMFQFLQCFMPTEHTNETSSVNFANSVEDLVTQTIEKTIEE
FT                   VNADRAVANNTKNRQIVLSLYEKGIFDIKDAINLVAERLDISRHTVYLYIRQIKQEQE"
FT   CDS_pept        complement(634029..634754)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08450"
FT                   /product="FKBP-type peptidyl-prolyl cis-trans isomerase
FT                   (rotamase)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86310"
FT                   /protein_id="CBY86310.1"
FT                   /translation="MLKIQKLSIAALMVSAVISGQVFAEDNTFDEKAASYAVGTLMGSQ
FT                   MKDLVDSHKEVIKYDNARILDGLKDALEGKVDVRKDEKIQKTLESIEAKLVAASKAKAE
FT                   SIAKQAKEEGDKFRAEFAKGKDVKTTQSGLMYKIESAGKGDTIKSTDTVKVHYTGKLPN
FT                   GKVFDSSVERGQPVEFQLDQVIKGWTEGLQLVKKGGKIQLVIAPELGYGEQGAGTSIPP
FT                   NSTLIFDVEVLDVNPKSEK"
FT   CDS_pept        634852..635073
FT                   /transl_table=11
FT                   /locus_tag="HICON_08460"
FT                   /product="Protein SlyX homologue"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86311"
FT                   /protein_id="CBY86311.1"
FT                   /translation="MQIQQMLENRIEELEMKIAFQEQLLDELNHALVQQQFDIDKMQVQ
FT                   LRYMANKLKDFQPSNIASQSEETPPPHY"
FT   CDS_pept        complement(635161..635886)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08470"
FT                   /product="DNA-binding transcriptional regulator OxyR"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86312"
FT                   /protein_id="CBY86312.1"
FT                   /translation="MSSVEGKKVPQVTFRTRQGDKWVDVTTSELFDNKTVIVFSLPGAF
FT                   TPTCSSSHLPRYNELAPVFKKYGVDDILVVSVNDTFVMNAWKEDEKSENITFIPDGNGE
FT                   FTEGMGMLVGKEDLGFGKRSWRYSMLVKNGVVEKMFIEPNEPGDPFKVSDADTMLKYLA
FT                   PQHQVQESISIFTKPGCPFCAKAKQLLHDKGLSFEEIILGHDATIVSVRAVSGRTTVPQ
FT                   VFIGGKHIGGSDDLEKYFA"
FT   CDS_pept        636010..636915
FT                   /transl_table=11
FT                   /locus_tag="HICON_08480"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86313"
FT                   /protein_id="CBY86313.1"
FT                   /translation="MNIRDLEYLVALSEYKHFRRAADSCNVSQPTLSGQIRKLEDELGI
FT                   ILLERTSRKVLFTQSGMLLVDQARTVLREVKLLKEMASNQGKEMTGPLHIGLIPTVGPY
FT                   LLPYIVPMLKAAFPDLEVFLYEAQTHQLLEQLETGRLDCAIVATVPETEAFIEVPIFNE
FT                   KMLLAVSEHHPWAQESKLPMNQLNGQEMLMLDDGHCLRNQALDYCFTAGAKENSHFQAT
FT                   SLETLRNMVAANAGITFMPELAVLNEGTRKGVKYIPCYSPEPSRTIALVYRPGSPLRNR
FT                   YERVASAVSDEVKSILDGLK"
FT   CDS_pept        636915..637532
FT                   /transl_table=11
FT                   /locus_tag="HICON_08490"
FT                   /product="DNA-binding transcriptional repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86314"
FT                   /protein_id="CBY86314.1"
FT                   /translation="MAGVRAVQKEKTRRALVDAAFNQLSAEKSFSNLSLREVAREAGIA
FT                   PTSFYRHFSDMDELGLEMVDEAGLMLRQLMRQARKRIDAGGSVISVSVDTFFEFITNST
FT                   NVFRLLLRESSGTSQAFRTAAAREIKHFVDELAEYISYKHQYSQYVAYVQAEGIVTIVF
FT                   TAGANALDMSKAEREQLKARVILQLRMLAKGADFAANKERGK"
FT   CDS_pept        complement(637590..638078)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08500"
FT                   /product="transcription elongation factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86315"
FT                   /protein_id="CBY86315.1"
FT                   /translation="MAKSNYITRQGWLALDQELKFLWKEERSKVTQAVSDAAALGDRSE
FT                   NAEYIYGKRRLREIDRRVRFLTKRLEVLQIVDYNPKQEGKVFFGAWVELENEEGETKQY
FT                   RIVGCDEFAPAKNWISIDSPVARALIGKTLDDEVRVETPSGFITLYINKIWYENNSEK"
FT   CDS_pept        638173..640485
FT                   /transl_table=11
FT                   /locus_tag="HICON_08510"
FT                   /product="predicted transcriptional accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86316"
FT                   /protein_id="CBY86316.1"
FT                   /translation="MLNQQISQIIAAELTVQPQQILAAIQLLDDGNTIPFIARYRKEAT
FT                   GGLDDTQLRHFETRLIYLRELEERRQTILKSIEEQGKLTDELRDKIDATQSKTELEDLY
FT                   LPYKPKRRTKGQIAIEAGLEPLADLLWNEPKNDPESTAFSFVDAEKGVADSKAALDGAR
FT                   YILMERFAEDAGLLAKVRDYLAKNAVIVSKVIEGKETEGAKFQDYFDHQELLKKVPSHR
FT                   ALAMFRGRNEGILQLSLNADPDAEEGSRQSYCEEIIRDYLDVRFTGQPADKWREQVIAW
FT                   TWKIKVSLHLETELMASLREKAEEEAIDVFARNLTALLMAAPAGAKSTMGLDPGLRTGV
FT                   KVAVVDNTGKLLDTTTIYPHTGREAEAQVAIFSLIRKHNVELIAIGNGTASRETERFAK
FT                   DVIKEIKENKPQTVVVSEAGASVYSASEFAANEFPNLDVSLRGAVSIARRLQDPLAELV
FT                   KIEPKAIGVGQYQHDVNQTQLARKLDAVVEDCVNAVGVDLNTASAPLLARVAGMTKTLA
FT                   QNIVEYRDENGRFESRAELKKVPRLGPKAFEQCAGFMRIANGKNPLDASGVHPEAYPVV
FT                   EKILQATAQSIQDLMSNASVVRQLDAKQFIDEQFGLPTVQDIFKELEKPGRDPRGEFKT
FT                   AVFAEGVEEITDLKPGMILEGTVTNVTNFGAFVDIGVHQDGLVHISSLSDKFVEDPHQV
FT                   VKTGNIVKVKVLEVDVSRKRIALTMRLDESAVKNDGKSDRTLSARPRGNTQREARSSRG
FT                   NNAMGNAFADALKNWKK"
FT   CDS_pept        640611..643031
FT                   /transl_table=11
FT                   /locus_tag="HICON_08520"
FT                   /product="DNA gyrase, subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86317"
FT                   /protein_id="CBY86317.1"
FT                   /translation="MSETTNDNYGASSIKVLKGLDAVRKRPGMYIGDTDDGTGLHHMVF
FT                   EVVDNAIDEALAGHCSDIIVTIHDDNSVSVQDDGRGIPVDIHPEEGVSAAEVIMTVLHA
FT                   GGKFDDNSYKVSGGLHGVGVSVVNALSDKLQLTIRRQGHVHEQFYHLGEPQSPLTVIGE
FT                   TEATGTTVRFWPSSDIFAITTFDYKILAKRLRELSFLNSGVSIRLIDKRDGSEDHFHYE
FT                   GGIQAFVEYLNKNKNPIHPKPFYFTAEKDGIGVEVALQWNDGVNENVYCFTNNIPQRDG
FT                   GTHLAGFRGALTRSLNSYMENEGMLKKEKVATSGDDAREGLVAIISVKVPDPKFSSQTK
FT                   DKLVSSEVKSAVESAMNEKMQEYLLENPADAKIIVNQIIMAARAREAARKAREMTRRKG
FT                   ALDIAGLPGKLADCQEKDPALSELYLVEGDSAGGSAKVGRDRKTQAILPLKGKILNVEK
FT                   ARFDKMLSSQEVGTLITALGCGIGRDEYNPDKLRYHHIIIMTDADVDGSHIRTLLLTFF
FT                   YRQMPELIERGYVYIAQPPLYKVKKGKQERYIKDADEMEQYELTLALDGAELHISANAP
FT                   AMNALVFEKLVAEYNSVQKLIGRLNRHYPVPVLQGLIYQSPISVEMMKNESAVENWGKS
FT                   FVEQLTAKETEAHQYSVRTQFNAERQVYEAVITVRKHGIDTDYFLNFDFVHGNEYAKIV
FT                   SLNKQLNGLLEEGAYVIRGEKVQPVRSFEQVVEWLVKESRKGLEVQRYKGLGEMNADQL
FT                   WETTMDPNSRRMLKVSIKDAVAADQLFTTLMGDEVEPRREFIELNALRANLDV"
FT   CDS_pept        643183..643857
FT                   /transl_table=11
FT                   /locus_tag="HICON_08530"
FT                   /product="D-ribulose-5-phosphate 3-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86318"
FT                   /protein_id="CBY86318.1"
FT                   /translation="MKPYLIAPSILSADLARLGDDVQNVLNAGADVIHFDVMDNHYVPN
FT                   LTFGSAVCQALRDYGITAPIDVHLMVKPIDRIIPDFAKAGANYITFHPESSEHIDRSLQ
FT                   LIRDCGCKSGLVFNPATPLSYLDYVLDKVDVVLLMSVNPGFGGQSFIPATLKKLQQARK
FT                   IIDESGYDIRLEVDGGVKVDNIAEIAAAGADMFVAGSAIFGKPDYKQVIDQMRTQLARV
FT                   SV"
FT   CDS_pept        643903..644577
FT                   /transl_table=11
FT                   /locus_tag="HICON_08540"
FT                   /product="phosphoglycolate phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86319"
FT                   /protein_id="CBY86319.1"
FT                   /translation="MNTQFKLIGFDLDGTLVNSLPDLALSVNSALAEFNLPQAPEELVL
FT                   TWIGNGAPVLIARALDWAKKQTGKVLTETEVKQVTERFNFYYGENLCNVSRLYPNVKET
FT                   LETLKEKGYVLAVVTNKPTKHVQPVLAAFGIDHLFSEMLGGQSLPAIKPHPAPLYYLCG
FT                   KFGFEPRQVLFVGDSKNDIIAAHAAGCAVVGLTYGYNYNIPIRESNPDWVFDDFAQLLS
FT                   IL"
FT   CDS_pept        complement(644642..645634)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08550"
FT                   /product="asparagine synthetase A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86320"
FT                   /protein_id="CBY86320.1"
FT                   /translation="MKKTFILQQQEISFVKNTFTQNLIEQLGIIEVQGPILSQVGNGMQ
FT                   DNLSGIEKAVQVNVKCIPNAVFEVVHSLAKWKRHTLARFNFKEDEGLFVHMKALRPDED
FT                   SLDPTHSVYVDQWDWEKVIPEGRRNFAYLKETVNSIYRAIRLTELAVEARFDIPSILPK
FT                   QITFVHSEDLVKRYPDLSSKERENAICKEYGAVFLIGIGGKLSDGKPHDGRAPDYDDWT
FT                   TESENGYKGLNGDILVWNDQLGKAFELSSMGIRVDESALRLQVGLTGDEDRLKMDWHQD
FT                   LLNGKLPLTIGGGIGQSRLAMLLLRKKHIGEVQSSVWPKEMLEEFSNIL"
FT   CDS_pept        645788..646240
FT                   /transl_table=11
FT                   /locus_tag="HICON_08560"
FT                   /product="DNA-binding transcriptional dual regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86321"
FT                   /protein_id="CBY86321.1"
FT                   /translation="MHNIDSLDRQILRVLTKDARTPYAEMAKNFGVSPGTIHVRVEKMR
FT                   QSGIIEGTKVIIDERKLGYDVCCFIGIILKSAKDYEKVIKKLESFDEVVEAYYTTGNYS
FT                   IFLKVMTHTIAELHSVLATKIQLIDEIQSTETLISMQNPILRDIKP"
FT   CDS_pept        complement(646267..646662)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08570"
FT                   /product="ribosome-associated heat shock protein Hsp15"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86322"
FT                   /protein_id="CBY86322.1"
FT                   /translation="MAEKEVRLDKWLWAARFYKTRSIAKAMIESGKVHYNNQRAKVSKI
FT                   VEVGVMLKLRQGNEEKEIKIIALSDQRRGAPEAQLLYQETENSVKKREEIAWARKNNSL
FT                   SMPHPDRRPNKKERRDLLKFKHQDKFE"
FT   CDS_pept        646893..648878
FT                   /transl_table=11
FT                   /locus_tag="HICON_08580"
FT                   /product="Predicted membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86323"
FT                   /protein_id="CBY86323.1"
FT                   /translation="MHNENLKELTVRGIILGALITVIFTASNVYLGLKVGMTFASSIPA
FT                   AVISMAVLKFFKDSSILENNMVQTQASSAGTLSSVIFVLPGLLMMGYWQDFPFWQTMLI
FT                   CAAGGTLGVLFTIPLRRAMVVNSNLPYPEGVAAAEILKAGNHADGDSGVKDIAYGGVLA
FT                   GLVAFLTNGLRVMADGASAWIQTSKAAFQLPMGFSLALLGAGYLIGIVGGIAMLIGVIL
FT                   TWGVAVPYFTMSGDIAADASLIDAAMVVWKTKVRFIGVGTIGIAAIWTLLILMKPMIEG
FT                   MVHSFRMLKGGQVESEHRVDIDLSPKTMIYILIATVVLVVISLHHFISAAPISPELSIL
FT                   LVVVCTFLAVFIGFFVAAASGYMAGLVGSSSSPISGIGIISVIVTSLVLVSIGNASGLF
FT                   ETVDGQKFLTALTLFTASIVITTACISNDNLQDLKTGLLVEATPWRQQVALIIGCFVGA
FT                   LVIAPVLEILYHAYGFSGALPRPDMDPSQALSAPQATLMTTISQGIFTNKLEWTYILTG
FT                   IGLGAVLITIDAFLKKVSNKVFSLPVIAVGIGIYLPPSINTPVIVGAFLAWIMARHIAK
FT                   LGNKEVSAKAERFGTLFSAGLIVGESLMGVILAFIIAASVTTGGSEAPLSLNLENWDTI
FT                   GEWFGLIVFIVGIVIFASRVLRAKKI"
FT   CDS_pept        648935..649351
FT                   /transl_table=11
FT                   /locus_tag="HICON_08590"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86324"
FT                   /protein_id="CBY86324.1"
FT                   /translation="MKSYLKTLIFFPLILQIVVTALLIWFDDDSSGVIVPFSSYALTAF
FT                   LLATIPAFLTALLAAKFRYTRYNIASIVLVSSIISFVYCNMASYFYLLLLGEQDTSFWG
FT                   WLTEGGLSLGLISTCGMVFYALFVMPWLLPKTRE"
FT   CDS_pept        649356..650165
FT                   /transl_table=11
FT                   /locus_tag="HICON_08600"
FT                   /product="DNA-binding transcriptional regulator CysQ"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86325"
FT                   /protein_id="CBY86325.1"
FT                   /translation="MLTLKEHLLNQVLLIAYQAGKHLQQFYQKQVHVELKEDNTPVTEA
FT                   DLFVSQFLTEKLTALFPNVHVLSEENCHISFEERKNWKEYWLIDPLDGTQQFINRTDQF
FT                   SVLITLVRKNKPVLSIIHAPILSTTYYAMRDFGAFKKQLDQVKKLTKNTTNFDRPLRIA
FT                   VGATTSQEKVRSILPKDFPCEFVVVGSSSLKSGLVAEGAVDCYVRLGQTGEWDTAGAEV
FT                   LLGETHGAIFDSHFEPLTYNQRETLINPHFVMVGDQSFDWRSVFQFN"
FT   CDS_pept        650241..651725
FT                   /transl_table=11
FT                   /locus_tag="HICON_08610"
FT                   /product="glucose-6-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86326"
FT                   /protein_id="CBY86326.1"
FT                   /translation="MQTDNNCIVIFGASGDLTHRKLIPALYNLYKIGRLSENFSVLGVA
FT                   RSDLNDETFRKKMREALIHNEETTPETLDAFCSHLYYQAVNTSDAQDYGKLVPRLDDLH
FT                   DKYQTCGNTFYYMSTPPNLYGVIPECLAAHGLNTEEYGWKRIIVEKPFGYDEKTAQTLD
FT                   VQIHRFFEEHQIYRIDHYLGKETVQNLLVLRFSNGWFEPLWNRNFIDYVEITGAESIGV
FT                   EDRGGYYDGSGAMRDMFQNHLLQVLAMVAMEPPAIINANSMRDEVAKVMHSLRPLTSED
FT                   MENNLVLGQYTAAEINGKMEKGYLEEKGVPANSRTETYIALRCEIENWRWAGVPFYVRT
FT                   GKRLPARVTEIVIHFKTTPHPVFSQNAPENKLIIRIQPDEAISMRFGLKKPGAGFEAKE
FT                   VSMDFRYADLAGAQVLTAYERLLLDAMKGDATLFARTDAVHAAWKFVQPILDYKANGGR
FT                   IHEYEAGTWGPVAADKLIAKQGKVWRKPSGLMKKKV"
FT   CDS_pept        651810..652508
FT                   /transl_table=11
FT                   /locus_tag="HICON_08620"
FT                   /product="6-phosphogluconolactonase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86327"
FT                   /protein_id="CBY86327.1"
FT                   /translation="MNYISFPTAQHAVDKIAQEFVIYSQLTHPVHISLSGGSTPKLLFK
FT                   TLAKSPYAEQINWKNLHFWWGDDRMVPPSDPESNYGEVQKLLFDHIQIPTENIHRIRGE
FT                   NEPHFELKRFEEELSAVIPNGVFDRIILGMGTDGHTASLFPHQTNFDDENLAVIAKHPE
FT                   SGQIRISKTAKLIEQAKRITYLVTGESKADILKEIQTTPAENLPYPAAKIKAKNGVTEW
FT                   YLDKAAARLL"
FT   CDS_pept        652848..653381
FT                   /transl_table=11
FT                   /locus_tag="HICON_08630"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86328"
FT                   /protein_id="CBY86328.1"
FT                   /translation="MTTKYNAGIHHRRSIRLKHYNYRSEGFYFITICCKNKECLFGHII
FT                   NQQMQLNDLGNYVKQCWENIPMFFPQVRIDEFVIMPNHLHGIIEIIEQVKGKCNLPLQS
FT                   RAAQKGTSQTIGSIVRGFKAGVTSWARKNSEIFDVWQRNYYEHIIRDEKSYLQIYEYIQ
FT                   NNPILWEQDKLYVD"
FT   CDS_pept        653806..655260
FT                   /transl_table=11
FT                   /locus_tag="HICON_08640"
FT                   /product="gluconate-6-phosphate dehydrogenase,
FT                   decarboxylating"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86329"
FT                   /protein_id="CBY86329.1"
FT                   /translation="MSVKGDIGVIGLAVMGQNLILNMNDHGFKVVAYNRTTSKVDEFLQ
FT                   GAAKGTNIIGAYSLEDLAAKLEKPRKVMLMVRAGDVVDQFIEALLPHLEEGDIIIDGGN
FT                   SNYPDTNRRVKALAEKGIRFIGSGVSGGEEGARHGPSIMPGGNQEAWQYVKPIFQAISA
FT                   KTEQGEPCCDWVGGEGAGHFVKMVHNGIEYGDMQLICEAYQFLKEGLGLSYEEMQAIFA
FT                   EWKKTELDSYLIDITTDILGYKDESGEPLVEKILDTAGQKGTGKWTGINALDFGIPLTL
FT                   ITESVFARCVSSFKDQRVAANQLFGKTITPVEGDKKVWIEAVRKALLASKIISYAQGFM
FT                   LIREASEQFGWDINYGATALLWREGCIIRSRFLGNIRDAYEANPNLVFLGSDSYFKGIL
FT                   ENALSDWRKVVAKSIEVGIPMPCMASAITFLDGYTSARLPANLLQAQRDYFGAHTYECT
FT                   DKPRGEFFHTNWTGRGGNTASTTYDV"
FT   CDS_pept        complement(655386..656009)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86330"
FT                   /protein_id="CBY86330.1"
FT                   /translation="MLSLTTESCELFNIPFYQFAQMKKFCPEDIPAIKADYKLHWDNWK
FT                   AIIQSVSAQLGTPFAKPHIESWTNGWQVRAHFFAYFKYEFNQNSAAIFSVLLNRRRLRV
FT                   CLDWHCYRADRSQINVQQYNQWLDQFDFKQFADFEIWREDESEYDDFRQVKVISEKNLI
FT                   LRSDEDFWCIGKSIEKAELNQIDPVLFITHTIQQLQPLYDRCHQ"
FT   CDS_pept        complement(656019..656846)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08660"
FT                   /product="diadenosine tetraphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86331"
FT                   /protein_id="CBY86331.1"
FT                   /translation="MATYFVGDLQGCYDELQLLLERVDFNPTQDKLYLVGDLVARGDKS
FT                   LECLRFVKSLGNAAQTVLGNHDLHLIATALGIKKVKPHDRVDAIFNAPDFDELIHWLRH
FT                   QPLLVHNEKLNFLMVHAGISPDWDLKTAKSCAAEVEQILQHGDFHYLIENMYSEQPDRW
FT                   SPDLQGLARHRYIINAFTRMRFCYLDHRFDFACKSPLKDAPAELTPWFNLDNPLYKQIP
FT                   IVFGHWASLVDEPTPKGIYALDTGCVWNNRMTMLRWEDKQFFTQSAVKNYSDF"
FT   CDS_pept        656965..657837
FT                   /transl_table=11
FT                   /gene="lic2A"
FT                   /locus_tag="HICON_08670"
FT                   /product="UDP-Gal--lipooligosaccharide
FT                   galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86332"
FT                   /protein_id="CBY86332.1"
FT                   /translation="MSAIENIVISMENATERRKHITKQFESKKLSFSFFNAYTYQSINQ
FT                   SINQSINQSINQSNSILHNIEESRILTKGEKGCLISHFLLWNKCVNENLEYLKIFEDDV
FT                   ILGENAEVFLNQNEWLKTRFDFNDIFIIRLETFLQPVKLEKQTKIPPFNSRNFDILKST
FT                   HWGTAGYIISQGAAKYLIEYLKNIPSDEIVAVDQLIFNKLVDVDNYIVYQLNPAICIQE
FT                   LQANQSKSVLTSGLEKERQKRPKIRKKKTLKQRLTRIKENIIRALNRKKWKEQQRIKEM
FT                   QGKEIVRFM"
FT   repeat_region   657085..657136
FT                   /note="CAAT x13"
FT   CDS_pept        complement(657876..658739)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08680"
FT                   /product="S-adenosylmethionine-6-N',N'-adenosyl (rRNA)
FT                   dimethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86333"
FT                   /protein_id="CBY86333.1"
FT                   /translation="MNSKKHLGHTARKRFGQNFLHNTSVIQGIVAAIYPQPNQFLVEIG
FT                   PGLGALTEPVGELVDHLTVVELDRDLAERLRHHPFLHQKLTVIETDAMQFDFGALYTKE
FT                   NLAEKGQKLRVFGNLPYNISTPLMFHLFKYHDVIQDMHFMLQKEVVKRLCAAPNSKAYG
FT                   RLTIMAQYFCQVMPVLEVPPSAFKPAPKVDSAVVRLIPHKELPHPVKDLYWLNRVCSQA
FT                   FNQRRKTLRNALSTLFSPENLTALGIDLNARAENLAIADYARLANWLADNPPADVNKDE
FT                   ILDSEE"
FT   CDS_pept        complement(658823..659875)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08690"
FT                   /product="LPS biosynthesis related protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86334"
FT                   /protein_id="CBY86334.1"
FT                   /translation="MTKLITISLTCQKFQYSGGMERYLLDIVNGLSKTNITPKIYSAKF
FT                   DTTLSEYNLINPIKINLSFVPKKWRTSFLSYFSNKYKETSEVSLTTSYTLSDVVICGGN
FT                   HKGYLQASKKKPSISDRFKIMGEQKSLNQSKYVIAHSALMKKELVELYHIPENKIDVIY
FT                   PPINTDKFTQINEEERMKLREKLGFKKDEIIYLFPSTGHTRKGFDILKKYFEKTQLPIR
FT                   LVVAGTPVEENPKISSLGFCKNMPELYQAADFTIMASQYEPFGLVGLESILSGTPVIFS
FT                   ENMGCLEVLQNEFGYTFSRENISTLDDAIQKSVKQASEQQHRIFNPMDCIRYNPSLSHH
FT                   IKAILEVIAK"
FT   CDS_pept        complement(659888..660898)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08700"
FT                   /product="putative galactosyl transferase Lic2B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86335"
FT                   /protein_id="CBY86335.1"
FT                   /translation="MQSSFAIVSSKNNRFFIRTLGGKVKKNGRIIAVFNVRRKIKIKLN
FT                   RKKITLIMQKPFLSKYDPQMHINYVISLTSAYQRREHIQKEFSQQNIPFEFFDALKPSK
FT                   ELTSLIEKFIPNLLHAKLTEGEKACFMSHYMLWQKCLSEDLPYIYIFEDDVLLGENADK
FT                   FLAEDEWLEERFKQTDKFILRFETFLNFSKCKDKKIKPYSGRKILKLVSENCGAAGYVI
FT                   SREAVKQLSTHICSLTSNHLLAIDLLMFNIFNQSTYQVSPGVCVQEEQLYPNDIKLHSQ
FT                   LETERQKYLSVKKKRTLKTVLISLAGKPKKILRKIYRKLFISKHIVPFRWSNIIL"
FT   CDS_pept        660879..661097
FT                   /transl_table=11
FT                   /locus_tag="HICON_08710"
FT                   /product="translation initiation factor IF-1"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86336"
FT                   /protein_id="CBY86336.1"
FT                   /translation="MAKEDCIEMQGTILETLPNTMFRVELENGHVVTAHISGKMRKNYI
FT                   RILTGDKVTVEMTPYDLSKGRIIFRSR"
FT   CDS_pept        661299..661676
FT                   /transl_table=11
FT                   /locus_tag="HICON_08720"
FT                   /product="30S ribosomal subunit protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86337"
FT                   /protein_id="CBY86337.1"
FT                   /translation="MRHYEIVFMVHPDQSEQVPGMIERYTGSVKEAGGQVHRLEDWGRR
FT                   QLAYPINKLHKAHYVLMNVEAPQQVIDELETTFRYNDAVLRSLVIHTKHAVTEASPMKA
FT                   AKEERKPLAEVENNDFEDAEE"
FT   CDS_pept        661663..661989
FT                   /transl_table=11
FT                   /locus_tag="HICON_08730"
FT                   /product="primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86338"
FT                   /protein_id="CBY86338.1"
FT                   /translation="MLKSNLKIDNRFSVMGVVSQLPKRLKSPSGIEHCKFLLEHCSDQI
FT                   ESGFTRQAWLKMPVQISGNQLIEKTQSITVGSKILVVGFITSHKTQSGLCQLVLHAEQI
FT                   EFID"
FT   CDS_pept        662002..662229
FT                   /transl_table=11
FT                   /locus_tag="HICON_08740"
FT                   /product="30S ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86339"
FT                   /protein_id="CBY86339.1"
FT                   /translation="MARYFRRRKFCRFTAENVVEIDYKDIATLKNYISESGKIVPSRIT
FT                   GTRAKYQRQLARAIKRARYLALLPYTDNHQ"
FT   CDS_pept        662246..662695
FT                   /transl_table=11
FT                   /locus_tag="HICON_08750"
FT                   /product="50S ribosomal subunit protein L9"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86340"
FT                   /protein_id="CBY86340.1"
FT                   /translation="MQVILLDKIVHLGQVGDQVNVKSGFARNFLIPQGKAVMATKANIE
FT                   HFEARRAELEATAAANLAAAQARAAEVTALGSVTIASKAGDEGRLFGAITTRDVAEAVT
FT                   AAGVKIAKSEVRLPNGPIRTLGDHDVRFQLHGEVFATLDVIVVAE"
FT   CDS_pept        complement(662869..664515)
FT                   /transl_table=11
FT                   /gene="haef1A"
FT                   /locus_tag="HICON_08760"
FT                   /product="60 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86341"
FT                   /protein_id="CBY86341.1"
FT                   /translation="MAAKDVKFGNDARVKMLKGVNVLADAVKVTLGPKGRNVILDKSFG
FT                   APTITKDGVSVAREIELEDKFENMGAQMVKEVASKANDAAGDGTTTATVLAQAIVNEGL
FT                   KAVAAGMNPMDLKRGIDKAVSAVVSELKNLSKPCETAKEIEQVGTISANSDSIVGQLIS
FT                   QAMEKVGKEGVITVEDGTGLEDELDVVEGMQFDRGYLSPYFINKPETATVELDNPYLLL
FT                   VDKKISNIRELLPVLEGVAKAGKPLLIIAEDVEGEALATLVVNTMRGIVKVAAVKAPGF
FT                   GDRRKAMLQDIAILTAGTVISEEIGMELEKATLEDLGQAKRVVINKDNTTIIDGIGDEA
FT                   QIKGRVAQIRQQIEESTSDYDKEKLQERVAKLAGGVAVIKVGAATEVEMKEKKDRVDDA
FT                   LHATRAAVEEGIVAGGGVALVRAAAKVAASLKGDNEEQNVGIKLALRAMEAPLRQIVTN
FT                   AGEEASVVASAVKNGEGNFGYNAGTEQYGDMIEMGILDPTKVTRSALQFAASVAGLMIT
FT                   TECMVTDLPKDDKADLGAAGMGGMGGMGGMM"
FT   CDS_pept        complement(664537..664827)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08770"
FT                   /product="10 kDa chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86342"
FT                   /protein_id="CBY86342.1"
FT                   /translation="MNIRPLHDRVIIKREEVETRSAGGIVLTGSAATKSTRAKVLAVGK
FT                   GRILENGTVQPLDVKVGDTVIFNDGYGVKSEKIDGEEVLIISENDILAIVE"
FT   CDS_pept        664990..665292
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="HICON_08780"
FT                   /product="Urease subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86343"
FT                   /protein_id="CBY86343.1"
FT                   /translation="MHLTSREQEKLMLFLAGELAAKRKARGVKLNYPETIAYIASHLQE
FT                   AARDGMSVAEVMQYGSTLLTVDDVMEGVAEMVHEVQIEATFPDGTKLVTVHNPIR"
FT   CDS_pept        665369..665674
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="HICON_08790"
FT                   /product="Urease subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86344"
FT                   /protein_id="CBY86344.1"
FT                   /translation="MIPGEYQLAEGDILANVGRKTVKIEVTNSGDRPIQVGSHYHFFET
FT                   NNALKFDRTLARGMRLNVPSGNAVRFEPGEVKSVELVAFGGNQIIYGFHNQIDGKL"
FT   CDS_pept        665686..667404
FT                   /transl_table=11
FT                   /gene="ureC"
FT                   /locus_tag="HICON_08800"
FT                   /product="Urease subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86345"
FT                   /protein_id="CBY86345.1"
FT                   /translation="MALTISRAQYVATYGPTVGDKVRLGDTNLWATIEQDLLTKGDECK
FT                   FGGGKSVRDGMAQSGTATRDNPNVLDFVITNVMIIDAKLGIIKADIGIRDGRIVGIGQA
FT                   GNPDTMDNVTPNMIIGASTEVHNGAHLIATAGGIDTHIHFICPQQAQHAIESGVTTLIG
FT                   GGTGPADGTHATTCTPGAWYMERMFQAAEALPVNVGFFGKGNCSTLDPLREQIEAGALG
FT                   LKIHEDWGATPAVIDSALKVADEMDIQVAIHTDTLNESGFLEDTMKAIDGRVIHTFHTE
FT                   GAGGGHAPDIIKAAMYSNVLPASTNPTRPFTKNTIDEHLDMLMVCHHLDKRVPEDVAFA
FT                   DSRIRPETIAAEDILHDMGVFSIMSSDSQAMGRIGEVVIRTWQTADKMKMQRGELGNEG
FT                   NDNFRIKRYIAKYTINPAIAHGIAEHIGSLEVGKIADIVLWKPMFFGVKPEVVIKKGFI
FT                   SYAKMGDPNASIPTPQPVFYRPMYGAQGLATAQTAVFFVSQAAEKADIREKFGLHKETI
FT                   AVKGCRNVGKKDLVHNDVTPNITVDAERYEVRVDGELITCEPVDSVPLGQRYFLF"
FT   CDS_pept        667532..668089
FT                   /transl_table=11
FT                   /gene="ureE"
FT                   /locus_tag="HICON_08810"
FT                   /product="Urease accessory protein ureE"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86346"
FT                   /protein_id="CBY86346.1"
FT                   /translation="MKIINPILPIIENILGNLTALQADGKITTQPIERIALQWYESERN
FT                   ILRKTTNTGREVAFRLLKEGQRLKHDDVVFISDELVIAIEILPSDVIVLSPKTLPEMAR
FT                   ACYEIGNKHSPLFLDGDEVTLPYDKPMFEWLQAAGFHPQKAERRLSQALRANSAQGHGH
FT                   SHSHSHDHHGYHHHGDGHWHKH"
FT   CDS_pept        668074..668781
FT                   /transl_table=11
FT                   /gene="ureF"
FT                   /locus_tag="HICON_08820"
FT                   /product="Urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86347"
FT                   /protein_id="CBY86347.1"
FT                   /translation="MAQTLNRSLTDLGALLHLVDPTLPIGGFNHSNGLETFVQQRVVES
FT                   KATLEEYVQTQLLQNWIYNDGAYLSLAFDAMCEGNFDRLCELDWQLSATKVARESREGS
FT                   FKLGVRLLKIFIRYETHTLLTAYQQAIAEKRVQGYFPIVFAMVAQAMGLSKADTLYAFY
FT                   YNAAVGVITNGVKLIPLSQMDGQDILFDLRGSLVQAVELSLDPDEEWLGAATLANDIRA
FT                   MQHEVLYTRLYMS"
FT   CDS_pept        668927..669562
FT                   /transl_table=11
FT                   /gene="ureG"
FT                   /locus_tag="HICON_08830"
FT                   /product="Urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86348"
FT                   /protein_id="CBY86348.1"
FT                   /translation="MRNYIKIGVAGPVGAGKTALIEKLTREIASKYSVAVITNDIYTQE
FT                   DAEFLTKNSLLPPERIMGVETGGCPHTAIREDASMNLEAVDEMVARFPDVEIVFIESGG
FT                   DNLSATFSPDLADVTIFVIDVAQGEKIPRKGGPGITRSDLLVINKTDLALFVGADLSVM
FT                   ECDARRMRNGQPFIFTNLMKKENLDGVIGWIEKYALLKHVEEPASLVR"
FT   CDS_pept        669637..670452
FT                   /transl_table=11
FT                   /gene="ureH"
FT                   /locus_tag="HICON_08840"
FT                   /product="Urease accessory protein UreH"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86349"
FT                   /protein_id="CBY86349.1"
FT                   /translation="MNSKLSLSTKLSSRGKTRLAEYFATPPFKVITLPSYDDAWANGLS
FT                   AMQMSSSPGVLACDLLEIDISLAKSTALSLNTQAFTRVQAMNEGDSAMQTTHILLAENS
FT                   RLFYLPHPLVLHKDSVFKQQTQIEMGEQSELIYGEIVAIGRVLNDERFAFRQFSSHLKI
FT                   YTLKDDGKKRPLVSDCIQWLPSKMNLTALSQMENYSHQGSLTYLNLAKNNAEIKQQVQA
FT                   LQQQSTEEKDLLIGISQLNEYGLMVRVLGCRAEQIQKLFEKIGRLLKSV"
FT   CDS_pept        670608..672026
FT                   /transl_table=11
FT                   /locus_tag="HICON_08850"
FT                   /product="aspartate ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86350"
FT                   /protein_id="CBY86350.1"
FT                   /translation="MTQFRKEVDLLGERDVPAEAYWGIHTLRAVENFNISNVTISDVPE
FT                   FVRGMVMVKKATALANGELGAIPSDIAKAIVAACDEILTTGKCLDQFPSDVYQGGAGTS
FT                   VNMNTNEVVANLALEKIGHKKGEYNVINPMDHVNASQSTNDAYPTGFRIAVYNSILKLI
FT                   DKIQYLHDGFDNKAKEFANILKMGRTQLQDAVPMTVGQEFKAFAVLLEEEVRNLKRTAG
FT                   LLLEVNLGATAIGTGLNTPQGYTELVVKHLAEVTGLACVPAENLIEATSDCGAYVMVHG
FT                   ALKRTAVKLSKVCNDLRLLSSGPRAGLKEINLPELQAGSSIMPAKVNPVVPEVVNQVCF
FT                   KVIGNDTTVTFASEAGQLQLNVMEPVIGQAMFESIDILTNACVNLRDKCVDGITVNKEI
FT                   CENYVFNSIGIVTYLNPFIGHHNGDLVGKICAQTGKGVREVVLEKGLLTEEQLDDILSV
FT                   ENLMNPAYKAKLNK"
FT   CDS_pept        complement(672330..674219)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08860"
FT                   /product="RNA polymerase, sigma 70 (sigma D) factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86351"
FT                   /protein_id="CBY86351.1"
FT                   /translation="MGKNQQSTAEQYSEQIEQLMELGRTQGYLTFAEINDLLPEDAIDP
FT                   EYYDKLLQTLQNDAGIPVLDEAPESDDMMLSDTIPDEDAVEEATQILSNVESEIGRTTD
FT                   PVRMYMREMGTVDLLTREDEISIAKRIEGGIDEVQTSIAAYPEALNGLLKNYDDVEKGN
FT                   FRLTDLITGFVDPNAEIEEHNGLDEDFSDEDDEEESSNADVENNEDEEDNESESTSDSS
FT                   DSDNSIDPEVAREKFQQLREQHSKTLAVIEKHGRSGKRAQDQIALLGEIFKQFRLVPKQ
FT                   FDLLVLSMKEMMKRVRYQERQLQKILVDIAGMPKDDFEKIITTNGSNSEWVAKALKSSK
FT                   PWAKRLIKYEDRIYEALNNLAITEENTKLTITQMRDICDAVARGEQKARRAKKEMVEAN
FT                   LRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGYKFSTYATWWIRQAITRS
FT                   IADQARTIRIPVHMIETINKLNRISRQLLQEMGREATPEELAERMGMPEDKIRKVLKIA
FT                   KEPISMETPIGDDDDSHLGDFIEDSTLELPLDSATAQSLKVATHEVLEGLTPREAKVLR
FT                   MRFGIDMNTDHTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSETLRSFLDE"
FT   CDS_pept        complement(674289..676070)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08870"
FT                   /product="DNA primase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86352"
FT                   /protein_id="CBY86352.1"
FT                   /translation="MKGSIPRPFIDDLLTKSDIVDVINTRVKLKKAGRDYQACCPFHHE
FT                   KTPSFTVSQKKQFYHCFGCGAHGNAISFLMDYDKLEFVEAIEELAAMAGLEIPYEKRAN
FT                   HSGKPQANYQTKRNLYELMQEIATFYQNQLPLNSQAQEYLQQRGLSAEIIERFQIGFVP
FT                   NAMDTVLRKFGVNREEQQKLIELGMLSRNDRGNIYDKFRNRIMFPIRDKRGRTVAFGGR
FT                   VLTDEKPKYLNSPETITYHKGKELYGLYEALQTNDEPKQLLVVEGYMDVVALAQFGVDY
FT                   AVASLGTSTTSEQIQLIFRSTEQVVCCYDGDRAGRDAAWRALENALPYLEDGRQLKFIF
FT                   LPDGEDPDTYIRQYGKEKFEEYIESAQSLSEFMFAHLSPQVDFSTKEGRGKLVALAAPL
FT                   IHQIPGEMLRLSLRNILAQKLGIFDQTQLENLIPKQLEQANTQQKVTHNKIKKTPMRMV
FT                   ISLLLQNPELVKRMSESGVQALRAEAGFEILEKLTALCRQREGITTGQILEYFRNTSYS
FT                   NPLEILATWDHLLDESDIINAFSQNYRRLNIQAIERDIEMLIAKERTEGLTNEEKTVLV
FT                   HLLAGKEQQKKQLVNPL"
FT   CDS_pept        complement(676204..676419)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08880"
FT                   /product="30S ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86353"
FT                   /protein_id="CBY86353.1"
FT                   /translation="MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIR
FT                   KRENATLAKRHAKRNARENARNTRLY"
FT   CDS_pept        676651..677679
FT                   /transl_table=11
FT                   /locus_tag="HICON_08890"
FT                   /product="predicted peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86354"
FT                   /protein_id="CBY86354.1"
FT                   /translation="MKILGIETSCDETGVAIYDEEKGLIANQLYTQIALHADYGGVVPE
FT                   LASRDHIRKTAPLIKAALEEANLTASDIDGIAYTSGPGLVGALLVGATIARSLAYAWNV
FT                   PAIGVHHMEGHLLAPMLDENSPHFPFVALLVSGGHTQLVRVDGVGKYEVIGESIDDAAG
FT                   EAFDKTAKLLGLDYPGGAALSRLAEKGTPNRFIFPRPMTDRAGLDFSFSGLKTFAANTV
FT                   NQAIKNEGELIEQTKADIAYAFQDAVVDTLAIKCKRALKETGYKRLVIAGGVSANKKLR
FT                   ETLAHLMQNLGGEVFYPQPQFCTDNGAMIAYTGFLRLKQGQHSDLAIDVKPRWAMTELP
FT                   AI"
FT   CDS_pept        677688..678269
FT                   /transl_table=11
FT                   /locus_tag="HICON_08900"
FT                   /product="thymidine kinase/deoxyuridine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86355"
FT                   /protein_id="CBY86355.1"
FT                   /translation="MAKLYFYYSTMNAGKSTTLLQSSYNYRERDMNTVVYTAAIDDRFG
FT                   VGKVTSRIGISQDAFLFRSETNLFDEINEHLKKEKVHCVLVDEAQFLSKQQVYQLSDVV
FT                   DKLKIPVLCYGLRTDFQAELFEGSKYLLAWADQLEELKTICYCGRKANFVLRLNDQGEV
FT                   IKEGAQIQIGGNDSYLSVCRLHYKEKCGQI"
FT   CDS_pept        678306..679526
FT                   /transl_table=11
FT                   /locus_tag="HICON_08910"
FT                   /product="Tyrosine-specific transport protein 2"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86356"
FT                   /protein_id="CBY86356.1"
FT                   /translation="MLKNKTFGSALIIAGTTIGAGMLAMPLTSAGMGFGYTVLLLVGLW
FT                   ALLVYSGLLFVEVYQTADQLDDGVATLAEKYFGVPGRILATLSLLVLLYALSAAYITGG
FT                   GSLLSGLPTAFGMDAISLKTAIIIFTVVLGSFVVVGTKGVDGLTRVLFIGKLIAFAFVL
FT                   FMMLPKVATDNLMALPLDYAFVVSAAPIFFTSFGFHVIMASVNSYLGGSVDKFRRAILI
FT                   GTAIPLAAYLVWQLATHGVLSQSEFVRILQADPTLNGLVNATREITGSHFMGEVVRVFS
FT                   SLALITSFLGVMLGVFEGLGDLFKRYHLPNNRFVLTIAAFLPPLVFALFYPEGFITALS
FT                   YAGLLCAFYCLILPISLAWRTRIENPTLPYRVAGGNFALVFALLIGVVIMLIPFLIQWG
FT                   YLPVVAG"
FT   CDS_pept        complement(679668..679928)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08920"
FT                   /product="Putative ferredoxin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86357"
FT                   /protein_id="CBY86357.1"
FT                   /translation="MALFITSKCTNCDMCLPECPNEAISIGDEIYVIDPILCTECVGHY
FT                   DTPTCQKVCPITNCIKPDPEHQETEEQLWERFVMIHHSDKL"
FT   CDS_pept        680006..680788
FT                   /transl_table=11
FT                   /locus_tag="HICON_08930"
FT                   /product="probable ribonuclease I"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86358"
FT                   /protein_id="CBY86358.1"
FT                   /translation="MKKLTSILSLIVLVILAIWQYFTDTAKTKHQSSSPVIEQTKQTKV
FT                   FEPKFEPKFETKRTDIKKSAVKNPDVFANYDVIMRNDHIGQNAKAPVDYYMLALSWSPG
FT                   FCDIQREKYGDQLPYSSQYQCGNNRTFGWVVHGLWPQNANARAVSDHPRFCKGDLPALP
FT                   KGLLAQYLAISPGEKLLQGEWEKHGSCAFDSAQQYFAKEQELFNALKLPNQKLSIDELF
FT                   GWMKQHNPQLKNAYLRASRNELFICYDKKWQVINCQSK"
FT   CDS_pept        680884..682044
FT                   /transl_table=11
FT                   /locus_tag="HICON_08940"
FT                   /product="phosphoglycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86359"
FT                   /protein_id="CBY86359.1"
FT                   /translation="MSVIKMTDLDLAGKRVFIRADLNVPVKDGKVTSDARIRATIPTLK
FT                   LALEKGAKVMVTSHLGRPTEGEFKPEDSLQPVVDYLKNAGFNVRLEQDYLNGVDVKDGE
FT                   IVVLENVRVNKGEKKNDPELGKKYAALCDVFVMDAFGTAHRAQASTYGVAEFAPIACAG
FT                   PLLAAELDALGKALKEPARPMVAIVGGSKVSTKLEVLNSLSKIADQIIVGGGIANTFIA
FT                   AAGHNVGKSLYEADLIPVAKELAANTDIPVPVDVRVGLEFSETAAATEKAVNEVKDDES
FT                   IFDIGDKSAEQLAEIIKNAKTVLWNGPVGVFEFPHFRKGTEIISHAIANSDAFSIAGGG
FT                   DTLAAIDLFGIADKISYISTGGGAFLEFVEGKVLPAVEILEKRAKN"
FT   CDS_pept        682155..683234
FT                   /transl_table=11
FT                   /locus_tag="HICON_08950"
FT                   /product="fructose-bisphosphate aldolase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86360"
FT                   /protein_id="CBY86360.1"
FT                   /translation="MAKLLDIVKPGVITGEDVQKVFAYAKEYNFAIPAVNCVGSDSVNA
FT                   VLETAARVKAPVIIQFSNGGAAFYAGKGIKPTSGTRPDVLGAIAGAKQVHTLAKEYGVP
FT                   VILHTDHAAKKLLPWIDGLLDAGEKHFAETGRPLFSSHMIDLSEESMEENMAICREYLA
FT                   RMDKMGMTLEIEIGITGGEEDGVDNSDVDESRLYTQPSDVLYVYDQLHPVSSNFTVAAA
FT                   FGNVHGVYKPGNVKLKPSILGASQEFVAKERNLPAKPINFVFHGGSGSSREEIREAIGY
FT                   GAIKMNIDTDTQWASWNGILNFYKANEAYLQGQLGNPEGPDAPNKKYYDPRVWLRKMEE
FT                   SMSKRLEQSFEDLNCVDVL"
FT   CDS_pept        683301..684341
FT                   /transl_table=11
FT                   /gene="waaQ"
FT                   /locus_tag="HICON_08960"
FT                   /product="ADP-heptose--lipooligosaccharide
FT                   heptosyltransferase III"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86361"
FT                   /protein_id="CBY86361.1"
FT                   /translation="MEKILVIRNDKLGDFMQAWPAFAMLKLSNPSLKLTALVPSYTAPL
FT                   AEVCPFIDHVIIDSKKNDKTDFNRLVQEIKAQQFDGMISFFSNTHNGKLAWKSGIKYRL
FT                   APATKWVQILYNHRLTQRRSRSEKSEAEYNQDLVRAFLQKHNMPVVEPKPPYLIFEKSA
FT                   VENQHVFLQESLGLSANKKWIFVHSGSGGSATNLSLAQYADLIKGLLAEFDCNIVLTAG
FT                   PGESEKAYELANLVNDLRVAIYDKNKGLVDFAHSLACADLFIAGSTGPLHLSSAFNIPT
FT                   IGFYPNSRSSQPRRWKPINDVDKHLAFCPPAGKETQMNLELISIDNALAEISLFIRNMW
FT                   QTSNNI"
FT   CDS_pept        complement(684297..684953)
FT                   /transl_table=11
FT                   /locus_tag="HICON_08970"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86362"
FT                   /protein_id="CBY86362.1"
FT                   /translation="MKKKVRVIPHTSWAATSLWTAQYKTISILLFALSILGIGDGLIVL
FT                   SGLGSTPWTVLSQGIAIQTNFDIGWSSFLISCAVMLVWKPLKLRLGLGTLLNIIVIALF
FT                   LGITTKILAPPTALFSRMIFCLIGILLYGFGTALYLTCHLGAGPRDGLMVGICQRFHLS
FT                   INVVRSSLEISVCLLGFLLGGVVGLGTVLFATSIGSVVQFFLNIIARLPHIPYEK"
FT   CDS_pept        685170..686714
FT                   /transl_table=11
FT                   /locus_tag="HICON_08980"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86363"
FT                   /protein_id="CBY86363.1"
FT                   /translation="MLASLQDILDTVKANNLTYHQKLMTLGNIAERLFDPRDLLGYTDE
FT                   EWGFLQNQMICDLCEGYAIYRPRYILPDYNVYIQKGCEFLELPPPKDLDEALDGLLILY
FT                   SHVPSITTYPVYVGRLDVLLEPFITDEEKDYIKIKRFLNHIDKTVPDSFCHANIGPYDT
FT                   KAGRLILRAVIELEAPTPNMTIRYDKSKTSREFAELAAKACLLVSKPSFANDAYYISDL
FT                   GEEYGVASCYNALPECGGAYTLTRLRLGTIARACKSADEMLNELLSRVAKCTLSTMDKR
FT                   HKFVVEESNFFNSSFLEKEGFIKRTNFTGMFAIVGLADATNHLLQCEGLNETFGTSVRG
FT                   DEIATAIMDKLKEITDAHEGVYAERTGNRYLLHAQVGASNHEEDKRNAPAHRIRVGEEP
FT                   TLLAHLKQSAPFHKYFPSGTGDLFAFDQTHVDHCDAVMDIIDGAFSLGYRYITTYLKNT
FT                   DLIRVTGYLVKKSEVEKYRKGEVALRDTTWYGSGTDECANVFDRQLRDEKDVTAEK"
FT   CDS_pept        686723..687511
FT                   /transl_table=11
FT                   /locus_tag="HICON_08990"
FT                   /product="Predicted pyruvate-formate lyase-activating
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_08990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86364"
FT                   /protein_id="CBY86364.1"
FT                   /translation="MTALSEIFVPLHRIIPFSNVEGQGNRSSIFLQSCKLNCLYCHNPE
FT                   TIPRYTENAKLVSLQYLYEQVMEAVPFIRGVTVSGGEPTIHHKKLVPLFKALRSQGLTC
FT                   YLDSSGFFEFDRVCSLIDVTDKFLFDLKGEGIGLQTLCFDRKNQAGIVPQQVILERLHI
FT                   KNDKLERNLQNLAALLPLNKVEEVRLVFLKHFFDAEHLVGKVAQLLRNYPDVALKIIRV
FT                   HSKGVRDEAGLSAYIPSVEETNALSAYARQCGINKILTIL"
FT   CDS_pept        687610..688863
FT                   /transl_table=11
FT                   /locus_tag="HICON_09000"
FT                   /product="predicted nucleoside transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86365"
FT                   /protein_id="CBY86365.1"
FT                   /translation="MSVLSSILGMVVLIAIAVLLSNNRKAISIRTVVGALAIQVGFAAL
FT                   ILYVPAGKQALGAAADMVSNVIAYGNDGINFVFGGLADPSKPSGFIFAVKVLPIIVFFS
FT                   GLISVLYYLGIMQVVIKVLGGALQKALGTSKAESMSAAANIFVGQTEAPLVVRPYIKNM
FT                   TQSELFAIMVGGTASIAGSVMAGYAGMGVPLAYLIAASFMAAPAGLLFAKLMFPQTEQF
FT                   TDKQPEDNDSEKPTNVLEAMAGGASAGMQLALNVGAMLIAFVGLIALINGILSGVGGWF
FT                   GYGDLTLQSIFGLIFKPLAYLIGVTDGAEAGIAGQMIGMKLAVNEFVGYLEFAKYLQPD
FT                   SAIVLTEKTKAIITFALCGFANFSSIAILIGGLGGMAPSRRSDVARLGIKAVIAGTLAN
FT                   LMSATIAGLFIGLGAAAL"
FT   CDS_pept        688947..689663
FT                   /transl_table=11
FT                   /locus_tag="HICON_09010"
FT                   /product="Purine nucleoside phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86366"
FT                   /protein_id="CBY86366.1"
FT                   /translation="MTPHINAPEGAFADVVLMPGDPLRAKYIAETFLQDVVEVTNVRNM
FT                   LGFTGTYKGRKISIMGHGMGIPSCSIYAKELITEYGVKKIIRVGSCGAVRMDVKVRDVI
FT                   IGLGACTDSKVNRIRFKDNDFAAIADFDMAQAAVQAAKAKGKAVRVGNLFSADLFYTPD
FT                   VEMFDVMEKYGILGVEMEAAGIYGVAAEYGAKALTICTVSDHIRTHEQTTAEERQLTFN
FT                   DMIEIALDSVLIGDAQ"
FT   CDS_pept        689835..690263
FT                   /transl_table=11
FT                   /locus_tag="HICON_09020"
FT                   /product="50S ribosomal subunit protein L11"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86367"
FT                   /protein_id="CBY86367.1"
FT                   /translation="MAKKVQAYVKLQVAAGMANPSPPVGPALGQQGVNIMEFCKAFNAR
FT                   TESLEKGLPIPVVITVYADRSFTFVTKTPPAAVLLKKAAGIKSGSGKPNKDKVGKVTLD
FT                   QVRQIAETKAADMTGASIETKMKSIAGTARSMGLVVEE"
FT   CDS_pept        690268..690957
FT                   /transl_table=11
FT                   /locus_tag="HICON_09030"
FT                   /product="50S ribosomal subunit protein L1"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86368"
FT                   /protein_id="CBY86368.1"
FT                   /translation="MAKLTKKMKAIKAGVDSTKAYEINEAIAVLKQFATAKFVESVDVA
FT                   VNLGIDPRKSDQNVRGATVLPHGTGREVRVAVFTQGANADAAKEAGADLVGMEDLAEQI
FT                   KKGEMNFDVVIASPDAMRVVGQLGQVLGPRGLMPNPKVGTVTPNVAEAVKNAKSGQIRY
FT                   RNDKNGIIHTTIGKANFSEVQLKENLQALLAALNKAKPTTAKGIFIKKVSISTTMGAGV
FT                   AVDQASL"
FT   CDS_pept        691340..695368
FT                   /transl_table=11
FT                   /locus_tag="HICON_09040"
FT                   /product="RNA polymerase, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86369"
FT                   /protein_id="CBY86369.1"
FT                   /translation="MGYSYSEKKRIRKDFGKRPQVLNVPYLLTIQLDSFDKFIQKDPEG
FT                   QQGLEAAFRSVFPIVSNNGYTELQYVDYRLEEPEFDVRECQIRGSTYAAGLRVKLRLVS
FT                   YDKESSSRAVKDIKENEVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGK
FT                   THSSGKVLYNARIIPYRGSWLDFEFDPKDNLFARIDRRRKLPATIILRALGYTTEEILN
FT                   LFFDKITFEIAGDKLLMTLVPERLRGETASFDIEANGKVYVERGRRITARHIKALEKDN
FT                   ISQVVVPSEYILGKVASKDYVDLESGEIICPANGEISLETLAKLAQAGYTTIETLFTND
FT                   LDYGPYISETLRVDPTYDKTSALYEIYRMMRPGEPPTPESSEVLFNNLFFSAERYDLST
FT                   VGRMKFNRSLAFPEGEGAGILSNEDIIAVMRKLIDIRNGRGEVDDIDHLGNRRIRSVGE
FT                   MAENQFRIGLVRVERAVKERLSLGDLDAITPQDLINPKPISAAVKEFFGSSQLSQFMDQ
FT                   NNPLSEVTHKRRISALGPGGLTRERAGFEVRDVHNTHYGRLCPIETPEGPNIGLINSLS
FT                   AFARTNDYGFLETPYRKVVDGQVTEEIEYLSVIDEANYIIAQANSNLDENNRFTDAFVT
FT                   ARGERGESGLYKPEDIHYMDVSTQQVVSVAAALIPFLEHDDANRALMGANMQRQAVPTL
FT                   RADKPLVGTGMEKPIALDSGVAVVAKRGGTVQYVDASRIVIKVNEDETIAGEAGIDIYN
FT                   LIKYTRSNQNTCINQIPCVNLGDPINRGEVLADGPSTDLGELALGQNIRVAFMPWNGYN
FT                   FEDSMLVSERVVQQDRFTTIHIQELSCVARDTKLGSEEITADIPNVGESALSKLDESGI
FT                   VYVGAEVKGGDILVGKVTPKGETQLTPEEKLLRAIFGEKASDVKDSSLRVPNGTSGTVI
FT                   DVQVFTRDGVEKDKRALEIEEMQLREAKKDLTEELEILEAGLFARVRHLLISSGADAAQ
FT                   LDNLDRAKWLEQTIADEEKQNQLEQLAEQYEELRKEFEHKLEVKRKKIIKGDDLAPGVL
FT                   KVVKVYLAVKRQIQPGDKMAGRHGNKGVISKINPVEDMPYDENGQPVEIVLNPLGVPSR
FT                   MNIGQILETHLGLAAKGIGDQINAMLKQKQEVEKLRGYIQKAYDLGNGSQKVDLSTFTD
FT                   EEVLRLAENLRKGLPVATPVFDGADEAEIKELLKLGGLPTSGQITLYDGRTGEKFERPV
FT                   TVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAA
FT                   YTLQEMLTVKSDDVNGRTKMYKNIVSGNQHMDPGTPESFNVIMKEIRSLGLNIELDEE"
FT   CDS_pept        695613..699863
FT                   /transl_table=11
FT                   /locus_tag="HICON_09050"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86370"
FT                   /protein_id="CBY86370.1"
FT                   /translation="MKDLVKFLKAQSKTNEDFDVIKIGLASPDMIRSWSFGEVKKPETI
FT                   NYRTFKPERDGLFCARIFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMG
FT                   HIELASPVAHIWFLKSLPSRIGLLLDMPLRDIERVLYFEMYIVTEPGMTDLERGQLLTE
FT                   EQYLDAEDRWQDEFEAKMGAEAIQDFLKGMDLEAECEKLREELQETNSETKRKKITKRL
FT                   KLLEAFVQSGNKPEWMVMTVLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLK
FT                   RLLDLIAPDIIVRNEKRMLQESVDALLDNGRRGRAITGSNRRPLKSLADMIKGKQGRFR
FT                   QNLLGKRVDYSGRSVITVGPYLHLHQCGLPKKMALELFRPFIYAKLESRGYATTIKAAK
FT                   KMVEREDAIVWDILAEVIREHPILLNRAPTLHRLGIQAFEPILIEGKAIQLHPLVCAAF
FT                   NADFDGDQMAVHVPLTLEAQLEARALMMSTNNVLSPANGDPIIVPSQDVVLGLYYMTRE
FT                   KVNGKGEGMLLQDPREAEKAYRTGEAELHSRVKVRITEYVKNEVGEFDAKTTLNNTTIG
FT                   RAILWMIAPKGMPYSLFNQTLGKKAISKLINEAYRRLGLKEAVIFADQIMYTGFAYAAR
FT                   SGSSVGIDDMEIPAKKYEIISAAEEEVAEIQEQFQSGLVTAGERYNKVIDIWAAANERV
FT                   AKAMMENLSQEEVINREGNPEKQASFNSIFMMADSGARGSAAQIRQLAGMRGLMARPDG
FT                   SIIETPITANFREGLNVLQYFISTHGARKGLADTALKTANSGYLTRRLVDVAQDLVIVE
FT                   DDCGTHEGLVMTPLIEGGDEKVPLRELVLGRVAAEDILKPGTEEVLIPRNTLLDEKLCD
FT                   VLDANSVDSVKVRSVVTCDTDFGVCAKCYGRDLARGHLINQGEAVGVIAAQSIGEPGTQ
FT                   LTMRTFHIGGAASAAAKESSVQVKNTGTLHLMNAKFVTNDEGKLVLTSRNTELTITDAF
FT                   GRTKEHYKVPYGAVLSKGDDQDVTAGETIANWDPHTMPVVSEVSGFVKFVDIIDGLTVT
FT                   RQTDELTGLSSIVVQDVGERATAGKDLRPTIKLVDANGNDIFLPETDVLAQYFLPGKAI
FT                   VSLDDGAAVKVGEPLARIPQESVGTKDITGGLPRVADLFEARKPKEPAILAEISGIVSF
FT                   GKETKGKRRLLITPAEGETYEEMIPKWRQLNVFEGEMVQRGDVISDGAETPHDILRLRG
FT                   VRAVTEYIVNEVQDVYRLQGVKINDKHIEVIVRQMLRKAVITKAYDSEFLEGEQVEVAR
FT                   VKIVNRQREAEGKPPVEFERELLGITKASLATESFISAASFQETTRVLTEAAVAGKRDE
FT                   LRGLKENVIVGRLIPAGTGFAYHQNRHKHRLVDDVVAKLSEEDEAAIADEFVMTADDAS
FT                   ANLAEMLNMADDAE"
FT   CDS_pept        700057..701001
FT                   /transl_table=11
FT                   /locus_tag="HICON_09060"
FT                   /product="potassium-tellurite ethidium and proflavin
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86371"
FT                   /protein_id="CBY86371.1"
FT                   /translation="MNITKPFPLPTGYFGIPLGLAALSLAWFHLENLFPAARMVSDVLG
FT                   IVASAVWILFILMYAYKLRYYFEEVRAEYHSPVRFSFIALIPITTMLVGDILYRWNPLI
FT                   AEVLIWIGTIGQLLFSTLRVSELWQGGVFEQKSTHPSFYLPAVAANFTSASSLALLGYH
FT                   DLAYLFFGAGMIAWIFFEPVLLQHLRISSLEPPFRATMGIVLAPAFVCVSAYLSLNHGE
FT                   VDTLAKILWGYGFLQLFFLLRLFPWIVEKGLNIGLWAFSFGLASMANSATAFYHGNVLQ
FT                   GVSIFAFVFSNLMIGLLVLITVIKLAKGQFFLK"
FT   CDS_pept        complement(701054..701773)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86372"
FT                   /protein_id="CBY86372.1"
FT                   /translation="MNDLTLSPIAIIYTPYKEKFSVPRQPNLVEDGVGIVELLPPYNSP
FT                   EAVRGLEQFSHLWLIFQFDQIQQGKWQPTVRPPRLGGNQRVGVFASRTTHRPNPLGLSK
FT                   VKLHQVECINGNVFLHLGAVDLVDGTPIFDIKPYIAYADSEPNAQSSFAQEKPPVKLTV
FT                   EFTEQVKSAVKKREEKRPHLSRFIRQVLEQDPRPAYQQGKPSDRIYGMSLYEFNVKWRI
FT                   KAGTLDCVEVIEIEKDK"
FT   CDS_pept        701835..702746
FT                   /transl_table=11
FT                   /locus_tag="HICON_09080"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86373"
FT                   /protein_id="CBY86373.1"
FT                   /translation="MTNEKLKMWWETARPKTLPLALASIFTGSALGYWANPQGFNGLVM
FT                   VLCLLTTILLQVLSNFANDYGDHQKGSDTEERIGPLRGIQKGAISAKELKWGLILMVMA
FT                   SFLSGSFLIGIAYENLSDLFAFAGLGILAIVAAITYTVGVKPYGYMGLGDISVLVFFGL
FT                   LGVGGTYYLQTHSIDSHIILPAIGSGLLASAVLNINNLRDIEQDAKASKNTLAVRLGAY
FT                   KGRVYHCILLSVATLCYLAFAVVTAISWTNYLFVLAMPLLAKHAIFVYHSQQPSELRPM
FT                   LAQMSMISLLINILFSLGLLIG"
FT   CDS_pept        702798..703286
FT                   /transl_table=11
FT                   /locus_tag="HICON_09090"
FT                   /product="ribonuclease E (RNase E) inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86374"
FT                   /protein_id="CBY86374.1"
FT                   /translation="MFIDTSELCDLYAEQVDVVEPIFSSFGGVSHFYGKVTTVKCFESN
FT                   GLIAEVLEENGEGRVLVIDGGGAVRRGLIDAELAQLAVDNGWEGIIVYGAVRQIQQLEN
FT                   LDIGIHALAPIPVSADESSAGESDIPVNFGGVTFFPEDYIYADLTGIILSQEPLDLED"
FT   CDS_pept        complement(703426..703977)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09100"
FT                   /product="conserved inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86375"
FT                   /protein_id="CBY86375.1"
FT                   /translation="MKENKPVDPYAKYNEQSNIIAKIIFASRWLQVPIYLGLIVTLAIY
FT                   SYKFIKGLWALVINVNDMDSNTIMLGVLNLIDVVMIANLLVMVTIGGYEIFVSKLRTRN
FT                   HPDQPEWMSHVNATVLKVKLSMSIIGISSIHMLQTFVNASNMPEKTMMWQLLLHLGFLV
FT                   SAIALAYTDKILYSTSHKTH"
FT   CDS_pept        complement(704083..705081)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09110"
FT                   /product="Periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86376"
FT                   /protein_id="CBY86376.1"
FT                   /translation="MATMKDIARLAQVSTSTVSHVINGSRFVSDEIREKVMRIVAELNY
FT                   TPSAVARSLKVRETKTIGLLVTTTNNPFFAEVMAGVEQYCQKNQYNLIIATTGGDAKRL
FT                   QQNLQTLMHKQVDGLLLMCGDSRFQADIELAISLPLVVMDWWFTELNADKILENSALGG
FT                   YLATKALIDAGHRKIGIITGNLKKSVAQNRLQGYKNALSEAKIALNPHWIVESHFDFEG
FT                   GVLGIQSLLTQSSRPTAVFCCSDTIAVGAYQAIQQQGLRIPQDLSIMGYDDIELARYLS
FT                   PPLSTICQPKAELGKLAVETLLQRIKNPNENYRTLVLEPTCVLRESIYSFK"
FT   CDS_pept        complement(705109..706029)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09120"
FT                   /product="ribokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86377"
FT                   /protein_id="CBY86377.1"
FT                   /translation="MRKTLTVLGSINADHVISVPYFAKPGETLTGQNYQIAYGGKGANQ
FT                   AVAAARLGAKVAFISCIGSDSIGKTMKNAFEQEGIDTTHINTVSQEMTGMAFIQVAKSS
FT                   ENSIVLASGANAHLGEMVVRQSEAQIAQSDCLLMQLETPLSGVELAAQIAKKNGVKVVL
FT                   NPAPAQILSDELLSLIDIITPNETEAEILTGVAVTDEQSAVKAASVFHDQGIKTVMITL
FT                   GAKGVFVSRKGKSRIIKGFCVQAIDTTAAGDTFNGGFVTALLEEKSFDEAIRFGQAAAA
FT                   ISVTKKGAQSSIPMRQETLEFLEHA"
FT   CDS_pept        complement(706126..707004)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09130"
FT                   /product="D-ribose transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86378"
FT                   /protein_id="CBY86378.1"
FT                   /translation="MKKLTALTSALLLGLAVSGSASAQDTIALAVSTLDNPFFVTLKDG
FT                   AQKKADELGYKLVVLDSQNDPAKELANVEDLTVRGAKILLINPTDSEAVGNAVAIANRK
FT                   HIPVITLDRGAAKGNVVSHIASDNIAGGKMAGDFIAQKLGDNAKVIQLEGIAGTSAARE
FT                   RGEGFKQAIDAHKFNVLASQPADFDRTKGLNVTENLLASKGDVQAIFAQNDEMALGALR
FT                   AVKAANKKVLIVGFDGTDDGVKAVKSGKMAATIAQQPELIGSLGIVTADKILKVEKVEA
FT                   KIPVDLKVISE"
FT   CDS_pept        complement(707024..707992)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09140"
FT                   /product="D-ribose transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86379"
FT                   /protein_id="CBY86379.1"
FT                   /translation="MKNETSNFQIGRFLIEQRSFIALIILIAIVSMINPDFFSVDNILN
FT                   ILRQTSVNAIIAVGMTFVILIAGIDLSVGSVLALTGAIAASMVSIELPIFLVIPVVLLI
FT                   GTLLGGISGVIVAKGKVQAFIATLVTMTLLRGITMVYTDGRPITTGFSDNADLFASIGT
FT                   GYVLGIPVPIWIMSIVFAVAWYILKHTPIGRYIYALGGNEAATQLSGINVNKIKVFVFA
FT                   VSGFLSALAGLIVTSRLSSAQPTAGVSYELDAIAAVVVGGTSLMGGKGRVMGTLIGALI
FT                   IGFLNNALNLLDISSYYQMIAKALVILVAVLADNYLGTKKL"
FT   CDS_pept        complement(708008..709489)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09150"
FT                   /product="fused D-ribose transporter subunits of ABC
FT                   superfamily: ATP-binding components"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86380"
FT                   /protein_id="CBY86380.1"
FT                   /translation="METLLKISGVDKSFPGVKALNNACFSVYAGRVMALMGENGAGKST
FT                   LMKVLTGIYSKDAGTIEYLNRSVNFNGPKASQEAGISIIHQELNLVGNLTIAENIFLGR
FT                   EFKTSWGAINWQKMHQEADKLLARLGVTHSSKQLCAELSIGEQQMVEIAKALSFESKVI
FT                   IMDEPTDALTDTETEALFNVIRELKAENRGIVYISHRLKEIFQICDDVTVLRDGQFIGE
FT                   RIVAEITEDDLIEMMVGRRLDEQYPHLSQEKGECVLDVKHVSGSGIDDVSFKLHAGEIV
FT                   GVSGLMGAGRTELGKLLYGALPKTAGKVRLKNQEIENLSPQDGLDNGIVYISEDRKGDG
FT                   LVLGMSVKENMSLTSLDHFSQKGSIRHQAEKMAVDDFILMFNIKTPNRDQQVGLLSGGN
FT                   QQKVAIARGLMTRPNVLILDEPTRGVDVGAKKEIYQLINEFKKEGLSILMISSDMPEAL
FT                   GMSDRVLVMREGKISAEFSREEATQEKLLAAAIGK"
FT   CDS_pept        complement(709503..709922)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09160"
FT                   /product="Ribose transport permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86381"
FT                   /protein_id="CBY86381.1"
FT                   /translation="MKKTMLLNAQLSRCIASVGHTESLTICDAGLPIPLSVERIDLALT
FT                   AGVPSFLQTLNVVTNEMYVERVVIAEEIKEKNPEILTALLTQLQQLESHQGNQIQVEFV
FT                   SHETFKKFTLESKAIVRTGECSPYANVILYSGVPF"
FT   CDS_pept        complement(710086..711528)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09170"
FT                   /product="DNA recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86382"
FT                   /protein_id="CBY86382.1"
FT                   /translation="MSENLLLFSLLAVVIILILLLILRQQKYTHLHQELSKTTQDYNQL
FT                   ASKFDELSSIKNQFEQQTIKVQTENQGLQYRLTERDEQIHHLTQERQNLTEKLTALSQE
FT                   LTGLQTTLTEKEKYFSAQQQNFEQSKLQLSVEFQNLANRILDEKSRSFSQSNQTALETL
FT                   LKPFREQIEGFQKRVNEIHSESVKGNAGLEAEIKKVLEIGLNMSQEASNLTSALKGEKK
FT                   TLGNWGEVQLERALQLAGLEENVHYRTQVHFKDEQGGRNYPDFVLNLPDEKHLIIDSKM
FT                   SLVAYESAVNSEDDFERERLLKEHISALKTHINDLHKKDYSNLIGMRSPNFVLMFIAVE
FT                   PAYIEALKADPALFNYGYERNVIMVSHTTLMPILRTVANLWRIERGNAEAKEIAEKAGE
FT                   IYNQICLVAERLNKLGNTLSTVSNQYNSTVTALVGQQGLVGKVERFKTLSAKANKTMPD
FT                   VDLLNNQLDLARLNVLNQENLQ"
FT   CDS_pept        complement(711693..712988)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09180"
FT                   /product="probable oxidoreductase OrdL"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86383"
FT                   /protein_id="CBY86383.1"
FT                   /translation="MLNFAYQEHVRSYYFDSRNQDFQFPPLTQIEHADVCVIGAGFFGL
FT                   SAALELAEKGKKVIVLEGARVGFGASGRSGGQAINGFEEGIDEYVKQVGEDKAHKLWNM
FT                   SLETIDIIDERIEKYSIQCDWKKGYATLALNERRMDDLIEMEKESHKNFGYQNMQLWDK
FT                   TKLKQHLGSDIYVGGLFDSNSGHLHPLNYCLGLAKACVDLGVQIFEQSPVVDMVEKNGC
FT                   VEVKTAKSAVISQDVILATNAYIDVLPKSIHHGINRKILPMESFIIATEPLSQAVADSV
FT                   INNGMSVCDNNLLLDYYRLSADNRLLFGSDSSSEKDMVAIMRKNMLCVFPQLENVKIDY
FT                   GWAGPIDMTLNSTPHFGRISPHIYFAHGYSGHGVALTGLAGRIVAEAILGDDERLSIFE
FT                   GLKVPSVYGGRIIKDLATKIGVQYYKFLDKYR"
FT   CDS_pept        713129..714181
FT                   /transl_table=11
FT                   /locus_tag="HICON_09190"
FT                   /product="spermidine/putrescine-binding periplasmic protein
FT                   2 precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86384"
FT                   /protein_id="CBY86384.1"
FT                   /translation="MKKFFAHSLKNLFLSTTALFAASAFANNKLYVYNWTDYVPSDLVA
FT                   QFSKETGIEVIYSTFESNEEMYAKLKLTQNTGSGYDLVFPSSYYVNKMIKEKMLQPIDQ
FT                   SKLTNIHQIPKHLLNKEFDPENKYSLPYVYGLTGIEVNADEIDPKTITSWADLWKPEFK
FT                   GKVLMTSDAREVFHVALLLDGKSPNTTNEEDIKTAYERLEKLLPNVATFNSDSPEVPYV
FT                   QGEVAIGMIWNGSAYLAQKENQSLQFVYPKEGAIFWMDNYAIPNSAQNVEGAHKFIDFL
FT                   LRPENAKIVIERMGFSMPNNGAKTLLSTEVANDPKLFPPAEEVEKGIMQGDVGEAVDIY
FT                   EKYWSKLKTN"
FT   CDS_pept        complement(714251..715585)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09200"
FT                   /product="molecular chaperone and ATPase component of HslUV
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86385"
FT                   /protein_id="CBY86385.1"
FT                   /translation="MSEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLR
FT                   HEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTEVGYVGKEVDSIIRDLT
FT                   DSAMKLVRQQEIAKNRARAEDVAEERILDALLPPAKNQWGEVENHDSHSSTRQAFRKKL
FT                   REGQLDDKEIEIDVSAGVSMGVEIMAPPGMEEMTNQLQSLFQNLGSDKTKKRKMKIKDA
FT                   LKTLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRD
FT                   LLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAAD
FT                   FERILTEPHASLTEQYKALMATEGVNIEFTTEAVKKIAEAAFRVNEKTENIGARRLHTV
FT                   MERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL"
FT   CDS_pept        complement(715596..716123)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09210"
FT                   /product="ATP-dependent protease peptidase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86386"
FT                   /protein_id="CBY86386.1"
FT                   /translation="MTTIVSVRRNGQVVVGGDGQVSLGNTVMKGNARKVRRLYNGKVLA
FT                   GFAGGTADAFTLFELFERKLEMHQGHLLKSAVELAKDWRTDRALRKLEAMLIVADEKES
FT                   LIITGIGDVVQPEEDQILAIGSGGNYALSAARALAENTELSAREIVEKSLKIAGDICVF
FT                   TNTNFTIEELPN"
FT   CDS_pept        716343..717050
FT                   /transl_table=11
FT                   /locus_tag="HICON_09220"
FT                   /product="acid phosphatase/phosphotransferase, class B,
FT                   non-specific"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86387"
FT                   /protein_id="CBY86387.1"
FT                   /translation="MKNVMKLSVIALLTAAAVPAMAGKTEPYTQSGTNAREMLQEQAIH
FT                   WISVDQIKQSLEGKAPINVSFDIDDTVLFSSPCFYHGQQKFSPGKHDYLKNQDFWNEVN
FT                   AGCDKYSIPKQIAIDLINMHQVRGDQVYFFTGRTAGKVDGVTPILEKTFNIKNMHPVEF
FT                   MGSRERTTKYNKTPAIISHKVSIHYGDSDDDVLAAKEAGVRGIRLMRAANSTYQPMPTL
FT                   GGYGEEVLINSSY"
FT   CDS_pept        complement(717142..717494)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_09230"
FT                   /product="Uncharacterized transposase-like protein"
FT   CDS_pept        complement(717992..718495)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09240"
FT                   /product="S-ribosylhomocysteinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86389"
FT                   /protein_id="CBY86389.1"
FT                   /translation="MPLLDSFKVDHTKMNAPAVRIAKTMRTPKGDNITVFDLRFCIPNK
FT                   EILSPKGIHTLEHLFAGFMRDHLNGDIIEIIDISPMGCRTGFYMSLIGTPNEQEVSEAW
FT                   LASMQDVLGVQDQASIPELNIYQCGSYTEHSLEDAHEIAKNVIARGIGVNKNEDLSLDN
FT                   SLLK"
FT   CDS_pept        complement(718679..719155)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_09250"
FT                   /product="Predicted membrane protein"
FT   CDS_pept        complement(719155..719757)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09260"
FT                   /product="predicted phosphatase/phosphohexomutase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86391"
FT                   /protein_id="CBY86391.1"
FT                   /translation="MLDYEIFNPYEGLIFDMDGTLIDTMPVHAQAWTMVGKKFGYEFDF
FT                   QIMYNFGGATVRTIAGEMMKAANMPLDRIEDVLAAKRELSYQLIPTQSKLLPTFEIVKS
FT                   FHQKKPIALGSGSHRKIIDMLMDKLAIAPYFNAIVSADDVKEHKPHPETFLRCAELIQA
FT                   NPSRCIVFEDADLGVQAGLSAGMDVFDVRTREIISPR"
FT   CDS_pept        719873..720250
FT                   /transl_table=11
FT                   /locus_tag="HICON_09270"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86392"
FT                   /protein_id="CBY86392.1"
FT                   /translation="MRLFKQLERWKIRKQINQSIIDVIFRLRNRLAHYWQADVNTPQVD
FT                   FMLLHIACSLGRIERGGCVSSLYSEMLEEMQSAVIFPQVLAIHRDLLKLMPFSIPEAEQ
FT                   TYFLANIHSLVLEQKQLKPLK"
FT   CDS_pept        720388..720999
FT                   /transl_table=11
FT                   /locus_tag="HICON_09280"
FT                   /product="methyltransferase, SAM-dependent
FT                   methyltransferase, glucose-inhibited cell-division protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86393"
FT                   /protein_id="CBY86393.1"
FT                   /translation="MKAKLVSLLAQANIKISDQQIQQLINLVNLLNKWNKAYNLTSVRD
FT                   PQEMLVKHILDSLVVSPYLQGDRFIDVGTGPGLPGLPLAIINPSKQFVLLDSLGKRISF
FT                   IRNAIRELRLTNVTPVLSRVEEYQPEDKFDGVLSRAFASLKDMTDWCHHLPKENGYFYA
FT                   LKGIYQEDEINELNKKYTIQKVIELSVPELIGERHLIVLR"
FT   CDS_pept        721125..721499
FT                   /transl_table=11
FT                   /locus_tag="HICON_09290"
FT                   /product="predicted F0F1-type ATP synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86394"
FT                   /protein_id="CBY86394.1"
FT                   /translation="MSRILSHAKKNYRKAIIIESLLLVVFYLLIYGWQRQSAVDFSYGF
FT                   LSAFLPFCTFIFIIFYRKQNFSTKLTALYRAEAIKFILTMVFIIVAIKWLFVINFIAFF
FT                   VGFLLALVLNNIIPLILNKI"
FT   CDS_pept        721536..722324
FT                   /transl_table=11
FT                   /locus_tag="HICON_09300"
FT                   /product="F0 sector of membrane-bound ATP synthase, subunit
FT                   a"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86395"
FT                   /protein_id="CBY86395.1"
FT                   /translation="MSGQTTSEYISHHLSFLKTGDGFWNVHIDTLFFSILAAVIFLFVF
FT                   SRVGKKATTGVPGKMQCLVEIVVEWVNGIVKENFHGPRNVVAPLALTIFCWVFIMNAID
FT                   LIPVDFLPQFAGLFGIHYLRAVPTADISATLGMSICVFFLILFYTIKSKGFKGLVKEYT
FT                   LHPFNHWAFIPVNFILETVTLLAKPISLAFRLFGNMYAGELIFILIAVMYSANMAIAAL
FT                   GIPLHLAWAIFHILVITLQAFIFMMLTVVYLSIAYNKADH"
FT   CDS_pept        722380..722634
FT                   /transl_table=11
FT                   /locus_tag="HICON_09310"
FT                   /product="ATP synthase C chain"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86396"
FT                   /protein_id="CBY86396.1"
FT                   /translation="METVITATIIGASILLAFAALGTAIGFAILGGKFLESSARQPELA
FT                   SSLQTKMFIVAGLLDAIAMIAVGISLLFIFANPFIGLLN"
FT   CDS_pept        722684..723154
FT                   /transl_table=11
FT                   /locus_tag="HICON_09320"
FT                   /product="ATP synthase B chain"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86397"
FT                   /protein_id="CBY86397.1"
FT                   /translation="MNLNATLIGQLIAFALFVWFCMKFVWSPIINAIETRQSQIANALA
FT                   SAEAAKKEQADTKNLVEQELSAAKVQAQDILDAANKRRNEVLDEVKAEAEELKAKIIAQ
FT                   GYAEVEAERKRVQEELRLKVASLAVAGAEKIVGRSIDEAANNDIIDKLVAEL"
FT   CDS_pept        723167..723700
FT                   /transl_table=11
FT                   /locus_tag="HICON_09330"
FT                   /product="F1 sector of membrane-bound ATP synthase, delta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86398"
FT                   /protein_id="CBY86398.1"
FT                   /translation="MSELTTIARPYAKAAFDFAIEQSAVEKWTEMLGFAAAVAEDETVK
FT                   AYLSSSLSAQKLADTVISICGEQLDQYGQNLIRLMAENKRLSAIPAVFEEFKHHVEEHQ
FT                   AIAEVEVTSAQPLNATQIEKIAAAMEKRLARKVKLNCNVDNALIAGVIVRTEDFVIDGS
FT                   SRGQLTRLANELQL"
FT   CDS_pept        723713..725254
FT                   /transl_table=11
FT                   /locus_tag="HICON_09340"
FT                   /product="F1 sector of membrane-bound ATP synthase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86399"
FT                   /protein_id="CBY86399.1"
FT                   /translation="MQLNSTEISELIKKRIAQFDVVSEARNTGTIVSVSDGIIRIHGLS
FT                   DVMQGEMIALPGNRYAMALNLERDSVGAVVMGPYADLAEGMEVQCTGRILEVPVGRGLL
FT                   GRVVNTLGQPIDGKGEIENDGFSPVEVIAPGVIDRRSVDQPVQTGYKAVDSMVPIGRGQ
FT                   RELIIGDRQTGKTALAIDAIINQRNSGIKCIYVAIGQKASTIANVVRKLEEHGALANTI
FT                   VVAASASESAALQYLAPYAGCAMGEYFRDRGEDALIVYDDLSKQAVAYRQISLLLRRPP
FT                   GREAYPGDVFYLHSRLLERASRVNEDYVEKFTKGEVKGKTGSLTALPIIETQAGDVSAF
FT                   VPTNVISITDGQIFLESNLFNSGIRPAVNPGISVSRVGGSAQTKVIKKLAGGIRTALAQ
FT                   YRELAAFAQFASDLDDATRKQLSHGEKVTELLKQKQFAPLSVAEQAVILFAVEFGYLDD
FT                   VELSKIASFETALLDYSNRNHAEFMQELNKTGNYNDEIKDTLKSILDGFKANSAW"
FT   CDS_pept        725270..726139
FT                   /transl_table=11
FT                   /locus_tag="HICON_09350"
FT                   /product="F1 sector of membrane-bound ATP synthase, gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86400"
FT                   /protein_id="CBY86400.1"
FT                   /translation="MAGAKEIKTKIASVQSTQKITKAMEMVATSKMRKTQDRMAASRPY
FT                   SETIRNVISHVSKASIGYKHPFLVEREVKKIGILVISTDRGMCGGLNVNLFKTILNQIK
FT                   NWKEQNISTDLGLIGSKGISFFRSFGFNIKGQLSGLGDTPALEELIGVANTMFDAYRNG
FT                   EIDAIYIAYNKFVNTMSQKPVVQQLVPLPESKDDHLNERQQTWDYLYEPEPKVLLDSLL
FT                   VRYLESQIYQAVVDNLASEQAARMVAMKAATDNAGNLINDLRLVYNKARQASITNELNE
FT                   IVAGAAAI"
FT   CDS_pept        726156..727529
FT                   /transl_table=11
FT                   /locus_tag="HICON_09360"
FT                   /product="F1 sector of membrane-bound ATP synthase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86401"
FT                   /protein_id="CBY86401.1"
FT                   /translation="MSAGKIVQIIGAVIDVEFPQDAVPKVYDALKVESGLTLEVQQQLG
FT                   GGVVRCIALGTSDGLKRGLKVENTNNPIQVPVGTKTLGRIMNVLGEPIDEQGAIGEEER
FT                   WAIHRSAPSYEEQSNSTELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTVNMMELIRN
FT                   IAIEHSGYSVFAGVGERTREGNDFYHEMKDSNVLDKVSLVYGQMNEPPGNRLRVALTGL
FT                   TMAEKFRDEGRDVLFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERIT
FT                   STKTGSITSVQAVYVPADDLTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLDSTSR
FT                   QLDPLVVGQEHYDVARGVQGILQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLS
FT                   QPFFVAEVFTGSPGKYVTLKDTIRGFKGILDGEYDHIPEQAFYMVGSIDEVLEKAKNM"
FT   CDS_pept        727559..727987
FT                   /transl_table=11
FT                   /locus_tag="HICON_09370"
FT                   /product="F1 sector of membrane-bound ATP synthase, epsilon
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86402"
FT                   /protein_id="CBY86402.1"
FT                   /translation="MATFNLTIVSAEQKIFEGEVKQIQVTGVEGELGILPGHTPLLTAI
FT                   KPGIVKFTLKDGNEEVIYVSGGFLEVQPNIVTVLADIAIRGSELDADRIHEAKRKAEEN
FT                   IVSHGSDADHDLLVAKLSKELAKLRAYELTEKLLKTRR"
FT   CDS_pept        complement(728173..729375)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09380"
FT                   /product="tyrosine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86403"
FT                   /protein_id="CBY86403.1"
FT                   /translation="MNKTVGSTLLVAGTMIGAGMLAMPLTSAGIGFGFTLVLLLGLWAL
FT                   LTFSALLFVELYQTAESDAGIGTLAEQYFGKTGRIIATAVLIIFLYALIAAYISGGGSL
FT                   LKDLLPESFGDKVSVLLFTVIFGSFIVIGTHSVDKINRVLFFVMLAAFAVVLSLMLPEI
FT                   KFDNLMATPIDKALIISASPVFFTAFGFHGSIPSLNKYLDGNVKALRFSILVGSAITLC
FT                   AYILWQLSTHGLLTQNEFLQILKEDATLNGLVKATFAITGSNVIASAVKLFSTLALITS
FT                   FLGVGLGLLECIEDLLKRSFNVTAGRISLGLLTFIPPLVFALFYPEGFILALGYAGQMF
FT                   AFYAVVLPVSLVWKARRVHRNLPYKVWGGNLTLIIVLVLGVIITSIPFAIRAGYLPFVV
FT                   G"
FT   CDS_pept        complement(729639..730304)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09390"
FT                   /product="histidine biosynthesis bifunctional protein
FT                   HisIE"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86404"
FT                   /protein_id="CBY86404.1"
FT                   /translation="MNITKIDWQKVNGLLPVIIQNISTREVLMLGYMNEEALTKTIKER
FT                   KVTFFSRTKQRLWTKGEISGNFLNVEEMSLDCDNDTLLILVDPIGATCHTGEYSCFHQF
FT                   TSPQSENKKQQFANWAWFIKLEQHLKEKKNADPSNSYTATLHAKGTKKIAQKVGEEGVE
FT                   TALAAVAQDKAEVISEATDLVYHLTVLLHNQDLQWYEIIAKLQERHQGIGLHPEGGNK"
FT   CDS_pept        complement(730304..731080)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09400"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisF"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86405"
FT                   /protein_id="CBY86405.1"
FT                   /translation="MLAKRIIPCLDVRDGQVVKGVQFRNHEIIGDIVPLAQRYAQEGAD
FT                   ELVFYDITASSDGRTVDKSWVERIAQVIDIPFCVAGGIKTIEDAEKLFAFGADKISINS
FT                   PALADPTLISRLADRFGVQAIVVGIDSWFEQETGKYWVNQYTGDETRTRQTHWQLLDWV
FT                   KEVQQCGAGEIVLNMMNQDGLRNGYDLAQLKLVRGVCRVPLIASGGAGKMVHFRDAFIE
FT                   AKVDGALAASVFHKQIIEIGELKSYLVKSAIEIRSE"
FT   CDS_pept        complement(731062..731811)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09410"
FT                   /product="N-(5'-phospho-L-ribosyl-formimino)-5-amino-1-(5
FT                   '-phosphoribosyl)-4-imidazolecarboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86406"
FT                   /protein_id="CBY86406.1"
FT                   /translation="MKQSIIIPALDLINGQVVRLHQGDYAKQTTYSENPIKQFDNYVRQ
FT                   GAKQLHLVDLTGAKNPQSRQTALIGKIVEATQCKVQVGGGIRTEQDVADLLAVGANRVV
FT                   IGSTAVTHRSMVKNWFIKYGAEKFVLALDVNINASGQKIVAISGWQEESGVLLETLIED
FT                   FQTVGLQQVLCTDISRDGTLTGSNIGLYQEICEKYPPIQFQSSGGIGSLADIEALKGTG
FT                   VSGVIVGRALLEGKFTLSEAIKCWQNG"
FT   CDS_pept        complement(731847..732446)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09420"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   HisH"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86407"
FT                   /protein_id="CBY86407.1"
FT                   /translation="MTNITIIDTGCANLSSVKFAFDRLGYNTEITFDLNKIKSADKLIL
FT                   PGVGTANAAMYNLQERQLIETIQNLTQPVLGICLGMQLMTEFSEEGNVPTLNLISGKTN
FT                   RIPDTGLPLPQMGWNRVQFVKNCPLFDGIVQNSHFYFVHSYAVSQNKHSVAISNYGVNF
FT                   SAAIAKENFYGVQFHPERSGKNGALLLKNFVEKVPF"
FT   CDS_pept        complement(732512..733600)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09430"
FT                   /product="histidine biosynthesis bifunctional protein HisB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86408"
FT                   /protein_id="CBY86408.1"
FT                   /translation="MQPTLFIDRDGTLIDEPKTDFQIDSLEKLKLEPKVIPALLRLKAK
FT                   YRFVIVSNQDGLGTDAFPQTDFDKPHNVMMALFESQGITFDEVLICPHKPEENCLCRKP
FT                   KIKLLDHYIRKNLFDIDRSFVIGDRETDVQLAENLGIRAIQYDPQKMNWDLIAEKLLGE
FT                   TVTNCGKRPPRFAEVIRQTKETDIKVQVWLDEAGVNEIKTGVGFFDHMLDQIATHGGFR
FT                   MNVQCKGDLWIDEHHTVEDTALALGQALKQAIGDKRGIARFGFVLPMDECKAECALDLS
FT                   GRPWIKFNACFKRDKVGDFSTELTEHFFQSLAFSMLATLHLNVTGNNDHHKIESLFKAF
FT                   GRTLRQAIRIEGNEMPSSKGVL"
FT   CDS_pept        complement(733712..734770)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09440"
FT                   /product="histidinol-phosphate aminotransferase 1"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86409"
FT                   /protein_id="CBY86409.1"
FT                   /translation="MTITTLSRQNIQALTPYQSARKLGGNGTIWLNANEYPTSPEFQLS
FT                   GKDLNRYPEPQPQRVVQAYANYAGVSTENVLVTRGGDEGIELIIHTFCEPKQDAILFCP
FT                   PTYGMYAVSAETAGVLSKTVPLTDDFQLNLPEIKNHLNDVKVVFVCSPNNPTGNLLKQS
FT                   DILDLLQITAGKAIVVVDEAYIEFCPEASVINLLKNYPHLAIIRTLSKAFALAGLRCGF
FT                   VLANPELIDILSKVIAPYPIPVPSADLAEQALRPANIATVQALTQELLSNRQWLAKALL
FT                   VLHQVEKVYESEANYLLIKCQNGQAVFKALWEQGIILRDQNKTLHLQNCIRITVGTRNE
FT                   CERVVEAIKEVK"
FT   CDS_pept        complement(734884..736167)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09450"
FT                   /product="histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86410"
FT                   /protein_id="CBY86410.1"
FT                   /translation="MQTIIWNHLSETEKRKVIMRPVQQNGKNIQQAVNVIRENVAYNGD
FT                   RALFELCEKFDGVKLDKLIVSVDEIQAASSRISVKLRNAIEQAKTNIEAFHKAQQNQEI
FT                   DLEIQEGVRCQVVTRPISCVGLYIPGGSAPLFSTVLMLAIPAKIAGCKKIVLCSPPPIS
FT                   DEILYTAHLCGVETIYAIGGAQAVFAMAQGTESVAKVDKIFGPGNAFVTEAKRQVAQNS
FT                   TAIDMPAGPSEVLVIADESADPEFVASDLLSQAEHGADSQVILVATCQTLAKETALAIE
FT                   RQLALLPRAETARKALNHSRIFIAESLEQAVEISNEYAPEHLIVQTKNARKLLPYLDNA
FT                   GSIFLGAYSPESMGDYVSGTNHVLPTYGYTKTYSSLGLADFSKRMTVQELTPKGFKNLA
FT                   ETVEVMAEAEQLAAHKMAVSVRLAKLNI"
FT   CDS_pept        complement(736260..737171)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09460"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86411"
FT                   /protein_id="CBY86411.1"
FT                   /translation="MTNTTMQPNRLRIALQKKGRLSQDCAILLKQCGVKINWNEQRLIA
FT                   YAENLPIEILRVRDDDIPGLIFDGVVDLGIIGENVLEEEELGRRAANETVTYKKLRQLD
FT                   FGDCRLSLAVDRDCHYENVKDLANRRIATSYPHLLKRYMNENGVSFKSCLLNGSVEVAP
FT                   SAGIAYAICDLVSSGATLEANGLKEVDVIYRSKACLIQRAEPLESTKQALVDKLLTRIQ
FT                   GVQQAAESKYIMLHAPKEKLEKITALLPGVENPTILPLASDTTRVAMHVVSQENLFWET
FT                   MEQLKEAGASSILVLPIEKMME"
FT   CDS_pept        737618..738481
FT                   /transl_table=11
FT                   /locus_tag="HICON_09470"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86412"
FT                   /protein_id="CBY86412.1"
FT                   /translation="MIYSMTAFARLEVKKDWGDAVWEIRSVNQRYLENFFRLPEQFRGL
FT                   ENTLREKLRQSLTRGKIECSLRIETKKQANAELNLNKELANQVIQSLQWIKAQAGEGEI
FT                   NLTDVLRYPGVVEAQEQDLDAISQDLLTAFDDLLTDFIAMRGREGEKLNDIIQQRLDSI
FT                   AVETDKVRSQMPAVLQWQRERLLQRFEDAQVNLDPQRVEQEMILLAQRVDVAEELDRLQ
FT                   MHVKETTNILKKGGAVGRKLDFMMQELNRESNTLASKSINADITASAVELKVLIEQMRE
FT                   QIQNLE"
FT   CDS_pept        738491..739333
FT                   /transl_table=11
FT                   /locus_tag="HICON_09480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86413"
FT                   /protein_id="CBY86413.1"
FT                   /translation="MSQFISLTQYQLIEVQGADAEKYLQGQLTSDVVRLASGATTLTAH
FT                   CDPKGKMNAIYRLFKVSSEQFFLLVKKDILPSGLDALKKYAVFSKVSFDLRDWQIIGVI
FT                   GEKCGKITPHFSLEIDEQRSILLNETELPVNFNGDEKIWEVADIQAGLPNLSPQTQNEF
FT                   IPQALNLQAIEQAISFTKGCYIGQETVARAKYRGANKRAMFIFKAQTQQESEIGSEIEM
FT                   QLEANWRKTGTITSAVNLDGVLWLQVVMNNDIDSEQQFRLLNSEILLERVQLPYSITE"
FT   CDS_pept        complement(739377..740609)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09490"
FT                   /product="D-3-phosphoglycerate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86414"
FT                   /protein_id="CBY86414.1"
FT                   /translation="MTNKVSLDKSKIKFVLFEGVHQSALDTLHAAGYSNIDYYKKALDG
FT                   DELKEAIKDAHFIGLRSRTHLTAEMIEAAPKLIAVGCFCIGTNQVDLNAAKVRGIPVFN
FT                   APFSNTRSVAELVLGEILLLMRNVPQANAEVHRGIWNKSATGSYEVRGKKLGIIGYGHI
FT                   GSQLSIIAESLGMDVYFYDIENKLPLGNAKQLRSLEELLSSCDVVSLHVPELPSTKNLM
FT                   NAARIAQLKQGAILINAARGTVVDIDTLAQALKDGKLQGAAIDVFPVEPASINEEFVSP
FT                   LREFDNVILTPHIGGSTAEAQENIGFEVAGKFVKYSDNGSTLSSVNFPEVSLPEHEGTK
FT                   RLLHIHENRPGILNKLNQIFVEANLNIAAQYLQTDPKIGYVVVDVETNDASPLLTKLKE
FT                   IDGTIRARVLY"
FT   CDS_pept        complement(740639..741298)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09500"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86415"
FT                   /protein_id="CBY86415.1"
FT                   /translation="MNQLEMKKLAAQAALQYVKADTIVGVGSGSTVNCFIEALGTIKDK
FT                   IQGAVAASKASEELLRKQGIEVFNANDVSSLDIYVDGADEINPQKMMIKGGGAALTREK
FT                   IVAALAKKFICIVDSSKQVDVLGSTFPLPVEVIPMARSQVGRKLAALGGSPEYREGVVT
FT                   DNGNVILDVHNFSILNPVEMEKELNNVAGVVNNGIFALRGADVVIVGTPEGAKVID"
FT   CDS_pept        complement(741431..742582)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09510"
FT                   /product="predicted Fe-S oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86416"
FT                   /protein_id="CBY86416.1"
FT                   /translation="MPKLPPLSLYIHIPWCVQKCPYCDFNSHAQKGDIPEQDYIYHLLQ
FT                   DLQADLQRFKDAIQQRKLHSIFIGGGTPSLFSAESIAYLLKEIKKQIDFEDNIEITLEA
FT                   NPGTVEAERFKGYVSAGITRISMGIQSFNDDKLQRLGRIHNAAEAKSAVNLAKVSGLKS
FT                   FNLDLMHGLPNQTLEEALDDLRQAIELSPPHISWYQLTIEPNTMFAYRPPKLPDDDALW
FT                   DIFEQGHQLLTMAGYQQYETSAYAKAGFQCKHNLNYWRFGDYLAIGCGAHGKLTFPTGE
FT                   ITRFSKTKHPKGYLRGEYLYEEKNVPKIDRPFEFFMNRFRLLEAVPKQEFEDYTGLSQS
FT                   AVKNQIDFAIQQNYIVENADSWQITEHGKLFLNELLELFLTEE"
FT   CDS_pept        complement(742699..745110)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09520"
FT                   /product="ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86417"
FT                   /protein_id="CBY86417.1"
FT                   /translation="MAKNTQRTMPVLPLRDVVVFPYMVMPLFVGRAKSINALEEAMNDD
FT                   KQILLVSQREADLEEPTPEDLFDVGTIANIIQLLKLPDGTVKVLVEGQNRAKINSLEDG
FT                   EKCFSAQITPIETTYGDEKELVVAKSAVLSEFENYLTLNKKVPTDILNALQRIDDVDRL
FT                   ADTMAAHLPVSIRHKQNALELANVQERLEYLLGMMESEADILQVEKRIRGRVKKQMEKS
FT                   QRNYYLNEQIKAIRKEMDGGENEDTIDEVEQLHQKVEAAGMPADVRDKVENELQKLKMM
FT                   SAMSSEATVIRSYIEWMIQVPWHQRSKVKKDIVKAQQVLDTDHYGLDRVKERILEYLAV
FT                   QARLNKVKGPILCLVGPPGVGKTSLGQSIANATGRKYVRMALGGVRDEAEIRGHRKTYI
FT                   GALPGKLIQKMAKVGVKNPLFLLDEIDKMASDMRGDPASALLEVLDPEQNTTFNDHYLE
FT                   VDYDLSDVMFVATSNSMNIPGPLLDRMEVIRLSGYTEDEKLNIAMRHLLAKQIERNGLK
FT                   KGELTVEESAILDIIRYYTREAGVRGLEREISKICRKAVKNLLVNPKLKSITVNSDNLH
FT                   DYLGVKRFEFGKADTQNRIGEVTGLAWTEVGGDLLTIETASVVGKGKLSFTGSLGDVMK
FT                   ESIQAAMTVVRARADKLGINAEFHEKRDIHIHVPDGATPKDGPSAGIAMCTALISCLTG
FT                   NPVRADVAMTGEISLRGKVLPIGGLKEKLLAAHRGGIKTVLIPKENVKDLEEIPENVKQ
FT                   NLAIHAVETIDEVLGFALENPPEGIEFVKVEAKPKAPRRKVTSKSERAVN"
FT   CDS_pept        745303..746178
FT                   /transl_table=11
FT                   /locus_tag="HICON_09530"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86418"
FT                   /protein_id="CBY86418.1"
FT                   /translation="MSTKNHFIFPTYVQMYPYSKDRPFLKQVREKLRYYGYKWLYQKQC
FT                   HQLVDFLNTETQWQSLFTQDYYRTNTILTTFCDKRFSASERLTAITENLRLAEEKMGRS
FT                   LCQQLLDQQHIVLTQLTEDLRLSLSINHIDPFEGYFSINIRNQNNERVYDASFTFLSPN
FT                   KLLIASIQGSSSNNAQELVKQATKALHGMRPMFMLVNAFKMLAEKWQCELVGIPHKAQG
FT                   KYRLSARSKILFNYDEFWQENQGEYRHNYWQLPLHIERKQLEDIASKKRSMYRKRYEML
FT                   DQMALDIQQL"
FT   CDS_pept        complement(746228..747019)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09540"
FT                   /product="predicted pyrophosphatase MazG"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86419"
FT                   /protein_id="CBY86419.1"
FT                   /translation="MRYSIQDFIQLIAQLRNPNGGCPWDLKQNYESMISCLTEETYEVI
FT                   EAIEKKDIPNLREELGDLLLQVVFFSQLATEDKYFTFDDVLQDIAEKIVRRHPHVFGNA
FT                   KAGDETEALSRWNEMKAKEKQGKSEETSILDNVPRALPSLTRAAKLQKRCSKVGFDWEE
FT                   ISPVFDKVREELQEVQAEINRTSIEQNKVEEEIGDLLFATVNLARHLKCDPEDALRKAN
FT                   LKFERRFRAVEQAVQQQGKQVNNVPLIELDLLWDEVKKQEN"
FT   CDS_pept        747151..747690
FT                   /transl_table=11
FT                   /locus_tag="HICON_09550"
FT                   /product="Bifunctional protein pyrR"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86420"
FT                   /protein_id="CBY86420.1"
FT                   /translation="MEKIIIDHDRFLRTISRISHEIIEKHQTLDDLVIVGIKRRGAEIA
FT                   ELLQRRVEELSGINLPSMELDITFYRDDLTLVDQEDKMPVYSGSSQYLNIQDKTVILVD
FT                   DVLFTGRTIRAAMDALTDFGRAAKIELVIFVDRGHRELPIRADYVGKNVPTSRDELVQV
FT                   RTEKQDGCYEVAILGK"
FT   CDS_pept        747767..748702
FT                   /transl_table=11
FT                   /locus_tag="HICON_09560"
FT                   /product="survival protein SurA homolog"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86421"
FT                   /protein_id="CBY86421.1"
FT                   /translation="MKKFVLRSFLLAALGCVAFASMAQAGERVVATVDGIPILESQVRA
FT                   NMGKKGDRQSAIDKIIDDILVQKAVQESGVKIDPREIDHIVEDTAARNGLTYGQFLDAL
FT                   DYQGISLNTFRQQIANQMVMGAVRNKAIQESIDVTREEVVALGQKMLEEAKEKGTAQKV
FT                   MGKEYEVRHILLKLNPLLNDAQAKKQLAKIRSDIIAGKTTFADAALKYSKDYLSGANGG
FT                   SLGYAFPETYAPQFAQTVVKSKQGVISAPFKTEFGWHILEVTGVRDGDLTAEAYTQKAY
FT                   ERLVNTQLQDATNDWVKALRKRANIQYFNK"
FT   CDS_pept        748788..749297
FT                   /transl_table=11
FT                   /locus_tag="HICON_09570"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86422"
FT                   /protein_id="CBY86422.1"
FT                   /translation="MTKYNFLFKQQVIEFYLQNGKNSSLTRRHFQLAETTLERWINQFN
FT                   HSGINGLAVLGKKRNYSPEFKLNVIQAVKNGKFSAEAACLHFGIANAGVVSQWLKAFEK
FT                   QGINGLIPKPKGRPTMKLQYPKMPPKPKTREEELELENLRLRAENAILKKLQELNQQKM
FT                   QKKPLS"
FT   CDS_pept        749348..750115
FT                   /transl_table=11
FT                   /locus_tag="HICON_09580"
FT                   /product="Transposase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86423"
FT                   /protein_id="CBY86423.1"
FT                   /translation="MARSVFFYHLKTKNDKNSALSQEIATIYHDNHGNYGYRRVTFKLR
FT                   ETIKINHKKVQRIMQWLGLKGKCKTQKYRSYQGEVGHIADNLLQRDFTATQPNEKWTTD
FT                   ITEFKCAEGKLYLSPIKDLFNNEIIAYDLSRSPNFEQITRMMKQAVARLEGAKPILHSD
FT                   QGWQYQMIGYQNILRENGIQQSMSRKGNCLDNSAMESFFGRLKTECYYGKRFETFEQLE
FT                   KTIHEYIHYYNHERIQGKLKGLSPVNYRTQSLN"
FT   CDS_pept        750190..751233
FT                   /transl_table=11
FT                   /locus_tag="HICON_09590"
FT                   /product="predicted periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86424"
FT                   /protein_id="CBY86424.1"
FT                   /translation="MKKFLIAILLLILILAGVASFAYYKMTEFVKTPVNVQADQLLTIE
FT                   RGTTGSKLAALFEQEKLIDDGKLLPYLLKLKPELNKIKAGTYSLENVKTVQDLLDLLNS
FT                   GKEVQFNVKWIEGKTFKDWRKDLENAPHLVQTLKDKSNEDIFTLLDLPDVGQNLELKNV
FT                   EGWLYPDTYNYTPKSTDLELLKRSAERMKKALNKAWNERDDDLPLANHYEMLILASIVE
FT                   KETGIANERAKVASIFLNRLKAKMKLQTDPTVIYGMGENYNGNIRKKDLETKTPYNTYV
FT                   IDGLPPTPIAMPSESSLQAVAHPEKTDFYYFVADGSGGHKFTRNLNEHNKAVQEYLRWY
FT                   RSQKNAK"
FT   CDS_pept        751223..751882
FT                   /transl_table=11
FT                   /locus_tag="HICON_09600"
FT                   /product="thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86425"
FT                   /protein_id="CBY86425.1"
FT                   /translation="MPNKSAEENMKGKFIVIEGLEGAGKSSAHQSVVRVLHELGIQDVV
FT                   FTREPGGTPLAEKLRHLIKHETEEPVTAKAELLMLYAARIQLVDNVIKPALMQGKWVVG
FT                   DRHDMSSQAYQGGGRQLDPHFMLTLKETVLGDFEPDLTIYLDIDPIVGLARARGRGELD
FT                   RIEQMDLDFFHRTRARYLALVKDNPKAVVINAEQSIELVQADIESAVKNWWKSNEK"
FT   CDS_pept        complement(751946..753910)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09610"
FT                   /product="Autotransporter protein Las"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86426"
FT                   /protein_id="CBY86426.1"
FT                   /translation="MIAFLFIPYSVSGEPKYVQEYFVKERGIQYFGEGSGASVFYSLKD
FT                   MLDRNSVAWSPVPKQIIDYITNTEACYFSHPDSPKDDCQLFGSNTYEKKWFLTDFSEQK
FT                   YGAEEENGIFGNEYAKHFVYPFREDIPFYSESEKLYKLPVLYQSYLYDNYETEKTSRPL
FT                   NALINNRVYDFNVLAIDNYRSKFPDETRGLTLTVKNQSEVRGATLQLLKMVLQDSLWEP
FT                   RFNSDVHHLETQNANIRFNSTNTRLTVHENYQGDGSRFFIKFNPKEATQPVLTFDKDVT
FT                   GTSNIVFEKPIDDLKSLDGHQIIKVNGTADKHAFRLSGKHQKGIYTLSLQQRPEGFFTK
FT                   VQERDDIAIYAQQAQAANTLFALRLNDKNSDIFDRTLPRKGLWLRLISGHLSQDVQGKT
FT                   APVEGNRKGIQLGGDVFSLQNQDYQLSFGLMGGQAEQRSTFRNSDTDNLTTGSMKGFGA
FT                   GIYATWHQLQDKQTGAYVDSWVQYQRFRHRINTEDGIERFTSKGITASIEAGYNALLAE
FT                   HLTEKGTQIRFYLQPQAQLTYLGVNGDLTDSGNSKVNLLGSRQLQSRVGAQAKAQFTFT
FT                   NGVIFQPFVALNSIYQQKPFGVEIDNERRVINNKTAIESQLGVALKIKSHLTLQATFNR
FT                   QTGKHHHAKQGALNLQWTF"
FT   repeat_region   complement(753939..754014)
FT                   /note="GCAA x19"
FT   repeat_region   754014..754436
FT   CDS_pept        754226..755209
FT                   /transl_table=11
FT                   /locus_tag="HICON_09620"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86427"
FT                   /protein_id="CBY86427.1"
FT                   /translation="MTALYPWLMPIYHQIAQTFDEGLGHHAVLIKADSGLGVESLFNAL
FT                   AQKIMCVAQGDKPCGQCHSCHLMQAHSHPDYHELSPIDGKDIGVDQVRDINEMVAQHAQ
FT                   QNGNKVVYVQGAERLTEAAANALLKTLEEPRPNTYFLLQADSSASLLATIYSRCQVWNL
FT                   SVPNEQMAVDWLKSESAAENQEILTALAMNLGRPLLALETLQQGLIEQRKNFLRQFWVF
FT                   YRRRSPLELLPLFDKERYVQQVDWILAFLSDCLKHKLEIDSHRQVADLGRGIEQFSDEQ
FT                   TALGLLQAIKIMQKVRSDLLTINGVNVELMLLDGLTRLVTEVFETQ"
FT   CDS_pept        755262..756044
FT                   /transl_table=11
FT                   /locus_tag="HICON_09630"
FT                   /product="Putative deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86428"
FT                   /protein_id="CBY86428.1"
FT                   /translation="MFIVDSHCHLDALDYENLHKNISDVVEKARARDVKHLLAIGVTLS
FT                   RFEQAYDSLREFNNVSLACGVHPLDFEEEPYDAERLLRLAQDPKVIAIGEIGLDYYYSA
FT                   DNKAQQQAVFGSQIDIANQLDKPVIIHTRSAGDDTIAMLREHHAEKCGGVIHCFTETME
FT                   FAKKALDLGFYISCSGIVTFKNAEAIREVIRYVPTDRLLVETDSPYLAPVPYRGKENQP
FT                   AYTREVCEYVATLKGVSAEAFAQITTQNFERLFKIRVE"
FT   CDS_pept        756071..756595
FT                   /transl_table=11
FT                   /locus_tag="HICON_09640"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86429"
FT                   /protein_id="CBY86429.1"
FT                   /translation="MRKFFKYFLFIVVFLFHGFMFSVVNYVFPHYDVTRVTGVEVKRVD
FT                   KDGPITKSNPADGPTRDVYYINTQNDDGKIMVYRNEDTRWGFPFYFKFGSANLQAEAQA
FT                   LGNDNKLVQIKYYGWRITMVDEYRNATSIKEITADDTPSNPIVSWILYVFLLATLFLSI
FT                   QFIRGWFDSDK"
FT   CDS_pept        756646..757944
FT                   /transl_table=11
FT                   /locus_tag="HICON_09650"
FT                   /product="predicted inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86430"
FT                   /protein_id="CBY86430.1"
FT                   /translation="MIMELFHTILAIVALILSSAVVSSAEISLASSRKLKLQSLANEGD
FT                   VRALQVLKLQEHPGRFITVVQILLNMVAILGGGIGESALSPYIADILNRSFEGNWIEPT
FT                   ASTIAFILVTCLFILFADLIPKRIAITYPEMVALRVVGIMNFSMYVFKPLVWFFDTLAN
FT                   AFFRLFRISTVREDGMTSEDIFAVVEAGAEAGVLKTQEHYLIENIFDMQARTVTSTMTT
FT                   RENIVYLDRTFSRQEVMDTLSRDSHSKIVICDNGLDKILGYIESHTLLTMYLQNENVVL
FT                   TDPKLLRKALFVPDTLSLYEVLELFKSTGEDFAIIVNEYALVVGIVTLNDVMSIVMGEL
FT                   VSNEEEYIVSRDENSWLIDGATPLEEVTRVLDIAYFPDEENYETISGFMMYMLRKIPKK
FT                   TDSVVYGKYKFEVIDTENFKIDQILVSLVKEAE"
FT   CDS_pept        758017..758547
FT                   /transl_table=11
FT                   /locus_tag="HICON_09660"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86431"
FT                   /protein_id="CBY86431.1"
FT                   /translation="MFKKISVLFFTLILAGCSSWSSVTNYIPFTGNDKKVIDLDKDKID
FT                   QKSYAAAYEATVATYKGRVNENFFVDNFASGANDWYLGRILVPVKQIQDKLYTGGHDSD
FT                   VYAYYSGVLHAEALQANLKRLSANCWEKVDSQSMAQGIYDAMRDLQKGEARGENDEYIV
FT                   QGSEALLKACTSK"
FT   CDS_pept        758619..760118
FT                   /transl_table=11
FT                   /locus_tag="HICON_09670"
FT                   /product="PTS system, fructose-specific IIA/FPr component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86432"
FT                   /protein_id="CBY86432.1"
FT                   /translation="MLELSESNIHLNANAIDKQQAIEMAASALVQADNVENGYLQGMLA
FT                   RELQTSTFLGNGIAIPHGTLDTRSMVKKTGVQVFQFPQGIEWGEGNIAYVVIGIAARSD
FT                   EHLSLLRQLTHVLSDEDTAAKLAKITDVAEFCAILMGETIDPFEIPAANISLDVNTQSL
FT                   LTLVAINAGQLQVQSAVENRFISEVINNAALPLGKGLWVTDSVVGNVKNALAFSRAKTI
FT                   FSHNGKAVKGVITVSAVGDQINPTLARLLDDDVQTTLLNGNSTEILTALLGSSSDVETQ
FT                   SVEGAVVGTFTIRNEHGLHARPSANLVNEVKKFTSKITMQNLTRESEVVSAKSLMKIVA
FT                   LGVTQGHRLRFVAEGEDAKQAIESLGKAIANGLGENVSAVPPSEPDTIEIMGDQIHTPA
FT                   LTEDDNLPANAIEAVFVIKNEQGLHARPSAILVNEVKKYNASVAVQNLDRNSQLVSAKS
FT                   LMKIVALGVVKGTRLRFVATGEEAQQAIDGISAVIESGLGE"
FT   CDS_pept        760120..761061
FT                   /transl_table=11
FT                   /locus_tag="HICON_09680"
FT                   /product="fructose-1-phosphate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86433"
FT                   /protein_id="CBY86433.1"
FT                   /translation="MASVVTITLNAAYDLVGRLNRIQLGEVNTVETLGLFPAGKGINVA
FT                   KVLKDLGVNVAVGGFLGKDNSADFEQMFNKHGLEDKFHRVDGKTRINVKITETEADVTD
FT                   LNFLGYQISRQVWQQFVTDSLAYCLDYDIVAVCGSLPRGVSPELFADWLNQLHQAGVKV
FT                   VLDSSNAALTAGLKAKPWLVKPNHRELEAWVGHPLNRLEEIIAAARQLKAKGIENVIIS
FT                   MGAKGSLWINNEGVLKAEPAKCENVVSTVGAGDSMVAGLIYGFEKGLSKAETLAFATAV
FT                   SAFAVSQSNVGVSDLSLLDPILEKVQITMIEG"
FT   CDS_pept        761063..762733
FT                   /transl_table=11
FT                   /locus_tag="HICON_09690"
FT                   /product="PTS system, fructose-specific IIBC component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86434"
FT                   /protein_id="CBY86434.1"
FT                   /translation="MKLFLTQSANVGDAKVYLLHEVFRAAAQKANVSIVETPAEADLVL
FT                   VFGSVLPNNPELVGKKVFIIGEAIAMISPEVTLANALANGADYVAPKSAVSFTGVSGVK
FT                   NIVAVTACPTGVAHTFMSAEAIEAYAKKQGWNVKVETRGQVGVGNEITVEEVAAADLVF
FT                   VAADIDVPLDKFKGKPMYRTSTGLALKKTEQEFDKAFKEAKIFDGGNNAGTKEESREKK
FT                   GVYKHLMTGVSHMLPLVVAGGLLIAISFMFSFNVIENTGVFQDLPNILINIGSGVAFKL
FT                   MIAVFAGYVAFSIADRPGLAVGLIAGMLASEAGAGILGGIIAGFLAGYVVKGLNVIIRL
FT                   PASLTSLKPILILPLLGSMIVGLTMIYLINPPVAEIMKELSNWLTSMGEVNAIVLGAII
FT                   GAMMCIDMGGPVNKAAYTFSVGLIASQVYTPMAAAMAAGMVPPIGMTVATWIARNKFTV
FT                   SQRDAGKASFVFGLCFISEGALPFVAADPIRVIISSVIGGAVAGAISMGLNITLQAPHG
FT                   GLFVIPFVSEPLKYLGAIAIGALSTGVVYAIIKSKNNAE"
FT   tRNA            complement(763174..763256)
FT                   /product="transfer RNA-Leu"
FT                   /anticodon="(pos:763220..763222,aa:Leu)"
FT   CDS_pept        complement(763281..763622)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09700"
FT                   /product="protein-export membrane protein SecG"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86435"
FT                   /protein_id="CBY86435.1"
FT                   /translation="MYQVLLFIYVVVAIALIGFILVQQGKGANAGASFGGGASGTMFGS
FT                   AGAGNFLTRTSAILATAFFVIALVLGNMNSHKGNIQKGAFDDLSQAAEQVQQQQAAPAK
FT                   DNKNSDIPQ"
FT   CDS_pept        complement(763731..765686)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09710"
FT                   /product="DNA topoisomerase III"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86436"
FT                   /protein_id="CBY86436.1"
FT                   /translation="MRLFIAEKPSLARAITDVLPKPHQRGDGFIKCGDNDVVTWCVGHL
FT                   LEQAEPDAYDPKFKQWRLEHLPIIPEKWQLLPRKEVKKQLSVVEKLIHQADTLVNAGDP
FT                   DREGQLLVDEVFSYANLSAEKRDKILRCLISDLNPSAVEKAVKKLQPNRNFIPLATSAL
FT                   ARARADWLYGINMTRAYTIRGRQTGYDGVLSVGRVQTPVLGLIVRRDLEIEHFQPKDFF
FT                   EVQAWVNPDNKEEKTPEKSTALFSALWQPSKACEDYQDDDGRVLSKGLAENVVKRITNQ
FT                   PAEVTEYKDVREKETAPLPYSLSALQIDAAKRFGMSAQAVLDTCQRLYETHRLITYPRS
FT                   DCRYLPEEHFAERHNVLNAISTHCEAYLRLPNVISTEQRNRCWNDKKVEAHHAIIPTAK
FT                   NRPVNLTQEERNIYSLIARQYLMQFCPDAEYRKSKITLNIAGGTFIAQARNLQTAGWKE
FT                   LLGKEDDTDNQEPLLPIVKKGQILHCERGEVMSKKTQPPKPFTDATLLSAMTGIARFVQ
FT                   DKELKKILRETDGLGTEATRAGIIELLFKRGFLTKKGRNIHSTETGRILIQALPDIATQ
FT                   PDMTAHWESQLTDISQKQATYQQFMHNLNQMLPDLVRFVDLNALRQLSRIKMIKSDRVK
FT                   PKSAVKKSSKSNGKTD"
FT   CDS_pept        complement(765702..766304)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09720"
FT                   /product="recombination protein RecR"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86437"
FT                   /protein_id="CBY86437.1"
FT                   /translation="MQSSPLLEHLIENLRCLPGVGPKSAQRMAYHLLQRNRSGGMNLAR
FT                   ALTEAMSKIGHCSQCRDFTEEDTCNICNNPRRQNSGLLCVVEMPADIQAIEQTGQFSGR
FT                   YFVLMGHLSPLDGIGPREIGLDLLQKRLVEESFHEVILATNPTVEGDATANYIAEMCRQ
FT                   HNIKVSRIAHGIPVGGELETVDGTTLTHSFLGRRQID"
FT   CDS_pept        complement(766435..766764)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86438"
FT                   /protein_id="CBY86438.1"
FT                   /translation="MFGKGGLGGLMKQAQQMQEKMQKMQEEIAQLEVTGESGAGLVKIT
FT                   INGAHNCRRIDIDPSLMEDDKEMLEDLIAAAFNDAVRRAEELQKEKMASVTAGMPLPPG
FT                   MKFPF"
FT   CDS_pept        complement(766933..767778)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86439"
FT                   /protein_id="CBY86439.1"
FT                   /translation="MLSYRHSFHAGNHADVLKHIVLMLILENLKLKEKGFFYLDTHSGV
FT                   GRYRLSSNESEKTGEYKEGIGRLWDQTDLPKDIARYVKMIKKLNYGGKELRYYAGSPLI
FT                   AAELLRSQDRALLTELHPSDYPILRNNFSDDKNVTVKCDNGFQQVKATLPPKERRGLVL
FT                   IDPPYELKDDYDLVVKAIEEGYKRFATGTYAIWYPVVLRQQTKRIFKGLDATGIRKILK
FT                   IELAVRPDSDQRGMTASGMVVINPPWTLETQMKEILPYLTKTLVPEGTGSWTVEWITPE
FT                   "
FT   CDS_pept        complement(767851..770445)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09750"
FT                   /product="penicillin-binding protein 1A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86440"
FT                   /protein_id="CBY86440.1"
FT                   /translation="MRIAKLILNTLLTLCILGLVAGGMLYFHLKSELPSVEALKTVELQ
FT                   QPMQIYTADGKLIGEVGEQRRIPVKLADVPQRLIDAFLATEDSRFYDHHGLDPIGIARA
FT                   LFVAVSNGGASQGASTITQQLARNFFLTSEKTIIRKAREAVLAVEIENTLNKQEILELY
FT                   LNKIFLGYRSYGVAAAAQTYFGKSLNELTLSEMAIIAGLPKAPSTMNPLYSLKRSEERR
FT                   NVVLSRMLDEKHISKEEYDAALKEPIVASYHGAKFEFRADYVTEMVRQEMVRRFGEENA
FT                   YTSGYKVFTTVLSKDQAEAQKAVRNNLIDYDMRHGYRGGAPLWQKNEAAWDNDRIVGFL
FT                   RKLPDSEPFIPAAVIGIAKGGADILLASGEKMTLSTNAMRWTGRSNPVKVGEQIWIRQR
FT                   ANGEWQLGQIPAANSALVSLNSDNGAIEAVVGGFSYEQSKFNRATQSLIQVGSSIKPFI
FT                   YAAALEKGLTLSSVLQDSPISIQKPGQKMWQPKNSPDRYDGPMRLRVGLGQSKNMIAIR
FT                   AIQTAGIDFTAEFLQRFGFKRDQYFASEALALGAASFTPLEMARAYAVFDNGGFLIEPY
FT                   IIEKIQDNTGKDLFIANPKIACIECNDIPVIYGETKDKINGFANIPLGESALKPTDDST
FT                   NGEELDQQPETVPELPELQSNFTALKEDAIDLMAAAKNASSKIEYAPRVISGELAFLIR
FT                   SALNTAIYGEQGLDWKGTSWRIAQSIKRSDIGGKTGTTNSSKVAWYAGFGANLVTTTYV
FT                   GFDDNKRVLGRGEAGAKTAMPAWITYMKTALSDKPERKLPLPPKIVEKNIDTLTGLLSP
FT                   NGGRKEYFIVGTEPTRTYLSEMQERGYYVPTELQQRLNNEGNTPATQPQELF"
FT   CDS_pept        770544..771341
FT                   /transl_table=11
FT                   /locus_tag="HICON_09760"
FT                   /product="competence protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86441"
FT                   /protein_id="CBY86441.1"
FT                   /translation="MQFSLKNYRTLQIGIHRKQSYFDFVWFDDLEQPQSYQIFVNDRYF
FT                   KNRFLQQLKTQYQGKTFPLQFVASIPAHLTWSKVLMLPQVLNAQECHQQCKFVIEKELP
FT                   IFLEELWFDYRSTPLKQGFRLEVTAIRKSTAQTYLQDFQPFKINVLDVASNAVLRAFQY
FT                   LLNEQVRSENTLFLFQEDDYCLAICERSQQSQILQSHENLTALYEQFTERFEGQLEQVF
FT                   VYQIPSSHTPLLENWQRVETELPFIALGNALWQKDLHQQKVGG"
FT   CDS_pept        771342..771848
FT                   /transl_table=11
FT                   /gene="comB"
FT                   /locus_tag="HICON_09770"
FT                   /product="competence protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86442"
FT                   /protein_id="CBY86442.1"
FT                   /translation="MSMNLLPWRTYQHQKRLRRLAFYIALFILLAINLMLAFSNLIEQQ
FT                   KQNLQAQQKSFEQLNQQLHKNTMQIDQLRSAVKVGEVLTSIPNEQVKKSLQQLSELPFQ
FT                   QGELNKFKQDANNLSLEGNAQDQTEFELIHQFLKKHFPNVKLSQVQPEQDTLFFHFDVE
FT                   QGAEK"
FT   CDS_pept        772115..772366
FT                   /transl_table=11
FT                   /gene="comC"
FT                   /locus_tag="HICON_09780"
FT                   /product="competence protein C"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86443"
FT                   /protein_id="CBY86443.1"
FT                   /translation="MPLNKQIQRLAARNGLSQHLRWEMGQKPILHLQLTGHFEKTKTFL
FT                   TALLANSSQLSVSRLQFIKPEDSPLQTEIIFQLDRETK"
FT   CDS_pept        772363..772776
FT                   /transl_table=11
FT                   /gene="comD"
FT                   /locus_tag="HICON_09790"
FT                   /product="competence protein D"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86444"
FT                   /protein_id="CBY86444.1"
FT                   /translation="MKYWFFLTALLFINCTWGQDPFDKTQRNRSQFDNAQTVMEQTEII
FT                   SSDVPNNLCGADENRQAAEIPLNALKLVGVVISKDKAFALLQDQALQVYSVLEGVDVAQ
FT                   EGYIVEKINQNNVQFMRKLGEQCDSSEWKKLSF"
FT   CDS_pept        772786..774123
FT                   /transl_table=11
FT                   /gene="comE"
FT                   /locus_tag="HICON_09800"
FT                   /product="competence protein E"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86445"
FT                   /protein_id="CBY86445.1"
FT                   /translation="MKKYFLKCGYFLVCFCLPLIVFANPKTDNERFFIRLSQAPLAQTL
FT                   EQLAFQQDVNLVMGERLEGNISLKLNNIDMPRLLKIIAKSKHLTLNKDDGVYYLNGSQS
FT                   GKGQVAGNLTTNEPHLVSHTVKLHFAKASELMKSLTTGSGSLLSSTGSITFDDRSNLLV
FT                   IQDEPRSVQNIKKLIAEMDKPIEQIAIEARIVTITDESLKELGVRWGIFNPTENARRVA
FT                   GSLTGNSFENIADNLNVNFATTTTPAGSIALQVAKINGRLLDLELSALERENNVEIIAS
FT                   PRLLTTNKKSASIKQGTEIPYIVSNTRNDTQSVEFREAVLGLEVTPHISKDNNILLDLL
FT                   VSQNSPGSRVAYGQNEVVSIDKQEINTQVFAKDGETIVLGGVFHDTITKSEDKVPLLGD
FT                   IPVIKRLFSKESERHQKRELVIFVTPHILKAGETLEALKQKSAGKK"
FT   CDS_pept        774136..774822
FT                   /transl_table=11
FT                   /gene="comF"
FT                   /locus_tag="HICON_09810"
FT                   /product="competence protein F"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86446"
FT                   /protein_id="CBY86446.1"
FT                   /translation="MNFFNFRCIHCRGNLHIAKNGLCSGCQKQIKSFPYCGHCGAELQY
FT                   YAQHCGNCLKQEPSWDKMVIIGHYIEPLSILIHRFKFQNQFWIDRTLARLLYLAVRDAK
FT                   RTHQLKLPEAIIPVPLYHFRQWRRGYNQADLLSRQLSRWLDIPNLSNIVKRVKHTYTQR
FT                   GLSAKDRRQNLKNAFSLVVSKNEFPYRRVALVDDVITTGSTLNEISKLLRKLGVEEIQV
FT                   WGLARA"
FT   CDS_pept        774898..775494
FT                   /transl_table=11
FT                   /locus_tag="HICON_09820"
FT                   /product="Fe/S biogenesis protein nfu"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86447"
FT                   /protein_id="CBY86447.1"
FT                   /translation="MEQATQQIAISDAAQAHFRKLLDTQEEGTNIRIFVVNPGTPNAEC
FT                   GVSYCPPNAVEESDIEMKYNTFSAFIDEVSLPFLEEAEIDYVTEELGAQLTLKAPNAKM
FT                   RKVADDAPLIERVEYVIQTQINPQLANHGGRITLIEITEDGYAVLQFGGGCNGCSMVDV
FT                   TLKDGVEKQLVSLFPNELKGAKDITEHQRGEHSYY"
FT   CDS_pept        775561..776355
FT                   /transl_table=11
FT                   /locus_tag="HICON_09830"
FT                   /product="NADH pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86448"
FT                   /protein_id="CBY86448.1"
FT                   /translation="MKILQQDDFGYWLLTQGSNLYLVNNELPFGIAKDIDLEGLQAMQI
FT                   GEWKNHPLWLVAEQESDEREYVSLRNLLSLPEDEFHILSRGVEINHFLKTHKFCGKCGH
FT                   KTQQTQDELAVQCIHCGYQTYPVICPSIIVAVRRGHEILLANHKRHYSPNGGIYTTLAG
FT                   FVEVGETFEQAVQREVFEETGISIKNLRYFGSQPWAFPNSQMVGFLADYESGEITLQES
FT                   EIHDAQWFSYDQPLPELPPTGTIARKLIHVTLELCKAEHKCD"
FT   CDS_pept        776391..776981
FT                   /transl_table=11
FT                   /locus_tag="HICON_09840"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86449"
FT                   /protein_id="CBY86449.1"
FT                   /translation="MRNPIHKRLENLDSWQHLTFMAALCERMAPNFKLFCQMNELSVET
FT                   KTYQNILNLVWEYLTIKDVKINFENQLEKLESIIPDVNDYDSFGVVPALDACQALAEIL
FT                   HAIIAGETLEKAVEISLISLGTVRALLETETGRDWSESKLKENEDIQTELDVQWQVYRL
FT                   LKECEKRDIELILALKNEIRTEGISNIGIEFHQ"
FT   CDS_pept        777121..777393
FT                   /transl_table=11
FT                   /locus_tag="HICON_09850"
FT                   /product="DNA-binding protein HU"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86450"
FT                   /protein_id="CBY86450.1"
FT                   /translation="MNKTDLIDAIANAAELNKKQAKAALEATLDAITASLKEGEPVQLI
FT                   GFGTFKVNERAARTGRNPQTGAEIQIAASKVPAFVSGKALKDAIK"
FT   CDS_pept        777508..779340
FT                   /transl_table=11
FT                   /locus_tag="HICON_09860"
FT                   /product="L-glutamine:D-fructose-6-phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86451"
FT                   /protein_id="CBY86451.1"
FT                   /translation="MCGIVGAVAQRDVAEILINGLHRLEYRGYDSAGVAVINKQNELQR
FT                   IRCLGKVKALDEAVSEKPLIGGTGIAHTRWATHGEPSETNAHPHSSGTFAVVHNGIIEN
FT                   HEELRELLKSRGYVFLSQTDTEVIAHLVEWEMRSTDSLLEAVQKSVKQLTGAYGMVVMD
FT                   SRHPEHLVAARSGSPLVIGLGIGENFLASDQLALLSVTRRFIFLEEGDIAEITRRTVDI
FT                   YDTHGNKAKREIHESNLENDAAEKGKFRHFMQKEIYEQPTALINTMEGRINHENVIVDS
FT                   IGNGAKGILEKVEHIQIVACGTSYNAGMVARYWFESLAGVSCDVEIASEFRYRKFVTRP
FT                   NSLLITLSQSGETADTLAALRLAKEKGYMAALTICNVAGSSLVRESDLAFMTRAGVEVG
FT                   VASTKAFTTQLAALLMLVTALGKVKGHISAEKEREIIKAMQSLPAEIEKALAFDTEIEA
FT                   LAEDFAEKHHALFLGRGAFYPIAVEASLKLKEISYIHAEAYAAGELKHGPLALIDADMP
FT                   VIVVAPNNELLEKVKSNIEEVRARGGQLYVFADKEAGFTPSEGMKIITMPKVNDIVAPI
FT                   FYTIPMQLLSYYVALIKGTDVDQPRNLAKSVTVE"
FT   CDS_pept        complement(779395..779928)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09870"
FT                   /product="disulfide bond formation protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86452"
FT                   /protein_id="CBY86452.1"
FT                   /translation="MLALLKQFSEKRFVWFLLAFSSLALESTALYFQYGMGLQPCVLCV
FT                   YERLAMIGLFVAGIIALLQPRVFILRLIALALGLFSSIKGLLISFRHLDLQMNPAPWKQ
FT                   CEFIPNFPETLPFHQWFPFIFNPTGSCNESQWSLFGLTMVQWLVIIFSLYVVILTLLLI
FT                   AQVIKTRKQRRLFN"
FT   CDS_pept        complement(779938..781482)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09880"
FT                   /product="sodium:proton antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86453"
FT                   /protein_id="CBY86453.1"
FT                   /translation="MTNIQAFMKNFLGASPEWYKLAIVVFLIINPIVFFFISPFIAGWL
FT                   LVAEFIFTLAMALKCYPLQPGGLLAIEAIIIGMTNAKHVKAEIMANFEVILLLIFMVAG
FT                   IFFMKQLLLYVFTKLLVKIRSKIALSIAFCFSAAFLSAFLDALTVVAVIISVAMGFYGV
FT                   YHKVASGNNLIDAVDISDDRKIIEQQHEILENFRAFLRSLMMHAGVGTALGGVMTVVGE
FT                   PQNLIIAEQAKWNFMEFFFRMAPVTIPVFICGLLTCFLVEKFKLFGYGEKLPDEVWKVL
FT                   SDLDRTNSEKMSKQDKIKLGMQALIAIWLILGLAFHLAAVGLIGLSIIIFATSFTGVTD
FT                   EHTIGKAFQESLPFTALLVVFFSVVAVIIDQKLFSPIIHFVLSAEENTQLTLFYLFNGL
FT                   LSSISDNVFVATVYINEAKAALTNGVIAPHQFELLSVAINTGTNLPSVATPNGQAAFLF
FT                   LLTSSISPLIRLSYGRMVYMALPYTIVLSIIGLLAIEFILPAATIWLASLGLILPI"
FT   CDS_pept        781607..782332
FT                   /transl_table=11
FT                   /locus_tag="HICON_09890"
FT                   /product="DNA-binding transcriptional dual regulator of
FT                   fatty acid metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86454"
FT                   /protein_id="CBY86454.1"
FT                   /translation="MQNNNDILKAQSPAALAEEYIVKSIWQDVFPAGSNLPSERDLADK
FT                   IGVTRTTLREVLQRLARDGWLTIQHGKPTKVNNIWDAAGPNIIETLIALDMQSAPLIID
FT                   NMLSLRSKMSESYIYEAVKNSPQKSTALFAELDQLQNTAQDYTEFDYQLFRQFTVVANK
FT                   PFYRLIFNSLKGVYQRIGLLFFKEKKHRELTKQFYLEMQQICLEGNADAVVDCIRKHNV
FT                   RSSTYWKAILERLPQNLSD"
FT   CDS_pept        complement(782377..783744)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09900"
FT                   /product="CDP-diacylglycerol--serine
FT                   O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86455"
FT                   /protein_id="CBY86455.1"
FT                   /translation="MLINKTKRAEQNLNNLPFLALQAEQIEFLGSSAEFKTQIIELIRN
FT                   AKKRIYVTALYWQKDEAGQEILDEIYRVKQENPHLDVKILIDWHRAQRNLLGAEKSATN
FT                   ADWYCEQRQTYQLPNDPNMFFGVPINTREVFGVLHVKGFVFDDTVLYSGASINNVYLHQ
FT                   FEKYRYDRYQKITHSELADSMVNFINDYLLDFSAVYPLDVTNRPRTKEIRGNIRAYRKD
FT                   LAQNGEYSLKSAVKLPNVLSVSPLFGLGASGNELNQVIEDLFLQVQKKLVICTPYFNFP
FT                   RTLQHKIATLLENGKRVEIIVGDKVANDFYIPPEQPFKMAGALPYLYESNLRRFCEKFE
FT                   TQIENGQLVVRLWRDGDNTYHLKGVWVDDRYILLTGNNLNPRAWRLDAENGLLIYDPQQ
FT                   QLLAQVEKEQNQIRQHTKVLKHYTELEELNQYPEPVQKLLKKFARIKADKLVKMIL"
FT   CDS_pept        783891..784946
FT                   /transl_table=11
FT                   /locus_tag="HICON_09910"
FT                   /product="predicted methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86456"
FT                   /protein_id="CBY86456.1"
FT                   /translation="MNDKRKPSFQSAGKTFQERSVGEKYREKPSQNRPHFNDKFNGNRN
FT                   EKSRFSRDKQEVKETKITQLSLSRAPSNKNAEQPKVQVTIKSTGTVYKTKEKKTGALSP
FT                   RAPEKIKKNRAEEMKVYGENACLALFAERPESIVRLWATVQMSHKIGDVLSYLAENKKA
FT                   YHVVDSEELARVSGTEHHGGICLLVKKPRVFMLQGYLDIPHKEDCLVLLDNVNNAQNIG
FT                   GVLRTCAYFGVKNIVADNVENLYSGASMRVAEGGAEYIRVLETDDIDSALMHLRKSGYQ
FT                   IIHVSHNKQGDPLDKVRLKNKVVFVLSESSTESLATPEDTQVRLTLASPIKSGLNIAVN
FT                   AGVLLAKWYFR"
FT   CDS_pept        complement(784978..785676)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09920"
FT                   /product="predicted O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86457"
FT                   /protein_id="CBY86457.1"
FT                   /translation="MNGFTFKQFHINQNSCAMKVGTDGILLGAWADVKHCKNILDMGCG
FT                   TGLLALMLAQRTEENCQIQAVELDPIAAKQAQENINNSVWKNRIQLTQADIQHFLQTTE
FT                   QTFDLIVANPPYFEQGIACKNEERELARYTKQSHLNWLEWAAIRLSENGRISFVLPYEA
FT                   GKTLIKSTALFCIKQTNVITKIGKTPQRMLLTFAKQPEVLMQDQLVIYDADNQYTEAFI
FT                   ELTKDFYLKF"
FT   CDS_pept        785746..787080
FT                   /transl_table=11
FT                   /locus_tag="HICON_09930"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86458"
FT                   /protein_id="CBY86458.1"
FT                   /translation="MNLSQFEQFDLSPELLKALEKKGYSRPTAIQMEAIPAAMEERDVL
FT                   GSAPTGTGKTAAFLLPALQHLLDYPRRKPGPPRILVLTPTRELAMQVAEQAEELAQFTH
FT                   LNIATITGGVAYQNHGDVFNTNQDLVVATPGRLLQYIKEENFDCRSVEMLIFDEADRML
FT                   QMGFGQDAEKIAAETRWRKQTLLFSATLEGELLVDFAERLLNDPVKVDAEPSRRERKKI
FT                   NQWYYHPDSNEHKIKLLARFIETEEVTRGIVFVRRREDARELSETLRKRGIRSAYLEGE
FT                   MAQTQRNNAIDKLKSGIVTVLVATDVAARGIDIDDVSHVMNFDLPYSADTYLHRIGRTA
FT                   RAGKKGTAVSFVEAHDYKLLGKIKRYTEEILKARILAGLEPRTKPPKDGEVKSVSKKQK
FT                   ARIKEKREEKKKTEAKKKVKLRHKDTKNIGKRRKPSNSHIYACIV"
FT   CDS_pept        complement(787257..787808)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09940"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86459"
FT                   /protein_id="CBY86459.1"
FT                   /translation="MKHIYLLQGKIMINENLAYLSVLPLEDLKIERSSFSCSVEPLEKY
FT                   FHKYVSQDVKKGLAKCFVLINEQQSRIVGYYTLSALSIPITDIPQERISKGVPYPNIPA
FT                   VLIGRLAIDTNFQKQGYGKFLIADAIHKIKNATVAATILVVEAKNDDASSFYERLGFIE
FT                   FKEFGGTHRKLFYPLTKLIK"
FT   CDS_pept        complement(788206..789588)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09950"
FT                   /product="Peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86460"
FT                   /protein_id="CBY86460.1"
FT                   /translation="MTTQFKPELLSPAGSLKNMRYAFAYGADAVYAGQPRYSLRVRNNE
FT                   FNHANLKIGIDEAHSLGKKFYVVVNIAPHNSKLKTFIKDLQPVIDMKPDALIMSDPGLI
FT                   MLVRENFPNIDIHLSVQANAVNWATVKFWKQMGLTRVILSRELSIDEIAEIRQQVPDIE
FT                   LEIFVHGALCMAYSGRCLLSGYINKRDPNQGTCTNACRWEYKMEEGTTDEIGNIVPKID
FT                   PAQQIEVKNVAPTLGEGAVTDKVFLYTESQKPDEQMTAFEDEHGTYFMNSKDLRAVQHV
FT                   EKLTALGVHSLKIEGRTKSFYYCARTAQVYRKAIDDAAAGKPFDESLMDTLESLAHRGY
FT                   TEGFLRRHTHDEYQNYEYGYSISDRQQFVGEFTGKRNEQGMAEVAVKNKFLLGDNVEMM
FT                   TPQGNINFKIEKMLNRKNETVDAALGDGHFVFLNVPQDINLNYALLMRNLVNTNTRNPH
FT                   SN"
FT   CDS_pept        complement(789757..791100)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09960"
FT                   /product="Conserved hypothetical metabolite transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86461"
FT                   /protein_id="CBY86461.1"
FT                   /translation="MCKPQQKHYGRQVMNTQNSLKQVATATMVGTAIEYFDNYIYAMAA
FT                   VLVFNHQFFHAADPLSGQIAALSTLALTFIARPLGAILFGHFGDRFGRKNTFVMSLLLM
FT                   GVSTVVIGLLPTYDSIGIWATILLCLCRIGQGIGLGGEWGGAALVAVENAPEGKRGWYG
FT                   TFPQLGAPLGLLLANGVFLGITAIFGQEAMTEWAWRIPFLSSVILVAIGLYVRLKLTEA
FT                   PIFLAALNKPQPKRLPMLEVVTTHFKPFFLGMLVCIAGYVLFYIMIAFSQIYAKSAPTV
FT                   SEAGYAMGLGLSPQIFTALLMASAISLAITIAVSGKYIDKIGRRIWLIWTTVGVAIFGL
FT                   SLPLFLENGTTTSLFWFLFIGMGLIGMGYGPLASFLPELFPTHARYSGASLTYNIAGLF
FT                   GASVAAIIALPLNAHYGLKGVGIYLTLNAVLSLVGLWFISETKDKLLS"
FT   CDS_pept        complement(791045..791725)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09970"
FT                   /product="Thiamine monophosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86462"
FT                   /protein_id="CBY86462.1"
FT                   /translation="MKNIQKILPLYFVAGTQDCRHLGENLSENLLFVLKQALEGGITCF
FT                   QFRDKGKFSLEHTPSAQKALAMSCRDLCREYGVPFIVDDNVDLALEIEADGIHVGQSDM
FT                   SVQEIRAKTDKPLIIGWSVNRLDEAKIGENLAEIDYFGIGPIFPTQSKENPKPTLGMAF
FT                   IQTLRNVGITKPLVAIGGVKLAHVKTLREFGADGVAVITAITHADNVQAATKALREASD
FT                   EYAK"
FT   CDS_pept        complement(791736..792545)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09980"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86463"
FT                   /protein_id="CBY86463.1"
FT                   /translation="MSNVKQVLTIAGSDSGGGAGIQADLKTFQMRGVFGTSAITAVTAQ
FT                   NTLGVFDIHPIPLKTIQAQLEAVKNDFQIASCKIGMLGNAEIIECVADFLADKPFGTLV
FT                   LDPVMIAKGGAPLLQQQAVSALSQKLLPLADVITPNIPEAEALTGIAIVDDISIQQAAK
FT                   ALQKQGAKNVIIKGGHSLNSQSELCQDWVLLADGRHFTLQSPRFNTPHTHGTGCTFSAC
FT                   LTAELAKGEPLQSAVKTAKDFITAAISHPLNIGQGHGPTNHWAYSRL"
FT   CDS_pept        complement(792538..793329)
FT                   /transl_table=11
FT                   /locus_tag="HICON_09990"
FT                   /product="hydoxyethylthiazole kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_09990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86464"
FT                   /protein_id="CBY86464.1"
FT                   /translation="MQSIYLSKIREQNPLIHNITNIVAANFSANGLLALGASPLMSANI
FT                   EEMQEVPKISQALVINIGTLIGKDREAMLQAGKTANEVGIPVVLDPVGVGATSYRRETI
FT                   RELLAEVKFALIRGNAGELAAIAGETWQAKGVDAGQGEVDLKAVAEKVAQRYGCTVLIS
FT                   GAVDIVSDGTQTATVHNGTSLFPKVTASGCLLSAVCAAFLAVSEGNYFSATLEACVAYT
FT                   IAGECAAQGLTTQVGQFQIRLLDELAALSPETIGQRGRINE"
FT   CDS_pept        complement(793655..794317)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10000"
FT                   /product="Opacity-related protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86465"
FT                   /protein_id="CBY86465.1"
FT                   /translation="MQADWVHAREKIETHNPNQPEILQDYSYIKTHSNHPRFSIGYDFG
FT                   NWRIAADYAHYRKWSHGKHLISEPIEKDLAGSTPQMKQVKSSTVIDHKDAGSFQAKNSY
FT                   GVSVIYDFDTEYKIKPYVGARIGVGHVAASGYTKDEFTTKLTLKANNMLIGNVKADQKT
FT                   SYSRTIKRIGFGFIGGIGYDITPNITLDLGYRYNDWGRLENVRFKTHEASFGVRYRF"
FT   CDS_pept        complement(794681..797479)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10010"
FT                   /product="ribonuclease E, RNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86466"
FT                   /protein_id="CBY86466.1"
FT                   /translation="MLINATQKEELRVALVDGQRLFDLDIESLGHEQKKANIYKGKITR
FT                   VEPSLEAAFVDYGAERHGFLPLKEIAREYFPDDYVFQGRPNIRDILTEGQEVIVQVNKE
FT                   ERGNKGAALTTFVSLAGSYLVFMPNNPRAGGISRRIEGDERTELKEALSSLDVPDGVGL
FT                   IVRTAGVGKSPEELQWDLKVLLHHWEAIKQASQSRPAPFLIHQESDVIVRAIRDYLRRD
FT                   IGEILIDSPKIFEKAKEHIKLVRPDFINRVKLYQGEVPLFSHYQIESQIESAFQREVRL
FT                   PSGGSIVIDVTEALTAIDINSARSTRGGDIEETALNTNLEAADEIARQLRLRDLGGLVV
FT                   IDFIDMTPIRHQREVENRIRDAVRPDRARIQISRISRFGLLEMSRQRLSPSLGESSHHI
FT                   CPRCQGTGKVRDNESLSLSILRLLEEEALKENTKQVHTIVPVQIASYLLNEKRKAISNI
FT                   EKRHNVDIIVAPNEAMETPHFSVFRLRDGEEVNELSYNLAKIHCAQDENTEESLVSRNV
FT                   ETTVVTEQPAVESAVVALSISEAAPTPVERKSNEPSLLAKIIAKIKGLFATKSEENKPK
FT                   NNRTSRNPNRNQRRSQDRRSSRRPRSENNETERTEEQVRNVRERNQRRPRRNLVEESIA
FT                   ESAVNSTPVFEAKEERTEPVTQRRQRRDLRKRVRVEDNETVVENNFSTTEKMPEVDVIT
FT                   VQNNDEKPVHQNQRSERQERQRRTPRHLRAANNQRRRRNQEPKSPMPLFAAVVSPELAS
FT                   GKAWIDYSTVNLPKENHFLSVDELLEQEKTKKGFITPAMGIVVEEKSPDVKPALDFITQ
FT                   PANESVQKKVQESLDRLSSYKPQEVVESIDPAINVDEPETLEKVSKFVRTYEFNGRLGT
FT                   ISSVPHTKAEMTLAKANDEMPEAFPIRAWQDSRYYFYGTGAAGHHCAISHVYSEPTRAK
FT                   SE"
FT   CDS_pept        797909..798877
FT                   /transl_table=11
FT                   /locus_tag="HICON_10020"
FT                   /product="23S rRNA pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86467"
FT                   /protein_id="CBY86467.1"
FT                   /translation="MTKQNEKIINSSVKMLTISEDESGQRIDNYLLAKLKGVPKSLIYR
FT                   IVRKGEVRVNKGRIKPEYKLQTGDVVRIPPVRVAEKNDAPISKNLNKVAALENQILFED
FT                   DCLIILNKPSGIAVHGGSGLNFGVIEALRALRPEARFLELVHRLDRDTSGILLIAKKRS
FT                   ALRNLHEQLRVKTVQKDYLALVRGQWQSHIKVIQAPLLKNELSSGERIVRVSEQGKPSE
FT                   TRFSIEERYINATLVKASPVTGRTHQIRVHTQYAGHPIALDDKYGDKDFDKQMNELGLN
FT                   RLFLHAFSIRFEHPKNGETLRFNASLDHQMKAILQKLRESK"
FT   CDS_pept        798968..799243
FT                   /transl_table=11
FT                   /locus_tag="HICON_10030"
FT                   /product="RNA-binding protein Hfq"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86468"
FT                   /protein_id="CBY86468.1"
FT                   /translation="MAKGQSLQDPYLNALRRERIPVSIYLVNGIKLQGQIESFDQFVIL
FT                   LKNTVNQMVYKHAISTVVPARSVSHHNNNHHTAPTEAVENVEIQAE"
FT   CDS_pept        complement(799340..800296)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10040"
FT                   /product="Transcriptional regulatory protein TyrR"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86469"
FT                   /protein_id="CBY86469.1"
FT                   /translation="MTISKFNPQKPFECFIVQSEAMKSAVENAKRFAMFDAPLLIQGET
FT                   GSGKDLLAKACHYQSLRRDKKFIAVNCAGLPDEDAESEMFGRKVGDSETIGFFEYANKG
FT                   TVLLDGIAELSLSLQAKLLRFLTDGSFRRVGEEKEHYANVRVICTSQVPLHLLVEQGKV
FT                   RADLFHRLNVLTINVPALRDRMADIEPLAQGFLQEISEELKIAKPTFDKDFLLYLQKYD
FT                   WKGNVRELYNTLYRACSLVQDNHLTIESLNLALPQSAVISLDEFENKTLDEIIGFYEAQ
FT                   VLKLFYVEYPSTRKLAQRLGVSHTAIANKLKQYGIGK"
FT   CDS_pept        complement(800411..801832)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10050"
FT                   /product="predicted peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86470"
FT                   /protein_id="CBY86470.1"
FT                   /translation="MQHVKLARDRRKKRAYIKVGVFFIAILLILTGILLTIKDKSEGNP
FT                   IFSTSDSGEYHELNTSPNENSSALQSDENATSYDDELQAKDDEVDEVKLSSDDLDTLPQ
FT                   HAQDALNGLLDAADQAIRITNQFSYTVTEGDRLKDVLVLSGLDDSSVQPLITIDPELAH
FT                   LKAGQQFYWILDKNDNLEYLNWLVSEKEERIYERLEDGKFKRQVIEKKSIWRKEVLKGE
FT                   IQNSLNSSLREKGLDTRQISQLSNALQWQVSLRKLKKGTQFAILVSREYLGDKLTGQGN
FT                   VEALRISSGGKNYYAVQAANGRYYNQQGETLGKGFARYPLQRQARVSSPFNPNRRHPVT
FT                   GRVRPHKGVDFSVSQGTPVIAPADGTVEKVAYQAGGTGRYVMLRHGREYQTVYMHLSKS
FT                   LVKAGQTVKKGERIALSGNTGISTGPHLHYEFHINGRAVNPLTVKLPGTSSGMTSAERK
FT                   QFLVRVREAERMLKP"
FT   CDS_pept        802010..802816
FT                   /transl_table=11
FT                   /locus_tag="HICON_10060"
FT                   /product="zinc transporter subunit: ATP-binding component
FT                   of ABC superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86471"
FT                   /protein_id="CBY86471.1"
FT                   /translation="MNITAIRNEQNQQPLIQLKNINVVFAQKTALQDINLNIYPNSIIT
FT                   IVGPNGGGKSTLLKTLLKLQTPTSGEVIYSKNVRIGYVPQKIHLDHSLPITVERFLSLK
FT                   KGIKTQEISTALEQLSISHLRKNNMQKLSGGEMQRVLLARAILNKPNLLVLDEPTQGVD
FT                   ITGQAELYQLIHQTQQKLNCAVLMVSHDLHIVMADSKEVLCINQHICCAGTPDVLSNDP
FT                   TFMRLWGNQIAQNIGFYTHHHNHHHTLHGDVCGCNSSAVHCQNKDK"
FT   CDS_pept        802816..803601
FT                   /transl_table=11
FT                   /locus_tag="HICON_10070"
FT                   /product="high-affinity zinc uptake system membrane protein
FT                   ZnuB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86472"
FT                   /protein_id="CBY86472.1"
FT                   /translation="MFEILFPAFLTGILLSLITAPLGVFVVWRKMAYFGDTLSHSALLG
FT                   VALGIFLQVNPYIAIVVLTLILAIAMVWLESNTQFSIDTLLGIIAHSCLSLGVVTVGLL
FT                   RNVRVDLMNYLFGDLLAINYTDLIYIGIGVIIVLSTLIYFWQSLLSTTVSPELAQVEGI
FT                   NIKKMRFILMILTALTIALSMKFVGALIITSLLIIPAATARRFARTPESMVGWAIVVSM
FT                   LSIIAGLILSAFYDTAAGPSVVICSAFLFVLSLFKKERL"
FT   CDS_pept        803690..804637
FT                   /transl_table=11
FT                   /locus_tag="HICON_10080"
FT                   /product="acetyl-CoA carboxylase, carboxytransferase, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86473"
FT                   /protein_id="CBY86473.1"
FT                   /translation="MNQEYLDFELPIAELEAKIEALCSASDDKVDLTDEIKRLQKKSNE
FT                   LTKKTFANLDAWQVSRMARHPNRPYTLDYIEHIFTEFEELAGDRAFADDKAIVGGLARL
FT                   DGRPVMVIGHQKGRTVKDKVSRNFGMPAPEGYRKALRLMEMAERFKLPIITFIDTPGAY
FT                   PGIGAEERGQAEAIARNLREMAQLTVPVICTVIGEGGSGGALAIGVGDKVNMLQYSTYS
FT                   VISPEGCASILWKSAEKASTAAEVMGLTASRLKELNLIDSIVQEPLGGAHRNYLEIAEN
FT                   LKLRLKEDLAELDGLSKEELLNRRYERLMSYGYC"
FT   CDS_pept        804814..806115
FT                   /transl_table=11
FT                   /locus_tag="HICON_10090"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86474"
FT                   /protein_id="CBY86474.1"
FT                   /translation="MDLLSDIEKQLKQTSAQGFLIALSGGLDSTVLLSLFAKLRQKQPH
FT                   LPPLSIRAIHIHHALSPNADCWAQHCQNLCDQFQIPLIIERVQVDKTNGIEAGAREARY
FT                   QAIKKHLQIQEMLVTAHHLNDQTETFFLALKRGSGLQGLGAMQHQSVLFGMPIFRPLLG
FT                   FTRLQLEDYAQQEKLNWVKDESNEDNRFDRNFLRNEILPKLRERWAHFDLAVQRSAQHC
FT                   FEQQQLINDLLSETFAQHCQIKNQFKLCQFRQYSLAKQTALLRMWLAENQLEMPSKRQL
FT                   TQLINDVIFAKEEANPQFQLVNKVIRRYQDSLYLTKPFSDLTKCTLKLEQNTLNLPDDL
FT                   GNLTVQENEHNLIFYWQDYSVTLEKTNLPISIRFGYSGKVKHHPKRPREDIKKIWQELS
FT                   VPPWERNRIPLIFYGNELKSAVGFFRVFDELKSS"
FT   CDS_pept        complement(806112..806783)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10100"
FT                   /product="DNA mismatch repair protein MutH"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86475"
FT                   /protein_id="CBY86475.1"
FT                   /translation="MIPQTLEQLLSQAQSIAGLTFGELADELHIPVPIDLKRDKGWVGM
FT                   LLERALGATAGSKAEQDFSHLGVELKTLPINAEGYPLETTFVSLAPLVQNSGVKWENSH
FT                   VRHKLSCVLWMPIEGSRHIPLRERHIGAPIFWKPTAEQERQLKQDWEELMDLIVLGKLE
FT                   QITARIGEVMQLRPKGANSRAVTKGIGKNGEIIDTLPLGFYLRKEFTAQILNAFLETKS
FT                   L"
FT   CDS_pept        complement(806780..807319)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10110"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86476"
FT                   /protein_id="CBY86476.1"
FT                   /translation="MTALYYTYYPSPVGQLLILSDGESITHIDFEKEQYAPNPKWHKQD
FT                   ELPVFQKVRLAFERYFNGEVERFFDIPLKPEGTAFQQAIWQALREIDYGELSSYGELAL
FT                   RINNPKAVRAVGGAVGSNPISIIIPCHRILGKDRTLTGFGGGLEAKRFLLQLEKIPYID
FT                   KGTENTKPRFFKKYHE"
FT   CDS_pept        complement(<807497..808762)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10120"
FT                   /product="Outer membrane protein P1"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86477"
FT                   /protein_id="CBY86477.1"
FT                   /translation="MKKFNQSILATAMLLAAGGANAAAFQLAEVSTSGLGRAYAGEAAI
FT                   ADNASVVATNPALMSLFKTNQFSVGGVYVDSRINMNGDVAVSITNLTIRTTKDGSASQR
FT                   NVVPGAFVPNLYFVAPVNDKFALGAGMNVNFGLKSKYDDSYDAGVFGGKTDLTAINLNL
FT                   SGAYRVTEGLSVGLGVNAVYAKAQVERNAGIIAESAMIARNGAVLSVLPPQEKKVGEYL
FT                   TSKDKSVVSLQDRAAWGFGWNAGVMYQFNEGNRIGLAYHSKVDIDFTDRTATSLDAVVI
FT                   DAGKKGNLTLKLPDYLELSGFHQLTDKFAVHYSYKYTHWSRLTKLHASFEDGKKAFDKE
FT                   LQYSNNSRIALGASYNLDEKLTLRAGIAYDQAASRHHRSAAIPDTDRTWYSLGATYKFT
FT                   PNLSVDLGYAYLKGKKVHFKEVQ"
FT   CDS_pept        809004..809291
FT                   /transl_table=11
FT                   /locus_tag="HICON_10130"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86478"
FT                   /protein_id="CBY86478.1"
FT                   /translation="MTVKCKAEESLTCSCVDVGTIIDGSDCSVEVHQVYSTEADANAAL
FT                   ERLTKKARDTESDPCEIKSEIVAVENGVQLNASFTFSCQAEAMIFELANR"
FT   CDS_pept        complement(809389..810213)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10140"
FT                   /product="predicted phosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86479"
FT                   /protein_id="CBY86479.1"
FT                   /translation="MKNAFVYQTEKPVIKLLQITDPHLFKDESAELLGVNTQASFAQVL
FT                   KEIQQENNQFDVILATGDLVQDSSDEGYTRFVEMMKPFNKPVFWIPGNHDFQPKMAEFL
FT                   NQPPMNVAKHLLLGEHWQALLLDSQVYGVPHGQLSQHQLDLLKETLEKNPERYTLVVLH
FT                   HHLLPTNSAWLDQHNLRNSHELAEVLEPFSNVKAILYGHIHQEVNSEWNGYQVMATPAT
FT                   CIQFKPDCQYFSLDTLQPGWREIELYSDGSIRTEVKRIQQAEFLPNMQEDGY"
FT   CDS_pept        complement(810223..810855)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10150"
FT                   /product="ADP-ribose pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86480"
FT                   /protein_id="CBY86480.1"
FT                   /translation="MSEIQHFSQQDIEILGEQTLYEGFFTLKRIQFKHKLFAGGQSGVV
FT                   TRELLIKGAASAVIAYDPKEDSVILVEQVRIGAAYHPESHRSPWLLELIAGMVEKGEKP
FT                   EDVALRESEEEAGIQVKNLTHCLSVWDSPGGIVERIHLFAGEVDSSQAKGIHGLAEENE
FT                   DIRVHVVKREQAYQWMCEGKIDNGIAVIGLQWLQLNYAQLQQSWKRS"
FT   CDS_pept        complement(810988..812307)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10160"
FT                   /product="exodeoxyribonuclease VII large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86481"
FT                   /protein_id="CBY86481.1"
FT                   /translation="MSDNIYSVSQLNSAARQMLEGNFCQIWLTGEISNFTQPVSGHWYL
FT                   TLKDENAQVRCAMFRMKNLRVAFRPQNGMQVLVRANVSLYEPRGDYQLIIDSMHPAGEG
FT                   LLQQQFEALKMKLAAEGLFAQNLKKNLPHFSKAVGIITSSTGAALQDILHILARRDPSL
FT                   KVVIYPTAVQGKEATAEIVQMIELANVRQEVDVLIVGRGGGSLEDLWCFNEEEVARAIF
FT                   RSTLPIISAVGHETDVTIADFVADLRAPTPSAAAELVSRNQDELLQQLRHQQQRLDMAF
FT                   DRLFTRKSQSLKQLTLRLQNQHPQNQLRAQQAKNEQLTHRLQLAILRQFENTQQKFTAL
FT                   SVRLKQNPLPYQVQRHQQHLEQLQVRLNFSINRQVTERQNKLATLCGKLDGLSPLKVLA
FT                   RGYSIAENPQGKAIVSVKDVNQGDFITTQVADGKIVSKVL"
FT   CDS_pept        complement(812309..813523)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10170"
FT                   /product="Conserved hypothetical cupin superfamily
FT                   metalloenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86482"
FT                   /protein_id="CBY86482.1"
FT                   /translation="MTALSSVDFCLPEHITPEIFLRDYWQKKPLVIRNGLPEIVGQFEP
FT                   QDIIELAQNEDVTARLVKTFSDDDWKVFFSPLSEKDFQQLPEKWSVLVQNLEQWSPELG
FT                   QLWNKFGFIPQWQRDDIMVSYAPKGGSVGKHYDEYDVFLVQGYGHRRWQVGKWCDASTE
FT                   FKPNQSIRIFDDMGELVIDEVMNPGDILYIPARMAHYGVAEDDCLTFSFGLRYPNLSNL
FT                   IDSVSKGFCHQDPDLNLSEFDLPLRLSQSVQATGKLADENIQAMKQLLLDKLANSKAFD
FT                   TLFKQAVASAVSSRRYELLVSDEMCDPNEVRSILEEDGAFLSQDNNCKLLYTENPLRIY
FT                   ANGEWLDELNIIESEVLKRLSDGESLDWVFLSNLVNETEDPETSMDLLLDSICNWVDDG
FT                   WVLIE"
FT   CDS_pept        complement(813526..813834)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10180"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86483"
FT                   /protein_id="CBY86483.1"
FT                   /translation="MNQINIEIAYALPERYYLKSFQVDEGITVQTAITQSGILSQFPEI
FT                   DLSINKIGIFSRPIKLADVLKEGDRIEIYRPLLADPKEIRRKRAAEQAAAKDKEKGA"
FT   CDS_pept        814017..814601
FT                   /transl_table=11
FT                   /locus_tag="HICON_10190"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86484"
FT                   /protein_id="CBY86484.1"
FT                   /translation="MSEIKLIVGLGNPGDKYTDTRHNAGEWLIERLARRFNVSLNPESK
FT                   FFGKTARTLVNGKEVRLLVPTTFMNLSGKAVGALASFYRIKPEEILVIHDELDLPAGVA
FT                   KLKQGGGHGGHNGLKDIVAQLGNNNNFYRLRIGIGHPGHRDLVAGYVLNKPSPADRDAL
FT                   EKVLDEATDCVEMIFKDGMVKATNRLNSFKI"
FT   CDS_pept        814649..815740
FT                   /transl_table=11
FT                   /locus_tag="HICON_10200"
FT                   /product="GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86485"
FT                   /protein_id="CBY86485.1"
FT                   /translation="MGFKCGIVGLPNVGKSTLFNALTKAGIEAANYPFCTIEPNTGVVP
FT                   MPDPRLDALAEIVKPERVLPTTMEFVDIAGLVAGASKGEGLGNKFLANIRETDAIGHVV
FT                   RCFENDDIVHVAGKIDPLDDIDTINTELALADLDSCERAIQRLQKRAKGGDKEAKFELS
FT                   VMEKILPVLENAGMIRSVGLDKEELQAIKSYNFLTLKPTMYIANVNEDGFENNPYLDRV
FT                   REIAAKEGAVVVPVCAAIESEIAELDDEEKVEFLQDLGIEEPGLNRVIRAGYALLNLQT
FT                   YFTAGVKEVRAWTVSVGATAPKAAAVIHTDFEKGFIRAEVIAYEDFIQFNGENGAKEAG
FT                   KWRLEGKDYIVQDGDVMHFRFNV"
FT   CDS_pept        815814..817694
FT                   /transl_table=11
FT                   /locus_tag="HICON_10210"
FT                   /product="Acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86486"
FT                   /protein_id="CBY86486.1"
FT                   /translation="MSSIKYRPEIDGLRAIAVISVIIYHLNENWLSGGFLGVDIFFVIS
FT                   GFLITGIIITEIQQNSFSLKQFYTRRIKRIYPAFITVMALVSFIASAIFIYNDFNKLRK
FT                   TIELAIAFLSNFYLGLTQGYFDLSANENPVLHIWSLAVEEQYYLIFPLILILAYKKFRE
FT                   IKVLFIITLILFFILLATSFVSANFYKEVLHQPNIYYLSNLRFPELLVGSLLAIYHNLS
FT                   ASKQASKQASKQASNVIAILSTLLLFFCLFLMNNNIAYIPGITLILPCIFTALIIHTTS
FT                   QNNIVKLCLSNKAIVFIGKISYSLYLYHWIFIAFAYYITGEKQINNQSIAIVIILTIIF
FT                   SVLSYYLIEQPIRKSKLNFKQSFLYIYFIPSLLLLGFNLYKRQTIRAEKEHIEQAIPVS
FT                   NENHYPAKVIILGDSHSSHLEAFLNYVGNKEGWKADIFKDKFECSFIVNEQYQLDPNCQ
FT                   SVWQKDSQYKAIFISAFYDLRMGGQPVPRFRPETFIEPDFKARFKNTVKQLAMQKPVYV
FT                   FANNSSVSRSPLRGYLLENYGLEKYLEPIRRMGDIDASNKIIHDLVKDIPNVYWVDAQQ
FT                   YLPKDSVMAEGKYLYADQDHLTNFGAYYMAKEFSKYQRVMTPEQVKKLYE"
FT   repeat_region   816480..816523
FT                   /note="GCAA x11"
FT   CDS_pept        complement(817737..818879)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10220"
FT                   /product="ribonuclease D"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86487"
FT                   /protein_id="CBY86487.1"
FT                   /translation="MIKECQNPPHFRVISDNAALLEVCNLAQQKSAVALDTEFMRVSTY
FT                   FPKLGLIQLYDGERVSLIDPLAITDFSPFVALLSNPKVLKVLHSCSEDLLVFLQEFDQL
FT                   PRPMIDTQIMARFLGLGTSAGLAKLAQQYLNIEIDKGATRTNWIKRPLSDIQLQYAAGD
FT                   VWYLLPLYHILEKELAKTPWEQAVRDDCELVLAKTHKLQERDSEKAYLDIPNAWKLNPL
FT                   ELSRLRILAQWRQNVAIERDLALSYIVKSEHLWKVAKNNPRNTSEMLEMGLTENEVRVR
FT                   GKKILQLLAQARRVSSNDYPKPIERISEDPRYKKTIRLLQEKVNSLTPEGLAPEIVASK
FT                   RTLEELIKWVWKYDCSQDTLPELLIGWRKPIGEKLVDELR"
FT   CDS_pept        complement(818935..820623)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10230"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86488"
FT                   /protein_id="CBY86488.1"
FT                   /translation="MEKIWFQNYPEGSEKFLDTSKYESILDMFDKAVREHPDRPAYINM
FT                   GQVLTFRKLEERSRAFAAYLQNEFKLQRGDRVALMMPNLLQYPIALFGILRAGLIAVNV
FT                   NPLYTPRELELQLQDSGAVAIVVVSNFASTLEKVVFNTNVKHVILTRMGDQLSFGKRTL
FT                   VNFVVKYVKKLVPKYKLPHAVTFREVLSIGKYRQYVRPEISREDLAFLQYTGGTTGVAK
FT                   GAMLTHGNIITNVFQAKWIAEPFIGDHSRTRSAILALPLYHIFALTVNCLLFLELGVTA
FT                   ILITNPRDIEGFVKELKKYRFEAITGVNTLFNALLNNENFKEVDFSALKLSVGGGMAIQ
FT                   QSVATRWHELTGCNIIEGYGMTECSPLIAACPINVVKHNGTIGVPVPNTDIKIVKDDGS
FT                   DAKIGETGELWVKGDQVMQGYWQRPEATSEVLKDGWMATGDIVLMDESYSLRIVDRKKD
FT                   IILVSGFNVYPNEIEDVVMLNYKVSEAVAIGVPHAVSGETIKIFVVKKDDSLTRDELRN
FT                   HCRQYLTGYKVPKEIEFRDELPKTNVGKILRRVLRDEEIAKRPKH"
FT   CDS_pept        complement(820665..821216)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10240"
FT                   /product="outer membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86489"
FT                   /protein_id="CBY86489.1"
FT                   /translation="MKGKITLFFTALCFGLTGCIAPPKGLEKERFSINSYREISPQDLT
FT                   CHCKTVRLGGKIVNTTVLANQTKIEVLSLPVSSISGKPFVELQSDGRFIVYFNGFVEPE
FT                   NLKERYITVGGQLAGTEKGKIEQADYTYPVVQADKYRIWTLSTTYDYPTDDWDEDDDWG
FT                   FFRWRYRPWYVQPEIRYYLN"
FT   CDS_pept        complement(821241..821951)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10250"
FT                   /product="predicted peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86490"
FT                   /protein_id="CBY86490.1"
FT                   /translation="MQNLTLLALDTSTEACSVALLYRGEKTHINELAQRTHTKRILPMI
FT                   DEILANSGLGLNQVDALAFGRGPGSFTGVRVGAGIAQGLAFGADLPVIPISNLTAMAQA
FT                   AFELHQAENVVAAIDARMNEVYFSQVVREKVRSDFGEVFQWREIISEQVCSPEQAINQL
FT                   QNDNAFRVGTGWAAYSQFTEKNLTGSDIELPNALYMLELARVEYLQKHTISALEIEPIY
FT                   LRNEVTWKKLPGRE"
FT   CDS_pept        complement(821964..823886)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10260"
FT                   /product="probable ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86491"
FT                   /protein_id="CBY86491.1"
FT                   /translation="MDYENQIANIFSLNGELSQNIKGFRPRAEQLEMAYAVGKAIQNKS
FT                   SLVVEAGTGTGKTFAYLAPALVFGKKTIISTGSKNLQDQLFNRDLPAIKKALNFTGKIA
FT                   LLKGRANYLCLERLDQVIAQGVLGDKSVLAELSKVRKWNNSTKTGDFTECIELAEDSPI
FT                   IPQLTSTAESCLGTDCPNYSECYLASARKKALNADLVVVNHHLFFADMAVKESGFGELI
FT                   PNAEVIIFDEAHQLPDIASQYFGQSLTSRQLFDLCKDINIVYRTELKDMQQLGTTSDTL
FT                   LKVVQDFRLLLGNGSNVRGNWRELYRQSAVKKSFELLQEKIDFLSEVIKLALGRSQTLD
FT                   SIFERVESIKIQLKRLSETNIVGYCYWYEGNGRQFGLHITPLTVADKFGAQLEAKEAAW
FT                   IFTSATLEVGGTFNHFCQRLGIENATQKILYSPFNYPEQSLLCVPRYLPNTNQVNTLNS
FT                   LGEMLLPVIEANKGRCFVLCTSYSMMRGLAEYFREKSHLSILLQGETSKGKLLEQFIKE
FT                   THSVLVATSSFWEGVDVRGDALSLVIIDKLPFTAPDEPLLKARIEDCRLQGGDPFNDIQ
FT                   IPEAVITLKQGVGRLIRDITDRGVVIICDNRLVMRNYGETFLKSLPNSSRTRDLNKVIQ
FT                   FLQNK"
FT   CDS_pept        824212..824622
FT                   /transl_table=11
FT                   /locus_tag="HICON_10270"
FT                   /product="predicted thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86492"
FT                   /protein_id="CBY86492.1"
FT                   /translation="MLDNCFSFPVRVYYEDTDAGGVVYHARYLHFFERARTEYLRTLNF
FT                   TQQTLLEEQQLAFVVKTLAIDYCVAAKLDDLLMVETEVSEVKGATILFEQRLMRNTLML
FT                   SKATVKVACVDLGKMKPVAFPKEVKAAFHHLK"
FT   CDS_pept        824639..825325
FT                   /transl_table=11
FT                   /locus_tag="HICON_10280"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86493"
FT                   /protein_id="CBY86493.1"
FT                   /translation="MTAELNFLDLFLKASIVVQLVIVILISFSIISWAIIIQRSRILTN
FT                   ALKEARTFEDRFWSGEDLNKLYEGLSNRRDGLTGSEQIFCVGFKEFSRLKQVNPDAPEA
FT                   IIKGTMRAMNLAMNREIESLENRVPFLATVASVSPYIGLFGTVWGIMHAFMALSGAKQA
FT                   TLQMVAPGIAEALIATAIGLFAAIPAVMAYNRLSLRVNAIEQDYGNFIDEFTTILHRQA
FT                   FGKAPH"
FT   CDS_pept        825396..825815
FT                   /transl_table=11
FT                   /locus_tag="HICON_10290"
FT                   /product="membrane spanning protein in TolA-TolQ-TolR
FT                   complex"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86494"
FT                   /protein_id="CBY86494.1"
FT                   /translation="MARRQRKAIKSEINIVPFLDVLLVLVLIFMATAPIISQSVQVELP
FT                   DSVQSQEVSNEDKVPVILEVAGIGKYAISIGGERQEGLTEEMVTQLSRQEFDKDNNTLF
FT                   LVGGAKEVPYEEVIKALNLLHLAGIKSVGLMTNPI"
FT   CDS_pept        825831..827027
FT                   /transl_table=11
FT                   /locus_tag="HICON_10300"
FT                   /product="outer membrane integrity protein (tolA)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86495"
FT                   /protein_id="CBY86495.1"
FT                   /translation="MQNNRQKKGINAFAISILLHFILFGLLILSSLYHTVEIMGGGEGE
FT                   GDVIGAVIVDTGTAAQEWGRIQQQKKGQADKQKRPEPVVEEKPPEPNQEEIKHQQEVQR
FT                   QEELKRQQEQQRQQEIKKQQEQTRQEALEKQKQAEEARAKQAAEAAKLKADAEAKRLAA
FT                   AAKQAEEEAKAKAAEIAAQKAKQEAEAKAKLEAEAKAKAVAEAKAKAKAKAKAKAKADA
FT                   EAKAKAVAEAKAKAKAKAKADAEAKAKAAAEAKAEAATEAKRKADQASLDDFLNGGDIG
FT                   GGSASKGGNINKGGTQGSGAALGSGDGGKVGDQYAGVIKKEIQRRFLKDPSFAGKVCRI
FT                   KIQLGRDGAILGYQKISGSDDICSAALSAVARTKKVPAAPSDEIYEKYKSPIIDFDIR"
FT   CDS_pept        827069..828352
FT                   /transl_table=11
FT                   /locus_tag="HICON_10310"
FT                   /product="TolB protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86496"
FT                   /protein_id="CBY86496.1"
FT                   /translation="MKLLKCLVSVLAIVLAVGSNAFAGDEVRIVIDEGVDGARPIAVVP
FT                   FVGSAPEDISKIVADDLRNSGKFNPIAVSQMPQHPTSAAEVNPEAWSNIGIDAVVIGQV
FT                   VPSGNGYSITYQLIDTVGASGTPGTVLMQNSYTVTNKWLRYGAHTVSDEVFEKLTAIRG
FT                   AFRTRIAYVVQKNGGSQPYEVRVADYDGYNQFIVNRSAQPIMSPAWSPDGQRLAYVSFE
FT                   NKKSQLVVQDLNSGARKVVASFQGHNGAPAFSPDGSRLAFASSRDGVLNIYVMGANGGT
FT                   PTQLTSGAGNNTEPAWSPDGNSILFTSDRSGSPQVYRMDASGGSATAVGGRGSAQISAD
FT                   GKTLVMINGNNNVVKQDLTTGVSEVLSTSFLGESPSLSPNGIMIIYSSTQGLGKVLQLV
FT                   SADGRFKASLPGSDGQVKFPAWSPYLTK"
FT   CDS_pept        828376..828837
FT                   /transl_table=11
FT                   /locus_tag="HICON_10320"
FT                   /product="peptidoglycan-associated outer membrane
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86497"
FT                   /protein_id="CBY86497.1"
FT                   /translation="MNKFVKSLLVAGSVAALAACSSSNNDAAGNGAAQTFGGYSVADLQ
FT                   QRYNTVYFGFDKYDITGEYVQILDAHAAYLNATPAAKVLVEGNTDERGTPEYNIALGQR
FT                   RADAVKGYLAGKGVDAGKLGTVSYGEEKPAVLGHDEAAYSKNRRAVLAY"
FT   tRNA            828992..829064
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:829025..829027,aa:Lys)"
FT   tRNA            829091..829163
FT                   /product="transfer RNA-Lys"
FT                   /anticodon="(pos:829124..829126,aa:Lys)"
FT   CDS_pept        complement(829271..830296)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10330"
FT                   /product="Prophage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86498"
FT                   /protein_id="CBY86498.1"
FT                   /translation="MPIRKNKNGVWQIDFTTPSGERVRCSSKTTDKKLAQHLHDKLKHE
FT                   AWQVEQLNKKPEKTVEQALILLLKDAEHKKDKLTKIQHAKYWRDEIGNKLLSSLTSEDI
FT                   QNAIPTHVVRTGKILSPATQNRYRSSIMRAINLAKQAGWIDVVPYIAKNSEPKKRIRWI
FT                   TEKEAERLLDSLNLNWMKDVCQFALLTGARMTEILSMTWDKINFANKMAIVTGDIAKSG
FT                   RGRSLPLSDDAINLIKERMKYQVSPYVFHSGTGKLRDDISRRDFKRALQRANIKNFRFH
FT                   DLRHTWASWHIQRGTPLMVLKELGGWETIEMVQKYAHLNADHLLSYVNQVKFSSNTRLA
FT                   R"
FT   CDS_pept        complement(830194..830508)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10340"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86499"
FT                   /protein_id="CBY86499.1"
FT                   /translation="MEQTLTIRDVAKCLNLSETTVRKNKLKWGFFQMEGSRMWRVFKSD
FT                   LDRNRKKAENLSDLYAKVGDTQEKQKCRSAKIKMACGKSILPHQAASEFDAVVKQLTKN
FT                   "
FT   CDS_pept        complement(830638..831075)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10350"
FT                   /product="Unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86500"
FT                   /protein_id="CBY86500.1"
FT                   /translation="MPNWCVGNLKIRGESADITHFLTECIEGCECDIDELGTLEIKNIR
FT                   EQEIKGARRVFCDNPNEIIEGYELENGYIVVIPISAAWVLSQPEMIELSKKFNVDFRFY
FT                   GFELGQEFNQELEIIKGVLTLDKCIEFKNYIWECPMPYLGG"
FT   CDS_pept        complement(831079..831348)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86501"
FT                   /protein_id="CBY86501.1"
FT                   /translation="MSENNGWINCANELPEPFSTDLEYRNATNKHLIYFTEDGDHWAVG
FT                   LGWYLYDDKSDCEGCLIPYWESDENPGEEVEVIYWQPLPQPPEE"
FT   CDS_pept        complement(831613..832146)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10370"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86502"
FT                   /protein_id="CBY86502.1"
FT                   /translation="MFGAVVRDENEIGEDMKVLDEHILEYIWDETLDRIAQHTLVTYIG
FT                   GSVGTYSDDHAEKRAEDFAILSVRHLIAGSGLSESQFRRRVKKLMAQGVLLQRIGPNSF
FT                   VINSDVVKDAAVHAARCWRAIGVPYGMDDTGRACKTLPINALPRSIFELKTNCYRILRS
FT                   EYPSYKGKGVGNEQ"
FT   CDS_pept        complement(832218..832634)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86503"
FT                   /protein_id="CBY86503.1"
FT                   /translation="MDIINLIKQQTPEERQTLFNEFIKLLNQKREYVDIPERIVCSACQ
FT                   VFVDERDGTNEDGGEIIHEVYGLRHYDPFMRKQIKELEKQYKYALLDWEQGFLTNKGRF
FT                   VGRKEAMEIAKAQNQVIRLSGSPNSDILFSEDLY"
FT   CDS_pept        complement(join(832682..833236,833236..833955))
FT                   /transl_table=11
FT                   /locus_tag="HICON_10390"
FT                   /product="Cytosine-specific methyltransferase (pseudogene)"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86504"
FT                   /protein_id="CBY86504.1"
FT                   /translation="MFTYGSICSGIEAVSVAWKGLGKPLWFSEIEPFPCAVLTYHYPNI
FT                   PNLGDMTTLPEKILNREIPAPDVLVGGTPCQAFSIAGLRNSLDDERGNLTLMLIHILEA
FT                   IDYVRYQDGKQPCILLWENVPGVLSTKDNAFGHFLAGLAQEREPLQPAGARWANSGYVH
FT                   SARTIAWRILDAQYFGVAQRRRRVFVVASARPRSVAQILIERKSLCGDIETGKSAEKNI
FT                   TAYTESSFGTYIRSTVGGVVTASGGALGGGSEILVVHGTQDPIISSTTAHCLGRNGGRE
FT                   NILFDIAHRSDVVRIQDDDTTPTLTARMGTGGNNIPCIALAGNTIGRQPHNGGNGNGFD
FT                   DSGVSYTLTTTDIHGVFNGLTVRKLTPSECEKLQGFPPGYTQIPYRNKLANDCPDSPRY
FT                   KAIGNSMAVPVIKWIGERMINYLNK"
FT   CDS_pept        complement(833963..834322)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10400"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86505"
FT                   /protein_id="CBY86505.1"
FT                   /translation="MNEINIKFPLHKFQTLIHRYVRDSLHDNGTPVLICIHDVKEYWAV
FT                   LDSHTREKIKGEVKFFIKEYHHLRNDEFFKKDLAAWSELADWINENRSSPSTTATTAKP
FT                   IVPVLPVINPKQRKK"
FT   CDS_pept        complement(834319..834555)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10410"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86506"
FT                   /protein_id="CBY86506.1"
FT                   /translation="MNLLKSLARIILKEELENNKYHFEKLSNENLAKSRRIKELESDND
FT                   RLRIKVEQIRQDNLKLRENRPHFKHHKKKGGRK"
FT   CDS_pept        complement(834552..835121)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10420"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86507"
FT                   /protein_id="CBY86507.1"
FT                   /translation="MIRNSRWTPEVPRPTLNDEHLFVPFLKEWVEKEYKDEINSDKEYF
FT                   EDEEFDIEYFGIYQDILKVWSGDNEDAAENLIKWQGWDYRQAKEFEEKNLEYDFDKENN
FT                   RLSKQWVTDNVYTLPFSVGSRVKWGLKEGIIMEDKNNNYLPFGKVCVLTDKQAAENKKW
FT                   QDQGISSRHGGYIVNWESLELIEEKP"
FT   CDS_pept        complement(835400..836503)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10430"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86508"
FT                   /protein_id="CBY86508.1"
FT                   /translation="MAEENKEIIAYKGFKQDWTCRGYQYEVGKTYEHKGNVKACESGFH
FT                   ACEYPLDVLSYYSPAVSKFAVVKMSGETSKDSDDTKIASAKITIETEINLPEMIKKAVE
FT                   WIKGKVDWDAAKVSNTGYRSVATNTGYRSVATNTGYRSVATNTGYRSVATNTGYRSVAT
FT                   NTGDQSTATNTGDRSVATNTGDQSTATNTGDRSVATNTGYWSAATNTGDRSAATNTGYQ
FT                   SAATNTGYQSAATNTGYQSAATNTGYQSAATNTGYRSVATNTGYQSAATNTGYRSVATN
FT                   TGDQSAATNTGDQSVAEVSGKQSIAVALGWQSKAKASINGAIVCVYRNHDGELIHIKAS
FT                   KVGENNIKADTWYTLDEIGEFVEVKDD"
FT   CDS_pept        complement(836565..836999)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10440"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86509"
FT                   /protein_id="CBY86509.1"
FT                   /translation="MARNTNTVILVGHLGSDPEIRQFQNGGQIATFNLAIGDDYRDKQG
FT                   NTVKRTHWIPIVVHGNSADVARQYLQKGSKICVTGKLVQESWQDQNGNNRTALKVATQS
FT                   FEMLDSKANNETQQPTKDKEKPDPLNAAAEQDGFNDDIPF"
FT   CDS_pept        complement(836999..837649)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10450"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86510"
FT                   /protein_id="CBY86510.1"
FT                   /translation="MEMYKLKARCSGLADLMVKPKSGNGISATAKSAVRKIVKYDLFGY
FT                   QDFEGNKYTEKGIALEEQAIKLSGRKRGLALKKNEERRENDWITGECDIYVPSRKLIID
FT                   TKCSWDIGSHPFFADEAEEKAKKAGYDAQMQGYMWLWDCDEAQIDFVLLPTPYDQLSSY
FT                   DDPSRYIDLVEQIPQEKRITTVTIKRDEKIIEKIKERVEIAQEYYQQLIQEMR"
FT   CDS_pept        complement(837624..838574)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10460"
FT                   /product="Predicted recombinational DNA repair protein,
FT                   RecE pathway"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86511"
FT                   /protein_id="CBY86511.1"
FT                   /translation="MTNQVQHQQNKQPPALKTFFESANVQNKIKELVGKNAATFATSVM
FT                   QIANSNAMLKTADPMSIFNAACMAATLNLPLQNGLGFAYIVPFRNNNEKKTEAQFQIGY
FT                   KGFIQLAQRSGQFKRLVALPVYKKQLIKKDFINGFEFDWEKEPEEGELPIGYYAYFKLV
FT                   NDFSAELYMTHEEINAHAKKYSQTYRTYLDKKAKGQWAQSVWAENFEAMALKTVIKLLL
FT                   SKQAPLSVEMQQAVLADQAVVKDVENQEFNYADNIQNAEFVAVVDDETFNNCKQSIANG
FT                   ETTLQELCDSGAYEFSQEQIAELEAIENGNVQAES"
FT   CDS_pept        complement(838877..839224)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10480"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86512"
FT                   /protein_id="CBY86512.1"
FT                   /translation="MKHSKTPLRQEKQSFTHFMNGSEKWLNRICYFLAALIIAMIVGGI
FT                   SLHANANPTDWHDNELSEQIQQEAQAKAKAQWREENGIYQANLTPQVNADMYRYVEQKQ
FT                   TEINRTLGAKQ"
FT   CDS_pept        complement(839238..839975)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10490"
FT                   /product="DNA methylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86513"
FT                   /protein_id="CBY86513.1"
FT                   /translation="MKTELFNDHFQNYKRYHIPKAQLVIADIPYNLGNNAYASNPEWYV
FT                   NGDNKNGESDKANSSFFDTDKDFRIAEFMHFCSKMLIKEPKERGKAPCMIVFCAFQQIS
FT                   MVIDYAKQHGFKNHIPLVFIKSSSPQVLKANMKVVGATEYALILYRDKLPKFNNNGKMI
FT                   KNWFEWEKDNRKEIPKLHPTQKPIAVLKRLIEIFTDEGDVVIDPVAGSASTLRAARELN
FT                   RPSYGFEIKKDSCKIAKEQMLNI"
FT   CDS_pept        complement(840066..841097)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86514"
FT                   /protein_id="CBY86514.1"
FT                   /translation="MTSNAERFKFTDEHIAFIRLHWDKKPSDLIKLFQQQFDLLINRNV
FT                   FYKLKKKHNIPSLKHANRYSKEELAFIKANCTLNERILAQKMEVYFNKPFNPHALKVLR
FT                   VKRQWLTGRSGRFEKGENLKPIGFERYCKNAKCWLIKASIKRYERKSHYLWRKAGRKIP
FT                   RGHIIDYKDGNSRNCILENLELISRVEMAWRKKLQYHQLNDEIKPTFSAFVKLKEGINQ
FT                   RKKEKDMEENQSPNIATQEPTTFTFEFTEHELQTMAWAWFALLRGTELCQVLHPALKQI
FT                   GSHYAASVYDIAYEYRSTLRHAHNVLTRITEQFECEQGNNWRVLKYLRAYDPKKTGFQL
FT                   EIL"
FT   CDS_pept        complement(841087..841338)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10510"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86515"
FT                   /protein_id="CBY86515.1"
FT                   /translation="MKNKITDLNNHLFSQLEKLLDEDLTDEELNREIKRANAVSGIAAN
FT                   IIASNAISLKAMTLFENRQIERESPDFLRISKAQGDDL"
FT   CDS_pept        complement(841458..841769)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10520"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86516"
FT                   /protein_id="CBY86516.1"
FT                   /translation="MATIIVKRDAGSRKFTEKGEILQRGKAGRLERMFDKQRRINAAFE
FT                   KMVEKESTVDRAIKFAANRQKEQLIDIANYHYYKGKPAGTNTVHAMQKRRLGVRELIR"
FT   CDS_pept        complement(842152..842337)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10530"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86517"
FT                   /protein_id="CBY86517.1"
FT                   /translation="MNINSPAELKAFFITEVLERYAEKTGKALEALADLFMTNEDFRNL
FT                   IMDEVEVEAKQVVAHI"
FT   CDS_pept        complement(842496..843395)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10540"
FT                   /product="Unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86518"
FT                   /protein_id="CBY86518.1"
FT                   /translation="MFIMGFMSSAIDAVQRGIAKAEGKSGELDPSLLKLFSELSLDIND
FT                   YPKDINARIEKFCGFFERITMSKKDIELLGEMKNSAYSFAGEWKYSFFKQMSIPTKLKF
FT                   SILIDFVRACLDSTGKIEDLNALGKKLRLERELIDYAQVIHFNAYIQREFNNGNPEGYI
FT                   DTDALILQKDEFTVLELPASIIEEKSKTIRQGSRNGVSVRLAKGLWFHSGKGNSTSEKI
FT                   NYLSHKADGNLIFTNQRIVFSGENASFSIKKQNIVSVENRDGLLYFHSRKSKPDIVESH
FT                   IPILDKTLKSVIRWIINQ"
FT   CDS_pept        complement(843506..844024)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10550"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86519"
FT                   /protein_id="CBY86519.1"
FT                   /translation="MFRLAKPLENRMITYAQLCEQNDRYQAMRHDNAQMLRTAINCFTI
FT                   ALEEDLGLTDKSYKKEFNQDQQVPYVDVLNIDDHKSCPWYQLKTEFEQNAPVIEFELAL
FT                   TLEKAPNVYPKTTLISPMRAIYINENSIQLEFTAHRDKPQFIISIKEKDAYSHAINAYK
FT                   QLILEMFKF"
FT   CDS_pept        complement(844063..844428)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10560"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86520"
FT                   /protein_id="CBY86520.1"
FT                   /translation="MQTKHILDIKLTARRYGKWAREGEGINYPAIQPFLRKATPDHGIP
FT                   MLDDETAMRIHDATLIMRNVTPELYQVFMLRYVSNLSQGDVGREMGVSVPTIKSYLYAA
FT                   HQSLKLLLTQNKCIFLA"
FT   CDS_pept        complement(844430..845017)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10570"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86521"
FT                   /protein_id="CBY86521.1"
FT                   /translation="MAKEYKCKMCGNYFIKTVSSLQKVCSPECAIKLSREQTRKAREKK
FT                   DKQARIENRKKMTALKEKNKTKHELTKEAQAAVNKYIRLRDMGKECISCGTPLVAEQLG
FT                   GGFDAGHYRSRGAAPHLRFYTINIHGQCKKCNRYYGGNVQQYRLGLLDRLGSEKVEQIE
FT                   ADNRPRHYFPDDLRRIKQIFNKKCRLIEKRKG"
FT   CDS_pept        complement(845110..845526)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10580"
FT                   /product="Putative recombination protein NinB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86522"
FT                   /protein_id="CBY86522.1"
FT                   /translation="MSQYKPFFLRDQRIKNNCLDLIKELPIDDKKPLVVKIQPITRSLE
FT                   QNSKLHALLSDISKQCEFNGKKRDIDTWKMIMVSAHKIATGGQAEMVIGLEGEVINLRE
FT                   STAQMSVKRLASLIEYITCWCVQNGVRFNDRWGL"
FT   CDS_pept        complement(845784..846425)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10590"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86523"
FT                   /protein_id="CBY86523.1"
FT                   /translation="MANSITENQINTLPPERAQRAEETINWLFQELKSIFLGWRAAFET
FT                   EADYLSAKKTWLRVLVREKITRPQLENGLYKAENSLDKFLPSVGLFVFWCKAYDYHALG
FT                   LPNEAELYQRYNTFLGYARFNRDEFQYRSKVEFWLLKNLYEKCKKKSEEDTLKTIQKLL
FT                   TEAAEKVRSNFPFEDIPKMIPTKPRFYDKAKADKARDSLMAMMKGKGALQ"
FT   CDS_pept        complement(846410..847192)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10600"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86524"
FT                   /protein_id="CBY86524.1"
FT                   /translation="MSVELMTKAFKSKTGNPLTKLVLVKLADNANDDGVCYPSYKRIAI
FT                   QCEVSRPTAISHVKKLEAMKYLSIRERKTENGNATNVYILHPENWEEVEPFTSKPALPP
FT                   LVNELNQPSKPALPPLVNELNPEPSIEPSDNHHIKKTTQKSEAEMLLEQFGITGQLAKD
FT                   FIAHRKAKKGVINQTQLNRLQKQADKAGISICEAVEICIERNWQGFNASWDWRDEKLRP
FT                   NSPHLGQSHPNKPKFDDTQTGWSAGMNFTVDGTQWQIP"
FT   CDS_pept        complement(847473..847925)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86525"
FT                   /protein_id="CBY86525.1"
FT                   /translation="MNSKDIQRTLHRDCKNASGGITTLALTLGKSPNILGNKLNVECEN
FT                   NHLSFIEALDLIEITNSTRTVAAIADKIDHLIVPMPKCASCCADVVQGFLDITTNAGKI
FT                   GEQIKSAVHPNSDLGRELSNKEKQTISASIDALIESALCLKWELEQ"
FT   CDS_pept        848309..849277
FT                   /transl_table=11
FT                   /locus_tag="HICON_10620"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86526"
FT                   /protein_id="CBY86526.1"
FT                   /translation="MTTLGERLKFLLIERNVTQAELAEMVGTTQGAISNIVKGETQKPR
FT                   NILEIANALGVDPNWLKYGSTKMTTLSERLKALLVEKGINQTEFANMIGIAQPSMQKIL
FT                   AGETRNPRKIVEIAKELGTTPDYLLYGDMTVSHSTLENSQINNNQGQTVNNFFDSGSDE
FT                   LREMLQKQQVSLKTKPTEEWVFALDVNRLAETDIINAHFPRPFEALHLSQDGMMDLLKL
FT                   RSTANVAMITMFNESMSPVINKKDLMFVDTTCKQYAGEGIYLFVMNNELYVRRLYQTPS
FT                   GVLNAVAENERVGSSFEIDDLSRLNVLGRCVRKFSIIAEDL"
FT   CDS_pept        849700..850026
FT                   /transl_table=11
FT                   /locus_tag="HICON_10630"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86527"
FT                   /protein_id="CBY86527.1"
FT                   /translation="MPTKDPTNWESFLRWLPLVFIGLFAGVAKYASDIQAGKLHFSVGL
FT                   FLCQVLVSMFAGWIGGLICLSSGLDSDLVYVGSGLSGYGGGAVLNAIWRGFFASKLGIK
FT                   DEQV"
FT   CDS_pept        850013..850417
FT                   /transl_table=11
FT                   /locus_tag="HICON_10640"
FT                   /product="Putative uncharacterized protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86528"
FT                   /protein_id="CBY86528.1"
FT                   /translation="MSKFKLSAASEEKLVGVHADLVKVVHRAIELSVVDFKVIEGKRTL
FT                   ERQKELFAKKATKTMNSRHLTGHAVDLVPLPVNWNDREPFKTVASAMFQAAKQLGVAIR
FT                   WGGDWNMNERSDDERFYDGPHFELLRSVYP"
FT   CDS_pept        850414..850803
FT                   /transl_table=11
FT                   /locus_tag="HICON_10650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86529"
FT                   /protein_id="CBY86529.1"
FT                   /translation="MTWWLFVIKKLGLNVLSHGCKHFNKVVAVFAGVFILALLYMQHTN
FT                   KLNIERQSAVIDSLHEKVIKRDKIIDELHEDVDEQRKIAEKRLAQEQLIREQSYAQIQS
FT                   IKKILESNQCSRATLPSGVAAELRK"
FT   CDS_pept        850709..851008
FT                   /transl_table=11
FT                   /locus_tag="HICON_10660"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86530"
FT                   /protein_id="CBY86530.1"
FT                   /translation="MRKFNPLRKFWKAINVAALLCLVVLLPSCASKPDVEYRTVTLMPP
FT                   AALLAPCPIPAFYGSTFGETVEYALLLKQELRLCANKVDGVREYVKARESAVEN"
FT   CDS_pept        851020..852375
FT                   /transl_table=11
FT                   /locus_tag="HICON_10670"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86531"
FT                   /protein_id="CBY86531.1"
FT                   /translation="MNKDLNIEYISTDVLKPYVNNSRTHSDEQIDQICESIEEFGFTNP
FT                   ILIDENNGIIAGHGRLLAAIKLNLYTVPTIRLTGLSDIQKKAYVIADNSLALNAGWNFE
FT                   LLSLELNELKDLGFDIDLLGFDDDFLKSLDGDLLADISGDSNSKEKLDLKQAFLAPPFS
FT                   ILNSREGWWQDRKRKWKALGIDSGSGRDSGMQRGMNSMARYNSKEDTSMSESDDSIFDP
FT                   VLCEILYSWFSPKGCQILDPFAGGSVRGIVASKLNRNYIGVDLRAEQIEANLKQRNLVC
FT                   SNDELQPIWICGDSINIDKLANGVSADLVFSCPPYADLEVYSNNPNDLSNMDYDNFKKA
FT                   YFEIIKKSCDMLKDNRFACFVVGEVRDKKGNYYNFVGDTIQAFLEAGLSYYNEMILVNV
FT                   CGTMPMRAATPFKGSRKIGKVHQNVLVFVKGNPKIAAEYCGDVDVYIPNEDN"
FT   CDS_pept        complement(852372..852593)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10680"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86532"
FT                   /protein_id="CBY86532.1"
FT                   /translation="MMKKIDVLKDLMAKNEWKKAISLASKFPRLGNAKDAIKSAQMAYT
FT                   NPNFVRQIKKDPDKLIYQGIQALIAKYG"
FT   CDS_pept        852651..853019
FT                   /transl_table=11
FT                   /locus_tag="HICON_10690"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86533"
FT                   /protein_id="CBY86533.1"
FT                   /translation="MSKKKTKPKIEIDLSMVESLAAQGLTNQQIADSLGISERTLQNRK
FT                   KDNAEFAEAIKKGKAKGIAVVTNALMKKIKSGNVTAMIFFLKTQGGWKENNQLEIEMKK
FT                   EKKLPTLAELFGDETDPD"
FT   CDS_pept        853000..854349
FT                   /transl_table=11
FT                   /locus_tag="HICON_10700"
FT                   /product="predicted phage terminase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86534"
FT                   /protein_id="CBY86534.1"
FT                   /translation="MRQTLIKPLKPMIKPCRYKILYGGRGSGKSWGVAQLLVEIAVRTK
FT                   VRVFCGRELQNSMSDSVIKLIADTIEDLGYLEDFEVQRNAIYCLKTGSEFMFYGIKNNP
FT                   NKIKSLEGIDLVWIEEAENVSNESWDILIPTIRKERSEIWVTFNPKNILDPTYQRFVIA
FT                   PPKNSFVRKINYDENPYFPETLRLEMEECKERDYELYRHIWLGEPVADSDKVIIKPVWI
FT                   ECAVDAHKKLGFLPAGRKIVGFDVADDGVDSNANAFVHGSVVLRVDEWRGEDVIGSADR
FT                   TRLNALEFGANEIVYDSIGVGAGVKAHYHRLDDKSIRINGFNAGGAVFEPDAEYVYGKT
FT                   NRDMFANIKAQAWWCLRDRFYKTYRAITYEEQYPVDEMISLSSDIRDLEYLKAELARPY
FT                   VDYDGNGRVKVESKKDMKKRGIPSPNKADALIMCFAPKEDVLSRFIGLGS"
FT   CDS_pept        854351..855667
FT                   /transl_table=11
FT                   /locus_tag="HICON_10710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86535"
FT                   /protein_id="CBY86535.1"
FT                   /translation="MEFNQDGYAEALGINHFARNSANSTALFDLTLYELGGLAARVVDM
FT                   PADAAISRSIEIQGDQDDAISNEIERLKILPALADMVRWSRFFGGAVMVLLTDDGARLS
FT                   EPLEPSRITRIDEVRVFDLSQISPTANRYSDPTKPNYGRYSSYRLNIGTIAGSLDSQVE
FT                   IHESRLLFMGGDSLPERLKNGLHWIGRSAVRSVYPKIRDYQKSLMWASLILERKQQAVH
FT                   KMKGLALAIDNGLEPVIRERINLVERGRSLLNGVAVDSEDDYNILNADLGGIVDVLDEF
FT                   KVAISADVNIPVAILFGQSAKGMNATGQSDFESYYDLVESIQQHKIKPVLEKLIELLMF
FT                   QKHIKPFENWKIKFPSLNTPTDKEIADVRKTNADAAKIELDRLINLVDSGALSTDELRT
FT                   QIAGEFGIQADKLPQVDDDDVEKYQEEQKAKGVVVSSRN"
FT   CDS_pept        855597..856865
FT                   /transl_table=11
FT                   /locus_tag="HICON_10720"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86536"
FT                   /protein_id="CBY86536.1"
FT                   /translation="MTMMLKSIKKNRKPKAWLFPHAIEREYVGYLRGVARNINTMVNQK
FT                   FVEIRPHFKANIRQDSFSDTLERWLIELLQAVLIFVDEKEITQFVRGYIHQTANFNGKQ
FT                   FHKVLKSVYSVDVFTTEPWLDDALKIAEWENIRLIKSLPTQTLEKLRSRFTQAVRGGWR
FT                   WESVVDDVKSILNTNEKRATLIARDQIGKLNSHLTKLRQQNIGVKSYIWRGMLDERERA
FT                   HHVDREGKQFDWDNPPDDGHPGEPILCRCYAEAVFPEFEDLGRDDAEPIDPISTIKTGK
FT                   MNLDELFDNSLSGGGNKSFSNFGSVGPALVTLAKESIGLDISGWQHSIDESSIRHILKQ
FT                   HGNEKAENKRGQRAVTKADILMLPQIVSSFDSIDYTGTSDAGSETFLLRKEIGDEIFCV
FT                   QEVRKRHKKIAVKTMWIRKKKKP"
FT   CDS_pept        856991..858064
FT                   /transl_table=11
FT                   /locus_tag="HICON_10730"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86537"
FT                   /protein_id="CBY86537.1"
FT                   /translation="MVMRYDRRGIQARRDDNGFIYDTPILTRSGVFVYELPNGKTRREY
FT                   RPPDEVFKADSLRAYKGLPITEDHHGLVTKNNAHLVVGSILTEGKQDGQNLTADIVIHN
FT                   TKAVDFGKKELSVGYKVDIDETSGTTEDGEPYDVIQRNIRPNHLAIVTVGRAGNAALNL
FT                   DAADAVEFNEDGENPMSNTQTTLSDIRLDSGITYQAAPEVIVELNKLKQDAKDAVTAKD
FT                   KEAARADAAEAKVKELETQVEQIKQDAVSQAKVRVELENVAKVHKVEVKADSTDRALRE
FT                   AVIKAIRQDNADLSQKSDGYIEAAFDIAVSDAKQRADAAGVQRQQLTPSATNQPTFTQD
FT                   SQTKLTGRAAMIASRNQ"
FT   CDS_pept        858077..858496
FT                   /transl_table=11
FT                   /locus_tag="HICON_10740"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86538"
FT                   /protein_id="CBY86538.1"
FT                   /translation="MSMYDQLQQKAFAGMKGDSRYDLVETFAAENEIPFGVVITQGTSA
FT                   TQAKLGGTKPIGIALHSHAVVGGYAKFDAVSVLRKGVAWCVVKDGETITAGSAVSFDPA
FT                   SGKVAKTGTALPNATFKTAVVDCGKYGKLALVELA"
FT   CDS_pept        858504..859505
FT                   /transl_table=11
FT                   /locus_tag="HICON_10750"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86539"
FT                   /protein_id="CBY86539.1"
FT                   /translation="MFNDALSENLGLFYWRKIMTDIRQDAFELNAINTCLNAVGVFNQD
FT                   AGLFTQRQLEFVRNKIYEEKLPGMNGLSLVPVSSEAPEWAETVTERIYDMVGMAKVIAN
FT                   YADDLPRADVAMTERAVKVKNIGAAYGYNLQELKAAAANQTDLPSSKARAARRAVEVKM
FT                   NEIALLGDKEFGLNGFINHPNLGETSVTGSWKTATADAVLADLDNLHDTVVLQSKGVHQ
FT                   PTHLLLSLTDYQTLSSKYMNTADKVDVLTFFKRKHPNLTIQGLWELEKAGTGNKNLAIC
FT                   YEKSLDNLTLETPQDFTQLPAQERNLELVVNCVARVGGVFLRYPLSATKAEI"
FT   CDS_pept        859508..859696
FT                   /transl_table=11
FT                   /locus_tag="HICON_10760"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86540"
FT                   /protein_id="CBY86540.1"
FT                   /translation="MIVRNIEARLIRVGGEFIAPNQEVEIADDAVGLDRLIERGVLIDV
FT                   TPKAEEPKKDGKSKKQE"
FT   CDS_pept        859700..860050
FT                   /transl_table=11
FT                   /locus_tag="HICON_10770"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86541"
FT                   /protein_id="CBY86541.1"
FT                   /translation="MSAYSLLNLFYPLSQQMPEDIVNKALSVADNKRPDCLSDEKQDEA
FT                   VAWYAAYLLAQSIESGVNAAGLRREREGDLEREYFSSSDKGGNAERFLAKYNELNNICV
FT                   RLGAITVGSHCV"
FT   CDS_pept        860043..860501
FT                   /transl_table=11
FT                   /locus_tag="HICON_10780"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86542"
FT                   /protein_id="CBY86542.1"
FT                   /translation="MSSVVKVKINNKGLEKELELINKIGKARVKVGVQADAGVHSESGE
FT                   SLVDIGIWNEYGTAHIPSRPFIRQTFEDNQQAVAQYLGRVVENVAKGADLVQELSKLGQ
FT                   WYQDKQKKTLKSYPWTPNAPSTRKRKKSSKPLVDTSQLVNSIRYKVEI"
FT   CDS_pept        860501..860860
FT                   /transl_table=11
FT                   /locus_tag="HICON_10790"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86543"
FT                   /protein_id="CBY86543.1"
FT                   /translation="MQVFSSQSSFRKPYKILVRSDGEYVKGKWVKGGEIEQMLMASIQP
FT                   LNGAEMDRLVVSMQGRRVSSAVKIYTDQKLTVAGENAHNGTVVLFDGERYEVISRASYH
FT                   SGVLSHHRYVAIRVK"
FT   CDS_pept        860862..861371
FT                   /transl_table=11
FT                   /locus_tag="HICON_10800"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86544"
FT                   /protein_id="CBY86544.1"
FT                   /translation="MLERLYDLLGDLSDRPFIRAYENGREPEKPFFTYELKFERTPEHF
FT                   HYSAVNDESNQTVKTHIDAVLELNYFGGNSLQALRDVCMRLSMQSCRERWLNDGVALIR
FT                   IGRITHLAFLNEQREYEDRAMVEIEIRYAASVQDIVGIIEQVEVTANIGRASEKNLIGV
FT                   NKNGEN"
FT   CDS_pept        861358..862431
FT                   /transl_table=11
FT                   /locus_tag="HICON_10810"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86545"
FT                   /protein_id="CBY86545.1"
FT                   /translation="MAKIDRLVNVAIDLNTTTIAGKSFSDLLILGEHTLNNSARLLVVT
FT                   DPNELLDLGLKSNNPLYIAVATAFAQPSHVAQVFIGRKAQDESVTDALAAVARENNSWY
FT                   GLALVSREDSDVMLAAAWAETNGKLFVTASADEKLPQSAEKTDIASKLEAKQYYRSAVM
FT                   YSHKATEEYPEIALMSYSFTFYPGSETWNLKKLAGVSYSPLMEGEYLACAKKNATTFEK
FT                   FNDSFAVTQGGKVAAGEWIDIIRFRDWLVQEVQINVTSVLINAYGKVPYTDKGIQLIGA
FT                   AVRQALDLGVARGGIAPTELDDNNKEIPSYVISLPLAAKVSNNNKGKRLLQDVKFSARL
FT                   AGAIHLTEIKGNLAYSL"
FT   CDS_pept        862477..862902
FT                   /transl_table=11
FT                   /locus_tag="HICON_10820"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86546"
FT                   /protein_id="CBY86546.1"
FT                   /translation="MALATYAPDEVSIVIGAVIVSGFADGTFIDIEEMSDGVSSVAGAD
FT                   GEVARATSADPRKKVTLTLLQTSDTNDVLSELYAADKVSKNATFPIAVKDLRGRSLFAA
FT                   STAWVVKSAKLELGKEVGSREWTLETADGKLFVGGND"
FT   CDS_pept        862902..863384
FT                   /transl_table=11
FT                   /locus_tag="HICON_10830"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86547"
FT                   /protein_id="CBY86547.1"
FT                   /translation="MARSEIQIGESTFFVQKFSVMDQLRIFGDLQKTLIPSLAKVIGFS
FT                   DEKPKDATSAQLAELAQKSAANFAQGLQDLSQQLSGAELVKLADMLIKPELVTVQRDDF
FT                   NNGTDKKLSKTDFDLVFDDMSELIELVIFILQLNFSSFFTKFLARLGSVQELVKKS"
FT   CDS_pept        863569..865986
FT                   /transl_table=11
FT                   /locus_tag="HICON_10840"
FT                   /product="predicted phage-related minor tail protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86548"
FT                   /protein_id="CBY86548.1"
FT                   /translation="MNAIRELVTLLRYKVDNSGLKAYVVQTQQAAKGIRSNLNNAVDGL
FT                   RAKFSEAAVSAKGVGNNLNDAKNQMLSLRNLVAGYFAMIAGGNVIKIADDWAAVDSRVK
FT                   LATKSAEEHKYALSQIFDLSQRSGQDYLASADLFSKVNRSAGDLGLSLDDTLNLTEIIG
FT                   QTMTIGGGDQGAQQAALMQLGQALGSGALRGDELNSIIEQAPRLANAIADSFGVPIGQL
FT                   KDLGKEGKLTSKELAQGLLKQADKIQKEFDQMPKTFGRGMTILKNKAGQLIDVAVNKVS
FT                   KLGAAFYNAAEWVTENIRLVGFLAGTVIGGKLMFALAAAKKSLRQLLMMGARAVAPYLA
FT                   MAAAAGVVALVLEDIYGWTQGDLSFTGALVGRYEVWADKFAALGKLADKLWINVRGLLK
FT                   DLSRMAGVEINFDSWQAFATDVLEYIIAAVRNLINTVSGMVRIIRALINGDYAGAWSSA
FT                   GDMIDGLSLKFLPLYSVGLMVLGGILSAVWALFSPFRAFFGLLKGGFRSVMFVAKPFIK
FT                   VAKGIASPFIWAQKHFKLFSRVGSGAFSLLKRAAVKFTVYGLKAFKWLAIKGINGFFGI
FT                   LRAAVKFGMIFKSVVGTVVKGIFAIGRAMFMAVASNPILLAISAVIGLVILLVVYWDEV
FT                   KAFAIAAWEAISKKAAEIWQSIITGASEMWDNITNKAAESWDNVKKDAVEKWNSVTTMF
FT                   KNAWQKSIDTVVGWFNSLIPSWIRDLFSDGAKAEVKLSGEALTTPVSGHVSPQRLGYGG
FT                   RPIFAPNQNMTQTNNFNIQGSANPSGVANAVSDKLSRGSSTSFGMGAIEYAG"
FT   CDS_pept        complement(866061..866783)
FT                   /transl_table=11
FT                   /locus_tag="HICON_10850"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86549"
FT                   /protein_id="CBY86549.1"
FT                   /translation="MTDGARNTIPKGNNSARLFTGFEPLVAQLWVNYQSSQKGINSMNT
FT                   QIQFSTFNFKDLPVRVISDPKGEFWFCGTDVCAILGYTNSRKALQDHCKQGGVTKRYTP
FT                   TKSADQEMTFINEPNLYRLIIKSRKPEAEPFEAWVFEEVLPQIRKTGKYQLQPQQLALP
FT                   MVNDDFKQAMAKMVTYASQYANFQQAITSAQLEEQKRLVEFFFSSIPNGDSYLFVFNKN
FT                   IQQDIQQASDLLHKLITQ"
FT   CDS_pept        866945..867526
FT                   /transl_table=11
FT                   /locus_tag="HICON_10870"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86550"
FT                   /protein_id="CBY86550.1"
FT                   /translation="MSIVNLLFSALSGKRTTIGVLELDALLTENTSLSSQITEYPIEDG
FT                   TVISDHITRESERLSLSGVITGTGTLFNVGLGKYKLIAAKETLRELHAKRELVTIVTGL
FT                   DVYEDFAIESLEIERNSDDGERLNISAEFRKIQKVTLRKEEVPPEKAAPNAKGKAGQTK
FT                   AKTGKAQTGKPTNTQAQKITKLGEWSGKKQ"
FT   CDS_pept        867523..867837
FT                   /transl_table=11
FT                   /locus_tag="HICON_10880"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86551"
FT                   /protein_id="CBY86551.1"
FT                   /translation="MITINLANKNDFITEVNLDDEVFFLHFSWNDTIGFWSLTIENAYN
FT                   DELVSSIVILPNRPLIAPVRRDELPLGELIAVRDDNLQTIGRDDFINGKAVLIYIGVDE
FT                   "
FT   CDS_pept        867834..868796
FT                   /transl_table=11
FT                   /locus_tag="HICON_10890"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86552"
FT                   /protein_id="CBY86552.1"
FT                   /translation="MSYRFLRSYKLMIGKKGQKDAIVIEPPMRIEFDIEKDCEAEPNEN
FT                   TIKIYNLASTTRKTIEQPDMRCVLYAGYEQEGNVLLCSGDIATAYSYHQGADWVTELYV
FT                   LDGLVEIRDTAVSLGYGGGVSSTQITNDIAAKMGVTVVGADNLKSRTWANGFSFYGAAR
FT                   KALDKVVAGTGLEWSIQNSELQIVNRNGVTKRSGYVLAKDSGLIGFPERTREAARSKKQ
FT                   DTPNKKQDEKFAFDRQARDGWNVKSLLLPMVNPCDKIKLESVTVTNWFRVEKIKHSGDS
FT                   HSGDWQSELHLVDLNAPTKEQMKAQSKHRKKRKKKDEQK"
FT   CDS_pept        868793..869464
FT                   /transl_table=11
FT                   /locus_tag="HICON_10900"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86553"
FT                   /protein_id="CBY86553.1"
FT                   /translation="MTDILTALSEINVSLPGKIVSYDAGTVRATVQPSIPKRLANGEVL
FT                   NAPQIVNVPVMFPMTDINGAVAQVTLPVKVGDGCLLIFSQRSLENWLSGSNDAPDDPRM
FT                   FDLSDAFCVMGGNSRSPNADAENLCIKYGSGKIKIAPNGNITINSPDVRVTTDNFTVTA
FT                   TTSTFNGNVIVNGGISTAGNSGSVSVSGSLTTTGDVMADGVSLQSHKHKGDSGGTTGAP
FT                   L"
FT   CDS_pept        869461..869826
FT                   /transl_table=11
FT                   /locus_tag="HICON_10910"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86554"
FT                   /protein_id="CBY86554.1"
FT                   /translation="MIDLKLSGQHDLMIKDRKLVLVDGVNQKAQQIKVVLLTFLGEWFL
FT                   DTTIGLPYFDEILTKNPDNARIQSIFRKKIMGVKGILAVERLSLEFHLKDRVLAVQFSA
FT                   RTNEGVVKDKVSIKRNG"
FT   CDS_pept        869819..871255
FT                   /transl_table=11
FT                   /locus_tag="HICON_10920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86555"
FT                   /protein_id="CBY86555.1"
FT                   /translation="MANYGLTRSGFVRKRMPEQLKELYENAKKMFGEDIDLSPETVMGM
FT                   MLNIESERFAALWELIESVYSAMYPMSATGANLDRAVSFTGVTRLQAEHSTVPVIFYGN
FT                   AGVEIPQYTAVRNAATQTLYYSDEDARIDSNQAAYARIELNSNTINTGDVFSVVVNGVT
FT                   YRFTAMRSSSASIIQGLANQLKAISYADVSNDNVIIEISAQSIPHFSISVSQNLTLSRL
FT                   GVRCMLSTESPSEDKADIGQMIELVNMIDGVVEVNNVVEGASGRLEESDIELYQRYHRG
FT                   VWQNGAGTIDSLYANLSKVAGVHSLRIYENDADQTINGIPKRSLYAVVKGGLDTDIAST
FT                   LLKFKPLGIGTHGQTEVTVRDSQNQPHLIKFSRPTKCYIWLKVTIETFVDEDEIARAGY
FT                   IVSALNNILKYGKSLGVGADVIHQRLIAACIAVQGVGKVTVQIGKTNNITDPEPRYQEQ
FT                   NITIAPDEEAIFDPSIIVMS"
FT   CDS_pept        871264..871878
FT                   /transl_table=11
FT                   /locus_tag="HICON_10930"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86556"
FT                   /protein_id="CBY86556.1"
FT                   /translation="MKDILTALNDDFKQLGRERLLSQFNYSPNLNAFLSLLLLPHHEIQ
FT                   ATLKQMLTERHIDTAIGKQLDGVGDIVGMPRPFARVNGDWYFGFSGQSKAKPFSRAPIR
FT                   DLATQTNSRDFNYMLDEHYRRLIKWKVIANHSHGTLDDVIEACRAIFLAERVSITEGQD
FT                   ADVHITITRMAKNRLDAVEQEPVLWIPTAAGVKVTVEFINA"
FT   CDS_pept        871888..874257
FT                   /transl_table=11
FT                   /locus_tag="HICON_10940"
FT                   /product="probable phage tail fiber protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86557"
FT                   /protein_id="CBY86557.1"
FT                   /translation="MKLKLIDLFKRITWAKNGDLTDFSQTNYEAGWAHLGDDTPTVQDF
FT                   NYVQQMNDKKDQWLFNQLKAVLEKANIEPTEENVNSLRDAILALSKGYSHPKSLTADTV
FT                   NFVDEQGHTHEIAKATLQQQGITQLYTGYNSQREDLALTPKTAYQLKQLIDSNTRSLDN
FT                   VIPNSKKSSAVNSNSADTVANSAAVKTAYDKAVEAKTTAESKVGLRGNESIQGTKSFES
FT                   KIIGFRGIGVADSQTYANANHLLNMGANDGDGWIEYKKSNRVIGTIRIRANGELSYNNQ
FT                   KIYHAGAKPQFNTDIEGKPNTLAGYGIGNFKIETFVGNVNTLKTDGIYAITQASRSQNL
FT                   PVSTSCHIQVIAGGDGAWCRQLAYVAYSTDVYERHQTSYQTDSWSAWKKLNTDGIPTGA
FT                   VVSFPRAVTNPVGFLKASGSTFNQQTFPDLYRVLGNSNKLPDLTRSDVGMTAYFAVDNI
FT                   PTGWIAFDSIRTTVTQQNYPELYRYLVGKYGSISNVPLAEDRFIRNASNNLSVGETQSD
FT                   EIKKHVHKVRTHWVNSSDSNIFYDKTKTVIDSRLRTSTTTDDNLSDNGFMHPLLDSPMA
FT                   TGGAETRPRAIALKLCIKAKNTFDDVQFWVKAFGVVENAGALDAGTLAQNMQALSERVE
FT                   QKIEENKQSTLREITNAKADINQQFLQAQENLSQIGTLKTVWQGNVGSGQITISEKCFG
FT                   KTLILYLQSSESHSLDDNNNIEIVSFEVGAEIEGKKGGRVRWLDVREVNAHSYSSGRRI
FT                   TDYVEVKRFDVTVDRDGTTIQIQDLAGRFVKRIDIR"
FT   CDS_pept        874269..874871
FT                   /transl_table=11
FT                   /locus_tag="HICON_10950"
FT                   /product="phage protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86558"
FT                   /protein_id="CBY86558.1"
FT                   /translation="MKVYFLKENLNSYQIFPIPQNLNDFVEMEVENESELETKQLIDFK
FT                   SQYILVDRQPTELHKWNGNSWVVDKKKKTEIKRELIKNLVDSIDDTAASISAKWNRFAE
FT                   EYKERESAALAFKEANFTGEVSIYISSFATVAGLDNKSATLLILKQAEGLRTLQEQLAV
FT                   QRMRKYELKHEELSEEELQQIHNDIIRKMKALTEVQQ"
FT   CDS_pept        874868..875326
FT                   /transl_table=11
FT                   /locus_tag="HICON_10960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86559"
FT                   /protein_id="CBY86559.1"
FT                   /translation="MTEGKVYLALYKGKKTGWTPKAILARLSDWLTRKLTKGLYSHCEI
FT                   VVNKGFKVCYSSSIRDGGVRSKIMYLEHEKWDLIELQNITEERIKAYFEQTKNMRYDWW
FT                   GALGIVLGIKQKRSKYFCSEWCFNAICGGENGWRFSPNQLGAMFKHDD"
FT   CDS_pept        875974..876699
FT                   /transl_table=11
FT                   /locus_tag="HICON_10970"
FT                   /product="hypothetical tRNA/rRNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86560"
FT                   /protein_id="CBY86560.1"
FT                   /translation="MLENIRIVLIETSHSGNIGSAARAMKTMGLTQLCLVSPKSVDEQS
FT                   YALSAGAENIVKNARVVDSFDEAVDDCSLVIGTSARLRHLQNTLIEPRECAEKVVAYKG
FT                   KIAIVFGRERIGLTNEELLKCHYHLNIPANPDYSSLNLAMAVQLVSYELRMAFLVQNNK
FT                   KNSLSLIEKNYPTTDQLAYFFDYTERIYQSLGFIQNQGVMRKLKRLYYRAKLEKNELNI
FT                   LNGMLSAVEKRIDLTKEDN"
FT   CDS_pept        876752..877204
FT                   /transl_table=11
FT                   /locus_tag="HICON_10980"
FT                   /product="predicted transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86561"
FT                   /protein_id="CBY86561.1"
FT                   /translation="MKLTSKGRYAVTAVLDIALNADGGPVSLADISERQHISLSYLEQL
FT                   FAKLRKDGLVKSVRGPGGGYQLGLPSEQISVGMIIAAVNENIHVTKCLGRENCKNGVEC
FT                   LTHKLWEDLSLRIESFLNEITLAELVNKRNVKRQSHRDFNNLLVNQ"
FT   CDS_pept        877272..878486
FT                   /transl_table=11
FT                   /locus_tag="HICON_10990"
FT                   /product="cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_10990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86562"
FT                   /protein_id="CBY86562.1"
FT                   /translation="MKLPIYLDYAATCPVDERVAKKMMAFLTIDGTFGNPASRSHKFGW
FT                   QAEEAVDIARNQIADLIGADSREIVFTSGATESDNLAIKGAAHFYQTKGKHILTCKTEH
FT                   KAVLDTCRQLEREGFEVTYLSPEADGLIDLEKFKAALRPDTILASIMHANNEIGVLQDI
FT                   KAIGELCRANKTIFHVDATQSVGKVEINLEELAVDLMSMSSHKLYGPKGVGALYVRRKP
FT                   RVRLEAIIHGGGHERGMRSGTLPVHQIVGMGEAYRIAKEEMASEMPRLKALRDRLYNGL
FT                   KDIEETYVNGSMEHRLDSNLNISFNYVEGESLMMALRDIAVSSGSACTSASLEPSYVLR
FT                   ALGLNDELAHSSIRFTLGRYTTEEEIDYTINLMKGAVEKLRALSPLWDMFKEGIDLNTI
FT                   EWSAH"
FT   CDS_pept        878546..878929
FT                   /transl_table=11
FT                   /locus_tag="HICON_11000"
FT                   /product="NifU-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86563"
FT                   /protein_id="CBY86563.1"
FT                   /translation="MAYSEKVIDHYENPRNVGSLDKKDSNVGTGMVGAPACGDVMQLQI
FT                   KVDDNGIIEDAKFKTYGCGSAIASSSLITEWVKGKSLEEAGAIKNSQIAEELELPPVKV
FT                   HCSILAEDAIKAAIADYKAKQGE"
FT   CDS_pept        878983..879306
FT                   /transl_table=11
FT                   /locus_tag="HICON_11010"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86564"
FT                   /protein_id="CBY86564.1"
FT                   /translation="MGITLTEKAAQRVKAFLDNRGKGIGLRLGVKTSGCSGLAYVLEFV
FT                   DVLNAEDQVFEQHGVNIIVDPKSLVYLNGIELDYVKEGLNEGFRYNNPNVKESCGCGES
FT                   FHV"
FT   CDS_pept        879319..879843
FT                   /transl_table=11
FT                   /locus_tag="HICON_11020"
FT                   /product="Co-chaperone protein HscB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86565"
FT                   /protein_id="CBY86565.1"
FT                   /translation="MLNPFQIFDLPVDFQLDEKALNARYLELQKALHPDNFVSSSALEQ
FT                   RVAMQKSTEVNDALKTLKDPILRAEAIIALNTGEQLDLEQKSTQDVAFLMQQLQWREQL
FT                   EEVERQQDERALNAFAKEIKQETQSLLTALFESLKSQQWARASQYCDKLRFTHKLSEEI
FT                   ESVEERIFELD"
FT   CDS_pept        879894..880580
FT                   /transl_table=11
FT                   /locus_tag="HICON_11030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86566"
FT                   /protein_id="CBY86566.1"
FT                   /translation="MQTLEQLTSPEHSAWITLSQWIDNARNHCEVIKKDQSSAERELFT
FT                   MQMPTSSPMGAVIYETGGILIHYGWLRILGSGSFKLPRGLMDWNFSKSFSESGEKPKYL
FT                   LVADDVIGGYFALNGGSLGNNIGKIYYYSSKDLTWHNLNFTYTEFLAWALNGDVEAFYQ
FT                   GLFWKNWQDDVKQLDGNQVFVFTPDLNQDRKIAIDERQKQEVNIETHYQASFAEKNKFD
FT                   LAYSVA"
FT   CDS_pept        880599..882458
FT                   /transl_table=11
FT                   /locus_tag="HICON_11040"
FT                   /product="chaperone protein HscA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86567"
FT                   /protein_id="CBY86567.1"
FT                   /translation="MALLQIAEPGQAAAPHQHRLAVGIDLGTTNSLVASVRSGQSVILN
FT                   DEQERSLVPSVVHYGVEEKKVGLEAFEQASLDPKNTVISVKRLIGRSLSDVQSRYSSLP
FT                   YEFVASENGLPLIITAQGPKSPIEVSSDILSRLNHIAEQRLGGELSGVVITVPAYFDDA
FT                   QRQSTKDAARLAGLNVLRLLNEPTAAALAYGLDSGQEGIIAVYDLGGGTFDISILRLSK
FT                   GIFEVLATGGDTALGGDDFDHLIADWIIEQTKLKPQTANQQRELITLANQAKITLTNEK
FT                   SAVISWQDFSVEISREQFNELIYPLVKRSLLTCRRALKDANVESEEVQAVVMVGGSTRV
FT                   PYVREQVGEFFSKTPLTSIDPDKVVALGAAIQADILVGNKTDSDMLLLDVVPLSLGIET
FT                   MGGLVEKIIPRNTTIPVARAQEFTTFKDGQTAMTVHVLQGERELVDDCRSLGRFTLRGI
FT                   PPMAAGAAHIRVTYQVDADGLLSVTVMEKSTKVQASIQIKPSYGLTDEEVTAMIKSSFD
FT                   NAQEDLQARELAEQRVEADRVIESVIVALQADGAELLSTDEFHHIETVLKQLMDVKQGS
FT                   DRDAIAQGIKALDTATQEFAARRMNASINKALTGKNLSDIENP"
FT   CDS_pept        882498..882839
FT                   /transl_table=11
FT                   /locus_tag="HICON_11050"
FT                   /product="ferredoxin, 2Fe-2S"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86568"
FT                   /protein_id="CBY86568.1"
FT                   /translation="MPKVIFLPNEDFCPEGMVVDAATGDNLLEVAHNAGVEIHHACDGS
FT                   CACTTCHVIVREGFDSLNETSDQEEDMLDKAWGLEMDSRLSCQCVVGNEDLVVEIPKYN
FT                   LNHANEAAH"
FT   CDS_pept        882839..883033
FT                   /transl_table=11
FT                   /locus_tag="HICON_11060"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86569"
FT                   /protein_id="CBY86569.1"
FT                   /translation="MKWTDAQLIAEELYDRNPGLDPKTVRFTDLHKWICELEDFDDDPN
FT                   KSNESILEAILLKWLDEFE"
FT   CDS_pept        complement(883084..883698)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86570"
FT                   /protein_id="CBY86570.1"
FT                   /translation="MAYSIEEEQEINQLKDWWKENGKTIIVAFILGVGGMFGWRYWQAH
FT                   QAEQIAQASAQYDTLINSVQQDEQAKKANIEQFVQANSKTAYAVFALLDEAKKATEKQD
FT                   FSAAEANLNQALTQSQDEVLTSIVALRLSAVQFQLGQLDNALSTLNQVKGESFNARKAI
FT                   LTGDIQVAKGDKVAAKNSFEQAQQSGSQLEQQMAKMKLNNL"
FT   CDS_pept        complement(883716..884987)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11080"
FT                   /product="histidyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86571"
FT                   /protein_id="CBY86571.1"
FT                   /translation="MAKTIQAIRGMNDCAPTESPLWQWIEAQVRNVLNSYGYSEVRMPI
FT                   VESTPLFARAIGEVTDVVSKEMYTFWDNDEQLTLRPEGTAGCVRAAIEHGWIYNNEQRL
FT                   WYIGPMFRHERPQKGRYRQFHQVGVEVFGIANPEIDAELIMLTYRLWKALGIDQHVTLQ
FT                   LNSIGSLEARANYRSALVGFLENHQDLMSDEEKERLVRNPLRILDTKNPELQKVLDNAP
FT                   KLLDYLDDESRAHFEQLCSLLDAVGIQYEINPKLVRGLDYYNKTVFEWVTSALGAQGTV
FT                   CGGGRYDGLVEQLGGHATPSIGFAMGLERLVLLVQEVNPNVPAKSAVDIYVVYQGEGAT
FT                   LAAFELAEKVRSELPHLNTMLHCSGGNFKKQFKRADKSSATLALVIGESEVQNKQVVVK
FT                   HLQGGTDQQTLDLVNIIDYLQTQF"
FT   CDS_pept        complement(884997..886103)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11090"
FT                   /product="4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86572"
FT                   /protein_id="CBY86572.1"
FT                   /translation="MSAFQPTIKRRESTKIYVGNVPIGGDAPIAVQSMTNTRTTDVEAT
FT                   VAQIKSLERVGADIVRVSVPTMDAAEAFKQIKQQVNVPLVADIHFDYRIALKVAEYGVD
FT                   CLRINPGNIGREDRVRAVVDCARDKNIPIRIGVNAGSLEKDLQEKYGEPTPEALLESAL
FT                   RHVEILDRLNFDQFKVSVKASDVFLAVESYRLLAKAIKQPLHLGITEAGGARAGAVKSA
FT                   VGLGMLLAEGIGDTLRVSLAADPIEEIKVGFDILKSLRIRSRGINFIACPTCSRQEFDV
FT                   IGTVNALEQRLEDIITPMDVSIIGCVVNGPGEALISDLGVTGGNKKSGYYLDGERQKER
FT                   FDNEDIVNQLEAKIRAKVAQQDPKNRII"
FT   CDS_pept        complement(886112..887023)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11100"
FT                   /product="conserved hypothetical transcriptional regulator
FT                   with an N-terminal xre-type HTH domain"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86573"
FT                   /protein_id="CBY86573.1"
FT                   /translation="MNPTTEQVLSPGEIFRQTREALNLSLEDVAKEITLRPSILEQLEN
FT                   NEFIQKSTPSIFVKGYVRSYAKFLRLPDSVWENIVFAETEKNDLGQNARSTRAVNQYSS
FT                   HNRWIGRLTAIVFVIVIGMTGLWWWQSYQQNTQERDDLVQSYVASTENNQPATALVTTE
FT                   ETNKSAPETAAPVSQPVEITNNLLPEIAQENSVSQPKNDEKSVSDIQSAVENPSISPTL
FT                   PIAKGDLVIEILTNSSWISVKDNARHVLAQKEYKQGEILTFNGNEFSLIVGAPSNVRIT
FT                   YKGENYPLKVDGRVAKFKLSQP"
FT   CDS_pept        complement(887095..887634)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11110"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86574"
FT                   /protein_id="CBY86574.1"
FT                   /translation="MKTISKQLSAVIFPFIFSACVSQSASSLNHQAAAKARVELALSYL
FT                   QQNNPQLAKINLDKALQHDKNYYLVHSALAHYYQQQGEIENAHREYEIAVNLNHKQGDV
FT                   HNNFGTFLCSQKKFEQAQQQFELALNSPNYYHQADTFENIALCAYSAQKMDIYQQTLEK
FT                   LRQIDGKRAEKFNSLK"
FT   CDS_pept        complement(887735..888886)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11120"
FT                   /product="predicted Fe-S-cluster redox enzyme"
FT                   /product="predicted enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86575"
FT                   /protein_id="CBY86575.1"
FT                   /translation="MSELLSVHSDAPAKKINLMDLTRQQMREFFKELGEKPFRADQLVK
FT                   WIYHFGEDNFDNMTNINKKLREKLKAVAEIKAPEVAVEQRSADGTIKWAMQVGEQQVET
FT                   VYIPEADRATLCVSSQVGCALACTFCSTAQQGFNRNLTVSEIIGQVWRASKIIGNFGVT
FT                   GVRPITNVVMMGMGEPLLNVANVVPAMEIMLDDFAYGLSKRRVTLSTSGVVPALDNLSK
FT                   MIDVALAISLHAPNDELRDEIVPINKKYNIKTLIDSVNRYLTVSNANHGKVTIEYVMLD
FT                   HVNDGVEHAHQLAEVLKNTPCKINLIPWNPFPEAPYAKSSNTRIDRFQKTLMEYGFTVI
FT                   IRKTRGDDIDAACGQLAGDVIDRTKRTAMKRQFGQNIGVTEVN"
FT   CDS_pept        889133..890011
FT                   /transl_table=11
FT                   /locus_tag="HICON_11130"
FT                   /product="penicillin-binding protein 7 homolog precursor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86576"
FT                   /protein_id="CBY86576.1"
FT                   /translation="MFKKALFILSLCPSFALAQSYVVYDFTHNRVLESHASDSIQPIAS
FT                   VTKLMTANVFLENNKNPNCRIAITKEDTDRIKGTGTKLPKNIPISCNELLKAMLVHSDN
FT                   YAAHALSRAVGISRRQFIKKMNEKAHQLGMYSTRFHDSSGLSSYNISSPMDLVKLAKYS
FT                   LNKSDIKRLSNLSATYIQAGKHKLYIKNTNKLVRDEIFDAAVNKTGYIQESGYNLVFIN
FT                   KHLCKNATIGVISLNNTSSAYRSSFTKSKLEKFGCTALNGRTIRDVAGEAQYEDGYDEV
FT                   GFNTLIQKLSK"
FT   CDS_pept        890376..891257
FT                   /transl_table=11
FT                   /gene="hfeA"
FT                   /locus_tag="HICON_11140"
FT                   /product="putative periplasmic chelated iron binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86577"
FT                   /protein_id="CBY86577.1"
FT                   /translation="MRNSFKIMTALALGLFAMQANAKFKVVTTFTVIQDIAQNVAGNAA
FT                   TVESLTKPGAEIHEYEPTPKDIVKAQSADLILWNGLNLERWFERFFQNVKDKPAVVVTE
FT                   GIQPLSIYEGPYKDAPNPHAWMSPSNALIYIENIKNALVKYDPQNAAVYEKNAADYAQK
FT                   IKQLDEPLRAKLAQIPEEQRWLVTSEGAFSYLAKDYNLKEGYLWPINAEQQGSPQQVRK
FT                   VIDLVRKNNIPVVFSESTISAKPAQQVAKESGAKYGGVLYVDSLSAKNGPVPTYIDLLN
FT                   VTVSTIVKGFGK"
FT   CDS_pept        891257..892177
FT                   /transl_table=11
FT                   /gene="hfeB"
FT                   /locus_tag="HICON_11150"
FT                   /product="putative ABC-type chelated iron transport system,
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86578"
FT                   /protein_id="CBY86578.1"
FT                   /translation="MDSFSTSIWVNDVTVRYNNGHTAIHNMTFSLNSGTICALVGVNGS
FT                   GKSTLFKSIMGLVKPQQGEIKLCDLPISQALKRNLVAYVPQSEEVDWQFPVSVYDVVMM
FT                   GRYGYMNFLRIPKAIDKQKVQEAMQRVNIEHLAHRQIGELSGGQKKRVFLARALAQQSP
FT                   IILLDEPFTGVDVKTENAIVDLLQKLREEGHLILVSTHNLGSVPDFCDQVVMINRTVIA
FT                   AGKTEDTFNQHNLEIVFGGVLRHIKLLGENLHNDEDKRAVTVLTDDEKAVVFYGETKQD
FT                   PPAPTTQDCHFEDCPYKSAVKKEKD"
FT   CDS_pept        892181..893029
FT                   /transl_table=11
FT                   /gene="hfeC"
FT                   /locus_tag="HICON_11160"
FT                   /product="putative ABC-type chelated iron transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86579"
FT                   /protein_id="CBY86579.1"
FT                   /translation="MLALLLEPFSYDYMLRAMILSTAVGGICAFLSSYLMLKGWSLIGD
FT                   ALSHSVVPGVAIAYTFSLPYALGAFFAGILAALSILWIKSISKLKEDAVIGFIFSTFFA
FT                   LGLLIISLNPTAVNVQSIILGNILGIADEDIYQVAIIIGVCLVLLLLFWKDLLLIFFDE
FT                   TQARTVGLSPLFYKVLFFTLLSACVVAALQTVGAILVIAMVITPGATAYLLTDKFKTLS
FT                   IIAIILGAVTSFVGVYISYYLDGATGGVIVTLQTLLFLAAFLFSPKYGLLTRNKKAVEN
FT                   V"
FT   CDS_pept        893022..893837
FT                   /transl_table=11
FT                   /gene="hfeD"
FT                   /locus_tag="HICON_11170"
FT                   /product="putative ABC-type chelated iron transport system,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86580"
FT                   /protein_id="CBY86580.1"
FT                   /translation="MFDWLLEPLQFEFMQNALLTALIVSIICALLSCYLVLKGWSLMGD
FT                   AISHAVLLGIVLAYLAGIPLAIGAFFSGIFCSLGVGYLKENSRIKEDTAMGIVFSGMFA
FT                   IGLVIFTKIQTEQHLTHILFGNVLGVSHQELIQSAVISAIIFCLIVFKRKDFLLYCFDP
FT                   NHARVAGLSPKILHYGLLMLLALTIVSTMQVVGVILVVAMLIAPGITALTLTKSFDKML
FT                   WIAIISSITSSLIGVILSYHFDASTGACIILLQAAFFVIALAYSKIRIR"
FT   CDS_pept        complement(893931..894578)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11180"
FT                   /product="TENA/THI-4 protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86581"
FT                   /protein_id="CBY86581.1"
FT                   /translation="MIEQLIQQAQPYWQQYIEHEFVQQLAKGTLPKACFQHYLKQDYLY
FT                   LFHYSRAFALGVFKSKNFAEMETPRKTLEILCQEIQLHLNYCREWGISEQEIFATQESA
FT                   ACIAYTRYLLDCGMTGSLAELYAAVTPCALGYAQVARYITQHYPRLPNNPYQTWIDTYA
FT                   SEEFQHAAQETVDFLTALCKPLNPSQLAEIQQIFTTATRMEIAFWQMGLGLA"
FT   CDS_pept        complement(894589..895533)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11190"
FT                   /product="putative ABC-type nitrate/sulfonate/bicarbonate
FT                   transport systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86582"
FT                   /protein_id="CBY86582.1"
FT                   /translation="MKIIIRYFSFVMGLMLTLPSFAKEKISIMLDWYVNPDHAAIIVAQ
FT                   QKGFFEKNNLEVEIIEPADPALPPKLAAAEKVDLAVSYQPQLYQQVAEGLPLVRVGSLI
FT                   SNPLNSVVVLKKSNLKSLADLKGKKVGYSVSGFEDGLLDTMLHSIGLSNKDVELVNVNW
FT                   SLSPSLLTGQVDAVIGAFRNFELNQLALEKQEGIAFFPEQYGVPAYDELILVANKNNVT
FT                   DKKTSAFLTALEQATSYLQAHPNEAWQAFVSYKPNELNTPLNQLAWKDTLPFLADKPRK
FT                   LDAKRYQQMAEFMQQKGLIPKALALKEYAVEIK"
FT   CDS_pept        complement(895555..896292)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11200"
FT                   /product="putative ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, permease component"
FT                   /product="taurine transporter subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86583"
FT                   /protein_id="CBY86583.1"
FT                   /translation="MKIRLLKPLLIVGVLLMIWQMVATLGSFPHYIFPSPQAVGQQLFT
FT                   HAELLWQHTQVTLLEICLGLLLGFLFGLISALLLSFSRQISAVLLPILVISQAIPVFAI
FT                   APLLVLWFGYGMASKIVMSVLIIYFPVTAACYDGLRNTPQAWLDLAKTFNISPLRLLLK
FT                   VRLPAALPAFASGLRIAVSVAPIGAVVGEWVGSSEGLGYLMIHANARMQVDLMFAALLI
FT                   LVSISLCLYFSIDWLLHRFIWSV"
FT   CDS_pept        complement(896289..897011)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11210"
FT                   /product="putative ABC-type nitrate/sulfonate/bicarbonate
FT                   transport system, ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86584"
FT                   /protein_id="CBY86584.1"
FT                   /translation="MVHIQDLSLAFNGQTLFEHLNLTLLPNEWVSLLGSSGVGKSTLLR
FT                   LLAGIETQGMVQGKILFEPKIRIAWLPQKETLYPWLSIVDNVQLQAVLFGRKSAKTTEK
FT                   AKMLLEKVGMAAHWHKPCSQLSGGQKQRVALARTLMQEADLILLDEPFSALDAISRHQL
FT                   QDLAFELLEDKSVLLVTHDPQEALRLSQRIFVLRSPETHQTALSAVILPEGNAPRELHQ
FT                   ANLWALQQQLLQELEGEQ"
FT   CDS_pept        897410..898378
FT                   /transl_table=11
FT                   /gene="lic3A"
FT                   /locus_tag="HICON_11220"
FT                   /product="CMP-Neu5Ac--lipooligosaccharide alpha 2-3
FT                   sialyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86585"
FT                   /protein_id="CBY86585.1"
FT                   /translation="MSINQSINQSINQSINQSINQSINQSINQSKSVIIAGNGTSLKSI
FT                   DYSLLPKDYDVFRCNQFYFEGHYFLGKKIKKVFFNCSVIFEQYYTFMQLIKNNEYEYAD
FT                   IILSSFVNLGDSELKKIKNVQKLLTQVDIGHYYLNKLPAFDAYLQYNELYENKRITSGV
FT                   YMCAVATAMGYKDLYLTGIDFYQEKGNPYAFHHQKENIIKLLPSFSKNKSQSDIHSMEY
FT                   DLNALYFLQKHYGVNIYCISPESPLCNYFPLSPLNNPITFILEEKKNYTQDILIPPKFV
FT                   YKKIGIYSKPRIYQNLIFRLFWDILRLPNDIKHALKSRKWD"
FT   repeat_region   897414..897497
FT   CDS_pept        898551..899567
FT                   /transl_table=11
FT                   /gene="galE"
FT                   /locus_tag="HICON_11230"
FT                   /product="UDP-galactose-4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86586"
FT                   /protein_id="CBY86586.1"
FT                   /translation="MAILVTGGAGYIGSHTVVELLNAGKEVVVLDNLCNSSPKSLERVK
FT                   QITGKEAKFYEGDILDRALLQKIFAENEINSVIHFAGLKAVGESVQKPTEYYMNNVAGT
FT                   LVLIQEMKKAGVWNFVFSSSATVYGDPKIIPITEDCEVGGTTNPYGTSKYMVEQILRDT
FT                   VKAEPKFSMTILRYFNPVGAHESGLIGEDPNGIPNNLLPYISQVAIGKLAQLSVFGSDY
FT                   DTHDGTGVRDYIHVVDLAVGHLKALQRHENDAGLHIYNLGTGHGYSVLDMVKAFEKANN
FT                   ITIAYKLVERRSGDIATCYSDPSLAAKELGWVAERGLEKMMQDTWNWQKNNPKGYRD"
FT   CDS_pept        899748..900986
FT                   /transl_table=11
FT                   /locus_tag="HICON_11240"
FT                   /product="putative integral membrane signal transducer
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86587"
FT                   /protein_id="CBY86587.1"
FT                   /translation="MLICAFTGFNSGLPLFVLLQMLPVWLTDKHLSIELIGAVTGVMLP
FT                   YGLKFLWAPLLDRYFPSFLGRRRSWMLLSQVALLILLYIISLFDPLTQLGTVANIALLI
FT                   AFFSATQDIVLDAYRREILSDHELGLGNTIHINAYRIAGLIPGGLSLYLAAIYPWETVF
FT                   LWTALCMLAGIFMTLFLAKEPKINVQQSNQPFYQAFWIPLQEFFQRKGVIQAIGFLLFL
FT                   FLYKFGDSFATTLQTKFIYDMGFSKEDIAIVVKSTALWSSILSGLAGGMIMLKLGINRA
FT                   LWLFGLVQMVTIGGFIWLSAFGHFDVITSAELWKLGVVIAAEYIGVGLGTAAFVAFMAR
FT                   ESNPLYTATQLALFTSLSALPSKVLGILSGYVVGAVGYYQYFWFCLFLAIPGMLCLFWV
FT                   APLKQENNKTSSV"
FT   CDS_pept        901071..901715
FT                   /transl_table=11
FT                   /locus_tag="HICON_11250"
FT                   /product="adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11250"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86588"
FT                   /protein_id="CBY86588.1"
FT                   /translation="MKIILLGAPGAGKGTQAQFIMNKFGIPQISTGDMFRAAIKAGTEL
FT                   GKQAKALMDEGKLVPDELTVALVKDRIAQADCTNGFLLDGFPRTIPQADALKDSGVKID
FT                   FVLEFDVPDEVIVERMSGRRVHQASGRSYHIVYNPPKVEGKDDVTGEDLIIRADDKPET
FT                   VLDRLAVYHKQTSPLIDYYQAEAKAGNTQYFRLDGTQKVEEVSQELDKILG"
FT   CDS_pept        complement(901875..902477)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11260"
FT                   /product="cytochrome C-type protein NapC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86589"
FT                   /protein_id="CBY86589.1"
FT                   /translation="MSEKKPNILKRFWQWFRKPSRMAIGTIIILSAIGGILSWVGFNYG
FT                   LEKTNTEQFCASCHMQDAYPEYLHSVHYQTRTGVGASCPDCHVPHEFGAKMKRKIIAAK
FT                   EVYAHYTGKVNTLEKFNAHRLEMAQNEWARMKANDSKECRNCHNVDRMNFNDQRSVAAR
FT                   MHQKMKTEGKTCIDCHKGIAHQLPDMSGVESGFKDEK"
FT   CDS_pept        complement(902492..902935)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11270"
FT                   /product="diheme cytochrome C NapB"
FT                   /product="nitrate reductase, small, cytochrome C550
FT                   subunit, periplasmic"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86590"
FT                   /protein_id="CBY86590.1"
FT                   /translation="MTKQVSKILAGLFTALFAGSLMASDAPAVGKDLTQAAENIPPAFH
FT                   NAPRQGELPALNYVNQPPMVPHSVANYQVTKNVNQCLNCHSPENSRLSGATRISPTHFM
FT                   DRDGKVGSSSSPRRYFCLQCHVSQANVDPIVPNDFKPMKGYGN"
FT   CDS_pept        complement(902941..903804)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11280"
FT                   /product="ferredoxin-type protein NapH"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86591"
FT                   /protein_id="CBY86591.1"
FT                   /translation="MANTPKFAGKESREKWGWWYANRFLFWRRFSQLSILAMFLSGPYF
FT                   GVWILKGNYSGSLLLDTIPLSDPLITAESLAARHLPDALTLIGAAIIVLFYAVLGSKVF
FT                   CGWVCPLNVVTDCAAWLRRKLGIRQTAKISRGLRYGILALILLGSCVNGMLLWEWVNPV
FT                   AALGRAFIFGFGATGWLLLVIFLFDLLIVEHGWCGHLCPIGAAYGVIGAKSLIRIKVID
FT                   RAKCDNCMDCYNVCPEAQVLRSPLHGKKDESLLVLSKDCISCGRCIDVCAEKVFKFSTR
FT                   FDHSGK"
FT   CDS_pept        complement(903804..904643)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11290"
FT                   /product="ferredoxin-type protein NapG"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86592"
FT                   /protein_id="CBY86592.1"
FT                   /translation="MKVRLKSKKKMKKPALNPERRKFLKEATRTAGGLAGVGILLGLQQ
FT                   NQSLAREGVPLRPPFALQDAKAFSAACIRCGQCVQACPYDMLHLASLLSPVEAGTPYFI
FT                   ARDKPCEMCPDIPCAKACPSGALDRQATDINESRMGLSVLLDHETCLNYQGLRCDVCYR
FT                   VCPLIDKAITLEKQHNPRSDKHALFIPTVHSDACTGCGKCEQACVLEEAAIKVLPMDLA
FT                   KGMLGKHYRLGWEEKAKAGHSLAPKDMISLPTRTPDGSTVMPAPAEPVLAPILGSGK"
FT   CDS_pept        complement(904699..907182)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11300"
FT                   /product="periplasmic nitrate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86593"
FT                   /protein_id="CBY86593.1"
FT                   /translation="MNLSRRDFMKANAAMAAATAAGLTIPVKNVVAAESEIKWDKAVCR
FT                   FCGTGCAVLVGTKDGRVVASQGDPDAEVNRGLNCIKGYFLPKIMYGKDRLTQPLLRMTN
FT                   GKFDKNGDFAPVSWDFAFKTMAEKFKEAFKKNGQNAVGMFSSGQSTIWEGYAKNKLWKA
FT                   GFRSNNVDPNARHCMASAAVAFMRTFGMDEPMGCYNDIEQADAFVLWGSNMAEMHPILW
FT                   SRITDRRISNPDVRVTVLSTYEHRSFELADHGLIFTPQTDLAIMNYIINYLIQNNAINW
FT                   DFVNKHTKFKRGETNIGYGLRPEHPLEKDTNRKTAGKMHDSSFEELKQLVSEYTVEKVS
FT                   KMSGLDKVQLETLAKLYADPTKKVVSYWTMGFNQHTRGVWANHLIYNIHLLTGKISIPG
FT                   CGPFSLTGQPSACGTAREVGSFPHRLPADLVVTNPKHRETAERIWKLPKGTISEKVGLH
FT                   TIAQDRAMNDGKMNVLWQMCNNNMQAGPNLTQDRLPGWRKEGNFVVVSDPYPTVSALSA
FT                   DLILPTAMWVEKEGAYGNAERRTQFWHQQVKAPGEAKSDLWQLMEFAKYFTTDEMWTEE
FT                   LLAQMPEYRGKTLYEVLFKNGQVDKFPLSELAEGKLNDESEYFGYYVHKGLFEEYAEFG
FT                   RGHGHDLAPFEMYHKARGLRWPVVEGKETLWRYREGYDPYVKEGEGVAFYGYPDKKAII
FT                   LAVPYEPPAESPDKEYDLWLSTGRVLEHWHTGTMTRRVPELHRAMPNNLVWMHPLDAQA
FT                   RGLRHGDKIKISSRRGEMFSYLDTRGRNKPPRGLVFTTFFDAGQLANNLTLDATDPISK
FT                   ETDFKKCAVKVEKAA"
FT   CDS_pept        complement(907219..907500)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11310"
FT                   /product="NapD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86594"
FT                   /protein_id="CBY86594.1"
FT                   /translation="MNNTNLILENARDWHVVGLIVQGNPKKLSAIQTALLAIEHTEIPT
FT                   FDEKLGKFVVVMQSNDQHLLLEKMESVKDIDGVINVSLVYHEQDEQNK"
FT   CDS_pept        complement(907493..908035)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11320"
FT                   /product="ferredoxin-type protein NapF"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86595"
FT                   /protein_id="CBY86595.1"
FT                   /translation="MKDIMTVENLPRRQFLRGKFSTLSCLENNQKQNFVGVRPPWSVEN
FT                   SIFVAQCTRCGDCLSVCETNILVKGDAGFPEVCFDNGECTFCGKCVDACKQPIFYPRDQ
FT                   LPWSHKIDIGVACLTLHRIECRTCQDNCPANAIRFKLQMGGVAQPLVNFDACNGCGACV
FT                   QGCPVNAITMNDLKQNE"
FT   CDS_pept        complement(908229..908573)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11330"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86596"
FT                   /protein_id="CBY86596.1"
FT                   /translation="MSKSYNQRQRKKLHLAEFQELGFLVNFQFAEGTAIETVDEIVDRF
FT                   INEVIQPNGLAYEGSGYLHWEGLVCLEKIGKCDESHRETVKKWLETNGLQQIEVSELFD
FT                   IWWEYPAKAE"
FT   CDS_pept        complement(908658..909398)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11340"
FT                   /product="tRNA (guanine-N(7)-)-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86597"
FT                   /protein_id="CBY86597.1"
FT                   /translation="MTQTFADQKRKTVETAEFTEDGRYKRKIRSFVLRTGRLSEFQRNM
FT                   MNDNWGTLGLDYQTEPFDFAKIYGNDNPVVLEIGFGMGKSLVDMAFANPDKNYLGIEVH
FT                   TPGVGACIAYAVEKGVTNLRVICHDATEILRDSIADGALGGLQLFFPDPWHKAKHHKRR
FT                   IVQPHFVTQVIQKLSENGFIHMATDWENYAEQMLEVLSVNTDLVNTSKNGNYIPRPDFR
FT                   PLTKFEARGHKLGHGVWDLYFVKK"
FT   CDS_pept        909483..911675
FT                   /transl_table=11
FT                   /locus_tag="HICON_11350"
FT                   /product="primosomal protein N'"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86598"
FT                   /protein_id="CBY86598.1"
FT                   /translation="MKIVRVALAVPLPRLFDYFVPDDVSLQIGMRVLVPFGTQKRVAIV
FT                   ADFPTKSDVPEDKLKAILQPLDLAPLFTPIYWDWLHWAANYYQAGLGDVLFQALPVKLR
FT                   NGESAVKNDRTFWRITDAGKNALKQGELKRSKKQAEALQYLSETDLEKGNNNFSSAIWS
FT                   ALKAKGFIEEITIHTNPLSWQQRLGNNPIVNAENRLTLNKQQALAFSQLLFHSGFNVWL
FT                   LDGVTGSGKTEIYLQYIEEILKSGKQVLVLVPEIGLTPQTVQRFKARFNVEIDVLHSNL
FT                   TDTQRLYVWDRARSGQSAIVIGTRSALFTQFSNLGAIILDEEHDSSYKQQDSWRYHARD
FT                   LAIVLAQKLNIAVLMGSATPSLESINNVQNGKYQHLVLSKRAGNSTALRHFVIDLKNQN
FT                   IQNGLSKPLLERMKAHLEKGNQVLLFLNRRGFAPVLLCHECGWIAQCPHCEKPYTYHQH
FT                   QNVLRCHHCGAQKTIPRQCGDCGSTHLVTTGLGTEQLEETLKTLFPHYSVARIDRDSTA
FT                   RKGKLEGYLEDIQQGKSQILIGTQMLAKGHHFPNVTLVALVNVDSALFSLDFRAEERLA
FT                   QLYIQVAGRAGRADKQGEVVLQTHYPDHPLLTTLLANGYQAFAKETLQLRHSMGLPPFT
FT                   FQALFKAQARHSDLAENCLSQIADFFQSKQITGLQMLGPMPAPFSKKAGQYRWQLLLQH
FT                   PSRMTLQKALREYQQAELEKNSLVRLILDVDPQDLS"
FT   CDS_pept        complement(911717..912763)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11360"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86599"
FT                   /protein_id="CBY86599.1"
FT                   /translation="MQNNLNLHRTLLGIAAVIIILAGVKLAAEIVVPFLLSLFIAIICS
FT                   PIIKAMTQRRVPHWLAITLLFVLISLVFFFLVGLINSTAREFTQSIPQYKVLLSQRVSD
FT                   LTGLLQRFNLPFTLSRETIQENFDPSIIMNFVSRVLLNFSGVVSNVFVLVLVVIFMLAE
FT                   APTMKHKFAMVISSTPHDAAKEERHIDRVLQGVIGYLGIKSITSLLTGVGVFILLEACG
FT                   VQYAILWATLSFLLNYIPNIGSIIAAIPIIVQALLLNGFGIGFGVAIGVIAINMVVGNI
FT                   IEPKMMGQRLGLSTLVVFLSLLFWGWLLGTVGMLLSVPLTMALKIALESSPNTAKYACL
FT                   LGDVEDFK"
FT   CDS_pept        complement(912763..913101)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11370"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86600"
FT                   /protein_id="CBY86600.1"
FT                   /translation="MKKIEAMIKPFKLDDVRESLSDIGISGMTITEVRGFGRQKGHTEL
FT                   YRGAEYMVDFLPKVKLEVVVPDELVDQCIEAIVETAQTGKIGDGKIFVYHVERAIRIRT
FT                   GEENEDAI"
FT   CDS_pept        complement(913103..913696)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11380"
FT                   /product="molybdopterin biosynthesis mog protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86601"
FT                   /protein_id="CBY86601.1"
FT                   /translation="MTALLKIGLVSVSDRASAGVYQDQGIPELQAWLEQALVDPFHLET
FT                   RLIPDEQPIIEQTLKELVDEQGCHLVLTTGGTGPAKRDVTPDATLAVADREMPGFGEQM
FT                   RQVSLHFVPTAILSRQVGVIRKESLILNLPGQPKAIKETLEGVKDKEGNVLVKGIFSAV
FT                   PYCLQLINGLYIDTKPEIIESFRPKSARRENLEK"
FT   CDS_pept        complement(913779..914135)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11390"
FT                   /product="diacylglycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86602"
FT                   /protein_id="CBY86602.1"
FT                   /translation="MYKTTGLTHLINSTKYSLQGLKSAFKNETAFRHECFLACILIPLT
FT                   FFLGETKIEIILMISSVLLVMALELLNSAVEAVVDRIGTERHELSGRAKDQGSASVFIA
FT                   LCIVGIVWGGILFF"
FT   CDS_pept        complement(914150..916381)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11400"
FT                   /product="GTP pyrophosphokinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86603"
FT                   /protein_id="CBY86603.1"
FT                   /translation="MVAVRGSHLLNPQDFVIEQWCTGLKLAEQTEKSLIDAWYYARDLM
FT                   NAYPDEMKNATLMLQSGVEMVEILHELNMDAETLLTAMLFPIVANKLTDWESLKEKFGA
FT                   KITKLLKGVLEMDNIRQLNASHSANALQVDNVRRMLLAMVDDFRCVIIKLAERITFLRD
FT                   AEHRCAEEDKVLAVKECSYIYAPLANRLGIGQLKWELEDYCFRYLHPEQYRAIAKLLQE
FT                   RRLDREHYIADFVSELSGYLRENIEQVEVYGRPKHIYSIWRKMQKKHLEFSGLYDVRAV
FT                   RIIVQKLQDCYTALGIVHTQFKHLPKEFDDYVANPKPNGYQSIHTVVLGKGDKPIEVQI
FT                   RTQQMHDDAELGMAAHWKYKEGNTGSMSAYEEKIAWLRKLLAWQDDITDSGEVLAELRS
FT                   QVFDDRVYVFTPKGEVVDLPTGSTPLDFAYAIHSEIGHRCIGAKVAGRIVPFTYQLQMG
FT                   DQIDIITQKNPNPSRDWLNPNLGFTHTAKSRAKIQAWFKKQDRDKNIPAGKELLDNELA
FT                   LLNLSIKQVEPYALPRYNLKNLDDLYAGIGSGDIRLNNLINFLQSKLIKVTAEEADQEI
FT                   LRHVANKSAVNSQQKSEKNNGYVIVEGVDNLMHHIARCCQPIPGDAIVGYITMGRGISI
FT                   HRADCEQFLDLQAAHPERVVESIWGENYASGFHINIRIVAGDRNGLLRDITTVLANEKI
FT                   SVLGVSSRADTKKQLATIDMEIELHNVESLSKILARLAKLDDVIEAKRL"
FT   CDS_pept        complement(916459..917775)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11410"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86604"
FT                   /protein_id="CBY86604.1"
FT                   /translation="MVLLYTPKQKTKNVQTITADILDLDYQGLGVAKINGKTWFIENAL
FT                   PHEKVECRILEDKRQYGHAIVKKWRVKSPERLAPKCAYFMRCGGCQGQHIPIEMQRKAK
FT                   ESALFKRLSKLQSEPISFQPMICGDAWAYRRRVRLSLWFNPNTKQIEMGFRQKNANDLI
FT                   PIQSCEVAEPAINHLLPKLTALLEQFSAPKQLGHIELVAADNGVAMLLRYTKKLAEIDR
FT                   TLLLKFAEQEKLMLFLQSDEGIEQNYGDAPYYQFSDGIKLHFDIRDFIQVNRALNERMV
FT                   NTALDWLELNQQDCVLDLFCGMGNFTLPLAKRVKSAVGIEGVFEMVQKAAQNAERNQIK
FT                   NITFFQADLGQSFVDQPWSHQSFNKILLDPPRSGAAFALNALCELNAEKILYVSCNPAT
FT                   LVRDAEILRDFGYKIEKSAVIDMFPHTGHLESITLFTTK"
FT   CDS_pept        917913..918182
FT                   /transl_table=11
FT                   /locus_tag="HICON_11420"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86605"
FT                   /protein_id="CBY86605.1"
FT                   /translation="MQATLRQQGGAAVLTVPMAILQQMGWQIGHKINLEAQGERVVLTP
FT                   IKRQARGRKTVAELLSNIDSQEIAELNASVSNFTQSEPTGKEVC"
FT   CDS_pept        918208..918537
FT                   /transl_table=11
FT                   /locus_tag="HICON_11430"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11430"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86606"
FT                   /protein_id="CBY86606.1"
FT                   /translation="MVYRSRSTKGQELRNQHYFIVVSDELLNKALGTAICCPISSGGNF
FT                   ARSQNVTVVIDGNSTQSGRVTGVILCYQVRALDLKERQAKFATKAEDYLVDEVIMKLVD
FT                   LIDPQ"
FT   CDS_pept        complement(918662..919780)
FT                   /transl_table=11
FT                   /gene="aef2D"
FT                   /locus_tag="HICON_11440"
FT                   /product="Fimbrial protein, adhesin subunit"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11440"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86607"
FT                   /protein_id="CBY86607.1"
FT                   /translation="MNKYVIGIISLLLTSQVWGRDSTSWDGATRTVRVNATDFTLPPPN
FT                   EQNKLRAYGQDNIPFQFNRMLMRTQDRNKIPLNASWGTGQQCWTIEAKTDLPNWGTLNR
FT                   RTIYKLTDYIGIVIEAGDTYDNNKNVPSSSWSDVFPGGYCTSGEAGAAVEAWPVLLQSP
FT                   PAGMKLDVPRTKIASMRIVKPTYVPQRKTRFWNGFNGFSGKTDWDVWLLGFSLRVEAKT
FT                   CQLDTPNDLIVVMPTIANQHIPKQGDERYGGKFQIRLTCPTTSDDNNKKIAAYMTLTDQ
FT                   TDPSNRGDILTLTPQSTAQGVGIKLYKNNDASALSYGPDSSLKGTENQWKFSSRDGEEK
FT                   PTVEFKAFYVNKDGNITGGTVNAVATYTFSYQ"
FT   CDS_pept        complement(919784..922303)
FT                   /transl_table=11
FT                   /gene="aef2C"
FT                   /locus_tag="HICON_11450"
FT                   /product="Putative F17-like fimbrial usher"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11450"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86608"
FT                   /protein_id="CBY86608.1"
FT                   /translation="MKKPTTKPFTRRTLAYLLMLAFYTSWGYAAEEDEFDGAYWGGGSK
FT                   LGVDFSRFNQKNAVLPGEYDAEVRVNNVSKGNVRLRFADNDETQRAELCLTPALQEMLD
FT                   LEKSAIKQQGSENNCVWAKDAIPDAVFTYQTGEFRLDVDIPQALTVSHPRDYISPTRWQ
FT                   SGTTAAFVNYDVNYYRYRNQHSMNDNFYLGIRAGANIGSWALRHYGSLSWNKSNRSGSY
FT                   TDGYQRGETYLQRDFALLQGDVTLGDFYTSDEIGESFGLRGIRVASDDRMLAPSQRSFA
FT                   PVIRGIANTNANITIRQNGNIIYQIAVPAGPFIIDDLYSSGYNGDLLVEIQESDGKVRS
FT                   FSVPFSNTAPLLRVGHFRYRLSGGKYRHNDDVVEDNVMQATLQYGLFNSLTINGGAIAS
FT                   PNYRARLFGFGLATPIGAFSADSTWAKARFPHQTFKGQRLHGNYRIDFNTFGTNIMLSV
FT                   YRYSRDFYRLQDTLSINHEAKKYTGFYFPLPYLVPKGQYQLSINQNMGKWGDFYLSGQT
FT                   STYWGTEGESREYQIAYSNRYKRLGYQISLLQTHDKISDRREKAVYLSFSLPLGDDHSL
FT                   SSTYSRQSDYSSAQLGVNGSLGDKRQWNYGLSVSQDGNRYRQVAANGGFQSGIGDYRAS
FT                   FSQDNQHSRQMGISANGSIVTHQYGVTLGTRVSDGFAIIHAKEGRGAGIESGNGSLDYF
FT                   GNGIVPYVSPYSINYIGIDPKGAQENVDFEATETQIIPRANSIHLVDFSTHKNTMILFN
FT                   LSLPSHGIVPMTATAQDEKGQFVGYVGQGGMLFAERLTKSEGRLNVKWGQNSADQCEFD
FT                   YRVDLSENSKLQAKTYDALCTPVKNRE"
FT   CDS_pept        complement(922336..923031)
FT                   /transl_table=11
FT                   /gene="aef2B"
FT                   /locus_tag="HICON_11460"
FT                   /product="Putative F17-like fimbrial chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11460"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86609"
FT                   /protein_id="CBY86609.1"
FT                   /translation="MLKKILFGVLLLSSTVQANVVITGTRVIYPENEKTITVKLDNPGK
FT                   KASLVQAWIDEGDPDADPRHIQVPFAITPPVSRIESQSGQTLRITYTGTKVLPKDRESL
FT                   FYFNLLDIPPKPSKEFLDSNQNFLQFAVRSRLKFFYRPENLPMKPEDAYKMVRWQAVSN
FT                   GVNVDNPTPYYLSYVSAEVNRTALKKVRMVAPFSQAVFEGKGIHKGDKLKWYLVNDYGG
FT                   DSAGEAILQ"
FT   CDS_pept        complement(923128..923736)
FT                   /transl_table=11
FT                   /gene="aef2A"
FT                   /locus_tag="HICON_11470"
FT                   /product="Putative fimbrial protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11470"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86610"
FT                   /protein_id="CBY86610.1"
FT                   /translation="MIQMKKQLLSAALVAAFSSALAINANAATKGTINFKGKIVEQTCI
FT                   VDNNNANQTIDLGKAPKNAFTAKESTANATRFTIHLKNCTVRSAGTNTATKVKAGFSSV
FT                   ANVDTTEKYTLKNTAGANKANNVNIRLFNEDGVNAISPMKTTVKQVGNIATQVDDDGAE
FT                   FKTITTTPDLTYIAKFYATNATVDAGEVQSSVDFELVYE"
FT   CDS_pept        complement(923876..924586)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11480"
FT                   /product="DNA repair protein Rec0"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11480"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86611"
FT                   /protein_id="CBY86611.1"
FT                   /translation="MQSELQRGFVLHRRPYSETSLLVDLFTEESGRLTVIAKGARAKRS
FT                   SWKSVLQPFTPLLLRWTGKNALKTLTKAEPAAITLPLQQIALYSGFYVNELLTRVIESE
FT                   TPNPALFQHYLKCLTGLATKTNVEPTLRLFEFQLLQILGYGVDFLHCAGSGEPVDFSMT
FT                   YRYREEKGFIASLVKDNLTFYGRDLLAFEALDFSDDVVRQAAKRFTRIALKPYLGDKPL
FT                   KSRELFSQHILLLK"
FT   CDS_pept        complement(924589..924993)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11490"
FT                   /product="opacity associated protein OapB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11490"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86612"
FT                   /protein_id="CBY86612.1"
FT                   /translation="MLKKTSLIFTALLLAGCVQNASVTTPQAQKMQVEKVDKALQKGEA
FT                   DRYLCQDDKIVRVVHATHKKYKKNLHYVTVTFQGVSEKLTLMISERGKNYANIRWMWQE
FT                   RDDFSTLKTNLGEILAVQCVSQTSERLSGQ"
FT   CDS_pept        complement(925052..926410)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11500"
FT                   /product="opacity associated protein OapA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11500"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86613"
FT                   /protein_id="CBY86613.1"
FT                   /translation="MRTSIRGNPVNSMDKNQQSSQNELDLGLNQEPITPKKTIQPSSSI
FT                   LGKAKGLFAKKNHAQTNFQQRKEPTFGDSSTQENDPLIPSENLKKAQKPVLQTSSTEEN
FT                   ISAVDEEISAENNTDETVEKAEKPTLAQPEKWKVLQVLPAKHRRLFMAIFVLVILLIIF
FT                   FALKPSSDTVESFTQSNSNEIPVQFQSLDQSQPVETTILDNPLAQNQMAAEQANQPENA
FT                   PKAEEAANNTTAQNQSVENTPMQQNVVQAPSQMPNEMAAASVMPMQPVQAEQPQMQPAQ
FT                   TQAEQPKPTVPVQPMKKTVEPQVVHKDTAKKEVKVAEKTQAPSKAMEQSVAKTAGKAPI
FT                   VEAKPVQAKKEKKVQIIDAKPVSKSTASRLSAKTLTVPKGVSLMQVFRDNQLNISDVNA
FT                   MSKAAGAGNVLSSFKSGDKVTVSVNNQGRVNEMRLSNGARFVRQSDGSYQYKK"
FT   CDS_pept        complement(926482..927498)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11510"
FT                   /product="predicted lysine 2,3-aminomutase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11510"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86614"
FT                   /protein_id="CBY86614.1"
FT                   /translation="MRILPQEPVIREEQNWLTILKNAISDPKLLLKALNLPEDDFEQSI
FT                   AARKLFSLRVPQPFIDKIEKGNPQDPLFLQVMCSDLEFVQAEGFSTDPLEEKNANAVPN
FT                   ILHKYRNRLLFMAKGGCAVNCRYCFRRHFPYDENPGNKKSWQLALDYIAAHSEIEEVIF
FT                   SGGDPLMAKDHELAWLIKHLENIPHLQRLRIHTRLPVVIPQRITDEFCTLLAETRLQTV
FT                   MVTHINHPNEIDQIFAHAMQKLNAVNVTLLNQSVLLKGVNDDAQILKILSDKLFQTGIL
FT                   PYYLHLLDKVQGASHFLISDIEAMQIYKTLQSLTSGYLVPKLAREIAGEPNKTLYAE"
FT   CDS_pept        927536..928102
FT                   /transl_table=11
FT                   /locus_tag="HICON_11520"
FT                   /product="elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11520"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86615"
FT                   /protein_id="CBY86615.1"
FT                   /translation="MATYTTSDFKPGLKFMQDGEPCVIVENEFVKPGKGQAFTRTRIRK
FT                   LISGKVLDVNFKSGTSVEAADVMDLNLTYSYKDDAFWYFMHPETFEQYSADAKAVGDAE
FT                   KWLLDQADCVVTLWNGAPITVTPPNFVELEIVDTDPGLKGDTAGTGGKPATLSTGAVVK
FT                   VPLFVQIGEVIKVDTRSGEYVSRVK"
FT   tRNA            928313..928399
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:928347..928349,aa:Ser)"
FT   CDS_pept        complement(928454..929041)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11530"
FT                   /product="predicted primosomal replication protein N"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11530"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86616"
FT                   /protein_id="CBY86616.1"
FT                   /translation="MTVQQLIQRLDQKVQQLYQAHLSKREEKIFAKFDRTLFSENGQNV
FT                   SFYLKEINQTLDRIKTLESNDSNHYNFLAERLLAQCSVLSEALVRKNTHLTESQTTTKQ
FT                   TIQKSQHSIHKLPPRERLEKYYEAREQLNNLYRQHKDLAQAEKNNDEKIRYAQLAEVYK
FT                   KRQQKCQDAIDLLEEYLVFKEEVENRENTENR"
FT   CDS_pept        complement(929074..930426)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11540"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11540"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86617"
FT                   /protein_id="CBY86617.1"
FT                   /translation="MLSNPVVISIIVLLALSLLRINVIIALVIAALTAGFIGDLGLTKT
FT                   IETFTGGLGGGAEVAMNYAILGAFAIAISKSGITDLIAYKIITKMNKTPTAGNLTWFKY
FT                   FIFAVLALFAISSQNLLPVHIAFIPIVVPPLLSIFNRLKIDRRAVACVLTFGLTATYML
FT                   LPVGFGKIFIESILVKNINQAGATLGLQTNVAQVSLAMLLPVIGMILGLLTAIFITYRK
FT                   PREYNINVEEPTTKDIEAHIANIKPKQIVASLIAIVATFATQLVTSSTIIGGLIGLIIF
FT                   VLCGIFKLKESNDIFQQGLRLMAMIGFVMIAASGFANVINATTGVTDLVQSLSSGVVQS
FT                   KGIAALLMLVVGLLITMGIGSSFSTVPIITSIYVPLCLSFGFSPLATISIVGVAAALGD
FT                   AGSPASDSTLGPTSGLNMDGKHDHIWDSVVPTFIHYNIPLLVFGWIAAMYL"
FT   CDS_pept        complement(930740..931429)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11550"
FT                   /product="ribonuclease T"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11550"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86618"
FT                   /protein_id="CBY86618.1"
FT                   /translation="MSDSQEIPYHNQLKNRFRGYFPVIIDVETAGFDAKKDALLELAAI
FT                   TLKMDENGYLHPDQKCHFHIEPFEGANINPESLKFNGIDIHNPLRGAVSELDAITGLFQ
FT                   MVRRGQKDADCQRSIIVAHNATFDQSFVMAAAERTGVKRNPFHPFGMFDTASLAGLMFG
FT                   QTVLVKACQAAKIPFDGKQAHSALYDTERTAKLFCYMVNHLKDLGGFPHIASELEQEKT
FT                   TEKETAL"
FT   CDS_pept        complement(931503..931910)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11560"
FT                   /product="lactoylglutathione lyase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11560"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86619"
FT                   /protein_id="CBY86619.1"
FT                   /translation="MQILHTMLRVGDLDRSIKFYQDVLGMRLLRTSENPEYKYTLAFLG
FT                   YEDSESAAEIELTYNWGVDKYEHGTAYGHIAIGVDDIYATCEAVSASGGNVTREAGPVK
FT                   GGSTVIAFVEDPDGYKIEFIENKSTKSGLGN"
FT   CDS_pept        complement(931985..932710)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11570"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11570"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86620"
FT                   /protein_id="CBY86620.1"
FT                   /translation="MVKDTLFSTPIAKLGDFIFDENVAEVFPDMIQRSVPGYSNIITAI
FT                   GMLAERFVTADSNVYDLGCSRGAATLSARRNIHQPNVKIIGIDNSQPMVERCRQHIAAY
FT                   HSEIPVEILCDDIRHVEIKNASMVILNFTLQFLPPEDRIALLTKIYEGLNPNGVLVLSE
FT                   KFRFEDTKINHLLIDLHHQFKRANGYSELEVSQKRTALENVMRTDSIETHKVRLKNVGF
FT                   SQVELWFQCFNFGSMIAVK"
FT   CDS_pept        complement(932763..933281)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11580"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11580"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86621"
FT                   /protein_id="CBY86621.1"
FT                   /translation="MLFINITFACILAIRFYSLSISIRHEKALIAKGAIQYGKRNSTLL
FT                   SIAHVAFYFAAIIEANKQNLSFNSTSQIGLAILIFAIAMLFYVIYELKEIWTVKIYILP
FT                   EHQINRSFLFKYVRHPNYFLNIIPELIGLSLFCQAKYTALVGLPIYLLILAVRIKQEES
FT                   AMSHLFPKS"
FT   CDS_pept        933500..935266
FT                   /transl_table=11
FT                   /locus_tag="HICON_11590"
FT                   /product="aspartyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11590"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86622"
FT                   /protein_id="CBY86622.1"
FT                   /translation="MMRTHYCGALNRNNIGQDVTLSGWVHRRRDLGGLIFIDMRDRDGI
FT                   VQVCFDPKYQDALTAAAGLRNEFCIQIKGEVIARPENQINKNMATGEVEVLAKELCIYN
FT                   ASDVLPLDFNQNNTEEQRLKYRYLDLRRPEMAQRLKTRAKITSFVRRFMDDNGFLDIET
FT                   PMLTKATPEGARDYLVPSRVHKGKFYALPQSPQLFKQLLMMSGFDRYYQIVKCFRDEDL
FT                   RADRQPEFTQIDVETSFLTAPEVREIMERMVHDLWLDTIGVDLGKFPVMTWQEAMRRFG
FT                   SDKPDLRNPLEMVDVADIVKDVDFKVFNEPANNPNGRVAVIRVPNGAEITRKQIDEYTQ
FT                   FVGIYGAKGLAWAKVNDINAGLEGVQSPITKFLNEEVWKALAERVNAQTGDILFFGADK
FT                   WQTTTDAMGALRLKLGRDLGLTRLDEWQPLWVIDFPMFERDEEGNLAAMHHPFTSPKDF
FT                   SPEQLEADPTSAVANAYDMVINGYEVGGGSVRIFDPKMQQTVFRILGIDEEQQREKFGF
FT                   LLDALKFGTPPHAGLAFGLDRLTMLLTGTENIRDVIAFPKTTAAACLMTEAPSFANPQA
FT                   LEELAISVVKAE"
FT   CDS_pept        935288..935764
FT                   /transl_table=11
FT                   /locus_tag="HICON_11600"
FT                   /product="dATP pyrophosphohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11600"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86623"
FT                   /protein_id="CBY86623.1"
FT                   /translation="MRSDLAAFLMMQYKNNQSVLVVIYTKDTNRVLMLQRQDDPDFWQS
FT                   VTGTIESGEAPKKTAIRELWEEVRLEISENSTALFDCNESIEFEIFPHFRYKYAPNITH
FT                   CKEHWFLCEVEKEFIPVLSEHLDFCWVSAKKAVEMTKSQNNAEAIKKYLFNLRR"
FT   CDS_pept        935924..936664
FT                   /transl_table=11
FT                   /locus_tag="HICON_11610"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11610"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86624"
FT                   /protein_id="CBY86624.1"
FT                   /translation="MAGHSKWANIKHRKAAQDAQRGKIFTKLIRELVTAAKIGGGDVSA
FT                   NPRLRAAVDKALSNNMTRDTINRAIDRGVGGGDDTNMETKIYEGYGPGGTAVMVECLSD
FT                   NANRTISQVRPSFTKCGGNLGTEGSVGYLFSKKGLILIAEADEDALTEAAIEAGADDIQ
FT                   PQDDGSFEIYTAWEDLGSVRDGIEAAGFKVQEAEVTMIPSTTVDLDIETAPKLLRLIDM
FT                   LEDCDDVQNVYHNGEISDEVASQL"
FT   CDS_pept        936711..937283
FT                   /transl_table=11
FT                   /locus_tag="HICON_11620"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11620"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86625"
FT                   /protein_id="CBY86625.1"
FT                   /translation="MSIILGIDPGSRVTGYGVIRQTGRHLEYLGSGAIRTQVEDLPTRL
FT                   KRIYAGVTEIITQFQPNMFAIEQVFMAKNADSALKLGQARGTAIVAAVNHDLPVFEYAA
FT                   RLVKQTVVGIGSADKVQVQEMVTRILKLSDKPQADAADALAIAITHAHSIQHSLHIANS
FT                   VKMTEMQEKMTALLKTRYSRGRFRLKI"
FT   CDS_pept        937346..937960
FT                   /transl_table=11
FT                   /locus_tag="HICON_11630"
FT                   /product="holliday junction DNA helicase RuvA"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11630"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86626"
FT                   /protein_id="CBY86626.1"
FT                   /translation="MIGRLQGILLEKQPPEILLNVQGVGYELLLPMTSFYDLPEIGQET
FT                   TLFTHLVVREDAHLLFGFAQKTDRTLFRELIKTNGVGPKLALAILSAMSVEQFAYAIER
FT                   EELSKLTKIPGVGKKTAERLLVELKGKFKGVKQSDFFVESTHIPLSPSIESHSESSSDE
FT                   AISALIALGYKPAEAEKMVKRVVKPELTSEQVIREALKAAL"
FT   CDS_pept        937968..938975
FT                   /transl_table=11
FT                   /locus_tag="HICON_11640"
FT                   /product="holliday junction DNA helicase RuvB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11640"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86627"
FT                   /protein_id="CBY86627.1"
FT                   /translation="MIEADRIISGQAKVDEDVIDRAIRPKLLADYVGQPQVREQMDIFI
FT                   KAAKLRQDALDHLLIFGPPGLGKTTLANIVANEMGVNIRTTSGPVLEKAGDLAAMLTNL
FT                   EPHDVLFIDEIHRLSPAIEEVLYPAMEDYQLDIMIGEGPAARSIKLDLPPFTLVGATTR
FT                   AGSLTSPLRDRFGIVQRLEFYSVEDLTSIVARSADCLNLELEQQAAFEVARRSRGTPRI
FT                   ANRLLRRVRDYADVRNGGVISVDVAKQALSMLDVDDAGFDYLDRKLLSAVIERFDGGPV
FT                   GLDNLAAAIGEERDTIEDVLEPYLIQQGFLQRTPRGRIATSQTYRHFGLQKLSD"
FT   CDS_pept        complement(939027..939314)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11650"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11650"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86628"
FT                   /protein_id="CBY86628.1"
FT                   /translation="MKKITLFFTALLCLFSTSVLAESNSMPKQCEQLFKETENLIAQAE
FT                   KQLGTHIQVSKIKSKLNQSKQQILQMELATQLKSCEVGLAKLSNLKSYSE"
FT   CDS_pept        complement(939440..940333)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11660"
FT                   /product="Site-specific recombinase XerD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11660"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86629"
FT                   /protein_id="CBY86629.1"
FT                   /translation="MKNLALIDLFLNEYWIEKGLSENTVQSYRLDLTALCDWLDKNGLS
FT                   LETLDAVDLQGFLGERLEKGYKATSTARMLSAMRKLFQYLYREKYRVDDPSAVLSSPKL
FT                   PSRLPKYLTEQQVSDLLNTPDVEVPLELRDKAMLELLYATGLRVTELVSLTIENMSVQQ
FT                   GVVRVIGKGNKERIVPMGEEAAYWVRQFMLYGRPVLLNGQSSDVVFPSQRAQQMTRQTF
FT                   WHRVKHYAILADIDAEALSPHVLRHAFATHLVNHGADLRVVQMLLGHTDLSTTQIYTHV
FT                   AKERLKRLHERFHPRG"
FT   CDS_pept        complement(940364..941530)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11670"
FT                   /product="probable 3-phenylpropionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11670"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86630"
FT                   /protein_id="CBY86630.1"
FT                   /translation="MQVRPFYWLALSFLGYYCAYGVFLPFFPAWLKSQQYGEEMIGLVI
FT                   GSAYIFRFAGGLFFSSLIKKANHIISSLRLLALASAIIMAAMSLVAHNFWLLFIAIGLY
FT                   ASVNSAGMPIGDSLASTWQRQIGLDYGKVRLIGSSAFILGVVVFGGMIGWVGEQNIVWI
FT                   LTALLSFYTIIQLLKPTIPPKDEIPEDGAQNNIGFIALLKNPITLRVMIAVGLIQGSHA
FT                   AYYVYSTIYWTSIGISVSQTSLLWGIGVLAEIVLFFFSRRLFQNISISVLLYISAFACV
FT                   GRWVVMGYIEDFWLIFLLQLMHSLTYAVCHYAIVRYITTQPQSHIAKLQGLYNGLSNGV
FT                   LIAIFTAIAGMIYPTSPAMTFVFMSIIAAAAFFVIPRKLNAFLIVQHK"
FT   CDS_pept        complement(941530..942345)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11680"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11680"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86631"
FT                   /protein_id="CBY86631.1"
FT                   /translation="MQHKLIAFIGGGNMAQAIILGLLKQGYPAEQIIVNDPNEEKRAFF
FT                   ANLGVATSENNVESVIKAEVVLLAVKPQMMADVCLPLSAVDFSDKLLISIAAGISTERL
FT                   NALIPSVKSIVRVMPNTPALVGEGMAGLFAPKNTSENYRTSAQDLLGAVGRTVWVNDET
FT                   QMHAVTAASGSSPAYFFLMLEAMQQALIKMNIDEKTARELVQQSMLGAAKMVTENPQIA
FT                   LSTLRENVTSKGGTTAAALAVFDAQHFNQTIEQAMQACLSRSQEMETLF"
FT   CDS_pept        942411..943319
FT                   /transl_table=11
FT                   /locus_tag="HICON_11690"
FT                   /product="recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11690"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86632"
FT                   /protein_id="CBY86632.1"
FT                   /translation="MWFKNLMTYRLTKPLDWDLTQLQTQLEDCQFHPCGAQDQSKFGWS
FT                   APLRDSDLLYFSVGKQILLIAKKEEKILPANVVKRELDERIESLEQKENRKLKKVEKQT
FT                   LKDDVVMNLLPRAFSKNQHTALWIDTENNLVHVDAASSKRAEDALALLRKSLGSLPVVP
FT                   LAFANEPSTILTNWILQDSLPHWLLALEEAELRGSQEDSVIRCKKQPLENEEILALLQD
FT                   GKKVVSKLALEWEDTLTFVFNEDCTIKRLKFADTVREKNDDILKEDFAQRFDADFVLMT
FT                   GILAKLTENLLDEFGGEKARL"
FT   CDS_pept        complement(943369..943788)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11700"
FT                   /product="putative holliday junction resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11700"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86633"
FT                   /protein_id="CBY86633.1"
FT                   /translation="MGITALAFDFGTKSIGCAIGQSITGTAQALPAFKAQDGIPNWEAI
FT                   EKCLKEWKPDVVIVGLPLNMDGTEQDLTLRARKFANRLQGRFGVNVHLQDERLTTTQAR
FT                   SEIFERGGFKALKKGKIDGVSACLILESWFEYAEY"
FT   CDS_pept        complement(943788..944345)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11710"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11710"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86634"
FT                   /protein_id="CBY86634.1"
FT                   /translation="MELQGKFLIAMPHLDDYFNRTVVFMCEHNEQGSMGLVINQPTDLS
FT                   IAELYSKLNFMMKNDRTFGNEMVVAGGPMHTERGFILHKNTLNAFQHTYKVTEELSMTT
FT                   SADVVETLGSTFAPEKYLVALGCSSWGAGQLEKEIRDNAWLVVSSNDQILFDMPYEDRY
FT                   AAANQLLGIHPYNFALAQVGHS"
FT   CDS_pept        complement(944345..945082)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11720"
FT                   /product="conserved hypothetical RNA methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11720"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86635"
FT                   /protein_id="CBY86635.1"
FT                   /translation="MRIPRIYHPISLENQTQCYLSEDATNHVARVLRMTEGEQLELFDG
FT                   SNHIYPAKIIESNKKSVKVEILGRELADKESHLKIHLGQVISRGERMEFTIQKSVELGV
FT                   NVITPLWSERCGVKLDAERMDKKIQQWQKIAIAACEQCGRNSVPEIRPLMKLQDWCAEN
FT                   DGALKLNLHPRAHYSIKTLPTIPAEGVRLLIGSEGGLSAQEIAQTEQQGFTEILLGKRV
FT                   LRTETASLAAISALQICFGDLGE"
FT   CDS_pept        complement(945132..946661)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11730"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11730"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86636"
FT                   /protein_id="CBY86636.1"
FT                   /translation="MNKYLTYFIAFISGLVGVFAFSPFDYWPLAYVSLLGLLYVVKNPK
FT                   KSTALLSTFLWAMGFFCFGVSWLNVSIHQFGGASLGVSYFLVSLLAAYLALYPMLFTYL
FT                   VQRFKVQSAVIFAVIWTLTEFLRGWIFTGFPWLQFGYTQIDSPFYGLAPIFGVTGLTFF
FT                   TLWASAVIFNLVSSLFKTKNLKLVLSNALLLIIVGGLSAYSSRIHFVKSVENKAISVTL
FT                   AQGNIEQNLKWDPNYFYSTLAIYQKLIAENLGKTDLIILPESALPTLENAITPFFEKLE
FT                   HAAKETKTEIMIGTVFQDTKSGKLLNSIMTTGNPDFPYQPDTPNRYNKHHLVPFGEYVP
FT                   LESILRPLNSVFNLPMSAFQSGEAVQPSLIAKKRAFSPAICYEIIFGEQVRQNLKQDTD
FT                   YLLTLSNDAWFGDSIGPWQHLQMARMRALELGKPLIRATNTGISVFVDAQGKVLAQATQ
FT                   FIETTLTYKIAPAEGKTPYSVLGNMPLYALSLLFLLLHSMMAFIRRKMNIL"
FT   CDS_pept        complement(946684..947583)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11740"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11740"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86637"
FT                   /protein_id="CBY86637.1"
FT                   /translation="MNDEQQNSNQPENTKKPFFQSLFGRFFQGELKNREELVEVIRDSE
FT                   QNDLIDQNTREMIEGVMEIAELRVRDIMIPRSQIIFIEDQQDLNTCLNTIIESAHSRFP
FT                   VIADADDRDNIVGILHAKDLLKFLREDAEVFDLSSLLRPVVIVPESKRVDRMLKDFRSE
FT                   RFHMAIVVDEFGAVSGLVTIEDILEQIVGDIEDEFDEEEIADIRQLSRHTYAVRALTDI
FT                   DDFNGQFNTDFDDEEVDTIGGLIMQTFGYLPKRGEEIILKNLQFKVTSADSRRLIQLRV
FT                   TVPDEHLAEMNNVDEKSE"
FT   CDS_pept        complement(948206..948766)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11750"
FT                   /product="AmpD signalling protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11750"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86638"
FT                   /protein_id="CBY86638.1"
FT                   /translation="MQKLKDIEQGILDCRQIQSPHFDKRPNPQDISLLVIHYISLPPKQ
FT                   FGGGYVDDFFQGKLDPKIHPYFAEIYQMRVSAHCLIERNGRITQYVNFNDRAWHAGVSN
FT                   FQGREKCNDFAIGIELEGSNEQPFTDAQYFSLQELTNVIMKSYPKITKDRIVGHCDISP
FT                   GRKIDPGQYFDWERYLSSVKQTV"
FT   CDS_pept        948881..949330
FT                   /transl_table=11
FT                   /gene="pilA"
FT                   /locus_tag="HICON_11760"
FT                   /product="putative type IV pilin secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11760"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86639"
FT                   /protein_id="CBY86639.1"
FT                   /translation="MKLTTQQTLKKGFTLIELMIVIAIIAILATIAIPSYQNYTKKAAV
FT                   SELLQASAPYKADVELCVYSTNETTNCTGGKNGIAADITAAKGYVKSVTTSNGAITVKG
FT                   DGTLANMEYILQATGNAATGVTWTTTCKGTDASLFPANFCGSVTQ"
FT   CDS_pept        949327..950721
FT                   /transl_table=11
FT                   /gene="pilB"
FT                   /locus_tag="HICON_11770"
FT                   /product="putative type IV pilin secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11770"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86640"
FT                   /protein_id="CBY86640.1"
FT                   /translation="MTSYALLHTQRVTAQNGEIFTISPDLWVRNQQQQSLLLRYFALPL
FT                   KEENNRLWLGVDSLSNLSACETIAFITGKPVEPILLESSQLKELLQQLTPRQMQVEEQV
FT                   KFYQHQETHFEQEDDEPVIRLLNQIFESALQKNASDIHLETLADQFQVRFRIDGVLQPQ
FT                   PLISKIFANRIISRLKLLAKLDISENRLPQDGRFQFKTTFSDILDFRLSTLPTHWGEKI
FT                   VLRAQQNKPVELSFAELGMTENQQQAFQRALSQPQGLILVTGPTGSGKSISLYTALQWL
FT                   NTPDKHIMTAEDPIEIELDGIIQSQINPQIGLDFSRLLRAFLRQDPDIIMLGEIRDEES
FT                   AMIALRAAQTGHLVLSTLHTNDAISAISRLQQLGIQQYEIENSLLLVIAQRLVRKICPK
FT                   CGGNLINSCDCHQGYRGRIGVYQFLHWQQNGYQTDFQNLRVSGLEKVSQGITDEKEIER
FT                   VLGKNS"
FT   CDS_pept        950718..951935
FT                   /transl_table=11
FT                   /gene="pilC"
FT                   /locus_tag="HICON_11780"
FT                   /product="putative type IV pilin secretion protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11780"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86641"
FT                   /protein_id="CBY86641.1"
FT                   /translation="MTKKLFYYQGSNALNQKQKGSIIADTKQQAHFQLISRGLTHIKLQ
FT                   QNWQFGAKPKNSEISELLNQLATLLQSAIPLKNSLQILQQNCTQIMLNEWLERLLQSIE
FT                   SGLAFSQAIEQQGKYLTQQEIQLIQVGEMTGKLAVVCKKIATHRSQSLALQRKLQKIML
FT                   YPSMVLGISLLLTLALLLFIVPQFAEMYSGNNAELPTITAILLSISNFLKQNIGILLFF
FT                   ALSFVLFYYFYLKRQTWFHQKKNQLISITPIFGTIQKLSRLVNFSHSLQIMLQAGVPLN
FT                   QALDSFLPRTQTWQTKTLVNDIILDKEVRSILQWVSQGYAFSDSVSSDLFPMEAQQMLQ
FT                   IGEQSGKLALMLEHIADNYQEKLNHQIDLLSQMLEPLMMVIIGSLIGIIMMGMYLPIFN
FT                   MGSVIQ"
FT   CDS_pept        951932..952624
FT                   /transl_table=11
FT                   /gene="pilD"
FT                   /locus_tag="HICON_11790"
FT                   /product="putative type 4 prepilin-like protein specific
FT                   leader peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11790"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86642"
FT                   /protein_id="CBY86642.1"
FT                   /translation="MIYFTMFLLGGIFGIALWFYLSGFITRLQQEIYATYIELFPQNFL
FT                   PFQSSVSSIQQKKCGHILRYFLSVGVGFIFLQIAFKDSIFTVWFGLTLLILWAISYLDW
FT                   HYQLISTTLCLWLLTIGLFGADNNFSLLTLSESIKSAASFFIVFYAIYWIAKFYYGKEA
FT                   FGRGDYWLAMALGSFIQLETLPHFLLLASVLGICFSLIHKKKKEFIPFAPFMNLSAVII
FT                   YFVKYYWY"
FT   CDS_pept        complement(952679..953941)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11800"
FT                   /product="transcription termination factor rho"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11800"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86643"
FT                   /protein_id="CBY86643.1"
FT                   /translation="MHLTELKNTPVSDLVKLGEEQMGLENLARLRKQDIVFAILKQHAK
FT                   SGEDIFGGGVLEILPDGFGFLRSADSSYLAGPDDIYVSPSQIRRFNLQTGDKIEGKIRP
FT                   PKEGERYFALLKIDQVNDDKPEVSRSKILFENLTPLHANSRLRMERGNGSTEDLTARIL
FT                   DLASPIGKGQRGLIVAPPKAGKTMLLQNIAQSITHNYPDVELIVLLIDERPEEVTEMQR
FT                   SVKGEVIASTFDEPATRHVQVAEMVIEKAKRSVEHKKDVVILLDSITRLARAYNTVTPA
FT                   SGKILSGGVDANALHRPKRFFGAARNVEEGGSLTIIATALVDTGSKMDEVIFEEFKGTG
FT                   NMELHLSRKIAERRVFPAIDFQRSGTRKEDLLTTADELQKMWILRKILNPMDEVDAMEF
FT                   LIDKLMMAKTNEEFFEVMKRS"
FT   CDS_pept        954189..954506
FT                   /transl_table=11
FT                   /locus_tag="HICON_11810"
FT                   /product="Met repressor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11810"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86644"
FT                   /protein_id="CBY86644.1"
FT                   /translation="MANWDGKYISPYAEHGKKSEQVKKITVSIPIKVLEILTNERTRRQ
FT                   LKSLRHATNSELLCEAFLHAFTGQPLPTDADLMKERNDEIPEDAKVLMRELGVDPESWE
FT                   Y"
FT   CDS_pept        complement(954520..954906)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11820"
FT                   /product="probable heavy metal dependent transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11820"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86645"
FT                   /protein_id="CBY86645.1"
FT                   /translation="MNISEAAKLVGLSTKQIRDYEKIGLIKPAVRSLSGYRNYGESDLE
FT                   RLHFIRHSRNVGFSLHQIAQLLALQDNPKRSCREVKVLTAQHIATLNQQIEQLQKMVQK
FT                   LQHWHDSCQGNDNPECLILNGLNG"
FT   CDS_pept        954983..955189
FT                   /transl_table=11
FT                   /locus_tag="HICON_11830"
FT                   /product="Mercuric ion scavenger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11830"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86646"
FT                   /protein_id="CBY86646.1"
FT                   /translation="MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKVNITF
FT                   DENRVNIAQLIEVIEDAGFDATE"
FT   CDS_pept        955264..955470
FT                   /transl_table=11
FT                   /locus_tag="HICON_11840"
FT                   /product="Mercuric ion scavenger protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11840"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86647"
FT                   /protein_id="CBY86647.1"
FT                   /translation="MKTITLNIKGIHCGCCVKSLTQVLTELDGVQSADVQLEGKVNITF
FT                   DENRVNIAQLIEVIEDAGFDATE"
FT   CDS_pept        955445..957613
FT                   /transl_table=11
FT                   /locus_tag="HICON_11850"
FT                   /product="copper transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11850"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86648"
FT                   /protein_id="CBY86648.1"
FT                   /translation="MLDLTPQSKKISIQIGGMTCQSCANRIEKVLNKKPFVQQAGVNFA
FT                   AEEAQVLFNPDQASEAQIIEIIHKTGFSAHIKQANELPIEENTSIPWRLIVLWIINIPF
FT                   LIGMLGMISGSHHLMLPPIWQFALASIVQLWLAIPFYRGAIGSIRGGLANMDVLVSTGT
FT                   LTIYLYSAFMLFYHANHAMGHVYFEASVMVMGFVSLGKFLEERTKKHSLNSLSMLLQLT
FT                   PKKVTALRNDKWTEIALDQVDIGEIIRANQGERIAADGIIESGNGWCDESHLTGESRPE
FT                   EKQKGGKVLAGAMVTEGSIIYRANQLGSQTLLGDMMNALSDAQGSKAPIARFADKVASV
FT                   FVPAVLVISLVTFTLTYILTNDSVFSLIHAVSVLVIACPCALGLATPAAIMVGLGKAVN
FT                   AGVWFKDAAAMEETAHVDTVVLDKTGTLTKGELEISALWQPQSAVYSEEDLYRFAAAVE
FT                   RQANHPIAKAIVQTAEQKMLEIPTALFSKMEVGQGIQAELEQVGTIKVGKPDYCGLILP
FT                   KNLEDIWQIASIVAVSINDKPIGAFALTDTLKNDSLHAIQRLQQQNIDVVIMSGDQQSV
FT                   VDYIAKQLGIKKVFGGLSPRDKAEQIQKLKAQGHIVAMVGDGINDAPALAAANVSFAMK
FT                   SGSDIAEQTASATLMQHSVNQLVDALFIAVATLKNIKQNLFFALIYNILGIPLAAFGFL
FT                   SPIIAGAAMALSSISVLMNALRLKKVRF"
FT   CDS_pept        957836..959074
FT                   /transl_table=11
FT                   /locus_tag="HICON_11860"
FT                   /product="predicted serine transporter"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11860"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86649"
FT                   /protein_id="CBY86649.1"
FT                   /translation="MKSTEKLKWNKFDATWMLNLFGTAVGAGVLFLPINAGMGGFWPLV
FT                   LMAIIVGSMTYFAHRGLAYFVLSSKNPGSDITEVVEEHFGKTAGKLITLLYFFAIFPIL
FT                   LIYGNGITNTVDSFIVNQLGMASPNRVILSFVLIAVLISVMLFNEKVMLKITEWLVYPL
FT                   VLILFVLSIYLIPEWNSAVLYELPTAGGFLTTLWLTIPVLVFSFNHSPAISSFTCSQFR
FT                   EYKTFEGAERHISHTEKGVSTILLFFVMFFVFSCVLTLTPEELVAAKEQNISILSFLAN
FT                   KFDNPYISYFGPLVAFLAITSSFFGHYMGAREGLEGLYLKMKGEAVNRKKLNYATALFF
FT                   LLTLWGVAIINPSILGLIESLGGPIIAMILFIMPMYSIRKIPAMKRYSGRFSNVFVTIM
FT                   GLIAISAVVYGLL"
FT   CDS_pept        959109..960476
FT                   /transl_table=11
FT                   /locus_tag="HICON_11870"
FT                   /product="L-serine deaminase I"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11870"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86650"
FT                   /protein_id="CBY86650.1"
FT                   /translation="MISVFDMFKVGIGPSSSHTVGPMKAGKQFIDDLIKRNQFEQTTEI
FT                   HVDVYGSLSMTGRGHSTDIAIIMGLAGYLPHNVDIDMISGFIEKVKQTALLPINVGQKI
FT                   VKFDFENNLIFHRTFLKLHENGMTITALDENRTELYLQTYYSIGGGFIVDEAHFGKAEK
FT                   NTVQVPYPYKNAEDILKHCSDNGLMLSTVMLENEIALNGKEAVSAHLENVWKTMQACIE
FT                   HGIHTEGILPGPLRVPRRAASLYRALQANTNLSNDPMRVIDWVNMFALAVNEENAAGGR
FT                   VVTAPTNGACGIIPAVLAYYEKFISPLTPEIIERYLLAAGMIGSLYKMNASISGAEVGC
FT                   QGEVGVACSMAAAGLAEILGGNPLQVCIAAEIAMEHNLGLTCDPVGGQVQVPCIERNAI
FT                   ASVKAINASRMALRRTTNPRVTLDKVIETMYETGKDMNAKYRETSQGGLAVKIVCN"
FT   CDS_pept        complement(960585..961841)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11880"
FT                   /product="tryptophan-specific transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11880"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86651"
FT                   /protein_id="CBY86651.1"
FT                   /translation="MIQQKSPSLLGGAMIIAGTAIGAGMLANPTSTAGVWFIGSILALI
FT                   YTWFCMTTSGLMILEANLHYPTGSSFDTIVKDLLGKSWNTINGLSVAFVLYILTYAYIT
FT                   SGGGITQNLLNQAFSSAESAVDIGRTSGSLIFCLILAAFVWLSTKAVDRFTTVLIVGMV
FT                   VAFFLSTTGLLSSVKTAVLFNTVAESEQTYLPYLLTALPVCLVSFGFHGNVPSLVKYYD
FT                   RDGRRVMKSIFIGTGLALVIYILWQLAVQGNLPRTEFAPVIEKGGDVSALLEALHKYIE
FT                   VEYFSVALNFFAYMAISTSFLGVTLGLFDYIADLFKFDDSLLGRTKTTLVTFLPPLLLS
FT                   LQFPYGFVIAIGYAGLAATIWAAIVPALLAKASRQKFPQASYKVYGGNFMIGFVILFGI
FT                   LNIVAQIGANLGWFASFTG"
FT   CDS_pept        complement(961958..963172)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11890"
FT                   /product="probable aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11890"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86652"
FT                   /protein_id="CBY86652.1"
FT                   /translation="MRLFPKSDKLEHVCYDIRGPVHKEALRLEEEGNKILKLNIGNPAP
FT                   FGFEAPDEILVDVLRNLPSAQGYCDSKGLYSARKAIVQYYQSKGIHGATVNDVYIGNGV
FT                   SELITMAMQALLNDGDEVLVPMPDYPLWTAAVTLSGGKAVHYLCDEEANWFPAIDDIKA
FT                   KVNTKTKAIVIINPNNPTGAVYSKELLQEIVEIARQNNLIIFADEIYDKILYDGAVHHH
FT                   IAALAPDLLTVTLNGLSKAYRVAGFRQGWMILNGPKHNAKGYIEGLDMLASMRLCANVP
FT                   MQHAIQTALGGYQSINEFILPGGRLLEQRNKAYDLITQIPGITCVKPMGAMYMFPKIDV
FT                   KKFNIHSDEKMVLDLLRQEKVLLVHGKGFNWHSPDHFRVVTLPYVNQLEEAITKLARFL
FT                   SDYRQ"
FT   CDS_pept        963329..964600
FT                   /transl_table=11
FT                   /locus_tag="HICON_11900"
FT                   /product="menaquinone-specific isochorismate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11900"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86653"
FT                   /protein_id="CBY86653.1"
FT                   /translation="MSYLAQAIGELKSQIHAYLQQSTNELVRFQVKLDKVDLLAWLKGQ
FT                   SAYPQFYLHFRDEEKALAALGAVQSFSQLNLAQEFIEESGFPLVGGLQFQGTAQFVLPK
FT                   MLVEQDNKGALVSFFVKNEQSANDTLAHLKTFGNLTALSALPKQIPLHTEPRANERTWC
FT                   DWVNQALVEIKSGELTKIVLANETTFHLKQAINAYDFLAESEKQNQGCYHFLWAENSHS
FT                   VFVGSTPERLFAREYNLLLTEALAGTASVSESEEETQSQANWLLNDEKNLKENWLVVKD
FT                   ISQNLRKQVESFDVSNVELKPLRKVQHLIRKIRANLTAHYADVNILKAIHPTAAVSGLP
FT                   QQQAKMILSEIETFDRGWYAGTLGVMSDVCSEFCVAIRSAFIEGHRIRVFAGAGIVAGS
FT                   QPLEEWKEIERKAAGLISLFAEEK"
FT   CDS_pept        964615..966321
FT                   /transl_table=11
FT                   /locus_tag="HICON_11910"
FT                   /product="menaquinone biosynthesis protein MenD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11910"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86654"
FT                   /protein_id="CBY86654.1"
FT                   /translation="MSVSVFNRCWSKVILETLVRQGVSHVCIAPGSRSTPLTLEAVRLQ
FT                   NAGSVTCHTHFDERGLGFFALGIAKATQLPVAIIVTSGTATANLYPAIIEARQTGVNLF
FT                   VLTADRPPELWECGANQAILQQNMFGQYPVANVNLPKPNADYSAQWLISLLEQAAFQQK
FT                   QQGGVVHINVPFAEPLYDATDEEVNSHSWLQPLQRWLIQNKSWINVEVQQNEVLMHENW
FT                   DHWRTKRGVVVVGQLPAEQAMGINSWASAMGWVLLTDIQSGVVPTTPYEDIWLANQTVR
FT                   EKLLQADIVIQFGARFISKRINQFLQAFKGEFWLVEQSGKALDPYHHSLTRFNAKAHHW
FT                   LRAHPPLRQKTWLLEPLALSKFCATFIEQQVGGNLTEASLALRLPTLLPYNGVLFLGNS
FT                   LLVRLVDALTQLPESYPVYTNRGASGIDGLLATAAGIGIGSNKPVVAVIGDTSTLYDLN
FT                   SFALFKNVTQPTLIFVINNNGGAIFDMLPVDEQVKDQFYRLPHNGDFSQIAAMFDLKYA
FT                   HPYTWADLNSVVKQAYSRRKATLIEIKTNPSDGSSLYKRLIEQISHAVIGA"
FT   CDS_pept        966382..967125
FT                   /transl_table=11
FT                   /locus_tag="HICON_11920"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11920"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86655"
FT                   /protein_id="CBY86655.1"
FT                   /translation="MINIIFLHGLLGTKNDWQKVIENLPHFNCIALDLPFHGQAKDLEV
FT                   TNFEETAVYLAQQIKSAVKNEPYFLVGYSLGGRIALYYALQAQLERSNLQGVILEGANL
FT                   GLKTDEEKQARFLQDFAWAQRFMQESPEKVLNDWYQQPVFSHLTAEERLQLVEKRKSSC
FT                   GENIGKMLLATSLSKQPDFSEKVRLSSLPFFYFCGERDHKFQVLAKENQIDLVTIPCAG
FT                   HNSHLENSKYFSKKIENCILKIARP"
FT   CDS_pept        967181..968497
FT                   /transl_table=11
FT                   /locus_tag="HICON_11930"
FT                   /product="conserved hypothetical metabolite transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11930"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86656"
FT                   /protein_id="CBY86656.1"
FT                   /translation="MSTQLRNNPMKVALASMVGTAIEFFDYYIYAAAAVLVFNTQFFHS
FT                   DDPLSNDLLSLSTLALAFFARPIGSALFGHFGDKIGRKKTLVASLVLMGGSTVVIGLLP
FT                   NYAQIGIWAPILLCVCRVGQGIGLGGEWGGAALVATENAPEGKRAWYGTFPQLGAPIGL
FT                   FVANGTFFLVSYLLGHNALVEWAWRIPFVSSILLVAVGLYIRLTLHESHVFVEAEQKGK
FT                   KLNAPVSVVFTKHLKPMIIGTFIMVATYSLFYIMTAFAQAYSRTAPKLSEAGYALGLGI
FT                   PANTFTGLLLISAIVFGVFISISGFYADKIGRRKWLIWVTIAIGVLGLAMPLFLENGTP
FT                   VSVFAFLVIGMAIMGMTFGPMAALLPELFPTEVRYSGASLAYNLASIIGATIAAMISLK
FT                   INASFGVMGVGIYLAINALMTFLALLASKETKNVDLTEI"
FT   CDS_pept        complement(968723..969481)
FT                   /transl_table=11
FT                   /locus_tag="HICON_11940"
FT                   /product="uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11940"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86657"
FT                   /protein_id="CBY86657.1"
FT                   /translation="MSDVFHLNLTKAQLKGATLAIVPGDPARSERIAKQLDNPEFLTST
FT                   REFTSWLGYINGQPIVVCSTGIGGPSTSICVEELAQLGVRTFLRIGTTGAIQPHINVGD
FT                   VLITTAAVRLDGASHHFVPLEYPAVANFECTTALYNAAKAKGIEPYVGVTVSSDTFYPG
FT                   QERYDTYSGKVYRNYQGLLKQWQDLNVMNYEMESSTLFTMCSALGLRAGMVAGVIVNRT
FT                   QQEIPNEATIKQTEEKAVSVVIAAAQALLS"
FT   CDS_pept        969717..970379
FT                   /transl_table=11
FT                   /locus_tag="HICON_11950"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11950"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86658"
FT                   /protein_id="CBY86658.1"
FT                   /translation="MNAKILVIKVGQVQTLTFSDGSLYESAIRKKVVPSVKIHSLGAEG
FT                   NDVGLKKHHGGVDKALFFMSADSFNELNTLLNKDFSYMDTATYGENFVVSGLNEDNVCI
FT                   GDRYQIGSTILEVSQPRKPCERLSKNTENEETRDIIYQTGLSGWYVRIIETGTIKQKDE
FT                   LKLLARPYPQITIRHLNRLLSAPKNEAELDVALEIEVLAEAFKRSIRSQISKFKQQG"
FT   CDS_pept        970382..970864
FT                   /transl_table=11
FT                   /locus_tag="HICON_11960"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11960"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86659"
FT                   /protein_id="CBY86659.1"
FT                   /translation="MSEISTALSEDCPCQSGHHYADCCGKFHLRQAFPETAEQLMRSRY
FT                   TAYVLKNIPYIVVTTVPSQQTLLKPRLLQEWADNTTWLGLEILKTESLTKTQSAVEFKA
FT                   IFQGEECDQAHQERSIFVKIENRWYFVDPTVSLPTMKQPCVCGSGKKFKHCCGGFL"
FT   CDS_pept        970843..971670
FT                   /transl_table=11
FT                   /locus_tag="HICON_11970"
FT                   /product="trna-processing ribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11970"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86660"
FT                   /protein_id="CBY86660.1"
FT                   /translation="MLWGISMISLKNFGLLFWKRFSENKLNQVAGALTYSTMLAIVPLV
FT                   MVIFSIFSAFPVFNEVTGELKEMIFTNFAPSASDMVGEYIDQFVSNSKKMSAVGIVSLI
FT                   AVALMLINNIDRTLNSIWHNSQSRSPLSSFAIYWMILTLGPLIIGVSIGISSYIKIMFE
FT                   QSEHLSLGLKLLSFVPFLFTWFIFTLIYTVVPNKKVKIKHSAYGAFLAAIFFTLGKQAF
FT                   TWYIVTFPSYQLIYGAMATLPIMLLWIQISWLVVLVGAQLASTLDEIGEQIEQ"
FT   CDS_pept        complement(971690..973345)
FT                   /transl_table=11
FT                   /gene="lpt6"
FT                   /locus_tag="HICON_11980"
FT                   /product="PE-tn-6--lipooligosaccharide
FT                   phosphorylethanolamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11980"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86661"
FT                   /protein_id="CBY86661.1"
FT                   /translation="MIAYIFLALFTIAAVIFIVNSHYRWTYFFAITLFTFLFGGMLMVS
FT                   SQWQRALNFSSVLFVVLMLFHRLKIHYYKQPLLISDFFLVVDWRNWETLIHYKGALFGV
FT                   IGLLALLGYAIFGFNDAESLGVLGSSIGALLFIISFSLMWHYSKNPSAVQVWLDSLPDD
FT                   GRDVFLNLPMSCRGIFFKVPNFDGNSQNFIEKMTALSPDTNNLSETKPDIVVTLMESTL
FT                   NPHQFAFSQQSIPPLSMFESQSDTVFASPLRVHTFAGATWKSEFAFLAGVPSTDFGALA
FT                   SGVFYSVVPHLQSGLVKNLKAQGYFCVALSPFTKGNYNAKSAYDHFGFDLMLQPQDLGY
FT                   PAPISKNLWDISSEEMMKYTRMILEKQYPALENVDQPMFVYVLTMREHGPYELGMENIF
FT                   NLQMPNLGAKSISALNDYTQRIVALNDAIEGINNYLHERKKPFVLGYFGDHQVAFDNAI
FT                   PPKKGDYAQPDYVTQFVVRSNCASQFKQEQRFLDLAFAGGVLMNVAGLSAEDEFMKANM
FT                   AMCKLSDGKLEDSSDIQLLNDYRHYLYQTLAIAR"
FT   tRNA            complement(973470..973542)
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:973507..973509,aa:Val)"
FT   tRNA            complement(973598..973670)
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:973635..973637,aa:Val)"
FT   tRNA            complement(973732..973804)
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:973769..973771,aa:Val)"
FT   tRNA            complement(973851..973923)
FT                   /product="transfer RNA-Val"
FT                   /anticodon="(pos:973888..973890,aa:Val)"
FT   CDS_pept        974094..975536
FT                   /transl_table=11
FT                   /locus_tag="HICON_11990"
FT                   /product="glutamyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_11990"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86662"
FT                   /protein_id="CBY86662.1"
FT                   /translation="MKLDAPFNLDPNVKVRTRFAPSPTGYLHVGGARTALYSWLYAKHN
FT                   NGEFVLRIEDTDLERSTPEATATIIEGMEWLNLPWEHGPYYQTKRFDRYNQVIDEMIEQ
FT                   GLAYRCYCTKDRLEELRHTQEQNKEKPRYDRHCLHDHNHSPDEPHVVRFKNPTEGSVVF
FT                   DDAVRGRIEISNSELDDLIIRRTDGSPTYNFCVVVDDWDMGITHVVRGEDHINNTPRQI
FT                   NILKAIGAPIPTYAHVSMINGDDGQKLSKRHGAVSVMQYRDDGYLPEALINYLVRLGWG
FT                   HGDQEIFSREEMINYFELDHVSKSASAFNTEKLQWLNQHYIRELPPEYVAKHLEWHYKD
FT                   QGIDTSNGPALTEIVTMLAERCKTLKEMASSSRYFFEEFETFDEAAAKKHFKGNAAETL
FT                   AKVKEKLTALSSWNLHSIHEAIEQTAAELEVGMGKVGMPLRVAVTGSGQSPSMDVTLVG
FT                   IGRDRVLARIQRAIDFIHAQNA"
FT   tRNA            975617..975689
FT                   /product="transfer RNA-Ala"
FT                   /anticodon="(pos:975650..975652,aa:Ala)"
FT   CDS_pept        975837..976553
FT                   /transl_table=11
FT                   /locus_tag="HICON_12000"
FT                   /product="ribonuclease PH"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12000"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86663"
FT                   /protein_id="CBY86663.1"
FT                   /translation="MRPNNRENNQPRQIKITRNYTKHAEGSVLVEFGDTKVLCTATVED
FT                   AVPRFLKGQGQGWVTAEYGMLPRSTHSRMQREAAKGKQSGRTMEIQRLIARSLRAMVDL
FT                   KALGERAITLDCDVIQADGGTRTASITGAAVALCDAINGLIENGTLKTNPIKGLVSAIS
FT                   VGIVDGQAVCDLEYVEDSAAETDMNVVMMEDGRMIEVQGTAEGEPFSHEELLTLLDLAK
FT                   QGCNQIFIAQREALGL"
FT   CDS_pept        976577..977218
FT                   /transl_table=11
FT                   /locus_tag="HICON_12010"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12010"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86664"
FT                   /protein_id="CBY86664.1"
FT                   /translation="MEQYKRDFIEFALSRNVLKFGEFALKSGRKSPYFFNAGLFNTGAD
FT                   LARLGESYAAAIQASAVDFDVVFGPAYKGIPIGTSVSVALFNRYGIDKPVCFNRKEVKD
FT                   HGEGGNLIGSPLQGKILLVDDVITAGTAIRESMELISANKAELAAVLIALNRKERGKGE
FT                   LSAIQEVERDYQCQVLSIIDLDDLMQFIEQDPRYSSHLPEMRAYRAEFGV"
FT   CDS_pept        977297..978163
FT                   /transl_table=11
FT                   /locus_tag="HICON_12020"
FT                   /product="DnaJ-like protein, membrane anchored"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12020"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86665"
FT                   /protein_id="CBY86665.1"
FT                   /translation="MEFIGKIIGVFLGWKVGGFFGAIAGLILGSIADKKLYELGSVSSS
FT                   FFKKKTTRQDLFMQTTFAVLGHLSKSKGRVTEEDIQLANQLMIQLKLDDAGRKLAQDAF
FT                   RRGKESDFPIRQVIREFRIGCGQRADLLRMFLQVQVQAAFADSELHENEKEVLYVIAEE
FT                   LGLSRMQFEQMIAMEMAARAFTQGGFYQQYQQGAYQGGYQYQQQNSGGYQHASGPTLND
FT                   GYKVLGVTESDEQSTVKRAYRRLMNEHHPDKLVAKGLPPEMMEMAKEKTQQIQAAYDLI
FT                   CQAKGWK"
FT   CDS_pept        978163..979095
FT                   /transl_table=11
FT                   /locus_tag="HICON_12030"
FT                   /product="tRNA-dihydrouridine synthase C"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12030"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86666"
FT                   /protein_id="CBY86666.1"
FT                   /translation="MRVILAPMQGVLDPFVRQLLTEVNNYDLCITEFVRVVDQLLPEKV
FT                   FYRLCPELKNQGFTSSGTPVRVQLLGQHPECLAENAIRAIDLGSHGIDLNCGCPSKTVN
FT                   GSNGGAALLKQPELIYRATQALRQAVPGEFPVSVKVRLGWDDISQAFEITDAVEQGGAT
FT                   EITVHGRTKADGYRADRINWKKIGEVRERLFIPVIANGEIWHWQDGQDCLSQTGCQDLM
FT                   VGRGALNIPNLSHVLKSNAEKMPWCEIQKILQKYANVENEYDSGFYHVARIKQWLRYLN
FT                   KEYDEANQVFDKIKTCQTAEDLKLRLNDK"
FT   CDS_pept        complement(979135..979980)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12040"
FT                   /product="RNA polymerase sigma-32 factor"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12040"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86667"
FT                   /protein_id="CBY86667.1"
FT                   /translation="MDKETQMMLVPQGSIEGYIRAANEYPMLTAEEEKELAERLYYHED
FT                   LDAAKKLILSHLRFVIHVARGYSGYGLPQADLIQEGNIGLMKAVKRFNPEVGVRLASFA
FT                   VHWIKAEIHEYVLRNWRIVKVATTKAQRKLFFNLRKTKQRLGWFNENEVDMVANELGVS
FT                   KEDVIEMESRMSGADVGFDLPTDDAETETYSPALYLEDKSSNFAAELENENFESQATEQ
FT                   LGVALQSLDARSQDIIKARWLDDNKATLHDLAAKYNVSAERIRQLETNALKKLKSAVNF
FT                   "
FT   CDS_pept        complement(980454..981479)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12050"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12050"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86668"
FT                   /protein_id="CBY86668.1"
FT                   /translation="MQNLQPFHTFHIQSNAREIIEAHSIEQLQQVWANSKSENLPTLFL
FT                   GQGSNVLFLDDFNGIVILNRLMGITHEQDANFHYLHVNGGENWHKLVEWSINNGIYGLE
FT                   NLALIPGCAGSAPIQNIGAYGVEFKDVCDYVEVLNLNTNETFRLDTEQCEFGYRESIFK
FT                   HRYQQGYVITAIGLKLKKDWQPILKYGSLVEFDPKTVTAKQIFDEVCHIRQSKLPDPNE
FT                   FGNAGSFFKNPVVSLEHFEKIKKHHENLPHFPQEDGSVKLAAGWLIDQCNLKGFQIGGA
FT                   AVHKKQALVLINKSGATGQDVVKLAHHVRQTVAEKFGVYLQPEVRFISATGEVNSEQII
FT                   T"
FT   CDS_pept        complement(981489..983192)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12060"
FT                   /product="sensor protein NarQ"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12060"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86669"
FT                   /protein_id="CBY86669.1"
FT                   /translation="MYTKGSVSTRIAKYLFIILIVAGVISSLSLAIMSSNKYDAEAINI
FT                   SGSLRMQSYRLLYEMQEQPESVETNLRRYHISLHSSALLEVQNQFFTPNVLKHSYQNIL
FT                   QRWTNMEKYARQQDVKNYSKQLTNYVADVDYFVFELQRFSEQKWILGVSVLGFAMLLIL
FT                   LMVSYVIWYTNREVVKPLHLMTKASMQVQMRQFNHIPLDTRKQNELGTLARVFTQMSTE
FT                   LGQLYSRLEEAVNEKTQKLRQTNRTLSTLYQSAQLLNTNTINDKILNQVLNYIFISDHL
FT                   NFVKVEVMGAEHWDITLGKQDANNELQIETLSVDNEELGVLSWQAGLPCPDPRIMQNLA
FT                   QMLARALYFHKNLRQKEQLLLMEERSIIARELHDSLAQVLSFLQIQLTLLKHNLKKEDE
FT                   QSKEKSLAIIANFEQALSGGYAQLRELLATFRLTIQEANLQLALEQVIDSLRSQTTMQM
FT                   NVNCQLPSQSLNPQQLVHVLQIVREATTNAIKHSQGTVIEISARINAEGEYEILVEDDG
FT                   VGIPNLEEPEGHYGLNIMAERCRQLNAQLHIHRREQGGTQVKITLPHTLY"
FT   CDS_pept        complement(983234..983833)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12070"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12070"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86670"
FT                   /protein_id="CBY86670.1"
FT                   /translation="MSLFALFYMLFAYLLGSVSSAILICRIAGLPDPRQNGSHNPGATN
FT                   VLRIGNRKSALAVLIFDMLKGMIPVWAGYYLGLTQFELGMVALGACLGHIFPIFFQFKG
FT                   GKGVATAFGAIAPISWAVAGSMFGTWIFVFLVSGYSSLSAVISALLVPFYVWWFKPEFT
FT                   FPVALVCCLLIYRHHDNIQRLWRGQEDKVWAKFKKK"
FT   CDS_pept        983916..984272
FT                   /transl_table=11
FT                   /locus_tag="HICON_12080"
FT                   /product="dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12080"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86671"
FT                   /protein_id="CBY86671.1"
FT                   /translation="MDRIFIEELTVFAQIGVYDWEQQIKQKLVFDLEMAWDCKQAAETD
FT                   DVAYCLNYAEVSQAIIDYVESKPFLLIERVAYEVADLLESRYQLQGLKIKLSKPKAVAQ
FT                   ARNVGVLIVRGCLK"
FT   CDS_pept        complement(984368..987127)
FT                   /transl_table=11
FT                   /gene="hxuA"
FT                   /locus_tag="HICON_12090"
FT                   /product="heme/hemopexin-binding protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12090"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86672"
FT                   /protein_id="CBY86672.1"
FT                   /translation="MYKLNVISLIILTTYTGATYASTQDFPQNHTTVSGTVTVTTTADK
FT                   MTIKQTTSKTQIDWYSFDIGKNKEVKFEQPDANSVAYNRVTGGNASQIQGKLTANGKVY
FT                   LANPNGVIITQGAEINVAGLFATTKDLERISENGNGNGNGNGNGNGNGNKFTRKAKEGK
FT                   VLTEGKVLNQGEIKAKDFVVLNGDEVINEGKIDATNGKVYLSSDYNFTFTLLPDSGISV
FT                   ALEDNAVQGIVKNEGSIKAGEITLSAKGRKEALDSLVMNNGVLEATKVSSKNGKVVLSA
FT                   DEIKLNDKSNIKGESEVVFTSNKELENNIKITSQNGSKVTSPKINFKGKSVNIKGDFGR
FT                   EDNNDYYKDEFKTLNTEVNIDVPDTENIRIADKDKEQDKDNTGTGSFIQTDALSSLLAN
FT                   NGKVNLKGKDVNISGNIKINSFKGTDSLLKLTNQGHININNADIHSTGRLFFITSLQND
FT                   VDFQSNITITNSKINLGNGAMGLGRSLNKENCDHPRWCRTETSQRKKFDVDMRNVVFDQ
FT                   VDDVVVAGGFRKVNLDRIVATGKTNFYIDGGVSRNNSKYEYGVLDLDERTQLSSLDQRK
FT                   RRWKYYYNLDLDMNKAYWHRFDMFASKNTGRSTIKDTEINISNSNINLKNGFMHLLAEK
FT                   IKLDKSKIDITFDKDNSEDISSQINRLGMNGKVSMVNSHIKIVGDEKSDISAKAPYATM
FT                   FLIGELIGEKSSIFVKSHQGYTFRTDGNTKIAGKYSKDDLKITAINTGGRTGKEVIING
FT                   APGSIDNDANIANMAFTIGDNADTKTTIENADITALAPNGGTAYLSSKGVEIEVKSNSN
FT                   FTFFELPREKNFNQTKINGASTKLSERDFARLYDKINGVRASNLSAEQLNVTDASEKII
FT                   NTKLVSSLDVEKLVSVAVCDAGNGCEEQQFGDKGNNTKVSVGELEAEQ"
FT   repeat_region   complement(986669..986716)
FT                   /note="GGCAAT x8"
FT   CDS_pept        complement(987139..988830)
FT                   /transl_table=11
FT                   /gene="hxuB"
FT                   /locus_tag="HICON_12100"
FT                   /product="heme/hemopexin-binding protein B"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12100"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86673"
FT                   /protein_id="CBY86673.1"
FT                   /translation="MRPRYSVIASAVSLGFVLSKSVMALGQPDTGSLNRELEQRQIQSE
FT                   TKPSGELFNQTANSPYTAQYKQGLKFPLTQVQILDRNNQEVVTDELAHILKNYVGKEVS
FT                   LSDLSNLANEISEFYRHNNYLVAKAILPPQEIEQGTVKILLLKGNVGEIRLQNHSALSN
FT                   KFVSRLSNTTVNTSEFILKDELEKFALTMNDVPGVNAGLQLSAGKKVGEANLLIKINDA
FT                   KRFSSYVSVDNQGNKYTGRYRLAAGTKVSNLNGWGDELKLDLMSSNQANLKNARIDYSS
FT                   LIDGYSTRFGVTANYLDYKLGGNFKSLQSQGHSHTLGAYLLHPTIRTPNFRLSTKVSFN
FT                   HQNLTDKQQAVYAKQKRKINSLTAGIDGSWNLIKDGTTYFSLSTLFGNLANQTSEKKQY
FT                   AVENFQAKSHFTVYNYRLSHEQILPKSFAFNIGINGQFADKTLESSQKMLLGGLSGVRG
FT                   HQAGAASVDEGHLIQTEFKHYLPVFSQSVLVSSLFYDYGLGKYYKNSQFLAKGVKNSVK
FT                   LQSVGAGLSLSDAGSYAINVSVAKPLDNNIDNADKHQFWLSMIKTF"
FT   CDS_pept        complement(988912..991077)
FT                   /transl_table=11
FT                   /gene="hxuC"
FT                   /locus_tag="HICON_12110"
FT                   /product="heme/hemopexin-binding protein C"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12110"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86674"
FT                   /protein_id="CBY86674.1"
FT                   /translation="MRFSKLSLAITTTLVTANALAQSVELDSINVIATRDPSRFAYTPE
FT                   KQSKDSLLSKQATSVADALEDIPNVDVRGGSRSIAQKPNIRGLSDNRVVQVIDGVRQNF
FT                   DLAHRGSYFLPMSLIQEIEVIKGPSSSLWGSGALGGVVAMRTPNALDLLKNNDKFGVKI
FT                   RQGYQTANNLSEKDVSVFAANDKFDVLISGFYNNADNLRTGKGNKLNNTAYKQFGGLAK
FT                   FGWQINDANRVELSHRETRFKQTAPSNNEVENELTNEQIKDQINEFHGSSNSFPPKRPS
FT                   APEISKFYSGVKTRLGSVSYLTDQQIPDQSTVFNYYLTPDNPYLNTHIALYNNKTIEKE
FT                   QRKVSGVKDQTKLTTRGINLRNSSELSHISFVYGVDYMRDKIRTERGTNDKDAKFRAEP
FT                   YNANSNTTGVYLIAHIPLFGEKLLVSPSVRYDHYDTSSKTVKYKDNHLSPATKLTWIVT
FT                   NWLDFTAKYNEAFRAPSMQERFVSGAHFGAETRGLNQVNRFVANPNLRPETAKNKEITA
FT                   NLHFDSLFKQGDKFKIEATYFRNDVKDFINLKIFNDAKTNAGANKNASANGAFLPKNSQ
FT                   YQNITNARLSGIELQAQYQTERLTLFTNYGSTKGKDKDSGEALSNIAASKIGVGVNYAL
FT                   VKDKFTVGATVTHYAAQRRVPKDHSVTYPSYILTDLRATYAPLKGEWKNLRLDFALENL
FT                   FDRKYQPAFSLMEGTGRNAKISAVYSF"
FT   CDS_pept        complement(991400..992443)
FT                   /transl_table=11
FT                   /gene="opsX"
FT                   /locus_tag="HICON_12120"
FT                   /product="ADP-heptose--lipooligosaccharide
FT                   heptosyltransferase I"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12120"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86675"
FT                   /protein_id="CBY86675.1"
FT                   /translation="MPLFTEAPKSLCILRLSAVGDVCHALAVVQHIQAYYPQTEITWIV
FT                   GKTEMGLLSGIPNITLIPYDKKTGWKGVLSLWKQLKNKQFDALLNMQTAFRASILSLGI
FT                   KAKFKIGFGEKRSREGQWLFVNRRITDPSSPHVLDGFMAFAEYIGVPKAEPKWELAISQ
FT                   DDYKFADQFIDFSRKNLLISPCSSKAEKDWLIEGYAEVANIAHQHNINVIFCSSPAKRE
FT                   LEIVEKITALCHFTPTNIAGKTNLKQLTALISKVDLVLSPDSGPAHIATTQGTPVIGLY
FT                   AYHNPLRTAPYNNLDNVISVYEKNAQKEFGKPSSELPWATKLKGKNLMAEIQVEPVIEQ
FT                   MKKLGLF"
FT   CDS_pept        992520..993248
FT                   /transl_table=11
FT                   /locus_tag="HICON_12130"
FT                   /product="3-deoxy-D-manno-octulosonic acid kinase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12130"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86676"
FT                   /protein_id="CBY86676.1"
FT                   /translation="MHQFQQDNQYFIFNFDRTFEQATEFFQAEFWQKQERVIGSAKGRG
FT                   TTYFLQTEDWFGVNCALRHYYRGGLWGKLNKDRYRFSALDTTRSFAEFHLLQRLYEAGL
FT                   PVPKPIAARIQKGKLGICYQADILTEKIENAQDLTALLQTQTLPKETWRQIGRLIRKLH
FT                   DLQICHTDLNAHNILLQQEAEQEQKCWLLDFDKCGKKSGDFWKTQNLNRLKRSFEKEVG
FT                   RMNIQFTEQNWADLTAAYHQ"
FT   CDS_pept        993260..993847
FT                   /transl_table=11
FT                   /gene="orfM"
FT                   /locus_tag="HICON_12140"
FT                   /product="predicted xanthosine triphosphate
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12140"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86677"
FT                   /protein_id="CBY86677.1"
FT                   /translation="MKQKIVLATGNKGKVKEMADVLSDFGFEVIAQTDLGIESPEETGL
FT                   TFVENALLKARYASEKSGLPAIADDSGLVVSALNGAPGLYSARYAGEEGNDAKNREKLL
FT                   AELAHVAQDQRQAKFVSCIVFLQHPTDPSPIIAEGECCGVIGFEEKGENGFGYDSLFFS
FT                   PEQGCTFAELETVEKKKISHRAKALSVLKSKL"
FT   CDS_pept        993924..994934
FT                   /transl_table=11
FT                   /locus_tag="HICON_12150"
FT                   /product="UDP-galactose--lipooligosaccharide
FT                   galactosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12150"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86678"
FT                   /protein_id="CBY86678.1"
FT                   /translation="MTDRQTDRQTDRQTDRQTDRQTDRQTDRQTDRQTVSQTMNIIFSS
FT                   DNYYAPYLAVSIFSIIKNTPKKINFYILDMKINQENKTIINNLASEYSCKVFFLPVCES
FT                   DFQNFPKTIDYISLATYARLNLTKYIKNIEKAIYIDVDTLTNSSLQELWNIDITNYYLA
FT                   ACRDTFIDVKNEAYKKTIGLEGYSYFNAGILLINLNKWKEENIFQKSINWMNKYNNVMK
FT                   YQDQDILNGICKGKVKFINNRFNFTPTDRNLIKKKNLLCVKMPIVISHYCGPYKFWHKK
FT                   CGHLNCHIGNLLLKEMDKIINIPSSWYDHFEKIPFLIKIKRLRKRIKDKLIYGIY"
FT   repeat_region   993926..994021
FT                   /note="GACA x24"
FT   tRNA            995118..995204
FT                   /product="transfer RNA-Ser"
FT                   /anticodon="(pos:995152..995154,aa:Ser)"
FT   CDS_pept        complement(995650..995973)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12160"
FT                   /product="Putative uncharacterised protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12160"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86679"
FT                   /protein_id="CBY86679.1"
FT                   /translation="MTLNITSKQMDITPAIREHLEERLAKLGKWQTQLISPHFVLNKVP
FT                   NGFSVEASIGTPLGNLLASATSDDMYKAINEVEEKLERQLNKLQHKSESRRADERLKDS
FT                   FEN"
FT   CDS_pept        complement(996145..996792)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12170"
FT                   /product="Conserved hypothetical lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12170"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86680"
FT                   /protein_id="CBY86680.1"
FT                   /translation="MKKIILNLITAIILAGCSSNPETLKATNDSFQKSETSIPHFSPLA
FT                   TGGVQLPKADDAYSLPNIEVKKGEDIDIRPPLIPLAIIQNSITKFDGERSLIVYPKQQA
FT                   KLYNLQQVKRLLKDEGISSTTDGSILTTDWAKTERIGDKSIEIKYQIEQVMTADVSALT
FT                   VSILHMRRDGIIFTPNVSDKQYYTSERLNRIVLTLTTAYNKQLQDLSSTLIQ"
FT   CDS_pept        complement(996903..997799)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12180"
FT                   /product="dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12180"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86681"
FT                   /protein_id="CBY86681.1"
FT                   /translation="MSAQNPLFSGSIVALVTPMNHYGEVDFSCLEKLVEHHIEAGSNAL
FT                   VSVGTTGESATLSIEENVKVIEKTVEFAKGRIPIIAGAGANATSEAITMTKLLRDSGVA
FT                   GCLSVVPYYNKPTQEGMYQHFKAIAECTDLPQILYNVPSRTGSDMKPETVARLAEIENI
FT                   VGIKEATRDVSRIVKIKQLAGKNFIVLSGDDATGLEAIKLGAEGVISVTNNIAAKDMAD
FT                   MCRYALAGDFDKAEEINARLMRLHHDLFIESNPIPVKWAAYRLGLIKSPHLRLPLTTLS
FT                   EEIQPKVEDALKIAGLL"
FT   CDS_pept        997905..998372
FT                   /transl_table=11
FT                   /locus_tag="HICON_12190"
FT                   /product="bacterioferritin comigratory protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12190"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86682"
FT                   /protein_id="CBY86682.1"
FT                   /translation="MNPLSVGNQAPAFTLLNQQEKFVSLSDFRGKKVLIYFYPKALTPG
FT                   CTTQACGLRDSKSELDALGLVVLGISPDAPKKLAQFIEKKELNFTLLSDPDHQVAEQFG
FT                   VWGEKKFMGRTYDGIHRISFLINESGTIMQVFDKFKIKDHHQMIIDYLRSL"
FT   CDS_pept        998541..998993
FT                   /transl_table=11
FT                   /locus_tag="HICON_12200"
FT                   /product="transport protein ExbB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12200"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86683"
FT                   /protein_id="CBY86683.1"
FT                   /translation="MVQLFDFLQQYSDYFIIGLLLLMSIIMLAMVIERYLFLRKVSVAH
FT                   YSTIHALDIDLNRNMTVISTIGANAPYVGLLGTVIGILLTFYQIGHGGGDIDPSVIMLH
FT                   LSLALKATALGILVAIPSMVFYNGLGRKVEVNRLKWKVLSEQKDKE"
FT   CDS_pept        998997..999440
FT                   /transl_table=11
FT                   /locus_tag="HICON_12210"
FT                   /product="transport protein ExbD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12210"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86684"
FT                   /protein_id="CBY86684.1"
FT                   /translation="MKKFDEINIIPFIDIMLVLLTVVLITASFISQGKIQVNVPKASTA
FT                   VAFKSDELAKLLTVTADKQLYFNDKPISQEALEAEIAQWNKDQKVTLKIDAEASFQDFV
FT                   TITDMLSKNEIKNVAIVSMKDKGKSAGKNSQESTPSQSVPTTP"
FT   CDS_pept        999450..1000232
FT                   /transl_table=11
FT                   /locus_tag="HICON_12220"
FT                   /product="TonB"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12220"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86685"
FT                   /protein_id="CBY86685.1"
FT                   /translation="MQQTKRSLLGLLISLIAHGIVIGFILWNWNEPSDSANSAQGDIST
FT                   SISMELLQGMVLEEPAPEPEDVQKEPENVQKEPEPEKQEIVEDPTIKPEPKKIKEPEKE
FT                   KPKPKEKPKNKPKKEVKPQKKPINKELPKGDENIDSSANVNDKASTTSAANSNAQVAGS
FT                   GTDTSEIAAYRSAIRREIESHKRYPTRAKIMRKQGKVSVSFNVGADGSLSGAKVTKSSG
FT                   DESLDKAALDAINVSRSVGTRPAGFPSSLNVQISFTLQ"
FT   CDS_pept        complement(1000410..1000916)
FT                   /transl_table=11
FT                   /gene="ssb"
FT                   /locus_tag="HICON_12230"
FT                   /product="Single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12230"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86686"
FT                   /protein_id="CBY86686.1"
FT                   /translation="MAGINKVIIVGHLGNDPEIRTMPNGDAVANISVATSESWNDRNTG
FT                   ERREVTEWHRIVFYRRQAEICGEYLRKGSQVYVEGRLKTRKWQDQNGQDRYTTEIQGDV
FT                   MQMLGGRNQNAGGYGNDMGGAPQPSYQARQTNNGNSYQSSRPAPQQSAPQAEPPMDGFD
FT                   DDIPF"
FT   CDS_pept        1001071..1003902
FT                   /transl_table=11
FT                   /locus_tag="HICON_12240"
FT                   /product="UvrABC system protein A"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12240"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86687"
FT                   /protein_id="CBY86687.1"
FT                   /translation="MENIDIRGARTHNLKNINLTIPRNKLVVITGLSGSGKSSLAFDTL
FT                   YAEGQRRYVESLSAYARQFLSLMEKPDVDSIEGLSPAISIEQKSTSHNPRSTVGTITEI
FT                   YDYLRLLFARVGEPRCPDHDVPLTAQTISQMVDKVLSLPEDSKMMLLAPVVKNRKGEHV
FT                   KILENIAAQGYIRARIDGEICDLSDPPKLPLQKKHTIEVVVDRFKVRSDLATRLAESFE
FT                   TALELSGGTAIVADMNNPKTEELIFSANFACPHCGYSVPELEPRLFSFNNPAGACPTCD
FT                   GLGVQQYFDEDRVVQNPTISLAGGAVKGWDRRNFYYYQILTSLAKHYHFDVEAPYESLP
FT                   KKIQHIIMQGSGKEEIEFQYMNDRGDVVIRKHPFEGILNNMARRYKETESMSVREELAK
FT                   NISNRPCTDCGGSRLRPEARNVYIGKTNLPIIAEKSIGETLEFFTALSLTGQKAQIAEK
FT                   ILKEIRERLQFLVNVGLNYLSLSRSAETLSGGEAQRIRLASQIGAGLVGVMYVLDEPSI
FT                   GLHQRDNERLLNTLIHLRNLGNTVIVVEHDEDAIRAADHIIDIGPGAGVHGGQVIAQGN
FT                   ADEIMLNPNSITGKFLSGADKIEIPKKRTALDKKKWLKLKGASGNNLRNVNLDIPVGLF
FT                   TCVTGVSGSGKSTLINDTLFPLAQNALNRAEKTDYAPYQSIEGLEHFDKVIDINQSPIG
FT                   RTPRSNPATYTGLFTPIRELFAGVPEARARGYNPGRFSFNVRGGRCEACQGDGVLKVEM
FT                   HFLPDVYVPCDQCKGKRYNRETLEIRYKGKTIHQVLDMTVEEAREFFDAIPMIARKLQT
FT                   LIDVGLSYIRLGQSSTTLSGGEAQRVKLATELSKRDTGKTLYILDEPTTGLHFADIKQL
FT                   LEVLHRLRDQGNTIVVIEHNLDVIKTADWIVDLGPEGGSGGGQIIATGTPEQVAKVESS
FT                   HTARFLKPILEKP"
FT   CDS_pept        join(1004236..1004718,1004709..1006574,1006576..1008231)
FT                   /pseudo
FT                   /transl_table=11
FT                   /locus_tag="HICON_12250"
FT                   /product="adhesion and penetration protein Hap
FT                   (pseudogene)"
FT   CDS_pept        1008373..1008819
FT                   /transl_table=11
FT                   /locus_tag="HICON_12260"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12260"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86689"
FT                   /protein_id="CBY86689.1"
FT                   /translation="MNLTKILPAFAAVVVLSACAKDAPEMTKSSAQMTEMQTLPTITDK
FT                   TVVYSCNKETVTAVYQFENQEPVAAMVSVGDGIIAKDFIRDKSQNDFTSFVSGDYVWNV
FT                   DSGLTLDKFDSVVPVNLIQKGKSSDNIIVKNCDVNVKATKKANL"
FT   CDS_pept        1008943..1010034
FT                   /transl_table=11
FT                   /locus_tag="HICON_12270"
FT                   /product="S-adenosylmethionine:tRNA
FT                   ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12270"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86690"
FT                   /protein_id="CBY86690.1"
FT                   /translation="MRVSDFNFNLPDELIARYPKTDRVSCRLLQLNGENGEIFHRTFSD
FT                   VLDLIDEGDLLIFNNTRVIPARMFGRKASGGKIEVLVERMLDEHRFLAHIRSSKSPKEG
FT                   AELFLGEDKLGENNGIKAVMKARHSSLFEVELSDKSTALLDVLQTIGHMPLPLYIDRPD
FT                   EEADKECYQTVYSKVPGAVAAPTAGLHFDDPLLEKLKKKGVNFEFVTLHVGAGTFQPVR
FT                   VENIEDHVMHAEYVEVSQEVCNAIIATKKAGKRVIAVGTTSVRSIESAALSAEEFGNPD
FT                   LIEPYFSDTSIFIYPGKKFRVVDCLITNFHLPESTLIMLVSAFAGYKNTMNAYKHAVQE
FT                   KYRFFSYGDAMFINKNSNVRGLE"
FT   CDS_pept        1010378..1011526
FT                   /transl_table=11
FT                   /locus_tag="HICON_12280"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12280"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86691"
FT                   /protein_id="CBY86691.1"
FT                   /translation="MKYELDKTSGNARRGRLVFERPQGIFSVETPAFMPVGTYGTVKGM
FT                   TPEEVRATGAEILLGNTFHLWLRPGQEIMRKHGDLHDFMQWHRPILTDSGGFQVFSLGK
FT                   LRKITEEGVKFQNPINGERIFLSPEKSMEIQYDLGSDIVMIFDECTPYPATFDYAKKSM
FT                   EMSLRWAKRSRDRFDELGNKNALFGIIQGGVFEELRKVSLEGLVNIGFDGYAVGGLAVG
FT                   EPKEDMHRILEYICPQIPADKPRYLMGVGKPEDLVEGVRRGIDMFDCVMPTRNARNGHL
FT                   FVTDGIVKIRNAKYRDDTSPLDPHCDCYTCKNYTKAYLYHLDKCGEILGARLNTIHNLR
FT                   YYQRLMAEIRQAIEDDRFDDFVVEFYARMGKPVPPLQLADKS"
FT   CDS_pept        1011616..1014804
FT                   /transl_table=11
FT                   /gene="HaeIVRM"
FT                   /locus_tag="HICON_12290"
FT                   /product="HaeIV restriction/modification system"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12290"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86692"
FT                   /protein_id="CBY86692.1"
FT                   /translation="MITRSNFPELLSSLDFSQTNKIYYKTINSYELKVDFANEKLIYPE
FT                   GLKAQRDTTKNFSAPENFVVFECVHNLLQSGYKPEHIILEQGMPGGHGDTGGFCDIIVQ
FT                   DNDGVEYLLIECKTADDGKSREFSKAWAKMLKNGGQLFNYFNTYRRAKWLCLYCSDFRN
FT                   DKVESIYHLISMTDNNDFLKNNDKLQSFAQIQAENGAKVDYFNVWTDTYQQDFITHNLF
FT                   ESEIFKVGNRPYNVNDLKIVDNDTIQKKYHQFATIMRQHNVSARENAFDKLVNIFLCKV
FT                   VDEKANPENLKVYWKGAASDNHYDLQDRLQQLYKIGMKDFLGEEVTYISEEEINNAFHL
FT                   FKNKKDETKRTVLEYFTQLKFYSNNPFAFLDVHNEKLFFQNAVILKEIVQMLQDIKLKS
FT                   EEEQHQFLGDLFEGFLDQGVKQSEGQFFTPMPIVKFLISSLPLEQVLQNKNAPKVIDYA
FT                   CGAGHFLTEYASQIKPLLKDSGRNLSEFYQKIYGIEKEYRLSKVAKVSAFMYGQDEMNI
FT                   IYADALAQNQEQGKALQDGSFSLLVANPPYSVKGFLSTISDEDKAKFTLYENIDNEETF
FT                   NSIETFFIEKAKQLLHAEGIAVIVLPSSILTNGNIYIKCREILLQHFDLVAIAEFGSGT
FT                   FSKTGTNTATLFLRRKQATPNLSEHYKNRIEQWQSGNFGFDGLFEDHHLLQSYCNHCGF
FT                   NLDDYKAFLSAIEEMPLAIAETEFFQEYRKAFEKRKFAKSANLAKEWLNFAKAIEADKM
FT                   QFFMLAQNNPQDVLVVKMPADNKEKKAFLGYEWSSAKGSEGIKYLNQTSGDEDDSLAKL
FT                   KGINQIQTPLFNPQNLFDETKINCLIRQNFNQQAVEIPQTLANYVSLLPLTQMLDFSRV
FT                   DFDKAIRTNVQKKIKVLSKYPIIALEEFPAEIKKGKSITAKNAIVGDYKVVAGGKNFAY
FT                   MHNEFNRMENTITISASGANAGFVNFWTEKIFASDCTTVRADNYVGTKFIFTYLQSIQE
FT                   NIFDLARGAAQPHVYPDDIKRLPIPKVPLDIQQKVVEECQKIDDEFNRTRMQIEEYRAK
FT                   FAKIFNELEIVRGG"
FT   CDS_pept        1014942..1015358
FT                   /transl_table=11
FT                   /locus_tag="HICON_12300"
FT                   /product="Restriction modification enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12300"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86693"
FT                   /protein_id="CBY86693.1"
FT                   /translation="MADNFIIDERKLQKGDILINSTGEGTAGRVTLFGLDGDFVVDSHI
FT                   TIFRPNEKVLPKFAMYSLAHIGFKTIERMATGASGQIELNLSTIGNISFLVPDLNEQQS
FT                   IVNQINEIETQISELEKVLENSRQEKKAVLDKWL"
FT   CDS_pept        1015385..1015903
FT                   /transl_table=11
FT                   /locus_tag="HICON_12310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12310"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86694"
FT                   /protein_id="CBY86694.1"
FT                   /translation="MQILEPQQFATWNEPIEMLYACHSKVKRFCRQLSILPDYLEKHGY
FT                   TQAVLNDVEQILTYFNRAAPLHHDDEELDFFPQLVKVAPQTQTSIDELEKQHEYLHENW
FT                   NALSVQLEELISEQRQNIDEYLIERFIQGYDRHIALEEPLFEMGRECLSADILTEMGKR
FT                   MSARRQVKE"
FT   CDS_pept        1015900..1016121
FT                   /transl_table=11
FT                   /locus_tag="HICON_12320"
FT                   /product="predicted redox protein, regulator of disulfide
FT                   bond formation"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12320"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86695"
FT                   /protein_id="CBY86695.1"
FT                   /translation="MKYQLNLTALRCPIPLLSAKKALKNLDKNDELMLILNLESAVENF
FT                   SIFAEENSVALVEQYYTSEKEFIVILKK"
FT   CDS_pept        1016229..1016522
FT                   /transl_table=11
FT                   /locus_tag="HICON_12330"
FT                   /product="conserved hypothetical preprotein translocase
FT                   subunit YajC"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12330"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86696"
FT                   /protein_id="CBY86696.1"
FT                   /translation="MEAQSPMSTLFIFVIFGLIFYFMIYRPQAKRNKEHKKLMSELAKG
FT                   TEVLTAGGLIGKITKVTEGSDSIVIALNDTTEITINRNYIVSVLPKGSLKSL"
FT   CDS_pept        1016592..1018442
FT                   /transl_table=11
FT                   /locus_tag="HICON_12340"
FT                   /product="Protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12340"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86697"
FT                   /protein_id="CBY86697.1"
FT                   /translation="MLNRYPLWKNLMVIFIVVIGILYSLPNIYGEDPAVQISGTRGQEA
FT                   NTSVLGQVQDVLKTNNLPTKSIVLENGSILARFTNTDDQLLAKDKIAERLGNNYTTALN
FT                   LAPATPAWLSMFGANPMKWGLDLRGGVRFLMEVDMNAALVKRQEQLQDSLRGELRKEKI
FT                   QYTAIKNTEHFGTLITLANVSQRAKAERIIRQLHPTLDITEPDADSINLGLSTAALNEA
FT                   RDLAIEQNLTILRKRVAELGVAEAVIQRQGAERIVIELPGVQDTARAKEILGATATLEF
FT                   RIVNQNVTADAISRNMLPADSEVKYDRQGHPVALFKRAVLGGEHIINSSSGLDQHSSTP
FT                   QVSVTLDSEGGEIMSQTTKKYYKKPMATLYVEYKDNGKKDENGKTILEKHEEVINVATI
FT                   QGRFGSNFQITGIDSIAEAHNLSTLLKSGALIAPIQIVEERTIGPSLGAQNVEQGINAS
FT                   LWGLVAVIAFMLFYYKMFGVIASFALVINIVLLVGLMSILPGATLSMPGIAGIVLTLGM
FT                   SVDANVLIFERIKEEIRNGRSIQQAINEGYNSAFTSIFDANLTTILTAIILYAVGTGPI
FT                   QGFAITLSLGVAISMFTAITGTRALVNALYGGKQLKKLLI"
FT   CDS_pept        1018450..1019427
FT                   /transl_table=11
FT                   /locus_tag="HICON_12350"
FT                   /product="protein-export membrane protein SecF"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12350"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86698"
FT                   /protein_id="CBY86698.1"
FT                   /translation="MMKLFTKDKDGHFIREINGIKLPFPLTEFMKVRKLGYILSALLMV
FT                   ISLFFIITKGFNWGLDFTGGVVFDTHFSQSANLEQIRSKLHENGIESPIVQTTGSVQDV
FT                   MIRLPASNNDSTIGEHVKSMLQNVDKDIQIRSIEFVGPNVGEELAQGAVYATLATLAMV
FT                   LIYVGSRFEWRLGFGSIASLAHDVIITLGVFSALQIEIDLTFVAAILSVVGYSINDSIV
FT                   VFDRVRENFRKIRRLDTIDIIDISLTQTLSRTIITSVTTLVVVMALFFFGGPSIHNFSL
FT                   ALLVGIGFGTYSSIFVAIAIAYDVGLRREHMIPPKVDKEIDELP"
FT   CDS_pept        complement(1019542..1020591)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12360"
FT                   /product="Putative permease PerM homolog"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12360"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86699"
FT                   /protein_id="CBY86699.1"
FT                   /translation="MLEMLKSWYSRRLSDPQAMGLLAILLFGFISIYFFGDLIAPLLIA
FT                   LVLSYLLEMPINFLNQYLKCPRMLATILIFGSFIGLAAIFFLVLVPMLWNQTISLLSDL
FT                   PAMFNKSNEWLLNLPKNYPELIDYSMVDSIFNSVREKILGFGESAVKLSLASIMNLVSL
FT                   GIYAFLVPLMMFFMLKDKSELLQGVSRFLPKNRNLAFKVWKEMQQQISNYIHGKLLEIL
FT                   IVTLITYIIFLIFGLNYPLLLAFAVGLSVLVPYIGAVIVTIPVALVALFQFGISPTFWY
FT                   IIIAFAVSQLLDGNLLVPYLFSEAVNLHPLIIIISVLIFGGLWGFWGVFFAIPLATLVK
FT                   AVINALPQD"
FT   CDS_pept        1020669..1021019
FT                   /transl_table=11
FT                   /locus_tag="HICON_12370"
FT                   /product="putative arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12370"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86700"
FT                   /protein_id="CBY86700.1"
FT                   /translation="MSVIIYHNPHCSKSRETLALLENKGIQPIIELYLQKQYSVNELQS
FT                   IAKKLGIDDVRQMMRTKDELYKSLNLDNLDLSQAELFKAISEHSALIERPIVINGDKAK
FT                   IGRPPETVLEIL"
FT   CDS_pept        1021087..1021332
FT                   /transl_table=11
FT                   /locus_tag="HICON_12380"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12380"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86701"
FT                   /protein_id="CBY86701.1"
FT                   /translation="MRKKQKSVVENETVYLHTRGVIKDNAVMALLGDKLFRQRVEKKRK
FT                   GKGSYQRKAKHPGKMFEKPDYKFFDYRNFIIGFFLG"
FT   CDS_pept        1021351..1021647
FT                   /transl_table=11
FT                   /locus_tag="HICON_12390"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12390"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86702"
FT                   /protein_id="CBY86702.1"
FT                   /translation="MSKQPQILLNNTWNVRISDPGEEGAKSHFFETIYLTLTAYFEENN
FT                   IRYEFVRKVEDQIKIQRSFTELNELFKFLGDYFDPVSIGLVGVKIGNLGIKLE"
FT   CDS_pept        complement(1021938..1023386)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12400"
FT                   /product="Membrane-bound lytic murein transglycosylase F"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12400"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86703"
FT                   /protein_id="CBY86703.1"
FT                   /translation="MKGLFLRIITALALLFWAIDMVFPWQFLRHTEENHYTAIQARGSL
FT                   YVGTINNQISYFINKDSERGFEYELAKAFADTLGVELEIKIFDNQEQLFDELDKHNIDL
FT                   AAAHLLYHPKNAERFQIGPAYHSASWQLAYRKNENRPKNLGNVKKDIYISNNLALEETL
FT                   KELQKQYPQLIWKRNQALTQEELLLQLAEGKIPYVIANSIDIAAIRQIKPELAIAFDIT
FT                   DEANVHWYLPNSPYRDLQTALLNFMNNAEETGLLDNLKEKYLGHISQFDYVDTRSYINA
FT                   IENTLPQFSPLFEKYKGKLDWRLLAAVAYQESHWNPDATSPTGVRGIMMLTKDTAQHMK
FT                   ISDRTDPEQSIKAGSEYLHWLISQIPESIEKEERIWFALVAYNIGLGHLIDARRLTQNL
FT                   GGNPDNWLDVKKNLPLLAEKRYYSQLKYGYARGYEAHQYVENIRRYMNSIVNYHRVQEN
FT                   QTTNDNANNESAVKNLEEIKENKD"
FT   CDS_pept        complement(1023504..1025345)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12410"
FT                   /product="ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12410"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86704"
FT                   /protein_id="CBY86704.1"
FT                   /translation="MTNKITFNNLGLPEFILKAVSDLGFETPSPIQQSCIPHLLSGNDV
FT                   LGMAQTGSGKTAAFALPLLAQIDPSEKHPQMLVMAPTRELAIQVADACELFVKYAQGTR
FT                   IVTLYGGQRYDIQLRALKQGAQVVVGTPGRILDHIRRGTLNLSELRFIVLDEADEMLRM
FT                   GFIDDVETVMAELPENHQTALFSATMPEPIRRITKRFMNDPQEVKIKVNNENAPDIDQS
FT                   CWYVHGVRKNEALLRFLEVEDFDAAIIFARTKTGTLDITELLEKNGFRSAALNGDMTQQ
FT                   LREQTLDRLRNRSLDIVVATDVAARGIDIERISLVVNYDIPLDAESYVHRIGRTGRAGR
FT                   SGRALLFVEPRERRLLRNIEHLMKKGINEVELPNHEVLQECRRKKFVAKITKQLEHHDL
FT                   EQYRSLLEDLFTADQDQENIAAAMLMLLQGKQKLILPPDPPMEKRRRERNERGDRRENP
FT                   RSAERRGERKGYVNPQPMDLYRIEVGRADGVEVRHIVGAIANEGDINSRYIGHIKLYDD
FT                   YTTVELPQGMPKELLQQFGKTRVLNKQMQMSFLGAVKSDNSRGSDDFNGKCKGRGGDFR
FT                   GERGRERGNDNRGNRKFNEKSNRTFSDKPRRDRRSSF"
FT   CDS_pept        complement(1025465..1026409)
FT                   /transl_table=11
FT                   /locus_tag="HICON_12420"
FT                   /product="Lipoprotein NlpI"
FT                   /db_xref="EnsemblGenomes-Gn:HICON_12420"
FT                   /db_xref="EnsemblGenomes-Tr:CBY86705"
FT                   /protein_id="CBY86705.1"
FT                   /translation="MRCFRLSRHFIVYLFSLCAILLLAGCVQSRGGFVSKNHVVLAEQN
FT                   PNTHFEQEVMIVRLSQVLLVGKMSNEERASLHFERGVLYDSLGLWGLARYDLTQALALQ
FT                   PKMASVYNYLGLYLLLEEDYDGALDAFNTVFELDSGYDYTHLNRGLNFYYVGRYHLAQQ
FT                   DFLQFYQADTKDPYRVLWLYLNEQKLKPQEAQTNLVERAKGLSEDFWGTHIVQYYLGRI
FT                   SVEELQQRASEFAENSQQYAEILTETYFYLAKQKLNVGLVDEAAALFKLAMANQVYNFV
FT                   EYRFAAFELMKLKPVQTEDEKEEKSAVTKAIVF"
FT   CDS_